WorldWideScience

Sample records for chp unit optimering

  1. Optimal PGU operation strategy in CHP systems

    Science.gov (United States)

    Yun, Kyungtae

    Traditional power plants only utilize about 30 percent of the primary energy that they consume, and the rest of the energy is usually wasted in the process of generating or transmitting electricity. On-site and near-site power generation has been considered by business, labor, and environmental groups to improve the efficiency and the reliability of power generation. Combined heat and power (CHP) systems are a promising alternative to traditional power plants because of the high efficiency and low CO2 emission achieved by recovering waste thermal energy produced during power generation. A CHP operational algorithm designed to optimize operational costs must be relatively simple to implement in practice such as to minimize the computational requirements from the hardware to be installed. This dissertation focuses on the following aspects pertaining the design of a practical CHP operational algorithm designed to minimize the operational costs: (a) real-time CHP operational strategy using a hierarchical optimization algorithm; (b) analytic solutions for cost-optimal power generation unit operation in CHP Systems; (c) modeling of reciprocating internal combustion engines for power generation and heat recovery; (d) an easy to implement, effective, and reliable hourly building load prediction algorithm.

  2. Survey of controllability in decentralized CHP plants. Optimal operation of priority production units; Kortlaegning af decentrale kraftvarmevaerkers regulerbarhed. Optimal drift af prioriterede anlaeg - Teknologisk grundlag

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2005-03-15

    The present report presents results from two closely related projects, carried out in parallel, under the PSO-F and U 2002. The one project is 'Survey of controllability in de-centralized combined heat and power plants' project number PSO 4724 and is fully reported here. The other project: 'Optimal operation of priority production units, project number PSO 4712, only the part project 'Technological foundations is reported here. In project 4724 the technical conditions that matter regarding controllability of electricity production in de-centralized heat and power stations are surveyed. In this context the term controllability means how fast and to which extent the load factors of the plants can be changed. Also, is has been investigated which options are available for improving the controllability, their potentials and estimates on required investments associated. The investigation covers CHP plants having a production capacity of up to 30 MW of electricity. The main part of the de-centralized CHP plants are based on spark ignited internal combustion engines (Otto engines). Most of these engines are fuelled by natural gas and a smaller part by biogas. A minor number are gas turbines fuelled by natural gas and steam turbines in industrial applications, waste incineration plants or in combined cycle power plants. The mapping has among others consisted of a number of visits on selected different types of plants including interview with people responsible for the daily operation. From these interviews data on the actual operating strategy and technical data have been provided. In addition suppliers of engines and other equipment involved have been contacted for technical information or recommendations regarding possible changes in operation strategy. Searching the Internet has been widely used for identification of technical investigations concerning e.g. operation and maintenance of relevant equipment. Finally, substantial statistical data from

  3. Dynamic simulation and optimal real-time operation of CHP systems for buildings

    Science.gov (United States)

    Cho, Hee Jin

    Combined Cooling, Heating, and Power (CHP) systems have been widely recognized as a key alternative for electric and thermal energy generation because of their outstanding energy efficiency, reduced environmental emissions, and relative independence from centralized power grids. The systems provide simultaneous onsite or near-site electric and thermal energy generation in a single, integrated package. As CHP becomes increasingly popular worldwide and its total capacity increases rapidly, the research on the topics of CHP performance assessment, design, and operational strategy become increasingly important. Following this trend of research activities to improve energy efficiency, environmental emissions, and operational cost, this dissertation focuses on the following aspects: (a) performance evaluation of a CHP system using a transient simulation model; (b) development of a dynamic simulation model of a power generation unit that can be effectively used in transient simulations of CHP systems; (c) investigation of real-time operation of CHP systems based on optimization with respect to operational cost, primary energy consumption, and carbon dioxide emissions; and (d) development of optimal supervisory feed-forward control that can provide realistic real-time operation of CHP systems with electric and thermal energy storages using short-term weather forecasting. The results from a transient simulation of a CHP system show that technical and economical performance can be readily evaluated using the transient model and that the design, component selection, and control of a CHP system can be improved using this model. The results from the case studies using optimal real-time operation strategies demonstrate that CHP systems with an energy dispatch algorithm have the potential to yield savings in operational cost, primary energy consumption, and carbon dioxide emissions with respect to a conventional HVAC system. Finally, the results from the case study using a

  4. A Stochastic Unit Commitment Model for a Local CHP Plant

    DEFF Research Database (Denmark)

    Ravn, Hans V.; Riisom, Jannik; Schaumburg-Müller, Camilla

    2005-01-01

    Local CHP development in Denmark has during the 90’s been characterised by large growth primarily due to government subsidies in the form of feed-in tariffs. In line with the liberalisation process in the EU, Danish local CHPs of a certain size must operate on market terms from 2005. This paper p...... the spot prices of the years 2001-2003, both with and without the immersion heater included in the model, and the results are compared to the full information case.......Local CHP development in Denmark has during the 90’s been characterised by large growth primarily due to government subsidies in the form of feed-in tariffs. In line with the liberalisation process in the EU, Danish local CHPs of a certain size must operate on market terms from 2005. This paper...... presents a stochastic unit commitment model for a single local CHP plant (consisting of CHP unit, boiler, and heat storage facility) which takes into account varying spot prices. Further, additional technology is implemented in the model in the form of an immersion heater. Simulations are conducted using...

  5. Optimal design and operation of a syngas-fuelled SOFC micro CHP system for residential applications in different climate zones in China

    DEFF Research Database (Denmark)

    Yang, Wenyuan; Zhao, Yingru; Liso, Vincenzo

    2014-01-01

    of the micro-CHP to cover the heat and electricity demand of a 70 m2 single-family apartment with an average number of occupants of 3 is evaluated. A detailed model of the micro-CHP unit coupled with a hot water storage tank and an auxiliary boiler is developed. System design trade-offs are discussed......Fuel cell based micro-CHP systems are expected to be one of the most promising technologies for implementation in the residential sector. Since the design and operation of such CHP systems are greatly dependent upon the seasonal atmospheric conditions, it is important to evaluate their performance...... under difference climate conditions to ensure that it is well matched with the local heat-to-power ratio. The aim of this study is to investigate the optimal design and operation of a syngas-fuelled SOFC micro-CHP system for small households located in five different climate zones in China. The ability...

  6. Optimization and operation of RNG-unit for production of reformed natural gas integrated with standard CHP unit; Optimering og drift af RNG-enhed til produktion af reformeret naturgas integreret med standard kraftvarmeenhed

    Energy Technology Data Exchange (ETDEWEB)

    Soegaard, C.; Schramm, J.

    2004-02-01

    A steam reforming unit has been developed during this project. The unit converts natural gas into reformed natural gas (RNG), which contain hydrogen. The RNG is combusted in an SI engine, which produces power and heat. Hydrogen was supposed to reduce hydrocarbon emissions and increase the combustion efficiency. An efficient control strategy has been developed, and the plant has been operating automatically without problems for more than one week. An increase in power efficiency of 0,5% was achieved, but almost no reduction in hydrocarbon emissions. However, the engine was unable to operate at excess air ratios beyond 2, where 10% reduction in unburned hydrocarbon emissions was seen. It is believed that larger plants, which operates with more excess air, will demonstrate more reduction in unburned hydrocarbons with RNG. An increase in compression ratio with RNG over NG is possible since the engine operates more stable on RNG. This could further improve power efficiency with 2-3%. The payback time for the plant was calculated to be 81 years without the effect from increased compression ratio. This does not support implementation of the plant in practice. (au)

  7. Improvements and simplifications of staged gasification unit for CHP production. Report for the project: Simplification, system and operation optimization of staged gasification unit for CHP production (the Castor unit in Graested); Forbedringer og forenklinger af trinopdelt forgasningsanlaeg til kraftvarmeproduktion. En Delrapport til projektet: Forenkling, system- og driftsoptimering af trinopdelt forgasningsanlaeg til kraftvarmeproduktion (Castor anlaegget i Graested)

    Energy Technology Data Exchange (ETDEWEB)

    Houmann Jakobsen, H.

    2010-08-15

    In 2003/04 BioSynergi Proces ApS built a complete approx. 450 kWth Open Core staged gasification unit as a development / demonstration plant. The plant uses wet wood chips as fuel for generating electricity and heat. The facility, known as the Castor plant, is connected to the heat supply network in Graested District Heating. The daily operation is handled by BioSynergi Process. The cogeneration system, that the Castor plant represents, is the basis for this completed project. In this subproject the Castor plant has been used to develop and test improvements to the cogeneration system at the following points: 1) Optimization of process design of the gas generator within the existing framework; 2) Establishment of a heating system to start up the gas generator; 3) Automation of switching the gas engine to operate on produced gas; 4) Simplification of the gas generator's fuel feeding system; 5) Improving the control options for the supply of gasification air. The introduced changes have led to the operation of the total gasification-cogeneration system becoming more convenient and easier to operate for non specialists. Operational testing of the plant during the project has covered approx. 2,300 hours of operation of cogeneration. It has identified the periodic maintenance tasks on the demonstration plant. Through further development of plant components that may happen in the subsequent development versions, it will be possible to eliminate some of the regular maintenance tasks and reduce the frequency of others. The optimization of the process design was completed with an experiment with the addition of extra air in the middle of the lower coke zone. Observations during the experiment gave the impression that both the amount and size of charcoal pieces are reduced. Because of the gas generator's section-wise construction, it will be relatively easy to construct and install a new subsection to it and thereby install the system permanently. It is estimated

  8. Modeling and optimization of a 1 kWe HT-PEMFC-based micro-CHP residential system

    DEFF Research Database (Denmark)

    Arsalis, Alexandros; Nielsen, Mads Pagh; Kær, Søren Knudsen

    2012-01-01

    A high temperature-proton exchange membrane (HT-PEMFC)-based micro-combined-heat-and-power (CHP) residential system is designed and optimized, using a genetic algorithm (GA) optimization strategy. The proposed system consists of a fuel cell stack, steam methane reformer (SMR) reactor, water gas s...

  9. Energy-optimisation of biogas-fuelled CHP units; Energetische Optimierung von Biogas-BHKW's

    Energy Technology Data Exchange (ETDEWEB)

    Soltic, P.; Edenhauser, D.; Winkler, A.

    2008-07-15

    This illustrated final report for the Swiss Federal office of Energy (SFOE) reports on the energy-related optimisation of combined heat and power (CHP) units that are fuelled with non-processed biogas. Ways of increasing the efficiency of these units as far as the production of electricity is concerned are examined and commented on. Also, ways of using the heat generated by the CHP units to produce electricity using other, exergetic means are also described. Systems such as Stirling engines and existing and new thermo-electrical elements are discussed. The economic viability of the systems is also discussed.

  10. SOFC-based micro-CHP system as an example of efficient power generation unit

    Science.gov (United States)

    Kupecki, Jakub; Badyda, Krzysztof

    2011-12-01

    Microscale combined heat and power (CHP) unit based on solid oxide fuel cells (SOFC) for distributed generation was analyzed. Operation principle is provided, and the technology development in recent years is briefly discussed. System baseline for numerical analysis under steady-state operation is given. Grid-connected unit, fuelled by biogas corresponds to potential market demand in Europe, therefore has been selected for analysis. Fuel processing method for particular application is described. Results of modeling performed in ASPEN Plus engineering software with certain assumptions are presented and discussed. Due to high system electrical efficiency exceeding 40%, and overall efficiency over 80%, technology is an example of highly competitive and sustainable energy generation unit.

  11. COMPARISON OF MATHEMATICAL MODELS FOR HEAT EXCHANGERS OF UNCONVENTIONAL CHP UNITS

    Directory of Open Access Journals (Sweden)

    Peter Durcansky

    2015-08-01

    Full Text Available An unconventional CHP unit with a hot air engine is designed as the primary energy source with fuel in the form of biomass. The heat source is a furnace designed for combustion of biomass, whether in the form of wood logs or pellets. The transport of energy generated by the biomass combustion to the working medium of a hot-air engine is ensured by a special heat exchanger connected to this resource. The correct operation of the hot-air engine is largely dependent on an appropriate design of the exchanger. The paper deals with the calculation of the heat exchanger for the applicationsmentioned, using criterion equations, and based on CFD simulations.

  12. Optimal designs of small CHP plants in a market with fluctuating electricity prices

    DEFF Research Database (Denmark)

    Lund, Henrik; Andersen, A.N.

    2005-01-01

    The paper presents the Danish experince with methodologies and software tools, which have been used to design investment and operation strategies for almost all small CHP plants in Denmark during the decade of the triple tariff.......The paper presents the Danish experince with methodologies and software tools, which have been used to design investment and operation strategies for almost all small CHP plants in Denmark during the decade of the triple tariff....

  13. Optimal Design and Operation of A Syngas-fuelled SOFC Micro-CHP System for Residential Applications in Different Climate Zones in China

    DEFF Research Database (Denmark)

    Yang, Wenyuan; Liso, Vincenzo; Zhao, Yingru

    2013-01-01

    Energy consumption in residential sector can be considerably reduced by enhancing the efficiency of energy supply. Fuel cell-based residential micro-CHP systems are expected to be one of the most promising technologies because of their high efficiency and low environmental impact. Since the design...... heat-to-power load ratio. Therefore, the aim of this study is to investigate the optimal design and operation of a syngas-fuelled SOFC micro-CHP system for small households located in five different climate zones in China. The ability of the micro-CHP to cover the heat and electricity demand of a 70m2...... demand. Numerical simulations are conducted in Matlab environment. System design trade-offs are discussed to determine the optimal match between the energy demand of the household for different climates across China and the energy supply of the micro-CHP during the whole year. Moreover, criteria...

  14. Energy Analysis and Multi-Objective Optimization of an Internal Combustion Engine-Based CHP System for Heat Recovery

    Directory of Open Access Journals (Sweden)

    Abdolsaeid Ganjehkaviri

    2014-10-01

    Full Text Available A comprehensive thermodynamic study is conducted of a diesel based Combined Heat and Power (CHP system, based on a diesel engine and an Organic Rankine Cycle (ORC. Present research covers both energy and exergy analyses along with a multi-objective optimization. In order to determine the irreversibilities in each component of the CHP system and assess the system performance, a complete parametric study is performed to investigate the effects of major design parameters and operating conditions on the system’s performance. The main contribution of the current research study is to conduct both exergy and multi-objective optimization of a system using different working fluid for low-grade heat recovery. In order to conduct the evolutionary based optimization, two objective functions are considered in the optimization; namely the system exergy efficiency, and the total cost rate of the system, which is a combination of the cost associated with environmental impact and the purchase cost of each component. Therefore, in the optimization approach, the overall cycle exergy efficiency is maximized satisfying several constraints while the total cost rate of the system is minimized. To provide a better understanding of the system under study, the Pareto frontier is shown for multi-objective optimization and also an equation is derived to fit the optimized point. In addition, a closed form relationship between exergy efficiency and total cost rate is derived.

  15. Hydrocarbon emissions from gas engine CHP-units. 2011 measurement program

    Energy Technology Data Exchange (ETDEWEB)

    Van Dijk, G.H.J. [KEMA, Arnhem (Netherlands)

    2012-06-15

    In December 2009, the Ministry of Infrastructure and Environment (IandM) issued the Decree on Emission Limits for Middle Sized Combustion Installations (BEMS). This decree imposes a first-time emission limit value (ELV) of 1500 mg C/m{sup 3}{sub o} at 3% O{sub 2} for hydrocarbons emitted by gas engines. IandM used the findings of two hydrocarbon emission measurement programs, executed in 2007 and 2009, as a guideline for this initial ELV. The programs did reveal substantial variation in the hydrocarbon emissions of the gas engines tested. This variation, and especially the uncertainty as to the role of engine and/or other parameters causing such variation, was felt to hamper further policy development. IandM therefore commissioned KEMA to perform follow-up measurements on ten gas engine CHP-units in 2011. Aim of this 2011 program is to assess hydrocarbon emission variation in relation to engine parameters and process conditions including maintenance status, and to atmospheric conditions. The 2011 program comprised two identical measurement sessions, one in spring and one in winter.

  16. A study on electricity export capability of the μCHP system with spot price

    DEFF Research Database (Denmark)

    You, Shi; Træholt, Chresten; Poulsen, Bjarne

    2009-01-01

    when the electricity buyback price is given at a value equalizing the dynamic spot price. A muCHP system is modeled with optimized generation, and the marginal price of electricity export for such system is explained. A sensitivity analysis of several key factors, e.g. fuel price, heat to power ratio......When a number of muCHP systems are aggregated as a virtual power plant (VPP), they will be able to participate in the electricity wholesale market with no discrimination compared to conventional large power plants. Hence, this paper investigates the electricity export capability of the muCHP system...... of the muCHP unit, which influence the export capability of muCHP system, is firstly carried out in the intraday case study, followed by the annual case study which explores the annual system performance. The results show that the electricity export capability of a muCHP system is closely related to its...

  17. Optimization of a High Temperature PEMFC micro-CHP System by Formulation and Application of a Process Integration Methodology

    DEFF Research Database (Denmark)

    Arsalis, Alexandros; Nielsen, Mads Pagh; Kær, Søren Knudsen

    2013-01-01

    A 1 kWe micro combined heat and power (CHP) system based on high temperature proton exchange membrane fuel cell (PEMFC) technology is modeled and optimized by formulation and application of a process integration methodology. The system can provide heat and electricity for a singlefamily household....... It consists of a fuel cell stack, a fuel processing subsystem, heat exchangers, and balance-of-plant components. The optimization methodology involves system optimization attempting to maximize the net electrical efficiency, and then by use of a mixed integer nonlinear programming (MINLP) problem formulation......, the heat exchange network (HEN) annual cost is minimized. The results show the high potential of the proposed model since high efficiencies are accomplished. The net electrical efficiency and total system efficiency, based on lower heating value (LHV), are 35.2% and 91.1%, respectively. The minimized total...

  18. Development of a Wood Powder Fuelled 35 kW Stirling CHP Unit

    DEFF Research Database (Denmark)

    Pålsson, M.; Carlsen, Henrik

    2003-01-01

    For biomass fuelled CHP in sizes below 100 kW, Stirling engines are the only feasible alternative today. Using wood powder as fuel, the Stirling engine can be heated directly by the flame like when using a gaseous or liquid fuel burner. However, the combustion chamber will have to be much larger...... due to the slow burning of the fuel. To avoid sintering of ash the flame temperature in a biomass burner has to be quite low. The flame temperature can be lowered by using a high excess air rate; however this will lower system efficiency and needs a large air preheater. By using combustion gas......-cylinder Stirling engine SM3D with an electric output of 35 kW. This engine is a further development of the engine SM3B that has been developed at the Technical University of Denmark. The engine heater is being adapted for use with wood powder as fuel. During a two-year period a combustion system for this engine...

  19. Heat Pumps in CHP Systems

    DEFF Research Database (Denmark)

    Ommen, Torben Schmidt

    representation allows infeasible production. Using MIP or NLP optimisation, the number of operation hours and the total production of heat from HPs are significantly increased, as the HPs may be used to shave the load patterns of CHP units in significantly constrained energy systems. A MIP energy system model...

  20. Coordination of decentralised CHP units for a grid-oriented operation mode; Koordination dezentraler Kraft-Waerme-Kopplungsanlagen fuer die Verwendung einer netzorientierten Betriebsweise im Verbund

    Energy Technology Data Exchange (ETDEWEB)

    Korte, M. [Oldenburg Univ. (Germany). Dept. fuer Informatik; Troeschel, M. [OFFIS e.V., Oldenburg (Germany). Betriebliches Informationsmanagement; Schulz, C.; Pielke, M.; Kurrat, M. [Technische Univ. Braunschweig (Germany). Inst. fuer Hochspannungstechnnk und Elektrische Energieanlagen; Slomka, F. [Ulm Univ. (Germany). Inst. fuer Eingebettete Systeme/Echtzeitsysteme

    2007-07-01

    Decentralised combined heat and power micro-units are considered as an interesting option to reduce the primary energy need and thus the carbon dioxide emissions of buildings. The technology of simultaneous generation of usable heat and electrical power is already available through combustion engine CHPs. In the next years fuel cell CHPs will be added. Due to the current energy price development a rising number of CHP micro-units in the mains electricity grid is expected. Thus for the power supplier the questions, which strategies are used in order to be able to integrate them technically into the grid and economically into the business field, become ever more important. (orig.)

  1. Technical preparation of a 300 kWel biomass gasification plant. Report for the project: Simplification, system and operation optimization of staged gasification unit for CHP production (the Castor unit in Graested); Teknisk forberedelse af 300 kWel bioforgasningsanlaeg. En Delrapport til projektet: Forenkling, system- og driftsoptimering af trinopdelt forgasningsanlaeg til kraftvarmeproduktion (Castor anlaegget i Graested)

    Energy Technology Data Exchange (ETDEWEB)

    Houmann Jakobsen, H.

    2009-09-15

    In 2003/04 BioSynergi Proces ApS built a complete approx. 450 kWth Open Core staged gasification unit as a development / demonstration plant. The plant uses wet wood chips as fuel for generating electricity and heat. The facility, known as the Castor plant, is connected to the heat supply network in Graested District Heating. The daily operation is handled by BioSynergi Process. The cogeneration system, that the Castor plant represents, is the basis for this completed project. For technical preparation of the planned future up scaling of the cogeneration system, a test of the function of the gas generator core (reactor core) was performed in this sub-project. It is the central component of the total cogeneration system, and it is also the one who has the greatest influence on the overall gasification process. The experiments have demonstrated that the stage gasification principle, which is in operation at the Castor plant, is also possible to have in operation with the desired process steps in the tested reactor core with four times more capacity. Finalization of the total gas generator in the range of 300 kWel is now being developed in a new project. The simplified experiments, that were possible to perform with the outdoor setup of the reactor core, were, however, not suited to qualitative assessments of the gasification process. (ln)

  2. A Geothermal Energy Supported Gas-steam Cogeneration Unit as a Possible Replacement for the Old Part of a Municipal CHP Plant (TEKO

    Directory of Open Access Journals (Sweden)

    L. Böszörményi

    2001-01-01

    Full Text Available The need for more intensive utilization of local renewable energy sources is indisputable. Under the current economic circumstances their competitiveness in comparison with fossil fuels is rather low, if we do not take into account environmental considerations. Integrating geothermal sources into combined heat and power production in a municipal CHP plant would be an excellent solution to this problem. This concept could lead to an innovative type of power plant - a gas-steam cycle based, geothermal energy supported cogeneration unit.

  3. Computer experimental analysis of the CHP performance of a 100 kW e SOFC Field Unit by a factorial design

    Science.gov (United States)

    Calì, M.; Santarelli, M. G. L.; Leone, P.

    Gas Turbine Technologies (GTT) and Politecnico di Torino, both located in Torino (Italy), have been involved in the design and installation of a SOFC laboratory in order to analyse the operation, in cogenerative configuration, of the CHP 100 kW e SOFC Field Unit, built by Siemens-Westinghouse Power Corporation (SWPC), which is at present (May 2005) starting its operation and which will supply electric and thermal power to the GTT factory. In order to take the better advantage from the analysis of the on-site operation, and especially to correctly design the scheduled experimental tests on the system, we developed a mathematical model and run a simulated experimental campaign, applying a rigorous statistical approach to the analysis of the results. The aim of this work is the computer experimental analysis, through a statistical methodology (2 k factorial experiments), of the CHP 100 performance. First, the mathematical model has been calibrated with the results acquired during the first CHP100 demonstration at EDB/ELSAM in Westerwoort. After, the simulated tests have been performed in the form of computer experimental session, and the measurement uncertainties have been simulated with perturbation imposed to the model independent variables. The statistical methodology used for the computer experimental analysis is the factorial design (Yates' Technique): using the ANOVA technique the effect of the main independent variables (air utilization factor U ox, fuel utilization factor U F, internal fuel and air preheating and anodic recycling flow rate) has been investigated in a rigorous manner. Analysis accounts for the effects of parameters on stack electric power, thermal recovered power, single cell voltage, cell operative temperature, consumed fuel flow and steam to carbon ratio. Each main effect and interaction effect of parameters is shown with particular attention on generated electric power and stack heat recovered.

  4. Modeling of non-linear CHP efficiency curves in distributed energy systems

    DEFF Research Database (Denmark)

    Milan, Christian; Stadler, Michael; Cardoso, Gonçalo

    2015-01-01

    operation has mainly been found important for fuel cell units. The micro-turbine is found almost exclusively in full load, thus rendering the application of the new approaches for this technology unnecessary for the considered unit sizes and building types. The approach using binary variables was the most...... for these technologies, detailed system models are needed. These models are often formulated as linear programming problems to keep computational costs and complexity in a reasonable range. However, CHP systems involve variations of the efficiency for large nameplate capacity ranges and in case of part load operation...... approaches are formulated using binary and Special-Ordered-Set (SOS) variables. Both suggestions have been implemented into the optimization model DER–CAM to simulate investment decisions of CHP micro-turbines and CHP fuel cells with variable efficiencies. The approaches have further been applied...

  5. Small Scale Gasification: Gas Engine CHP for Biofuels

    Energy Technology Data Exchange (ETDEWEB)

    Brandin, Jan (Linnaeus Univ., Vaexjoe. Faculty of Science and Engineering, School of Engineering (Sweden)); Tuner, Martin; Odenbrand, Ingemar (The Faculty of Engineering at Lund Univ. (LTH) (Sweden))

    2011-07-01

    In a joint project, Linnaeus Univ. in Vaexjoe (LNU) and the Faculty of Engineering at Lund Univ. (LTH) were commissioned by the Swedish Energy Agency to make an inventory of the techniques and systems for small scale gasifier-gas engine combined heat and power (CHP) production and to evaluate the technology. Small scale is defined here as plants up to 10 MW{sub th}, and the fuel used in the gasifier is some kind of biofuel, usually woody biofuel in the form of chips, pellets, or sawdust. The study is presented in this report. The report has been compiled by searching the literature, participating in seminars, visiting plants, interviewing contact people, and following up contacts by e-mail and phone. The first, descriptive part of the report, examines the state-of-the-art technology for gasification, gas cleaning, and gas engines. The second part presents case studies of the selected plants: - Meva Innovation's VIPP-VORTEX CHP plant - DTU's VIKING CHP plant - Guessing bio-power station - Harbooere CHP plant -Skive CHP plant The case studies examine the features of the plants and the included unit operations, the kinds of fuels used and the net electricity and overall efficiencies obtained. The investment and operating costs are presented when available as are figures on plant availability. In addition we survey the international situation, mainly covering developing countries. Generally, the technology is sufficiently mature for commercialization, though some unit operations, for example catalytic tar reforming, still needs further development. Further development and optimization will probably streamline the performance of the various plants so that their biofuel-to-electricity efficiency reaches 30-40 % and overall performance efficiency in the range of 90 %. The Harbooere, Skive, and Guessing plant types are considered appropriate for municipal CHP systems, while the Viking and VIPP-VORTEX plants are smaller and considered appropriate for replacing hot

  6. The Optimized Operation of Gas Turbine Combined Heat and Power Units Oriented for the Grid-Connected Control

    Science.gov (United States)

    Xia, Shu; Ge, Xiaolin

    2016-04-01

    In this study, according to various grid-connected demands, the optimization scheduling models of Combined Heat and Power (CHP) units are established with three scheduling modes, which are tracking the total generation scheduling mode, tracking steady output scheduling mode and tracking peaking curve scheduling mode. In order to reduce the solution difficulty, based on the principles of modern algebraic integers, linearizing techniques are developed to handle complex nonlinear constrains of the variable conditions, and the optimized operation problem of CHP units is converted into a mixed-integer linear programming problem. Finally, with specific examples, the 96 points day ahead, heat and power supply plans of the systems are optimized. The results show that, the proposed models and methods can develop appropriate coordination heat and power optimization programs according to different grid-connected control.

  7. Small-Scale Chp Potential in Latvia and Estonia

    Science.gov (United States)

    Volkova, A.; Latõšv, E.; Siirde, A.

    2009-01-01

    In the research the small-scale CHP potential of Latvia and Estonia has been defined. Factors, which influence the CHP development, were analyzed in this paper, including political, geographic, climatological, legislative and technological factors. For the small-scale CHP potential assessment the three alternatives were chosen. The first alternative is the case, when only the hot water is taken into account. In this case the CHP can work with full load during the whole year because the heat load will not change (k=0,13). For the second alternative the results of the previous research were used. In this case an optimal relative heat load has been found for a small-scale CHP. This optimum value is 0,3. According to this optimum value the CHP can produce more electricity working with full load than in the first case. However, the CHP does not work whole year round. The third alternative shows the situation for the small-scale CHP when a half of the maximum heat load will be covered by the CHP. The formulas and the results for each case were provided.

  8. Network Capacity Assessment of CHP-based Distributed Generation on Urban Energy Distribution Networks

    Science.gov (United States)

    Zhang, Xianjun

    The combined heat and power (CHP)-based distributed generation (DG) or dis-tributed energy resources (DERs) are mature options available in the present energy market, considered to be an effective solution to promote energy efficiency. In the urban environment, the electricity, water and natural gas distribution networks are becoming increasingly interconnected with the growing penetration of the CHP-based DG. Subsequently, this emerging interdependence leads to new topics meriting serious consideration: how much of the CHP-based DG can be accommodated and where to locate these DERs, and given preexisting constraints, how to quantify the mutual impacts on operation performances between these urban energy distribution networks and the CHP-based DG. The early research work was conducted to investigate the feasibility and design methods for one residential microgrid system based on existing electricity, water and gas infrastructures of a residential community, mainly focusing on the economic planning. However, this proposed design method cannot determine the optimal DG sizing and siting for a larger test bed with the given information of energy infrastructures. In this context, a more systematic as well as generalized approach should be developed to solve these problems. In the later study, the model architecture that integrates urban electricity, water and gas distribution networks, and the CHP-based DG system was developed. The proposed approach addressed the challenge of identifying the optimal sizing and siting of the CHP-based DG on these urban energy networks and the mutual impacts on operation performances were also quantified. For this study, the overall objective is to maximize the electrical output and recovered thermal output of the CHP-based DG units. The electricity, gas, and water system models were developed individually and coupled by the developed CHP-based DG system model. The resultant integrated system model is used to constrain the DG's electrical

  9. Dicty_cDB: CHP536 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available library) CHP536 (Link to dictyBase) - - - Contig-U16458-1 CHP536P (Link to Original site) CHP536F 597 CHP536Z...CHP536Z 660 CHP536P 1237 - - Show CHP536 Library CH (Link to library) Clone ID CHP536 (Link to dictyBase)...tsukuba.ac.jp/CSM/CH/CHP5-B/CHP536Q.Seq.d/ Representative seq. ID CHP536P (Link to Original site) Representative...Representative DNA sequence >CHP536 (CHP536Q) /CSM/CH/CHP5-B/CHP536Q.Seq.d/ CTGTTGGCCTACTGGNATTAATTCTAA...significant alignments: (bits) Value CHP536 (CHP536Q) /CSM/CH/CHP5-B/CHP536Q.Seq.d/ 2389 0.0 CHP283 (CHP283Q)

  10. Biomass CHP Catalog of Technologies

    Science.gov (United States)

    This report reviews the technical and economic characterization of biomass resources, biomass preparation, energy conversion technologies, power production systems, and complete integrated CHP systems.

  11. Highly-efficient controllable {mu}CHP system as part in a virtual power plant

    Energy Technology Data Exchange (ETDEWEB)

    Foegger, Karl; Dahlmanns, Frank [Ceramic Fuel Cells B.V., Heerlen (Netherlands)

    2012-11-01

    The use of micro-CHP units as an effective option for grid control is presented. A controllable micro-CHP unit with a net electrical efficiency of 60 %, power modulation rates of 6.25 % absolute/minute and all-year availability is presented - an ideal component of a virtual power plant. The 'engine' of this highly efficient and flexible micro-CHP system is a fuel cell module based on solid oxide fuel cell technology. (orig.)

  12. Dicty_cDB: CHP763 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP763 (Link to dictyBase) - - - Contig-U15926-1 CHP763P (Link to Original site) CHP...763F 254 CHP763Z 701 CHP763P 935 - - Show CHP763 Library CH (Link to library) Clone ID CHP... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CH/CHP7-C/CHP763Q.Seq.d/ Representative seq. ID CHP...763P (Link to Original site) Representative DNA sequence >CHP763 (CHP763Q) /CSM/CH/CHP7-C/CHP7...*isrilnm**tmtsqtq*k fiftvlvvllelehpvsvihy*qqimhvwltn*lky*lrqnkkyqlnfqifpllqvhlqi rknfhhiqliqrdikfnnnnnnnnnnk

  13. Dicty_cDB: CHP843 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP843 (Link to dictyBase) - - - Contig-U16433-1 CHP843P (Link to Original site) CHP...843F 160 CHP843Z 524 CHP843P 664 - - Show CHP843 Library CH (Link to library) Clone ID CHP... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CH/CHP8-B/CHP843Q.Seq.d/ Representative seq. ID CHP...843P (Link to Original site) Representative DNA sequence >CHP843 (CHP843Q) /CSM/CH/CHP8-B/CHP8...lfikllfielcklpsnkf*yfvyiflyk*kk--- ---kpvtmlsisl*mvttsmvsqrllplnqphplntlmlkvkv*skylimpqlnslfspl tlkvllvpmvvi

  14. Dicty_cDB: CHP412 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP412 (Link to dictyBase) - - - Contig-U16328-1 CHP412P (Link to Original site) CHP...412F 745 CHP412Z 843 CHP412P 1568 - - Show CHP412 Library CH (Link to library) Clone ID CHP...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CH/CHP4-A/CHP412Q.Seq.d/ Representative seq. ID CHP...412P (Link to Original site) Representative DNA sequence >CHP412 (CHP412Q) /CSM/CH/CHP4-A/CHP...YFCPWDGSLVRELYFGDIKQDLLLRNNENQQVKQVYEGDIKQDLIRRK NKIHPEKQMHEEDIKQQVFFRIKNIHEKPVYE

  15. Dicty_cDB: CHP553 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP553 (Link to dictyBase) - - - Contig-U16333-1 CHP553P (Link to Original site) CHP...553F 522 CHP553Z 458 CHP553P 960 - - Show CHP553 Library CH (Link to library) Clone ID CHP... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CH/CHP5-C/CHP553Q.Seq.d/ Representative seq. ID CHP...553P (Link to Original site) Representative DNA sequence >CHP553 (CHP553Q) /CSM/CH/CHP5-C/CHP5...TSTTTTTAT ALPTTSAASTAKVTTTTTTTGSPASTTTTGAPTSTTGASTSTTGAPSSSSSSNETTPTAT PTKKPVTPTP

  16. Dicty_cDB: CHP430 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP430 (Link to dictyBase) - - - Contig-U15680-1 CHP430P (Link to Original site) CHP...430F 652 CHP430Z 725 CHP430P 1357 - - Show CHP430 Library CH (Link to library) Clone ID CHP...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CH/CHP4-B/CHP430Q.Seq.d/ Representative seq. ID CHP...430P (Link to Original site) Representative DNA sequence >CHP430 (CHP430Q) /CSM/CH/CHP4-B/CHP...wy*nlyi--- ---xkk*svnc*nhyhnv*alklnqvnhpltlc*eik*tliwvfwvtkrlwprlerdlsn skstnllylpisvqvf*sll*rmvpklnnkklsidtslpmilqrnqvycqlfanhhp

  17. Dicty_cDB: CHP147 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP147 (Link to dictyBase) - - - Contig-U16471-1 CHP147P (Link to Original site) CHP...147F 556 CHP147Z 747 CHP147P 1283 - - Show CHP147 Library CH (Link to library) Clone ID CHP...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CH/CHP1-B/CHP147Q.Seq.d/ Representative seq. ID CHP...147P (Link to Original site) Representative DNA sequence >CHP147 (CHP147Q) /CSM/CH/CHP1-B/CHP...qeknqql leqeqnkn Translated Amino Acid sequence (All Frames) Frame A: llaywxkker*kkknfffff*nwyn*kcxvknihp

  18. Dicty_cDB: CHP829 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP829 (Link to dictyBase) - - - Contig-U16471-1 CHP829P (Link to Original site) CHP...829F 515 CHP829Z 658 CHP829P 1153 - - Show CHP829 Library CH (Link to library) Clone ID CHP...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CH/CHP8-B/CHP829Q.Seq.d/ Representative seq. ID CHP...829P (Link to Original site) Representative DNA sequence >CHP829 (CHP829Q) /CSM/CH/CHP8-B/CHP...laywkftik*lfflfflfkv*iieiikinikkker*kkkdfffff*nwyn*kcivknxhp l**y*fyhvsfqhvhlikflkmxvkqlikn*mkilkklxm*lxnlxm

  19. Dicty_cDB: CHP323 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP323 (Link to dictyBase) - - - Contig-U16361-1 CHP323P (Link to Original site) CHP...323F 578 CHP323Z 715 CHP323P 1273 - - Show CHP323 Library CH (Link to library) Clone ID CHP...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CH/CHP3-A/CHP323Q.Seq.d/ Representative seq. ID CHP...323P (Link to Original site) Representative DNA sequence >CHP323 (CHP323Q) /CSM/CH/CHP3-A/CHP...ltilfy Frame B: cwptgnnnnnnnnknnnnsfyfiffivvirk*nyklnifvipypykinni*v*ypffi*i *****ykyi*iqflviknng*k*rg*fpnkhp

  20. Dicty_cDB: CHP665 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP665 (Link to dictyBase) - - - Contig-U11094-1 CHP665P (Link to Original site) CHP...665F 510 CHP665Z 668 CHP665P 1158 - - Show CHP665 Library CH (Link to library) Clone ID CHP...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CH/CHP6-C/CHP665Q.Seq.d/ Representative seq. ID CHP...665P (Link to Original site) Representative DNA sequence >CHP665 (CHP665Q) /CSM/CH/CHP6-C/CHP...ILQPIVRDHSTYRPKNLYGSSD--- ---LPLMLTVMTAKWVADALIHPLFDLLMQMKYIPYLEPNPSKEMKLMMCKHIMA

  1. Dicty_cDB: CHP321 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP321 (Link to dictyBase) - - - Contig-U15525-1 CHP321P (Link to Original site) CHP...321F 677 CHP321Z 687 CHP321P 1344 - - Show CHP321 Library CH (Link to library) Clone ID CHP...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CH/CHP3-A/CHP321Q.Seq.d/ Representative seq. ID CHP...321P (Link to Original site) Representative DNA sequence >CHP321 (CHP321Q) /CSM/CH/CHP3-A/CHP...TDTSQGLPQLISNINACCAIVD TVRTTLGPRGMDKLIYQSERQVTISNDGATVMKLLDIVHPAARTLVDIAKSQDSEVGDGT TSVVILAGEFLKAAKPFLEEGIHP

  2. Dicty_cDB: CHP713 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP713 (Link to dictyBase) - - - Contig-U16583-1 CHP713P (Link to Original site) CHP...713F 664 CHP713Z 606 CHP713P 1250 - - Show CHP713 Library CH (Link to library) Clone ID CHP...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CH/CHP7-A/CHP713Q.Seq.d/ Representative seq. ID CHP...713P (Link to Original site) Representative DNA sequence >CHP713 (CHP713Q) /CSM/CH/CHP7-A/CHP...keftlkaevgkgsitmeftyg*vdpkvwvnsl**gy*vigskvkvaltlvt l*aereag*NSCTIEWDIRVTDRNPGHQLAVEEELSF--- ---wqpsahsdxaf*sfdvgssyhceaeftkcwivhp

  3. Dicty_cDB: CHP681 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP681 (Link to dictyBase) - - - Contig-U16471-1 CHP681P (Link to Original site) CHP...681F 563 CHP681Z 683 CHP681P 1226 - - Show CHP681 Library CH (Link to library) Clone ID CHP...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CH/CHP6-D/CHP681Q.Seq.d/ Representative seq. ID CHP...681P (Link to Original site) Representative DNA sequence >CHP681 (CHP681Q) /CSM/CH/CHP6-D/CHP...wlkiinkrikmri* fkrnnnlltklkin*kifnmnnksknnkin*ikkkinny*nknkxki Frame C: cwptgnnxk**klilkkrnvkkkknfffff*nwyn*kcivknxhp

  4. Dicty_cDB: CHP847 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP847 (Link to dictyBase) - - - Contig-U16586-1 CHP847P (Link to Original site) CHP...847F 288 CHP847Z 424 CHP847P 692 - - Show CHP847 Library CH (Link to library) Clone ID CHP... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CH/CHP8-B/CHP847Q.Seq.d/ Representative seq. ID CHP...847P (Link to Original site) Representative DNA sequence >CHP847 (CHP847Q) /CSM/CH/CHP8-B/CHP8...IFITDRKKELIITAGGENISPTLIEGFIRQIIGVEQAVVIGDRQKYLVA LVTVNADLFKLLPGQGYTHPLPKSMEEASTDKHFIAYIDSQMKDINSKLPNVSTIKKV

  5. Dicty_cDB: CHP487 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP487 (Link to dictyBase) - - - Contig-U16328-1 CHP487P (Link to Original site) CHP...487F 728 CHP487Z 836 CHP487P 1544 - - Show CHP487 Library CH (Link to library) Clone ID CHP...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CH/CHP4-D/CHP487Q.Seq.d/ Representative seq. ID CHP...487P (Link to Original site) Representative DNA sequence >CHP487 (CHP487Q) /CSM/CH/CHP4-D/CHP...llrrnnknhqeeqvyqgdii qdilrvlnyeekevyegdikqnllrrknhdhpekeiyegdikqdllrrnnknhqeklvye gdikqdllrrnnknhkeeqvyqgdii

  6. Dicty_cDB: CHP208 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP208 (Link to dictyBase) - - - Contig-U16405-1 CHP208P (Link to Original site) CHP...208F 593 CHP208Z 657 CHP208P 1230 - - Show CHP208 Library CH (Link to library) Clone ID CHP...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CH/CHP2-A/CHP208Q.Seq.d/ Representative seq. ID CHP...208P (Link to Original site) Representative DNA sequence >CHP208 (CHP208Q) /CSM/CH/CHP2-A/CHP...i*nq*fqkfqplkiklkkvf*q*fvvivlqixsmqa*qfhqk lflfhvi*nvvyhqmkylmiviqvklilqivilivyhaipvqv*kihqeyyxsyltqhhf nimsqlkklnyxhhqtlvkxmlklnhp

  7. Dicty_cDB: CHP259 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP259 (Link to dictyBase) - - - Contig-U16440-1 CHP259P (Link to Original site) CHP...259F 582 CHP259Z 651 CHP259P 1213 - - Show CHP259 Library CH (Link to library) Clone ID CHP...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CH/CHP2-C/CHP259Q.Seq.d/ Representative seq. ID CHP...259P (Link to Original site) Representative DNA sequence >CHP259 (CHP259Q) /CSM/CH/CHP2-C/CHP...vvlighqmylinkeilfmvmqdiikemiilwl*ish lmekpkfqyqmmqvkhfqpqqffhiklyqfhhi*ilrv**lhvpiisf*lvkilv*hgtm hhpmvmfysh

  8. Dicty_cDB: CHP511 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP511 (Link to dictyBase) - - - Contig-U15732-1 CHP511P (Link to Original site) CHP...511F 648 CHP511Z 685 CHP511P 1313 - - Show CHP511 Library CH (Link to library) Clone ID CHP...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CH/CHP5-A/CHP511Q.Seq.d/ Representative seq. ID CHP...511P (Link to Original site) Representative DNA sequence >CHP511 (CHP511Q) /CSM/CH/CHP5-A/CHP...NKLKKEQEKKEKEAEEKEKQEAEEKIVREHIEKILKTPKGEKKDVSSLLSSY HPTAVESIWYDYWLDNGYFSPEKQMEIQPHVVKDKKFVIVIPPPNVTGSLHLGHA

  9. Dicty_cDB: CHP678 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP678 (Link to dictyBase) - - - Contig-U11527-1 CHP678P (Link to Original site) CHP...678F 615 CHP678Z 658 CHP678P 1253 - - Show CHP678 Library CH (Link to library) Clone ID CHP...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CH/CHP6-D/CHP678Q.Seq.d/ Representative seq. ID CHP...678P (Link to Original site) Representative DNA sequence >CHP678 (CHP678Q) /CSM/CH/CHP6-D/CHP...ICSSVQNQDFTVVQDYITGLKTYLYMQSRE DLLQWDGQSPPNEIINKNPKLKGLPKFGKYLLERNRIDTEEKQNIDLQKVKNPLVPSPNP THPVPSLKDQINRAIP

  10. Dicty_cDB: CHP875 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP875 (Link to dictyBase) - - - Contig-U16440-1 CHP875P (Link to Original site) CHP...875F 595 CHP875Z 479 CHP875P 1054 - - Show CHP875 Library CH (Link to library) Clone ID CHP...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CH/CHP8-D/CHP875Q.Seq.d/ Representative seq. ID CHP...875P (Link to Original site) Representative DNA sequence >CHP875 (CHP875Q) /CSM/CH/CHP8-D/CHP...fqyqmmqvkhfqpqqffhiklyqfhhi*ilrv**lhvpiisf*lvkil v*hgtmhhpmgdvlf--- ---xipivi*pnkhkfqixivnvqskilnvilvtkvqtia

  11. Dicty_cDB: CHP228 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP228 (Link to dictyBase) - - - Contig-U16531-1 CHP228P (Link to Original site) CHP...228F 614 CHP228Z 540 CHP228P 1134 - - Show CHP228 Library CH (Link to library) Clone ID CHP...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CH/CHP2-B/CHP228Q.Seq.d/ Representative seq. ID CHP...228P (Link to Original site) Representative DNA sequence >CHP228 (CHP228Q) /CSM/CH/CHP2-B/CHP...NSKTNPTKSI YTTSYFTQVRALIARNSQIIWGDRFALISKYISIIVQTFVYASLFYNMKSDVTGLFNRGG AIYAAILFNAFVSAGELGLTF--- ---dsryllqw*i*flflynfhp

  12. Dicty_cDB: CHP736 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP736 (Link to dictyBase) - - - Contig-U16256-1 CHP736P (Link to Original site) CHP...736F 641 CHP736Z 522 CHP736P 1143 - - Show CHP736 Library CH (Link to library) Clone ID CHP...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CH/CHP7-B/CHP736Q.Seq.d/ Representative seq. ID CHP...736P (Link to Original site) Representative DNA sequence >CHP736 (CHP736Q) /CSM/CH/CHP7-B/CHP...VLFISTT LAVEMKKTQDFNLRIFDQHPKYNNNFEPENGVLTVNLVKSILNETTGIPELTTMSNLTTV NKQGRIYSPELFKYFFADNSDAPDRNNSGKNYPLDITLT

  13. Dicty_cDB: CHP538 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available library) CHP538 (Link to dictyBase) - - - Contig-U11908-1 CHP538P (Link to Original site) CHP538F 639 CHP538Z...CHP538Z 714 CHP538P 1333 - - Show CHP538 Library CH (Link to library) Clone ID CHP538 (Link to dictyBase)...tsukuba.ac.jp/CSM/CH/CHP5-B/CHP538Q.Seq.d/ Representative seq. ID CHP538P (Link to Original site) Representative...Representative DNA sequence >CHP538 (CHP538Q) /CSM/CH/CHP5-B/CHP538Q.Seq.d/ CTGTTGGCCTACTGGNATCATCACCTG...significant alignments: (bits) Value CHP538 (CHP538Q) /CSM/CH/CHP5-B/CHP538Q.Seq.d/ 1259 0.0 VHI134 (VHI134Q)

  14. Efficiencies and emissions of a 192 kw{sub el} Otto engine CHP-unit running on biogas at the research station ''Unterer Lindenhof''

    Energy Technology Data Exchange (ETDEWEB)

    Thomas, Bernd; Wyndorps, Agnes

    2012-06-15

    An Otto engine CHP-unit running on biogas has been under investigation for more than two years. Within this time data regarding temperatures, energy flows, biogas composition, emissions etc. were collected, and this paper presents some of the results. In detail, electric and thermal output are discussed for one full year. From these data the monthly electric availability of the unit can be calculated, which ranges from 84.0 to 96.4%. In addition, the utilization of the heat produced by the CHP-unit during one year is displayed. It was found that 18.2% of the heat was needed for heating purposes within the biogas plant, and 64.5% of the heat could be supplied to the district heating system. Hence, 17.3% of the useful heat had to be released to the ambient air by an additional cooler. Regarding emissions, a strong impact of the excess air ratio on emissions of NO{sub X} has been observed. Moreover, the effect on electric efficiency is outlined in this paper. As known from theory, the experimental results revealed that an increase in the excess air ratio helps to lower NO{sub X}-emissions, while electric efficiency is reduced by this means. (copyright 2012 WILEY-VCH Verlag GmbH 8 Co. KGaA, Weinheim)

  15. Dicty_cDB: CHP537 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available (Link to library) CHP537 (Link to dictyBase) - - - Contig-U12147-1 | Contig-U15540-1 CHP537P (Link to Original...site) CHP537F 116 CHP537Z 256 CHP537P 352 - - Show CHP537 Library CH (Link to library) Clone ID CHP537 (Link...tsukuba.ac.jp/CSM/CH/CHP5-B/CHP537Q.Seq.d/ Representative seq. ID CHP537P (Link to Original site) Representative...Representative DNA sequence >CHP537 (CHP537Q) /CSM/CH/CHP5-B/CHP537Q.Seq.d/ ACTGTTGGCCTACTGGGGTAAACTAAT...significant alignments: (bits) Value CHP537 (CHP537Q) /CSM/CH/CHP5-B/CHP537Q.Seq.d/ 387 e-107 VSI794 (VSI794Q)

  16. Dicty_cDB: CHP533 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available (Link to library) CHP533 (Link to dictyBase) - - - Contig-U13117-1 | Contig-U15928-1 CHP533P (Link to Original...site) CHP533F 113 CHP533Z 753 CHP533P 846 - - Show CHP533 Library CH (Link to library) Clone ID CHP533 (Link...tsukuba.ac.jp/CSM/CH/CHP5-B/CHP533Q.Seq.d/ Representative seq. ID CHP533P (Link to Original site) Representative...Representative DNA sequence >CHP533 (CHP533Q) /CSM/CH/CHP5-B/CHP533Q.Seq.d/ TTANTTAAAAAGATNGATANTAAATCA...significant alignments: (bits) Value CHP533 (CHP533Q) /CSM/CH/CHP5-B/CHP533Q.Seq.d/ 942 0.0 VHD768 (VHD768Q)

  17. Dicty_cDB: CHP535 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available (Link to library) CHP535 (Link to dictyBase) - - - Contig-U16475-1 | Contig-U16524-1 CHP535P (Link to Original...site) CHP535F 213 CHP535Z 459 CHP535P 652 - - Show CHP535 Library CH (Link to library) Clone ID CHP535 (Link...tsukuba.ac.jp/CSM/CH/CHP5-B/CHP535Q.Seq.d/ Representative seq. ID CHP535P (Link to Original site) Representative...Representative DNA sequence >CHP535 (CHP535Q) /CSM/CH/CHP5-B/CHP535Q.Seq.d/ ACTGTTGGCCTACTGGNATGATTATTA...vacuolar >> prediction for CHP535 is cyt 5' end seq. ID CHP535F 5' end seq. >CHP535F.Seq ACTGTTGGCCTACTGGN

  18. SOFC/TEG hybrid mCHP system. Final report

    Energy Technology Data Exchange (ETDEWEB)

    2012-03-15

    The starting point for this project have been the challenge has been to develop a cost effective solution with long term stability. This is where a focused effort in a strong consortium covering material research, module development and manufacture as well as device design and optimization can make a real difference. In March 2010 the SOFTEG phase II project was initiated and a cooperation organization was established to implement the project as a development and demonstration project involving the staff from all project partners. The project is now completed with excellent and documented outcome. The final results by Alpcon have been demonstration as a TEG-based mCHP system calls CHP Dual Engine Power System, which will be applicable as both a standalone TEG-CHP hybrid system, but also as an auxiliary power unit and power booster for the SOFC system. However the SOFC system cannot cover the household's heat demand alone so it is necessary to combine a SOFC system together with a water heater/boiler system to cover the peak heat demand of a residential house or a complex building. The SOFTEG project partners achieved significant results that mainly can be outlined as following: 1) University of Aarhus has improved the thermal stability of ZnSb by optimizing the concentration of Nano composite material. 2) The grain size and its influence on the sintering process by spark plasma method are investigated by Aarhus University, but further work seems to be necessary. 3) The TE material is going to commercialization by Aarhus University. 4) Aalborg University has prepared simulation tools for complex thermoelectric simulation in non-steady state condition. 5) The new type DCDC interleaved converter using the MPPT system for optimal power tracing is designed, build and tested by Aalborg University in cooperation with Alpcon. This task is included overall system design, control system implementation and power electronic control design. 6) Full scale practical

  19. Multi-Objective Analysis of a CHP Plant Integrated Microgrid in Pakistan

    Directory of Open Access Journals (Sweden)

    Asad Waqar

    2017-10-01

    Full Text Available In developing countries like Pakistan, the capacity shortage (CS of electricity is a critical problem. The frequent natural gas (NG outages compel consumers to use electricity to fulfill the thermal loads, which ends up as an increase in electrical load. In this scenario, the authors have proposed the concept of a combined heat & power (CHP plant to be a better option for supplying both electrical and thermal loads simultaneously. A CHP plant-based microgrid comprising a PV array, diesel generators and batteries (operating in grid-connected as well as islanded modes has been simulated using the HOMER Pro software. Different configurations of distributed generators (DGs with/without batteries have been evaluated considering multiple objectives. The multiple objectives include the minimization of the total net present cost (TNPC, cost of generated energy (COE and the annual greenhouse gas (GHG emissions, as well as the maximization of annual waste heat recovery (WHR of thermal units and annual grid sales (GS. These objectives are subject to the constraints of power balance, battery operation within state of charge (SOC limits, generator operation within capacity limits and zero capacity shortage. The simulations have been performed on six cities including Islamabad, Lahore, Karachi, Peshawar, Quetta and Gilgit. The simulation results have been analyzed to find the most optimal city for the CHP plant integrated microgrid.

  20. Combined Heat and Power (CHP) Partnership

    Science.gov (United States)

    The CHP Partnership seeks to reduce air pollution and water usage associated with electric power generation by promoting the use of CHP. The Partnership works to remove policy barriers and to facilitate the development of new projects.

  1. Islanded house operation using a micro CHP

    NARCIS (Netherlands)

    Molderink, Albert; Bakker, Vincent; Hurink, Johann L.; Smit, Gerardus Johannes Maria

    2007-01-01

    The µCHP is expected as the successor of the conventional high-efficiency boiler producing next to heat also electricity with a comparable overall efficiency. A µCHP appliance saves money and reduces greenhouse gas emission. An additional functionality of the µCHP is using the appliance as a

  2. Topology optimization of inertia driven dosing units

    DEFF Research Database (Denmark)

    Andreasen, Casper Schousboe

    2017-01-01

    This paper presents a methodology for optimizing inertia driven dosing units, sometimes referred to as eductors, for use in small scale flow applications. The unit is assumed to operate at low to moderate Reynolds numbers and under steady state conditions. By applying topology optimization...... to the Brinkman penalized Navier-Stokes equation the design of the dosing units can be optimized with respect to dosing capability without initial design assumptions. The influence of flow resistance and speed is investigated to assess design performance under varying operating conditions....

  3. Dicty_cDB: CHP612 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP612 (Link to dictyBase) - - - Contig-U14298-1 - (Link to Original site) CHP...612F 589 - - - - - - Show CHP612 Library CH (Link to library) Clone ID CHP612 (Link to dicty...iol.tsukuba.ac.jp/CSM/CH/CHP6-A/CHP612Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >CHP612 (CHP612Q) /CSM/CH/CHP6-A/CHP612Q.Seq.d/ CTGTTGGCCTACTGGTA...kplylpnqmvvvlvslvvs*vvevqmvv*hhl* lqlqhrnhqvvf*vdl*vvvdqhqhphkhfhqlqpqpqlqpqiqlknqylvswvxylvvq qlvqhnlfkhlh-

  4. Dicty_cDB: CHP466 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP466 (Link to dictyBase) - - - Contig-U15768-1 - (Link to Original site) - - CHP...466Z 578 - - - - Show CHP466 Library CH (Link to library) Clone ID CHP466 (Link to dicty...iol.tsukuba.ac.jp/CSM/CH/CHP4-C/CHP466Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >CHP466 (CHP466Q) /CSM/CH/CHP4-C/CHP466Q.Seq.d/ XXXXXXXXXXCAACATA....10 Translated Amino Acid sequence ---HNVLQEIGFLTQCDHPNILKYNCSVLYGSDLFIVSEFIQGGTLEQASASSHVFKETQ VGFIGLELLKAI

  5. Dicty_cDB: CHP738 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP738 (Link to dictyBase) - - - Contig-U16256-1 - (Link to Original site) - - CHP...738Z 540 - - - - Show CHP738 Library CH (Link to library) Clone ID CHP738 (Link to dicty...iol.tsukuba.ac.jp/CSM/CH/CHP7-B/CHP738Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >CHP738 (CHP738Q) /CSM/CH/CHP7-B/CHP738Q.Seq.d/ XXXXXXXXXXCTAACAA...CTGGTGAAGAAAAGGTTATGNACTACTGGNAAAGCAAGTTCAAGG sequence update 2002. 9.10 Translated Amino Acid sequence ---*qw*lfhp

  6. Dicty_cDB: CHP460 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP460 (Link to dictyBase) - - - Contig-U15817-1 - (Link to Original site) - - CHP...460Z 569 - - - - Show CHP460 Library CH (Link to library) Clone ID CHP460 (Link to dicty...iol.tsukuba.ac.jp/CSM/CH/CHP4-C/CHP460Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >CHP460 (CHP460Q) /CSM/CH/CHP4-C/CHP460Q.Seq.d/ XXXXXXXXXXTTGGTTT...T Translated Amino Acid sequence (All Frames) Frame A: ---wfwvlqivtnhyvvi*qnmivhp

  7. Dicty_cDB: CHP827 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP827 (Link to dictyBase) - - - Contig-U15898-1 - (Link to Original site) CHP...827F 148 - - - - - - Show CHP827 Library CH (Link to library) Clone ID CHP827 (Link to dicty...iol.tsukuba.ac.jp/CSM/CH/CHP8-B/CHP827Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >CHP827 (CHP827Q) /CSM/CH/CHP8-B/CHP827Q.Seq.d/ ACTGTTGGCCTACTGGT...ce TVGLLVLNNTLTHYFIKKKXKNKIXKIIXINLLINHY*ffhplkk--- Translated Amino Acid sequence (All Frames) Frame A: TVG

  8. Dicty_cDB: CHP143 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP143 (Link to dictyBase) - - - Contig-U15591-1 - (Link to Original site) - - CHP...143Z 396 - - - - Show CHP143 Library CH (Link to library) Clone ID CHP143 (Link to dicty...iol.tsukuba.ac.jp/CSM/CH/CHP1-B/CHP143Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >CHP143 (CHP143Q) /CSM/CH/CHP1-B/CHP143Q.Seq.d/ XXXXXXXXXXAAGAAAA...rilwsncllasks*asfh*vclx ydfiiyn**fiiiic*nvcsnftnn*nckcnsisntfnlviifqvstapkndixrlvefg yiiyhp

  9. Mississippi State University Cooling, Heating, and Power (Micro-CHP) and Bio-Fuel Center

    Energy Technology Data Exchange (ETDEWEB)

    Mago, Pedro [Mississippi State Univ., Mississippi State, MS (United States); Newell, LeLe [Mississippi State Univ., Mississippi State, MS (United States)

    2014-01-31

    Between 2008 and 2014, the U.S. Department of Energy funded the MSU Micro-CHP and Bio-Fuel Center located at Mississippi State University. The overall objective of this project was to enable micro-CHP (micro-combined heat and power) utilization, to facilitate and promote the use of CHP systems and to educate architects, engineers, and agricultural producers and scientists on the benefits of CHP systems. Therefore, the work of the Center focused on the three areas: CHP system modeling and optimization, outreach, and research. In general, the results obtained from this project demonstrated that CHP systems are attractive because they can provide energy, environmental, and economic benefits. Some of these benefits include the potential to reduce operational cost, carbon dioxide emissions, primary energy consumption, and power reliability during electric grid disruptions. The knowledge disseminated in numerous journal and conference papers from the outcomes of this project is beneficial to engineers, architects, agricultural producers, scientists and the public in general who are interested in CHP technology and applications. In addition, more than 48 graduate students and 23 undergraduate students, benefited from the training and research performed in the MSU Micro-CHP and Bio-Fuel Center.

  10. Dicty_cDB: CHP119 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP119 (Link to dictyBase) - - - Contig-U16361-1 CHP119P (Link to Original site) CHP...119F 671 CHP119Z 693 CHP119P 1344 - - Show CHP119 Library CH (Link to library) Clone ID CHP...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CH/CHP1-A/CHP119Q.Seq.d/ Representative seq. ID CHP...119P (Link to Original site) Representative DNA sequence >CHP119 (CHP119Q) /CSM/CH/CHP1-A/CHP...PYAXFIPCSQYCFIXWY Translated Amino Acid sequence (All Frames) Frame A: hcwptg*****ykyi*iqflviknng*k*rg*fpnkhp

  11. Dicty_cDB: CHP324 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP324 (Link to dictyBase) - - - Contig-U16255-1 | Contig-U16524-1 CHP...324P (Link to Original site) CHP324F 138 CHP324Z 589 CHP324P 707 - - Show CHP324 Library CH (Link to library) Clone ID CHP...55-1 | Contig-U16524-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CH/CHP3-A/CHP...324Q.Seq.d/ Representative seq. ID CHP324P (Link to Original site) Representative DNA sequence >CHP324 (CHP...324Q) /CSM/CH/CHP3-A/CHP324Q.Seq.d/ CTGTTGGCCTACTGGNAACATTAAATATTAATAATTAGNATACATTGAAAAAAAAGNAAA

  12. Dicty_cDB: CHP377 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP377 (Link to dictyBase) - - - - CHP377P (Link to Original site) CHP377F 564 CHP...377Z 654 CHP377P 1198 - - Show CHP377 Library CH (Link to library) Clone ID CHP377 (Link... to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CH/CHP...3-D/CHP377Q.Seq.d/ Representative seq. ID CHP377P (Link to... Original site) Representative DNA sequence >CHP377 (CHP377Q) /CSM/CH/CHP3-D/CHP377Q.Seq.d/ CTGTTGGCCTACTGGN

  13. Dicty_cDB: CHP350 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP350 (Link to dictyBase) - - - Contig-U16411-1 | Contig-U16470-1 CHP...350P (Link to Original site) CHP350F 573 CHP350Z 665 CHP350P 1218 - - Show CHP350 Library CH (Link to library) Clone ID CHP...411-1 | Contig-U16470-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CH/CHP3-C/CHP...350Q.Seq.d/ Representative seq. ID CHP350P (Link to Original site) Representative DNA sequence >CHP350 (CHP...350Q) /CSM/CH/CHP3-C/CHP350Q.Seq.d/ CACTGTTGGCCTACTGGNATTAATAAATAATAATTAAAATTTGCATATATAAAAGNAAAT

  14. Dicty_cDB: CHP555 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP555 (Link to dictyBase) - - - Contig-U16255-1 | Contig-U16524-1 CHP...555P (Link to Original site) CHP555F 123 CHP555Z 444 CHP555P 547 - - Show CHP555 Library CH (Link to library) Clone ID CHP...55-1 | Contig-U16524-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CH/CHP5-C/CHP...555Q.Seq.d/ Representative seq. ID CHP555P (Link to Original site) Representative DNA sequence >CHP555 (CHP...555Q) /CSM/CH/CHP5-C/CHP555Q.Seq.d/ ACTGTTGGCCTACTGGTATTTATATTATTACAAATAAAACAGTAACATTAAATATTAATA

  15. Dicty_cDB: CHP378 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP378 (Link to dictyBase) - - - Contig-U15346-1 | Contig-U15652-1 CHP...378P (Link to Original site) CHP378F 607 CHP378Z 537 CHP378P 1124 - - Show CHP378 Library CH (Link to library) Clone ID CHP...346-1 | Contig-U15652-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CH/CHP3-D/CHP...378Q.Seq.d/ Representative seq. ID CHP378P (Link to Original site) Representative DNA sequence >CHP378 (CHP...378Q) /CSM/CH/CHP3-D/CHP378Q.Seq.d/ ACTGTTGGCCTACTGGNAATTTTTATATCTTCTCATAGTTTTAAAAATTATTAATAATAT

  16. Dicty_cDB: CHP438 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP438 (Link to dictyBase) - - - Contig-U16411-1 | Contig-U16470-1 CHP...438P (Link to Original site) CHP438F 622 CHP438Z 722 CHP438P 1324 - - Show CHP438 Library CH (Link to library) Clone ID CHP...411-1 | Contig-U16470-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CH/CHP4-B/CHP...438Q.Seq.d/ Representative seq. ID CHP438P (Link to Original site) Representative DNA sequence >CHP438 (CHP...438Q) /CSM/CH/CHP4-B/CHP438Q.Seq.d/ CACTGTTGGCCTACTGGTCTGTAAATAAATCATATAATTTTTCAACATACATATATATAT

  17. Dicty_cDB: CHP463 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP463 (Link to dictyBase) - - - - CHP463P (Link to Original site) CHP463F 601 CHP...463Z 726 CHP463P 1307 - - Show CHP463 Library CH (Link to library) Clone ID CHP463 (Link... to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CH/CHP...4-C/CHP463Q.Seq.d/ Representative seq. ID CHP463P (Link to... Original site) Representative DNA sequence >CHP463 (CHP463Q) /CSM/CH/CHP4-C/CHP463Q.Seq.d/ ACTGTTGGCCTCTGGN

  18. Dicty_cDB: CHP756 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP756 (Link to dictyBase) - - - - CHP756P (Link to Original site) CHP756F 490 CHP...756Z 631 CHP756P 1101 - - Show CHP756 Library CH (Link to library) Clone ID CHP756 (Link... to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CH/CHP...7-C/CHP756Q.Seq.d/ Representative seq. ID CHP756P (Link to... Original site) Representative DNA sequence >CHP756 (CHP756Q) /CSM/CH/CHP7-C/CHP756Q.Seq.d/ GTAAATGGTAATGTTA

  19. Dicty_cDB: CHP710 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP710 (Link to dictyBase) - G02976 - Contig-U15934-1 CHP710P ...(Link to Original site) CHP710F 578 CHP710Z 701 CHP710P 1259 - - Show CHP710 Library CH (Link to library) Clone ID CHP...iginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CH/CHP7-A/CHP710Q.Seq.d/ R...epresentative seq. ID CHP710P (Link to Original site) Representative DNA sequence >CHP710 (CHP710Q) /CSM/CH/CHP7-A/CHP...sskksssssiiifrrnql*y**q*k* **k*kneq*w*nrknvfflrkwaiiiivvvvvlvvvvvvvvvvvkrnhhphhlhhlhhrh hhlqqyqhq*qi*kvevnll

  20. Dicty_cDB: CHP426 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP426 (Link to dictyBase) - - - Contig-U13114-1 | Contig-U16361-1 CHP...426P (Link to Original site) CHP426F 615 CHP426Z 686 CHP426P 1281 - - Show CHP426 Library CH (Link to library) Clone ID CHP...114-1 | Contig-U16361-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CH/CHP4-B/CHP...426Q.Seq.d/ Representative seq. ID CHP426P (Link to Original site) Representative DNA sequence >CHP426 (CHP...426Q) /CSM/CH/CHP4-B/CHP426Q.Seq.d/ ACTGTTGGCCTACTGGNATTATTTAATTTTATAAATAATTAAACAACAACAACAACAACA

  1. Dicty_cDB: CHP575 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP575 (Link to dictyBase) - - - Contig-U15689-1 | Contig-U16524-1 CHP...575P (Link to Original site) CHP575F 573 CHP575Z 281 CHP575P 834 - - Show CHP575 Library CH (Link to library) Clone ID CHP...89-1 | Contig-U16524-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CH/CHP5-D/CHP...575Q.Seq.d/ Representative seq. ID CHP575P (Link to Original site) Representative DNA sequence >CHP575 (CHP...575Q) /CSM/CH/CHP5-D/CHP575Q.Seq.d/ CTGTTGGCCTACTGGNATAATAATACAACAACAACAACAACATAATGTCAACACCTTTAA

  2. Dicty_cDB: CHP532 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available library) CHP532 (Link to dictyBase) - - - Contig-U16255-1 - (Link to Original site) - - CHP532Z 245 - -...- - - Show CHP532 Library CH (Link to library) Clone ID CHP532 (Link to dictyBase) Atlas ID - NBRP ID...http://dictycdb.biol.tsukuba.ac.jp/CSM/CH/CHP5-B/CHP532Q.Seq.d/ Representative seq. ID - (Link to Original...site) Representative DNA sequence >CHP532 (CHP532Q) /CSM/CH/CHP5-B/CHP532Q.Seq.d/ XXXXXXXXXXGGTNTNTTTGAAG...significant alignments: (bits) Value CHP532 (CHP532Q) /CSM/CH/CHP5-B/CHP532Q.Seq.d/ 335 2e-91 SSM572 (SSM572Q)

  3. Dicty_cDB: CHP530 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available library) CHP530 (Link to dictyBase) - - - - - (Link to Original site) CHP530F 182 - - - - - - Show CHP530 Library...Library CH (Link to library) Clone ID CHP530 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link...http://dictycdb.biol.tsukuba.ac.jp/CSM/CH/CHP5-B/CHP530Q.Seq.d/ Representative seq. ID - (Link to Original...site) Representative DNA sequence >CHP530 (CHP530Q) /CSM/CH/CHP5-B/CHP530Q.Seq.d/ ACTGTTGGCCTACTGGGCAAATT...significant alignments: (bits) Value CHP530 (CHP530Q) /CSM/CH/CHP5-B/CHP530Q.Seq.d/ 64 7e-10 SFH605 (SFH605Q)

  4. Dicty_cDB: CHP531 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available library) CHP531 (Link to dictyBase) - G20193 DDB0235388 Contig-U14452-1 - (Link to Original site) CHP531F 577...577 - - - - - - Show CHP531 Library CH (Link to library) Clone ID CHP531 (Link to dictyBase) Atlas ID...http://dictycdb.biol.tsukuba.ac.jp/CSM/CH/CHP5-B/CHP531Q.Seq.d/ Representative seq. ID - (Link to Original...site) Representative DNA sequence >CHP531 (CHP531Q) /CSM/CH/CHP5-B/CHP531Q.Seq.d/ CTGTTGGCCTACTGGNAATTTCT...significant alignments: (bits) Value CHP531 (CHP531Q) /CSM/CH/CHP5-B/CHP531Q.Seq.d/ 759 0.0 VHJ729 (VHJ729Q)

  5. Dicty_cDB: CHP794 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP794 (Link to dictyBase) - - - Contig-U16423-1 - (Link to Original site) - - CHP794Z...(Link to library) Clone ID CHP794 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig...Contig-U16423-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CH/CHP7-D/CHP794Q.Seq.d/ Representative...Representative seq. ID - (Link to Original site) Representative DNA sequence >CHP794 (CHP794Q) /CSM/CH/CHP7-D/CHP794Q...XXXXXXXXXXTCATTTTCGTTGAAACTAAACGTTCTTGTGATACTCTTACCTACTTTTTA AATCAAAGAAATTTCCCAACTACCTGTATTCATGGTGATTTAACTCAACCAGAAAGAGAA

  6. CHP Integrated with Burners for Packaged Boilers

    Energy Technology Data Exchange (ETDEWEB)

    Castaldini, Carlo; Darby, Eric

    2013-09-30

    The objective of this project was to engineer, design, fabricate, and field demonstrate a Boiler Burner Energy System Technology (BBEST) that integrates a low-cost, clean burning, gas-fired simple-cycle (unrecuperated) 100 kWe (net) microturbine (SCMT) with a new ultra low-NOx gas-fired burner (ULNB) into one compact Combined Heat and Power (CHP) product that can be retrofit on new and existing industrial and commercial boilers in place of conventional burners. The Scope of Work for this project was segmented into two principal phases: (Phase I) Hardware development, assembly and pre-test and (Phase II) Field installation and demonstration testing. Phase I was divided into five technical tasks (Task 2 to 6). These tasks covered the engineering, design, fabrication, testing and optimization of each key component of the CHP system principally, ULNB, SCMT, assembly BBEST CHP package, and integrated controls. Phase I work culminated with the laboratory testing of the completed BBEST assembly prior to shipment for field installation and demonstration. Phase II consisted of two remaining technical tasks (Task 7 and 8), which focused on the installation, startup, and field verification tests at a pre-selected industrial plant to document performance and attainment of all project objectives. Technical direction and administration was under the management of CMCE, Inc. Altex Technologies Corporation lead the design, assembly and testing of the system. Field demonstration was supported by Leva Energy, the commercialization firm founded by executives at CMCE and Altex. Leva Energy has applied for patent protection on the BBEST process under the trade name of Power Burner and holds the license for the burner currently used in the product. The commercial term Power Burner is used throughout this report to refer to the BBEST technology proposed for this project. The project was co-funded by the California Energy Commission and the Southern California Gas Company (SCG), a

  7. Compact biogas unit for use in agriculture with efficient CHP technology; Kompakt-Biogasanlage fuer die Landwirtschaft mit effizienter BHKW-Technik. P. Wyss (Ittigen)

    Energy Technology Data Exchange (ETDEWEB)

    Liesch, B.; Mueller, Ch.

    2006-07-01

    This illustrated final report for the Swiss Federal Office of Energy (SFOE) takes a look at the implementation of a waste-fermentation plant whose biogas-production is used in a combined heat and power unit to produce heat and electricity. The installation with two fermenter tanks at a Swiss farm is described and illustrated with photos. The results covering the plant's first year of operation are presented and discussed. The substrates used are described. The energy-balance of the installation is illustrated with a flow diagram. Figures on biogas and electrical power production are presented.

  8. Modeling work of a small scale gasifier/SOFC CHP system

    Energy Technology Data Exchange (ETDEWEB)

    Liu, M.; Aravind, P.V.; Qu, Z.; Woudstra, N.; Verkooijen, A.H.M. [Delft University of Technology (Netherlands). Dept. of Mechanical Engineering], Emails: ming.liu@tudelft.nl, p.v.aravind@tudelft.nl, z.qu@tudelft.nl, n.woudstra@tudelft.nl, a. h. m. verkooijen@tudelft.nl; Cobas, V.R.M. [Federal University of Itajuba (UNIFEI), Pinheirinhos, MG (Brazil). Dept. of Mechanical Engineering], E-mail: vlad@unifei.edu.br

    2009-07-01

    For a highly efficient biomass gasification/Solid Oxide Fuel Cell (SOFC) Combined Heat and Power (CHP) generation system, the gasifier, the accompanying gas cleaning technologies and the CHP unit must be carefully designed as an integrated unit. This paper describes such a system involving a two-stage fixed-bed down draft gasifier, a SOFC CHP unit and a gas cleaning system. A gas cleaning system with both low temperature and high temperature sections is proposed for coupling the gasifier and the SOFC. Thermodynamic modeling was carried out for the gasifier/SOFC system with the proposed gas cleaning system. The net AC electrical efficiency of this system is around 30% and the overall system efficiency is around 60%. This paper also describes various exergy losses in the system and the future plans for integrated gasifier-GCU-SOFC experiments from which the results will be used to validate the modeling results of this system. (author)

  9. Microturbine CHP projects in the Netherlands

    Energy Technology Data Exchange (ETDEWEB)

    Mallon, W. [Gasunie Research (Netherlands)

    2003-07-01

    Several microturbine CHP systems were installed in the Netherlands. Their installation costs were described along with new concepts of heat exchanger systems. The installations include a swimming pool 30 kW Capstone microturbine, a brick kiln 30 kW Capstone microturbine, and a tar factory 100 kW Turbec microturbine and 60 kW Capstone microturbine. This paper described the heating system of the swimming pool, the heat exchanger, the lay out of the kiln system, the kiln installation, a picture of the Turbec microturbine, photographs of the air and flue ductwork, and a lay out of the energy system at the tar factory. A table of measured technical data was also presented. After 14,230 hours of operation, the total efficiency of the Capstone 30 was 97 per cent with less than 9 ppm emissions. After 1300 hours of operation the total efficiency of the Capstone 60 was 85 per cent with emissions less than 9 ppm. After 14000 hours of operation the total efficiency was 75 per cent with emissions less than 9 ppm. Payback period was calculated to be 6 years for each unit. tabs., figs.

  10. Dicty_cDB: CHP491 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available GTTGTGAAAAAG sequence update 2002. 9.10 Translated Amino Acid sequence ---xf*dvhpihecrfk*PKGHP...ce (All Frames) Frame A: ---xf*dvhpihecrfk*PKGHPMLXKGFTHDRCSLRCPHGHECKVDHNGKECXVRSHRP PPPEVCSLRCPPKHECKFDDHG...CH (Link to library) CHP491 (Link to dictyBase) - - - Contig-U16419-1 - (Link to Original site) - - CHP...491Z 826 - - - - Show CHP491 Library CH (Link to library) Clone ID CHP491 (Link to dicty...iol.tsukuba.ac.jp/CSM/CH/CHP4-D/CHP491Q.Seq.d/ Representative seq. ID - (Link to

  11. 330 kWe Packaged CHP System with Reduced Emissions

    Energy Technology Data Exchange (ETDEWEB)

    Plahn, Paul [Cummins Power Generation, Minneapolis, MN (United States); Keene, Kevin [Cummins Power Generation, Minneapolis, MN (United States); Pendray, John [Cummins Power Generation, Minneapolis, MN (United States)

    2015-03-31

    The objective of this project was to develop a flexible, 330 kWe packaged Combined Heat and Power (CHP) system that can be deployed to commercial and light industrial applications at a lower total cost of ownership than current CHP solutions. The project resulted in a CHP system that is easy to use and inexpensive to install, offering world class customer support, while providing a low-emissions, higher-efficiency internal combustion engine for a CHP system of this size.

  12. Combined Heat and Power (CHP) as a Compliance Option under the Clean Power Plan: A Template and Policy Options for State Regulators

    Energy Technology Data Exchange (ETDEWEB)

    None

    2015-07-30

    Combined Heat and Power (CHP) is an important option for states to consider in developing strategies to meet their emission targets under the US Environmental Protection Agency's Clean Power Plan. This Template is designed to highlight key issues that states should consider when evaluating whether CHP could be a meaningful component of their compliance plans. It demonstrates that CHP can be a valuable approach for reducing emissions and helping states achieve their targets. While the report does not endorse any particular approach for any state, and actual plans will vary dependent upon state-specific factors and determinations, it provides tools and resources that states can use to begin the process, and underscores the opportunity CHP represents for many states. . By producing both heat and electricity from a single fuel source, CHP offers significant energy savings and carbon emissions benefits over the separate generation of heat and power, with a typical unit producing electricity with half the emissions of conventional generation. These efficiency gains translate to economic savings and enhanced competitiveness for CHP hosts, and emissions reductions for the state, along with helping to lower electric bills; and creating jobs in the design, construction, installation and maintenance of equipment. In 2015, CHP represents 8 percent of electric capacity in the United States and provides 12 percent of total power generation. Projects already exist in all 50 states, but significant technical and economic potential remains. CHP offers a tested way for states to achieve their emission limits while advancing a host of ancillary benefits.

  13. Deployment of FlexCHP System

    Energy Technology Data Exchange (ETDEWEB)

    Cygan, David [Gas Technology Inst., Des Plaines, IL (United States)

    2015-11-01

    The Gas Technology Institute (GTI), along with its partner Integrated CHP Systems Corporation, has developed and demonstrated an Ultra-Low-Nitrogen Oxide (ULN) Flexible Combined Heat and Power (FlexCHP) system that packages a state-of-the-art Capstone C65 gas microturbine and Johnston PFXX100 boiler with an innovative natural gas-fired supplemental burner. Supplemental burners add heat as needed in response to facility demand, which increases energy efficiency, but typically raises exhaust NOx levels, degrading local air quality unless a costly and complicated catalytic treatment system is added. The FlexCHP system increases energy efficiency and achieves the 2007 California Air Resource Board (CARB) distributed generation emissions standards for Nitrogen oxides (NOx), Carbon Monoxide (CO), and Total Hydrocarbons (THC) without catalytic exhaust gas treatment. The key to this breakthrough performance is a simple and reliable burner design which utilizes staged combustion with engineered internal recirculation. This ULN burner system successfully uses turbine exhaust as an oxidizer, while achieving high efficiencies and low emissions. In tests at its laboratory facilities in Des Plaines, Illinois, GTI validated the ability of the system to achieve emissions of NOx, CO, and THC below the CARB criteria of 0.07, 0.10, and 0.02 lb/MW-h respectively. The FlexCHP system was installed at the field demonstration site, Inland Empire Foods, in Riverside, California to verify performance of the technology in an applied environment. The resulting Combined Heat and Power (CHP) package promises to make CHP implementation more attractive, mitigate greenhouse gas emissions, and improve the reliability of electricity supply.

  14. Optimal portfolio selection between different kinds of Renewable energy sources

    Energy Technology Data Exchange (ETDEWEB)

    Zakerinia, MohammadSaleh; Piltan, Mehdi; Ghaderi, Farid

    2010-09-15

    In this paper, selection of the optimal energy supply system in an industrial unit is taken into consideration. This study takes environmental, economical and social parameters into consideration in modeling along with technical factors. Several alternatives which include renewable energy sources, micro-CHP systems and conventional system has been compared by means of an integrated model of linear programming and three multi-criteria approaches (AHP, TOPSIS and ELECTRE III). New parameters like availability of sources, fuels' price volatility, besides traditional factors are considered in different scenarios. Results show with environmental preferences, renewable sources and micro-CHP are good alternatives for conventional systems.

  15. Future market relevance of CHP installations with electrical ratings from 1 to 1000 kW; Zukuenftige Marktbedeutung von WKK-Anlagen mit 1 - 1000 kW elektrischer Leistung

    Energy Technology Data Exchange (ETDEWEB)

    Eicher, H.; Rigassi, R.

    2003-12-15

    This report for the Swiss Federal Office of Energy (SFOE) discusses the future market relevance of combined heat and power (CHP) installations with electrical ratings from 1 to 1000 kW. Developments over the past ten years are reviewed. Important reductions in the price of motor-driven CHP units and the price of the electrical power produced are noted and commented on. The technical market potential of CHP units and the degree to which this potential has been implemented are commented on. Work done, including CHP implementation in the industrial, commercial and residential areas, is commented on. Future developments both in the technical area as well as in commercial areas are commented on. Micro-gas-turbine based CHP systems are also discussed, as are fuel-cell based systems in both the higher and lower capacity power generation area. The prospects for CHP systems in general in the electricity generation area are discussed

  16. Optimal Scheduling of a Multi-Carrier Energy Hub Supplemented By Battery Energy Storage Systems

    DEFF Research Database (Denmark)

    Javadi, Mohammad Sadegh; Anvari-Moghaddam, Amjad; Guerrero, Josep M.

    2017-01-01

    This paper introduces a management model for optimal scheduling of a multi-carrier energy hub. In the proposed hub, three types of assets are considered: dispersed generating systems (DGs) such as micro-combined heat and power (mCHP) units, storage devices such as battery-based electrical storage...

  17. Optimized mobile retroreflectivity unit data processing algorithms.

    Science.gov (United States)

    2017-04-01

    The University of North Florida, in collaboration with the FDOT, was tasked to establish precise line-stripe evaluation methods using the Mobile Retroreflectivity Unit (MRU). Initial implementation of the manufacturers software resulted in measure...

  18. Why hospitals are prime candidates for CHP systems

    Energy Technology Data Exchange (ETDEWEB)

    Katsanis, J.S.; Tsarabaris, P.T.; Bourkas, P.D. [National Technical Univ. of Athens, Athens (Greece). Dept. of Electrical and Computer Engineering; Malahias, G.N. [Hellenic Naval Academy, Athens (Greece)

    2007-07-01

    Combined heat and power systems for hospitals were discussed. Hospitals and clinics have higher energy consumption levels in relation than many other buildings. High power reliability and quality is required. While hospitals typically drive their heat and electrical power separately, the approach can lead to losses from power station generators and local boilers. CHP units eliminate losses by burning fuels to generate electricity while using waste heat to provide warmth and hot water. Studies have demonstrated that considerable decreases in energy use can be achieved if CHP systems are used in hospitals. A new directive from the European Union is designed to promote high efficiency cogeneration in the internal energy market. The use of on-site power generators will allow hospitals to decide when to generate their own power and can offer significant savings and improved energy efficiency. A case study of a Greek hospital in Athens was used to demonstrate that in addition to significantly reducing energy costs for the hospital, carbon dioxide (CO{sub 2}) emissions were reduced by 46 per cent. 25 refs., 4 tabs., 9 figs.

  19. Optimal Locations for New Casara Units

    Science.gov (United States)

    1996-04-01

    du commandement aerien a Otawa demanda au DRO(A) de faire une mise a jour de l’etude et de determiner oft de nouvelles unites CASARA pourraient etre...a l’etude de 1976 pour evaluer la demande de service RES et les regions couvertes par !’organisation CASARA d’aujourd’hui. La superficie

  20. MICRO-CHP System for Residential Applications

    Energy Technology Data Exchange (ETDEWEB)

    Joseph Gerstmann

    2009-01-31

    This is the final report of progress under Phase I of a project to develop and commercialize a micro-CHP system for residential applications that provides electrical power, heating, and cooling for the home. This is the first phase of a three-phase effort in which the residential micro-CHP system will be designed (Phase I), developed and tested in the laboratory (Phase II); and further developed and field tested (Phase III). The project team consists of Advanced Mechanical Technology, Inc. (AMTI), responsible for system design and integration; Marathon Engine Systems, Inc. (MES), responsible for design of the engine-generator subsystem; AO Smith, responsible for design of the thermal storage and water heating subsystems; Trane, a business of American Standard Companies, responsible for design of the HVAC subsystem; and AirXchange, Inc., responsible for design of the mechanical ventilation and dehumidification subsystem.

  1. Modelling Danish local CHP on market conditions

    DEFF Research Database (Denmark)

    Ravn, Hans V.; Riisom, Jannik; Schaumburg-Müller, Camilla

    2004-01-01

    in the Western Danish system. As both the power produced by the local CHPs and the wind power are prioritised, the production of these types of power is occasionally sufficient to meet the total demand in the system, causing the market price to drop dramatically, sometimes even to zero-level. In line...... with the liberalisation process of the energy sectors of the EU countries, it is however anticipated that Danish local CHP are to begin operating on market conditions within the year 2005. This means that the income that the local CHPs previously gained from selling electricity at the feed-in tariff is replaced in part...... by income gained from selling electricity on the Nordic spot market, Nord Pool. Thus, the production quantities of the local CHPs will depend on the market price. This paper analyses the new situation. This is done by creating a model for the supply function of a local CHP, which takes into account...

  2. Simulation and optimization of an industrial PSA unit

    Directory of Open Access Journals (Sweden)

    Barg C.

    2000-01-01

    Full Text Available The Pressure Swing Adsorption (PSA units have been used as a low cost alternative to the usual gas separation processes. Its largest commercial application is for hydrogen purification systems. Several studies have been made about the simulation of pressure swing adsorption units, but there are only few reports on the optimization of such processes. The objective of this study is to simulate and optimize an industrial PSA unit for hydrogen purification. This unit consists of six beds, each of them have three layers of different kinds of adsorbents. The main impurities are methane, carbon monoxide and sulfidric gas. The product stream has 99.99% purity in hydrogen, and the recovery is around 90%. A mathematical model for a commercial PSA unit is developed. The cycle time and the pressure swing steps are optimized. All the features concerning with complex commercial processes are considered.

  3. CHP plant Legionowo Poland - Final report

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2004-12-01

    In 1997, a new Energy Law was passed in Poland. An important element of the law is that local energy planning is made obligatory. The law describes obligatory tasks and procedures for Polish municipalities related to planning and organisation of the energy sector. With the objective of supporting the Polish municipalities in their obligations according to the energy law of 1997, the project 'Energy Planning in Poland at Municipal Level - Support to Decision Makers' was launched. As part of the project, Municipal Guideline Reports have been elaborated for three model municipalities. These guidelines present the basis for the Energy Supply Plans in these municipalities. For the city of Legionowo, the following was recommended: 1. The planning processes initiated during the project should be continues/followed up, 2. Master Plan for the district heating system should be prepared, 3. The possibilities of establishment of a major natural gas-fired CHP plant of the Combined Cycle type should be investigated. The present report is the final Master Plan based on the following reports: Master Plan for Legionowo - Status Report; Master Plan for Legionowo - Hydraulic Analysis; CHP Plant Legionowo Poland - CHP Feasibility Analysis. The final Master Plan describes the status in the DH Company in Legionowo, possible improvements and an investment plan for the selected scenario. (BA)

  4. Analysis and optmization of CHP, CCHP, CHP-ORC, and CCHP-ORC systems

    Science.gov (United States)

    Hueffed, Anna Kathrine

    Increased demand for energy, rising energy costs, and heightened environmental concerns are driving forces that continually press for the improvement and development of new technologies to promote energy savings and emissions reduction. Combined heating and power (CHP), combined cooling, heating, and power (CCHP), and organic Rankine cycles (ORC) are a few of the technologies that promise to reduce primary energy consumption (PEC), cost, and emissions. CHP systems generate electricity at or near the place of consumption using a prime mover, e.g. a combustion engine or a turbine, and utilize the accompanying exhaust heat that would otherwise be wasted to satisfy the building's thermal demand. In the case of CCHP systems, exhaust heat also goes to satisfy a cooling load. An organic Rankine cycle (ORC) combined with a CHP or CCHP system can generate electricity from any surplus low-grade heat, thereby reducing the total primary energy, cost, and emissions.

  5. Performance study of an innovative natural gas CHP system

    Energy Technology Data Exchange (ETDEWEB)

    Fu, Lin; Zhao, Xiling; Zhang, Shigang; Li, Yan; Jiang, Yi; Li, Hui; Sun, Zuoliang [Department of Building Science, School of Architecture, Tsinghua University, Beijing (China)

    2011-01-15

    In the last decade, technological innovation and changes in the economic and regulatory environment have resulted in increased attention to distributed energy systems (DES). Combined cooling heating and power (CHP) systems based on the gas-powered internal combustion engine (ICE) are increasingly used as small-scale distribution co-generators. This paper describes an innovative ICE-CHP system with an exhaust-gas-driven absorption heat pump (AHP) that has been set up at the energy-saving building in Beijing, China. The system is composed of an ICE, an exhaust-gas-driven AHP, and a flue gas condensation heat exchanger (CHE), which could recover both the sensible and latent heat of the flue gas. The steady performance and dynamic response of the innovative CHP system with different operation modes were tested. The results show that the system's energy utilization efficiency could reach above 90% based on lower heating value (LHV) of natural gas; that is, the innovative CHP system could increase the heat utilization efficiency 10% compared to conventional CHP systems, and the thermally activated components of the system have much more thermal inertia than the electricity generation component. The detailed test results provide important insight into CHP performance characteristics and could be valuable references for the control of CHP systems. The novel CHP system could take on a very important role in the CHP market. (author)

  6. Dicty_cDB: CHP195 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP195 (Link to dictyBase) - - - Contig-U11819-1 - (Link to Or...iginal site) CHP195F 138 - - - - - - Show CHP195 Library CH (Link to library) Clone ID CHP195 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11819-1 Original site URL http://dictycdb.b...qilkvstnk**IKNYYVNRVYEIIIIINICTYKKK--- Translated Amino Acid sequence (All Frames) Frame A: tvgllvfsnt*gink*...iin*kllck*sl*nnnynkymyi*kk--- Frame B: llaywffqilkvstnk**IKNYYVNRVYEIIIIINICTYKKK--- Frame C: cwptgffkylryqq

  7. Micro-CHP Systems for Residential Applications

    Energy Technology Data Exchange (ETDEWEB)

    Timothy DeValve; Benoit Olsommer

    2007-09-30

    Integrated micro-CHP (Cooling, Heating and Power) system solutions represent an opportunity to address all of the following requirements at once: conservation of scarce energy resources, moderation of pollutant release into our environment, and assured comfort for home-owners. The objective of this effort was to establish strategies for development, demonstration, and sustainable commercialization of cost-effective integrated CHP systems for residential applications. A unified approach to market and opportunity identification, technology assessment, specific system designs, adaptation to modular product platform component conceptual designs was employed. UTRC's recommendation to U.S. Department of Energy is to go ahead with the execution of the proposed product development and commercialization strategy plan under Phase II of this effort. Recent indicators show the emergence of micro-CHP. More than 12,000 micro-CHP systems have been sold worldwide so far, around 7,500 in 2004. Market projections predict a world-wide market growth over 35% per year. In 2004 the installations were mainly in Europe (73.5%) and in Japan (26.4%). The market in North-America is almost non-existent (0.1%). High energy consumption, high energy expenditure, large spark-spread (i.e., difference between electricity and fuel costs), big square footage, and high income are the key conditions for market acceptance. Today, these conditions are best found in the states of New York, Pennsylvania, New Jersey, Wisconsin, Illinois, Indiana, Michigan, Ohio, New England states. A multiple stage development plan is proposed to address risk mitigation. These stages include concept development and supplier engagement, component development, system integration, system demonstration, and field trials. A two stage commercialization strategy is suggested based on two product versions. The first version--a heat and power system named Micro-Cogen, provides the heat and essential electrical power to the

  8. ANALYSIS OF CHP POTENTIAL AT FEDERAL SITES

    Energy Technology Data Exchange (ETDEWEB)

    HADLEY, S.W.

    2002-03-11

    This document was prepared at the request of the U.S. Department of Energy's (DOE's) Federal Energy Management Program (FEMP) under its Technical Guidance and Assistance and Project Financing Programs. The purpose was to provide an estimate of the national potential for combined heat and power (also known as CHP; cogeneration; or cooling, heating, and power) applications at federal facilities and the associated costs and benefits including energy and emission savings. The report provides a broad overview for the U.S. Department of Energy (DOE) and other agencies on when and where CHP systems are most likely to serve the government's best interest. FEMP's mission is to reduce the cost to and environmental impact of the federal government by advancing energy efficiency and water conservation, promoting the use of renewable energy, and improving utility management decisions at federal sites. FEMP programs are driven by its customers: federal agency sites. FEMP monitors energy efficiency and renewable energy technology developments and mounts ''technology-specific'' programs to make technologies that are in strong demand by agencies more accessible. FEMP's role is often one of helping the federal government ''lead by example'' through the use of advanced energy efficiency/renewable energy (EERE) technologies in its own buildings and facilities. CHP was highlighted in the Bush Administration's National Energy Policy Report as a commercially available technology offering extraordinary benefits in terms of energy efficiencies and emission reductions. FEMP's criteria for emphasizing a technology are that it must be commercially available; be proven but underutilized; have a strong constituency and momentum; offer large energy savings and other benefits of interest to federal sites and FEMP mission; be in demand; and carry sufficient federal market potential. As discussed in the report, CHP meets all

  9. Temperature Optimization of a Naphtha Splitter Unit

    Directory of Open Access Journals (Sweden)

    NEVADO, A.

    2008-04-01

    Full Text Available A fully reliable and efficient adaptive control methodology has been long awaited in industry due to the time-varying nature of industrial plants. This paper demonstrates that this kind of adaptive solution is now available and simple to apply by presenting the first application of a methodology called Adaptive Predictive Expert (ADEX Control in a petrochemical production unit. A description of the plant and the ADEX solution is followed by a comparative analysis of the results obtained with those of the existing conventional PID control. The objectives of the application involving the naphtha splitter at the Puertollano Refinery of Repsol were to establish the viability of ADEX in this environment, increase the quality of the naphtha products by achieving closer compliance with desired specification and maximizing the economic yield. To achieve these objectives it was necessary to enhance the stability of the naphtha splitter by improving control of the principal variables and eliminating a degree of interaction between them which was causing a resonance problem in the column. The application of the ADEX system confirm its viability, demonstrated a marked increase in column stability, significant improvements in levels of control and the elimination of the resonance problems.

  10. Penempatan Optimal Phasor Measurement Unit (PMU) dengan Integer Programming

    OpenAIRE

    Yunan Helmy Amrulloh

    2013-01-01

    Phasor Measurement Unit (PMU) merupakan peralatan yang mampu memberikan pengukuran fasor tegangan dan arus secara real-time. PMU dapat digunakan untuk monitoring, proteksi dan kontrol pada sistem tenaga listrik. Tugas akhir ini membahas penempatan PMU secara optimal berdasarkan topologi jaringan sehingga sistem tenaga listrik  dapat diobservasi. Penempatan optimal PMU dirumuskan sebagai masalah Binary Integer Programming (BIP) yang akan memberikan variabel dengan pilihan nilai (0,1) yang menu...

  11. Generic Combined Heat and Power (CHP Model for the Concept Phase of Energy Planning Process

    Directory of Open Access Journals (Sweden)

    Satya Gopisetty

    2016-12-01

    Full Text Available Micro gas turbines (MGTs are regarded as combined heat and power (CHP units which offer high fuel utilization and low emissions. They are applied in decentralized energy generation. To facilitate the planning process of energy systems, namely in the context of the increasing application of optimization techniques, there is a need for easy-to-parametrize component models with sufficient accuracy which allow a fast computation. In this paper, a model is proposed where the non-linear part load characteristics of the MGT are linearized by means of physical insight of the working principles of turbomachinery. Further, it is shown that the model can be parametrized by the data usually available in spec sheets. With this model a uniform description of MGTs from several manufacturers covering an electrical power range from 30 k W to 333 k W can be obtained. The MGT model was implemented by means of Modelica/Dymola. The resulting MGT system model, comprising further heat exchangers and hydraulic components, was validated using the experimental data of a 65 k W MGT from a trigeneration energy system.

  12. Dicty_cDB: CHP528 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP528 (Link to dictyBase) - - - Contig-U16417-1 - (Link to Original site) - - CHP528Z...CHP528Z 150 - - - - Show CHP528 Library CH (Link to library) Clone ID CHP528 (Link to dictyBase) Atlas...DT761935 |DT761935.1 EST1195784 Aquilegia cDNA library Aquilegia formosa x Aquilegia pubescens cDNA clone...DR952811 |DR952811.1 EST1144350 Aquilegia cDNA library Aquilegia formosa x Aquilegia pubescens cDNA clone...DR924298 |DR924298.1 EST1115837 Aquilegia cDNA library Aquilegia formosa x Aquilegia pubescens cDNA clone

  13. Elimination of restraints on the propagation of combined heat and power (CHP) generation systems in Switzerland; Beseitigung von Hemmnissen bei der Verbreitung von Waermekraftkopplung (WKK) in der Schweiz

    Energy Technology Data Exchange (ETDEWEB)

    Rieder, S.; Landis, F. [Interface Politikstudien Forschung Beratung, Luzern (Switzerland); Lienhard, A.; Marti Locher, F. [Universitaet Bern, Kompetenzzentrum fuer Public Management (KPM), Bern (Switzerland); Krummenacher, S. [Enerprice Partners AG, Technopark Luzern, Root Laengenbold (Switzerland)

    2009-04-15

    This report for the Swiss Federal Office of Energy (SFOE) discusses the results of study initiated by the SFOE that was to investigate the reasons for the low level of proliferation of CHP technology in Switzerland. The two main questions asked - which factors inhibit the use of CHP in particular application areas and which energy-policy measures can remove such obstacles - are discussed. The use of CHP in various areas of application from waste incineration plants through to units used in residential buildings is analysed and commented on. Recommendations on measures that can be taken to enhance the use of CHP are discussed. Three strategy variants available to the public services area are presented and discussed. It is noted that a consensus between players in the technical and political areas is necessary

  14. Sewage Sludge Gasification for CHP Applications

    Energy Technology Data Exchange (ETDEWEB)

    McCahey, S.; Huang, Y.; McMullan, J.T.

    2003-07-01

    Many routes previously available for sewage sludge disposal within the European Union are now prohibited or constrained by environmental legislation. Meanwhile, sewage sludge production increases annually as more rigorous treatment processes are used. This paper introduces an ongoing project, supported by the European Commission FP5 Programme, which seeks to examine the key technical environmental and economic issues relating to the gasification of sewage sludge for utilisation in CHP applications and ultimately to establish the commercial viability of the process. Sewage sludge treatment data has been collected by country and region and a database compiled. Laboratory and pilot plant scale gasification trials are underway and two small engines and a generator have been installed and commissioned. This paper discusses the concurrent development of ECLIPSE process simulation models for the three selected gasification processes, namely fluidised bed, spouted bed and fixed bed. These models have been validated and are being used to predict the behaviour of appropriately sized commercial scale plant, enabling informed decisions regarding technical suitability. The next step in this project is to determine capital costs and economic performance. Process routes will be identified that offer the most cost effective routes to reducing environmental burdens by using sewage sludge in CHP applications. (author)

  15. Cost targets for domestic fuel cell CHP

    Science.gov (United States)

    Staffell, I.; Green, R.; Kendall, K.

    Fuel cells have the potential to reduce domestic energy bills by providing both heat and power at the point of use, generating high value electricity from a low cost fuel. However, the cost of installing the fuel cell must be sufficiently low to be recovered by the savings made over its lifetime. A computer simulation is used to estimate the savings and cost targets for fuel cell CHP systems. Two pitfalls of this kind of simulation are addressed: the selection of representative performance figures for fuel cells, and the range of houses from which energy demand data was taken. A meta-study of the current state of the art is presented, and used with 102 house-years of demand to simulate the range of economic performance expected from four fuel cell technologies within the UK domestic CHP market. Annual savings relative to a condensing boiler are estimated at €170-300 for a 1 kWe fuel cell, giving a target cost of €350-625 kW -1 for any fuel cell technology that can demonstrate a 2.5-year lifetime. Increasing lifetime and reducing fuel cell capacity are identified as routes to accelerated market entry. The importance of energy demand is seen to outweigh both economic and technical performance assumptions, while manufacture cost and system lifetime are highlighted as the only significant differences between the technologies considered. SOFC are considered to have the greatest potential, but uncertainty in the assumptions used precludes any clear-cut judgement.

  16. THE BREAKEVEN POINT GIVEN LIMIT COST USING BIOMASS CHP PLANT

    Directory of Open Access Journals (Sweden)

    Paula VOICU

    2015-06-01

    Full Text Available Biomass is a renewable source, non-fossil, from which can be obtained fuels, which can be used in power generation systems. The main difference of fossil fuels is the availability biomass in nature and that it is in continue "reproduction". The use its enable the use of materials that could be destined destruction, as a source of energy "renewable", though result with many ecological values. In this paper we will study, applying a calculation model in view optimal sizing of the cogeneration plant based on biomass, biomass cost limit for the net present value is zero. It will consider that in cogeneration systems and in heating peak systems using biomass. After applying the mathematical model for limit value of biomass cost will determine the nominal optimal coefficient of cogeneration, for which discounted net revenue value is zero. Optimal sizing of CHP plants based on using biomass will be given by optimum coefficient of cogeneration determined following the application of the proposed mathematical model.

  17. System effects of primary energy reduction connected with operation of the CHP plants

    Science.gov (United States)

    Ziębik, Andrzej; Gładysz, Paweł

    2017-06-01

    The paper is devoted to explication of one of the advantages of heat and electricity cogeneration, rarely considered in technical literature. Usually attention is paid to the fact that heat losses of the heat distribution network are less severe in the case of cogeneration of heat in comparison with its separate production. But this conclusion is also true in other cases when the internal consumption of heat is significant. In this paper it has been proved in the case of two examples concerning trigeneration technology with an absorption chiller cooperating with a combined heat and power (CHP) plant and CHP plant integrated with amine post-combustion CO2 processing unit. In both considered cases it might be said that thanks to cogeneration we have to do with less severe consequences of significant demand of heat for internal purposes.

  18. System effects of primary energy reduction connected with operation of the CHP plants

    Directory of Open Access Journals (Sweden)

    Ziębik Andrzej

    2017-06-01

    Full Text Available The paper is devoted to explication of one of the advantages of heat and electricity cogeneration, rarely considered in technical literature. Usually attention is paid to the fact that heat losses of the heat distribution network are less severe in the case of cogeneration of heat in comparison with its separate production. But this conclusion is also true in other cases when the internal consumption of heat is significant. In this paper it has been proved in the case of two examples concerning trigeneration technology with an absorption chiller cooperating with a combined heat and power (CHP plant and CHP plant integrated with amine post-combustion CO2 processing unit. In both considered cases it might be said that thanks to cogeneration we have to do with less severe consequences of significant demand of heat for internal purposes.

  19. Hybrid robust predictive optimization method of power system dispatch

    Science.gov (United States)

    Chandra, Ramu Sharat [Niskayuna, NY; Liu, Yan [Ballston Lake, NY; Bose, Sumit [Niskayuna, NY; de Bedout, Juan Manuel [West Glenville, NY

    2011-08-02

    A method of power system dispatch control solves power system dispatch problems by integrating a larger variety of generation, load and storage assets, including without limitation, combined heat and power (CHP) units, renewable generation with forecasting, controllable loads, electric, thermal and water energy storage. The method employs a predictive algorithm to dynamically schedule different assets in order to achieve global optimization and maintain the system normal operation.

  20. Demonstration of a residential CHP system based on PEM fuel cells

    Science.gov (United States)

    Gigliucci, G.; Petruzzi, L.; Cerelli, E.; Garzisi, A.; La Mendola, A.

    Fuel cell-based CHP systems are very attractive for stationary energy generation, since they allow production of electricity and heat in a decentralised, quiet, efficient and environmentally friendly way. As a means of evaluating this new technology, Enel Produzione installed a beta-version fuel cell CHP system, supplied by H-Power, at its experimental area sited in Livorno (Italy), and submitted it to a series of tests. The system is a co-generative unit, converting natural gas into electricity and heat: the former is delivered to local loads using electric load following capability; the latter is delivered to the experimental area hydraulic refrigeration circuit. Experiments were aimed at assessing the suitability of this kind of system to supply Italian residential customers. Factors such as performances, flexibility and operational requirements were evaluated under all the possible operating conditions, both under grid connected and stand alone configurations. At the same time, a mathematical model of the FC/CHP unit was developed to allow for the prediction of system performances and operating parameters under off-design conditions. This model can be used as an effective tool to optimise system operation when a particular customer has to be supplied. Results show that the prototype behaved as expected by a first "proof of concept" system and outline improvements to be achieved in order to satisfy the energy needs of small residential applications.

  1. Micro Cooling, Heating, and Power (Micro-CHP) and Bio-Fuel Center, Mississippi State University

    Energy Technology Data Exchange (ETDEWEB)

    Louay Chamra

    2008-09-26

    Initially, most micro-CHP systems will likely be designed as constant-power output or base-load systems. This implies that at some point the power requirement will not be met, or that the requirement will be exceeded. Realistically, both cases will occur within a 24-hour period. For example, in the United States, the base electrical load for the average home is approximately 2 kW while the peak electrical demand is slightly over 4 kW. If a 3 kWe micro- CHP system were installed in this situation, part of the time more energy will be provided than could be used and for a portion of the time more energy will be required than could be provided. Jalalzadeh-Azar [6] investigated this situation and presented a comparison of electrical- and thermal-load-following CHP systems. In his investigation he included in a parametric analysis addressing the influence of the subsystem efficiencies on the total primary energy consumption as well as an economic analysis of these systems. He found that an increase in the efficiencies of the on-site power generation and electrical equipment reduced the total monthly import of electricity. A methodology for calculating performance characteristics of different micro-CHP system components will be introduced in this article. Thermodynamic cycles are used to model each individual prime mover. The prime movers modeled in this article are a spark-ignition internal combustion engine (Otto cycle) and a diesel engine (Diesel cycle). Calculations for heat exchanger, absorption chiller, and boiler modeling are also presented. The individual component models are then linked together to calculate total system performance values. Performance characteristics that will be observed for each system include maximum fuel flow rate, total monthly fuel consumption, and system energy (electrical, thermal, and total) efficiencies. Also, whether or not both the required electrical and thermal loads can sufficiently be accounted for within the system

  2. CHP plant Legionowo Poland. Description of the electricity market in Poland/CHP-feasibility analysis

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2003-04-01

    In 1997, a new energy law was passed in Poland. An important element of the law is that local energy is made obligatory. The law describes obligatory tasks and procedures for the Polish municipalities related to planning and organisation of the energy sector. With the objective of supporting the Polish municipalities in their obligations according to the energy law, the project 'Energy Planning in Poland at Municipal Level - Support to Decision Makers' was launched. As part of the project, Municipal Guideline Reports have been elaborated for three model municipalities. These guidelines present the basis for energy supply plans in the three municipalities. For the city of Legionowo, the following was recommended: 1. The planning processes initiated during the project should be continued/followed up, 2. Master Plan for the district heating system should be prepared, 3. The possibilities of establishment of a major natural gas-fired CHP plant of the combined cycle type should be investigated. The present report describes the electricity market in Poland, the market in which a CHP plant in Legionowo will have to operate. Furthermore the report presents the results of the feasibility analysis carried out for a new CHP plant in Legionowo. (BA)

  3. On Topology Optimization of Inertia Driven Dosing Units

    DEFF Research Database (Denmark)

    Andreasen, Casper Schousboe

    2016-01-01

    This paper describes how topology optimization can be used to design inertia driven dosing units for the continuous dosage ofone fluid into another. These components often referred to as eductors, utilize the low static pressure in a venturi-type nozzle to drive thedosing flow. The fluids...... are modeled using the steady state incompressible Navier-Stokes equations and the two fluids are considered havingthe same properties. A Brinkman penalization term is added to the governing equations such that a control problem of the flow topologyis obtained. Optimized component geometries for a range...

  4. Putney Basketville Site Biomass CHP Analysis

    Energy Technology Data Exchange (ETDEWEB)

    Hunsberger, Randolph [National Renewable Energy Lab. (NREL), Golden, CO (United States); Mosey, Gail [National Renewable Energy Lab. (NREL), Golden, CO (United States)

    2013-10-01

    The U.S. Environmental Protection Agency (EPA) Office of Solid Waste and Emergency Response Center for Program Analysis developed the RE-Powering America's Land initiative to reuse contaminated sites for renewable energy generation when aligned with the community's vision for the site. The Putney, Vermont, Basketville site, formerly the location of a basket-making facility and a paper mill andwoolen mill, was selected for a feasibility study under the program. Biomass was chosen as the renewable energy resource based on abundant woody-biomass resources available in the area. Biomass combined heat and power (CHP) was selected as the technology due to nearby loads, including Putney Paper and Landmark College.

  5. Optimizing the Shunting Schedule of Electric Multiple Units Depot Using an Enhanced Particle Swarm Optimization Algorithm

    Science.gov (United States)

    Jin, Junchen

    2016-01-01

    The shunting schedule of electric multiple units depot (SSED) is one of the essential plans for high-speed train maintenance activities. This paper presents a 0-1 programming model to address the problem of determining an optimal SSED through automatic computing. The objective of the model is to minimize the number of shunting movements and the constraints include track occupation conflicts, shunting routes conflicts, time durations of maintenance processes, and shunting running time. An enhanced particle swarm optimization (EPSO) algorithm is proposed to solve the optimization problem. Finally, an empirical study from Shanghai South EMU Depot is carried out to illustrate the model and EPSO algorithm. The optimization results indicate that the proposed method is valid for the SSED problem and that the EPSO algorithm outperforms the traditional PSO algorithm on the aspect of optimality. PMID:27436998

  6. Optimizing the Shunting Schedule of Electric Multiple Units Depot Using an Enhanced Particle Swarm Optimization Algorithm

    Directory of Open Access Journals (Sweden)

    Jiaxi Wang

    2016-01-01

    Full Text Available The shunting schedule of electric multiple units depot (SSED is one of the essential plans for high-speed train maintenance activities. This paper presents a 0-1 programming model to address the problem of determining an optimal SSED through automatic computing. The objective of the model is to minimize the number of shunting movements and the constraints include track occupation conflicts, shunting routes conflicts, time durations of maintenance processes, and shunting running time. An enhanced particle swarm optimization (EPSO algorithm is proposed to solve the optimization problem. Finally, an empirical study from Shanghai South EMU Depot is carried out to illustrate the model and EPSO algorithm. The optimization results indicate that the proposed method is valid for the SSED problem and that the EPSO algorithm outperforms the traditional PSO algorithm on the aspect of optimality.

  7. Analysis and Optimization of Central Processing Unit Process Parameters

    Science.gov (United States)

    Kaja Bantha Navas, R.; Venkata Chaitana Vignan, Budi; Durganadh, Margani; Rama Krishna, Chunduri

    2017-05-01

    The rapid growth of computer has made processing more data capable, which increase the heat dissipation. Hence the system unit CPU must be cooled against operating temperature. This paper presents a novel approach for the optimization of operating parameters on Central Processing Unit with single response based on response graph method. These methods have a series of steps from of proposed approach which are capable of decreasing uncertainty caused by engineering judgment in the Taguchi method. Orthogonal Array value was taken from ANSYS report. The method shows a good convergence with the experimental and the optimum process parameters.

  8. Exergy diagnosis of coal fired CHP plant with application of neural and regression modelling

    Directory of Open Access Journals (Sweden)

    Stanek Wojciech

    2012-01-01

    Full Text Available Mathematical models of the processes, that proceed in energetic machines and devices, in many cases are very complicated. In such cases, the exact analytical models should be equipped with the auxiliary empirical models that describe those parameters which are difficult to model in a theoretical way. Regression or neural models identified basing on measurements are rather simple and are characterized by relatively short computation time. For this reason they can be effectively applied for simulation and optimization of steering and regulation processes, as well as, for control and thermal diagnosis of operation (eq. power plants or CHP plants. In the paper regression and neural models of thermal processes developed for systems of operation control of thermal plants are presented. Theoretical-empirical model of processes proceeding in coal fired CHP plant have been applied. Simulative calculations basing on these models have been carried out. Results of simulative calculations have been used for the exergetic evaluation of considered power plant. The diagnosis procedure let to investigate the formation of exergy costs in interconnected components of the system of CHP, as well as, investigate the influence of defects in operation of components on exergy losses and on the exergetic cost in other components. [Acknowledgment. The paper has been prepared within the RECENT project (REsearch Center for Energy and New Technologies supported by 7th Framework Programme, Theme 4, Capacities.

  9. An Optimal Calibration Method for a MEMS Inertial Measurement Unit

    OpenAIRE

    Bin Fang; Wusheng Chou; Li Ding

    2014-01-01

    An optimal calibration method for a micro-electro-mechanical inertial measurement unit (MIMU) is presented in this paper. The accuracy of the MIMU is highly dependent on calibration to remove the deterministic errors of systematic errors, which also contain random errors. The overlapping Allan variance is applied to characterize the types of random error terms in the measurements. The calibration model includes package misalignment error, sensor-to-sensor misalignment error and bias, and a sc...

  10. Penempatan Optimal Phasor Measurement Unit (PMU dengan Integer Programming

    Directory of Open Access Journals (Sweden)

    Yunan Helmy Amrulloh

    2013-09-01

    Full Text Available Phasor Measurement Unit (PMU merupakan peralatan yang mampu memberikan pengukuran fasor tegangan dan arus secara real-time. PMU dapat digunakan untuk monitoring, proteksi dan kontrol pada sistem tenaga listrik. Tugas akhir ini membahas penempatan PMU secara optimal berdasarkan topologi jaringan sehingga sistem tenaga listrik  dapat diobservasi. Penempatan optimal PMU dirumuskan sebagai masalah Binary Integer Programming (BIP yang akan memberikan variabel dengan pilihan nilai (0,1 yang menunjukkan tempat yang harus dipasang PMU. Dalam tugas akhir ini, BIP diterapkan untuk menyelesaikan masalah penempatan PMU secara optimal pada sistem tenaga listrik  Jawa-Bali 500 KV yang selanjutnya diterapkan dengan penambahan konsep incomplete observability. Hasil simulasi menunjukkan bahwa penerapan BIP pada sistem dengan incomplete observability memberikan jumlah PMU yang lebih sedikit dibandingkan dengan sistem tanpa konsep incomplete observability.

  11. Prototype of the domestic CHP ORC energy system

    National Research Council Canada - National Science Library

    J. Kicinski; G. Zywica

    2016-01-01

    The Institute of Fluid-Flow Machinery (IMP PAN) in Gdansk pursues its own research in fields such as technologies that use renewable energy sources efficiently, including in particular the small-scale combined heat and power (CHP) systems...

  12. IEA Energy Technology Essentials: Biomass for Power Generation and CHP

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2007-01-15

    The IEA Energy Technology Essentials series offers concise four-page updates on the different technologies for producing, transporting and using energy. Biomass for Power Generation and CHP is the topic covered in this edition.

  13. Combustion Turbine CHP System for Food Processing Industry

    Energy Technology Data Exchange (ETDEWEB)

    None

    2010-10-01

    This factsheet describes a combined heat and power (CHP) demonstration project that reduces the energy costs and environmental impact of a plant while easing congestion on the constrained Northeast power grid.

  14. Large-area landslide susceptibility with optimized slope-units

    Science.gov (United States)

    Alvioli, Massimiliano; Marchesini, Ivan; Reichenbach, Paola; Rossi, Mauro; Ardizzone, Francesca; Fiorucci, Federica; Guzzetti, Fausto

    2017-04-01

    A Slope-Unit (SU) is a type of morphological terrain unit bounded by drainage and divide lines that maximize the within-unit homogeneity and the between-unit heterogeneity across distinct physical and geographical boundaries [1]. Compared to other terrain subdivisions, SU are morphological terrain unit well related to the natural (i.e., geological, geomorphological, hydrological) processes that shape and characterize natural slopes. This makes SU easily recognizable in the field or in topographic base maps, and well suited for environmental and geomorphological analysis, in particular for landslide susceptibility (LS) modelling. An optimal subdivision of an area into a set of SU depends on multiple factors: size and complexity of the study area, quality and resolution of the available terrain elevation data, purpose of the terrain subdivision, scale and resolution of the phenomena for which SU are delineated. We use the recently developed r.slopeunits software [2,3] for the automatic, parametric delineation of SU within the open source GRASS GIS based on terrain elevation data and a small number of user-defined parameters. The software provides subdivisions consisting of SU with different shapes and sizes, as a function of the input parameters. In this work, we describe a procedure for the optimal selection of the user parameters through the production of a large number of realizations of the LS model. We tested the software and the optimization procedure in a 2,000 km2 area in Umbria, Central Italy. For LS zonation we adopt a logistic regression model implemented in an well-known software [4,5], using about 50 independent variables. To select the optimal SU partition for LS zonation, we want to define a metric which is able to quantify simultaneously: (i) slope-unit internal homogeneity (ii) slope-unit external heterogeneity (iii) landslide susceptibility model performance. To this end, we define a comprehensive objective function S, as the product of three

  15. Stochastic Optimization for Unit Commitment-A Review

    Energy Technology Data Exchange (ETDEWEB)

    Zheng, Qipeng P.; Wang, Jianhui; Liu, Andrew L.

    2015-07-01

    Optimization models have been widely used in the power industry to aid the decision-making process of scheduling and dispatching electric power generation resources, a process known as unit commitment (UC). Since UC's birth, there have been two major waves of revolution on UC research and real life practice. The first wave has made mixed integer programming stand out from the early solution and modeling approaches for deterministic UC, such as priority list, dynamic programming, and Lagrangian relaxation. With the high penetration of renewable energy, increasing deregulation of the electricity industry, and growing demands on system reliability, the next wave is focused on transitioning from traditional deterministic approaches to stochastic optimization for unit commitment. Since the literature has grown rapidly in the past several years, this paper is to review the works that have contributed to the modeling and computational aspects of stochastic optimization (SO) based UC. Relevant lines of future research are also discussed to help transform research advances into real-world applications.

  16. Optimal placement of phasor measurement units for state estimation

    Energy Technology Data Exchange (ETDEWEB)

    Chakrabarti, S.; Kyriakides, E. [Cyprus Univ., Nicosia (Cyprus). Dept. of Electrical and Computer Engineering

    2007-07-01

    Power system state estimators calculate the states, angles and voltages at power system buses based on sets of available measurements. Systems are considered to be observable only when power flow through all the branches can be determined. However, power flow can only be determine if the phase angles of the voltages at the terminal buses are known. This paper presented a method of optimally placing phase measurement units (PMUs) for the accurate estimate of power system states. The method used a binary search algorithm to determine the minimum number of PMUs needed to make the system observable. The process was designed to eliminate the uncertainties associated with evolutionary search methods. The problem of finding optimal PMU locations was solved by using a binary search algorithm to determine the minimum number of PMUs needed. Optimal solutions were then selected among the placement sets with the same number of PMUs. A lexicographic algorithm was used to formulate combinations. Tests conducted using Institute of Electrical and Electronic Engineers (IEEE) 15- and 30-bus test systems confirmed the effectiveness of the proposed method of optimizing PMU placements for state estimation. It was concluded that the method is more accurate and reliable than conventional methods of determining PMUs. 13 refs., 8 tabs., 3 figs.

  17. An Optimal Calibration Method for a MEMS Inertial Measurement Unit

    Directory of Open Access Journals (Sweden)

    Bin Fang

    2014-02-01

    Full Text Available An optimal calibration method for a micro-electro-mechanical inertial measurement unit (MIMU is presented in this paper. The accuracy of the MIMU is highly dependent on calibration to remove the deterministic errors of systematic errors, which also contain random errors. The overlapping Allan variance is applied to characterize the types of random error terms in the measurements. The calibration model includes package misalignment error, sensor-to-sensor misalignment error and bias, and a scale factor is built. The new concept of a calibration method, which includes a calibration scheme and a calibration algorithm, is proposed. The calibration scheme is designed by D-optimal and the calibration algorithm is deduced by a Kalman filter. In addition, the thermal calibration is investigated, as the bias and scale factor varied with temperature. The simulations and real tests verify the effectiveness of the proposed calibration method and show that it is better than the traditional method.

  18. Ising Processing Units: Potential and Challenges for Discrete Optimization

    Energy Technology Data Exchange (ETDEWEB)

    Coffrin, Carleton James [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Nagarajan, Harsha [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Bent, Russell Whitford [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2017-07-05

    The recent emergence of novel computational devices, such as adiabatic quantum computers, CMOS annealers, and optical parametric oscillators, presents new opportunities for hybrid-optimization algorithms that leverage these kinds of specialized hardware. In this work, we propose the idea of an Ising processing unit as a computational abstraction for these emerging tools. Challenges involved in using and bench- marking these devices are presented, and open-source software tools are proposed to address some of these challenges. The proposed benchmarking tools and methodology are demonstrated by conducting a baseline study of established solution methods to a D-Wave 2X adiabatic quantum computer, one example of a commercially available Ising processing unit.

  19. Thermal gain of CHP steam generator plants and heat supply systems

    Science.gov (United States)

    Ziganshina, S. K.; Kudinov, A. A.

    2016-08-01

    Heating calculation of the surface condensate heat recovery unit (HRU) installed behind the BKZ-420-140 NGM boiler resulting in determination of HRU heat output according to fire gas value parameters at the heat recovery unit inlet and its outlet, heated water quantity, combustion efficiency per boiler as a result of installation of HRU, and steam condensate discharge from combustion products at its cooling below condensing point and HRU heat exchange area has been performed. Inspection results of Samara CHP BKZ-420-140 NGM power boilers and field tests of the surface condensate heat recovery unit (HRU) made on the bimetal calorifier base KCk-4-11 (KSk-4-11) installed behind station no. 2 Ulyanovsk CHP-3 DE-10-14 GM boiler were the basis of calculation. Integration of the surface condensation heat recovery unit behind a steam boiler rendered it possible to increase combustion efficiency and simultaneously decrease nitrogen oxide content in exit gases. Influence of the blowing air moisture content, the excess-air coefficient in exit gases, and exit gases temperature at the HRU outlet on steam condensate amount discharge from combustion products at its cooling below condensing point has been analyzed. The steam condensate from HRU gases is offered as heat system make-up water after degasification. The cost-effectiveness analysis of HRU installation behind the Samara CHP BKZ-420-140 NGM steam boiler with consideration of heat energy and chemically purified water economy has been performed. Calculation data for boilers with different heat output has been generalized.

  20. Optimal maintenance of a multi-unit system under dependencies

    Science.gov (United States)

    Sung, Ho-Joon

    The availability, or reliability, of an engineering component greatly influences the operational cost and safety characteristics of a modern system over its life-cycle. Until recently, the reliance on past empirical data has been the industry-standard practice to develop maintenance policies that provide the minimum level of system reliability. Because such empirically-derived policies are vulnerable to unforeseen or fast-changing external factors, recent advancements in the study of topic on maintenance, which is known as optimal maintenance problem, has gained considerable interest as a legitimate area of research. An extensive body of applicable work is available, ranging from those concerned with identifying maintenance policies aimed at providing required system availability at minimum possible cost, to topics on imperfect maintenance of multi-unit system under dependencies. Nonetheless, these existing mathematical approaches to solve for optimal maintenance policies must be treated with caution when considered for broader applications, as they are accompanied by specialized treatments to ease the mathematical derivation of unknown functions in both objective function and constraint for a given optimal maintenance problem. These unknown functions are defined as reliability measures in this thesis, and theses measures (e.g., expected number of failures, system renewal cycle, expected system up time, etc.) do not often lend themselves to possess closed-form formulas. It is thus quite common to impose simplifying assumptions on input probability distributions of components' lifetime or repair policies. Simplifying the complex structure of a multi-unit system to a k-out-of-n system by neglecting any sources of dependencies is another commonly practiced technique intended to increase the mathematical tractability of a particular model. This dissertation presents a proposal for an alternative methodology to solve optimal maintenance problems by aiming to achieve the

  1. ChpR is a chlorpyrifos-responsive transcription regulator in Sinorhizobium meliloti.

    Science.gov (United States)

    Whangsuk, Wirongrong; Dubbs, James M; Sallabhan, Ratiboot; Somsongkul, Kumpanart; Mongkolsuk, Skorn; Loprasert, Suvit

    2010-01-01

    The broad-spectrum organophosphate insecticide chlorpyrifos (CPF)-inducible locus, chpAB, was identified on the endogenous plasmid pSymB in Sinorhizobium meliloti. The S. meliloti chpA promoter was highly induced by CPF and was induced at much lower levels by diazinon and ethion. Transcription of chpA was dependent on chpR, a CadC family transcriptional regulator located upstream of, and divergently transcribed from, chpAB. ChpR was able to mediate the CPF-inducible expression of the S. melilotichpA promoter in Escherichia coli through direct interaction with the chpAB promoter. The chpR-chpA intergenic regions of several bacterial chpRAB operons were aligned and a putative ChpR-binding sequence was proposed. Both the ChpR transcription factor and chpA promoter constitute a good candidate system for genetic-based biosensor development. 2010 S. Karger AG, Basel.

  2. Demonstration Stirling Engine based Micro-CHP with ultra-low emissions

    Energy Technology Data Exchange (ETDEWEB)

    Oeberg, Rolf; Olsson, Fredrik [Carl Bro Energikonsult AB (Sweden); Paalsson, Magnus [Lund Inst. of Technology (Sweden)

    2004-03-01

    This project has been initiated in order to develop a new type of natural gas fired low emission combustion system for a Stirling engine CHP-unit, and to demonstrate and evaluate the unit with the newly developed combustion system in a CHP application. The Stirling engine technology is well developed, but mostly used in special applications and CHP-applications are scarce. The very low exhaust emissions with the new combustion system would make the Stirling engine very suitable for installation in as a CHP-unit in domestic areas. The Stirling engine used in the project has been a V161 engine produced by Solo Kleinmotoren GmbH in Sindelfingen. The unit has a nominal output of 7,5 kW{sub el} and 20 kW{sub heat} (Hot water). The new combustion system was developed at Lund University and the very strict emission targets that were set up could be achieved, both in the laboratory tests and during the site-testing period. Typical performance and emission figures measured at the site installation are: Generator output (kW): 7,3; Hot water output (kW): 15; El. efficiency (%): 25,4; Total efficiency (%): 77,8; NO{sub x} (ppm): 14; CO (ppm): 112; HC (ppm): < 1; O{sub 2} (%): 8,0; Noise level 1 m from the unit (dBA): 83. The NO{sub x} emissions were reduced with almost 97 % as compared to a standard Stirling combustion system. The emission figures are considerably lower than what could be achieved in an internal combustion engine of similar size with an oxidation catalyst (report SGC 106), while the performance figures are similar for the two technologies. The site testing was carried out during a period of 1,5 year at a site owned by Goeteborg Energi. The site comprises a building structure with workshops, offices etc. covering a ground area of 2,500 m{sup 2}. A gas fired boiler with an output of 250 kW supplies hot water to a local grid for heating and tap water. The annual heat demand is typically 285 MWh and the hot water temperatures are normally 60-80 deg C. The site

  3. DEVELOPMENT OF THE CHP-THERMAL SCHEMES IN CONTEXTS OF THE CONSOLIDATED ENERGY SYSTEM OF BELARUS

    Directory of Open Access Journals (Sweden)

    V. N. Romaniuk

    2015-01-01

    Full Text Available The paper deals with the structural specifics of the Belarus Consolidated Energy System capacities in view of their ongoing transfer to the combined-cycle technology, building the nuclear power plant and necessity for the generating capacity regulation in compliance with the load diagram. With the country’s economic complex energy utilization pattern being preserved, the generating capacities are subject to restructuring and the CHP characteristics undergo enhancement inter alia a well-known increase of the specific electricity production based on the heat consumption. Because of this the steam-turbine condensation units which are the traditional capacity regulators for the energy systems with heat power plants dominance are being pushed out of operation. In consequence of this complex of changes the issue of load diagram provision gains momentum which in evidence is relevant to the Consolidated Energy System of Belarus. One of the ways to alleviate acuteness of the problem could be the specific electric energy production cut on the CHP heat consumption with preserving the heat loads and without their handover to the heat generating capacities of direct combustion i.e. without fuel over-burning. The solution lies in integrating the absorption bromous-lithium heat pump units into the CHP thermal scheme. Through their agency low-temperature heat streams of the generator cooling, the lubrication and condensation heat-extraction of steam minimal passing to the condenser systems are utilized. As a case study the authors choose one of the CHPs in the conditions of which the corresponding employment of the said pumps leads to diminution of the fuel-equivalent specific flow-rate by 20−25 g for 1 kW⋅h production and conjoined electric energy generation capacity lowering. The latter will be handed over to other generating capacities, and the choice of them affects economic expediency of the absorption bromous-lithium heat pump-units installation

  4. Optimizing oil recovery in the Wasson Denver unit

    Energy Technology Data Exchange (ETDEWEB)

    Mayfield, G.B.

    1973-12-01

    Optimizing oil recovery has been a combined effort of many engineering disciplines in the Shell-operated Denver unit of the Wasson San Andres field of Gaines and Yoakum counties, Texas. Rising market demand and increased oil allowables provided the impetus for full-scale infill drilling, major injection system expansion and active remedial efforts. Maintaining high producing and injection efficiency required concentrated production engineering and field operations' work. Areas of specific activity are well completions, the injection system, flood surveillance, and workovers. The Denver unit is the largest of 5 waterflood pressure maintenance projects in this field discovered in 1936. The unit currently contains 664 oil producing wells and 238 water injection wells. Production is from the Permian San Andres dolomite formation at an average total depth of 5,200 ft. Gross pay thickness is from 300 to 500 ft. Production and performance curves are shown. A graphical representation shows the completion and acid treatment program for producers and injection well to maximize oil recovery.

  5. CHP as a Boiler Replacement Opportunity (Webinar) – April 30, 2013

    Science.gov (United States)

    This webinar provides information about the benefits of replacing a boiler with a CHP system, describes CHP project analysis and delivery processes, and highlights a case study at Penn State University.

  6. A Study of a Diesel Engine Based Micro-CHP System

    Energy Technology Data Exchange (ETDEWEB)

    Krishna, C.R.; Andrews, J.; Tutu, N.; Butcher, T.

    2010-08-31

    systems instead of the conventional heating system, and analyze system approaches for interaction with the local electric utility. The primary energy savings between the space heating provided by a conventional space heating system with all the required electrical energy supplied by the grid and the micro-CHP system supplemented when needed by a conventional space heating and the grid supplied electricity. were calculated for two locations namely Long Island and Albany. The key results from the experimental work are summarized first and the results from the analytical work next. Experimental results: (1) The engine could be operated successfully in the normal and HCCI modes using both diesel and biodiesel blends. (2) The smoke levels are lower with biodiesel than with diesel in both modes of operation. (3) The NOx levels are lower with the HCCI mode of operation than with the normal mode for both fuels. (4) The engine efficiency in these tests is lower in the HCCI mode of operation. However, the system parameters were not optimized for such operation within the scope of this project. However, for an engine designed with such operation in mind, the efficiency would possibly be not lower. Analytical results: (1) The internal combustion engine (diesel engine in this case) is the only proven technology as a prime mover at present. However, as noted above, no U.S. engine is available at present. (2) For both locations, the use of a micro-CHP system results in primary energy savings. This is true whether the CHP system is used only to supply domestic hot water or to supply both hot water and space heat and even for a low efficiency system especially for the latter case. The size of the thermal storage (as long as it above a certain minimum) did not affect this. (3) For example, for a 2 kW CHP electrical efficiency of 25%, a typical house on Long Island will save about 30MBtu of energy per year for a combined space heat and domestic hot water system. This corresponds to annual

  7. Parallel particle swarm optimization on a graphics processing unit with application to trajectory optimization

    Science.gov (United States)

    Wu, Q.; Xiong, F.; Wang, F.; Xiong, Y.

    2016-10-01

    In order to reduce the computational time, a fully parallel implementation of the particle swarm optimization (PSO) algorithm on a graphics processing unit (GPU) is presented. Instead of being executed on the central processing unit (CPU) sequentially, PSO is executed in parallel via the GPU on the compute unified device architecture (CUDA) platform. The processes of fitness evaluation, updating of velocity and position of all particles are all parallelized and introduced in detail. Comparative studies on the optimization of four benchmark functions and a trajectory optimization problem are conducted by running PSO on the GPU (GPU-PSO) and CPU (CPU-PSO). The impact of design dimension, number of particles and size of the thread-block in the GPU and their interactions on the computational time is investigated. The results show that the computational time of the developed GPU-PSO is much shorter than that of CPU-PSO, with comparable accuracy, which demonstrates the remarkable speed-up capability of GPU-PSO.

  8. Is there enough primary forest fuel available to feed into the existing and planned CHP facilities? The case of Northern Sweden

    Energy Technology Data Exchange (ETDEWEB)

    Athanassiadis, D.; Lundstroem, A.; Wikstroem, P.; Matisons, M.; Nordfjell, T. (Swedish Univ. of Agricultural Sciences, Umeaa (Sweden), Dept. of Forest Resource Management), e-mail: dimitris.athanassiadis@srh.slu.se, e-mail: anders.lundstom@srh.slu.se

    2010-07-01

    A combined GIS and optimization method was used to calculate logging residue (slash and stumps) flows and expected costs at the heating or combined heat and power plants (CHP) in Northern Sweden for two logging residue supply chains. Regional primary forest energy availability was estimated considering ecological, technical and economical restrictions. Two supply chains were considered: One supply chain was based on truck transport of the fuel to the CHP plants and the other one was based on collecting the fuel to terminals adjacent to railway lines and transporting it by train to plants that are located in Central Sweden. The costs for each supply chain were calculated based on current costs for harvesting, forwarding, chipping/crushing, machine allocation to the harvesting site, road transport, compensation to the land owner and administration. The lowest cost pathway to the plants was selected. The effects of the establishment of the CHP plants on regional development are discussed. (orig.)

  9. Geographic information system (GIS) simulation of emergency power production from disaster debris in a combined heat and power (CHP) system

    Science.gov (United States)

    Ryals, Christopher Shannon

    The objective of this study is to determine a predicted energy capacity of disaster debris for the production of emergency power using a combined heat and power (CHP) unit. A prediction simulation using geographic information systems (GIS) will use data from past storms to calculate an estimated amount of debris along with an estimated energy potential of said debris. Rather than the expense and burden of transporting woody debris such as downed trees and wood framing materials offsite, they can be processed (sorting and chipping) to provide an onsite energy source to provide power to emergency management facilities such as shelters in schools and hospitals. A CHP unit can simultaneously produce heat, cooling effects and electrical power using various biomass sources. This study surveys the quantity and composition of debris produced for a given classification of disaster and location. A comparison of power efficiency estimates for various disasters is conducted.

  10. Local CHP Plants between the Natural Gas and Electricity Systems

    DEFF Research Database (Denmark)

    Bregnbæk, Lars; Schaumburg-Müller, Camilla

    2005-01-01

    , and they contribute significantly to the electricity production. CHP is, together with the wind power, the almost exclusive distributed generation in Denmark. This paper deals with the CHP as intermediary between the natural gas system and the electricity system. In particular, the relationship between the peak hour...... characteristics of the electricity and gas systems will be investigated. The point is here that the two systems will tend to have peak demand during the same hours. This is the typical situation, since load is high during the same hours of the day and of the year. Moreover, the random variations in the load...... will be correlated between the systems, because both demands in part depend on the climate. The analysis in the paper is based on a numerical model which simulates the operation of a CHP plant with heat storage. The conditions for the operation of the plant are assumed to be consistent with the conditions...

  11. Optimal physicians schedule in an Intensive Care Unit

    Science.gov (United States)

    Hidri, L.; Labidi, M.

    2016-05-01

    In this paper, we consider a case study for the problem of physicians scheduling in an Intensive Care Unit (ICU). The objective is to minimize the total overtime under complex constraints. The considered ICU is composed of three buildings and the physicians are divided accordingly into six teams. The workload is assigned to each team under a set of constraints. The studied problem is composed of two simultaneous phases: composing teams and assigning the workload to each one of them. This constitutes an additional major hardness compared to the two phase's process: composing teams and after that assigning the workload. The physicians schedule in this ICU is used to be done manually each month. In this work, the studied physician scheduling problem is formulated as an integer linear program and solved optimally using state of the art software. The preliminary experimental results show that 50% of the overtime can be saved.

  12. Development of next generation micro-CHP system: Based on high temperature proton exchange membrane fuel cell technology

    Energy Technology Data Exchange (ETDEWEB)

    Arsalis, A.

    2012-01-15

    Novel proposals for the modeling and operation of a micro-CHP (combined-heat-and-power) residential system based on HT-PEMFC (High Temperature-Proton Exchange Membrane Fuel Cell) technology are described and analyzed to investigate the technical feasibility of such systems. The proposed systems must provide electricity, hot water, and space heating for an average single-family household in Denmark. A complete fuel processing subsystem, with all necessary BOP (balance-of-plant) components, is modeled and coupled to the fuel cell stack subsystem. The research project is divided into five main study topics: (a) Modeling, simulation and validation of the system in LabVIEW environment to provide the ability of Data Acquisition of actual components, and thereby more realistic design in the future; (b) Modeling, parametric study, and sensitivity analysis of the system in EES (Engineering Equation Solver). The parametric study is conducted to determine the most viable system/component design based on maximizing total system efficiency; (c) An improved operational strategy is formulated and applied in an attempt to minimize operational implications, experienced when using conventional operational strategies; (d) Application of a GA (Genetic Algorithm) optimization strategy. The objective function of the single-objective optimization strategy is the net electrical efficiency of the micro-CHP system. The implemented optimization procedure attempts to maximize the objective function by variation of nine decision variables; (e) The micro-CHP system is optimized by formulating and applying a process integration methodology. The methodology involves system optimization targeting in net electrical efficiency maximization. Subsequently a MINLP (Mixed Integer Non-Linear Programming) problem optimization strategy is applied to minimize the annual cost of the HEN (Heat Exchanger Network). The results obtained throughout this research work indicate the high potential of the proposed

  13. CHP REGIONAL APPLICATION CENTERS: ACTIVITIES AND SELECTED RESULTS

    Energy Technology Data Exchange (ETDEWEB)

    Schweitzer, Martin [ORNL

    2010-08-01

    Between 2001 and 2005, the U.S. Department of Energy (DOE) created a set of eight Regional Application Centers (RACs) to facilitate the development and deployment of Combined Heat and Power (CHP) technologies. By utilizing the thermal energy that is normally wasted when electricity is produced at central generating stations, Combined Heat and Power installations can save substantial amounts of energy compared to more traditional technologies. In addition, the location of CHP facilities at or near the point of consumption greatly reduces or eliminates electric transmission and distribution losses. The regional nature of the RACs allows each one to design and provide services that are most relevant to the specific economic and market conditions in its particular geographic area. Between them, the eight RACs provide services to all 50 states and the District of Columbia. Through the end of the federal 2009 fiscal year (FY 2009), the primary focus of the RACs was on providing CHP-related information to targeted markets, encouraging the creation and adoption of public policies and incentives favorable to CHP, and providing CHP users and prospective users with technical assistance and support on specific projects. Beginning with the 2010 fiscal year, the focus of the regional centers broadened to include district energy and waste heat recovery and these entities became formally known as Clean Energy Application Centers, as required by the Energy Independence and Security Act (EISA) of 2007. In 2007, ORNL led a cooperative effort to establish metrics to quantify the RACs accomplishments. That effort began with the development of a detailed logic model describing RAC operations and outcomes, which provided a basis for identifying important activities and accomplishments to track. A data collection spreadsheet soliciting information on those activities for FY 2008 and all previous years of RAC operations was developed and sent to the RACs in the summer of 2008. This

  14. Energie-Cites opinion on the directive project of CHP. To meet urban energy requirements with optimal energy efficiency and production closer to residents; Avis d'Energie-Cites sur le project de directive cogeneration. Satisfaire les besoins energetiques urbains avec la meilleure efficacite energetique et une production plus proche des habitants

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2003-01-01

    The Directive on ''the promotion of cogeneration based on a useful heat demand in the internal energy market'' should be adopted very soon. The initial aim of the Directive is to strengthen existing measures to promote CHP in line with the Community target of doubling the share of CHP in EU electricity generation from 9% in 1994 to 18% by 2010. But no target has been mentioned. Energie-Cites states, in this document, its opinion of this draft proposal. Cogeneration is a well-tried and proven technology which has achieved tangible results and is one of the more efficient ways for the EU to fulfill the commitments it made under the Kyoto Protocol. (A.L.B.)

  15. Toxin-antitoxin loci as stress-response-elements: ChpAK/MazF and ChpBK cleave translated RNAs and are counteracted by tmRNA

    DEFF Research Database (Denmark)

    Christensen, S.K.; Pedersen, K.; Hansen, Flemming G.

    2003-01-01

    Prokaryotic chromosomes encode toxin-antitoxin loci, often in multiple copies. In most cases, the function of these genes is not known. The chpA (mazEF) locus of Escherichia coli has been described as a cell killing module that induces bacterial apoptosis during nutritional stress. However, we...... found recently that ChpAK (MazF) does not confer cell killing but rather, induces a bacteriostatic condition from which the cells could be resuscitated. Results presented here yield a mechanistic explanation for the detrimental effect on cell growth exerted by ChpAK and the homologous ChpBK protein of E......AK cleaved tmRNA in its coding region. Thus, ChpAK and ChpBK inhibit translation by a mechanism very similar to that of E. coli RelE. On the basis of these results, we propose a model that integrates TA loci into general prokaryotic stress physiology....

  16. IVO`s CHP know-how: experience, inventions, patents

    Energy Technology Data Exchange (ETDEWEB)

    Aeijaelae, M.; Ohtonen, V. [ed.

    1997-11-01

    IVO can justly claim mastery in the co-generation of district heat and electricity - CHP. As well as looking at the issue from the viewpoint of planners, builders and operators, IVO`s engineers also view power plants through the eyes of the product developer and inventor. This approach has resulted in successful power plant configurations, inventions and patents and visions

  17. (CHP)-enriched yeast hydrolysate in streptozotocin-induced diabetic

    African Journals Online (AJOL)

    Lee hyun jung

    2013-08-28

    Aug 28, 2013 ... disorder therapy. In the previous study (Jung et al., 2011), we increased the CHP content in the YH that was obtained from enzymatic hydrolysis and briefly assessed ... (OGTT) in a type 1 diabetic animal model. The purpose of this study ... cient number of islet beta cells to be a model of type 1 diabetes with.

  18. Biomass gasification with CHP production: A review of state of the art technology and near future perspectives

    Directory of Open Access Journals (Sweden)

    Jankes Goran G.

    2012-01-01

    Full Text Available This paper is a review of the state of the art of biomass gasification and the future of using biomass in Serbia and it presents researches within the project “The Development of a CHP Plant with Biomass Gasification”. The concept of downdraft demonstration unit coupled with gas engine is adopted. Downdraft fixed-bed gasification is generally favored for CHP, owing to the simple and reliable gasifiers and low content of tar and dust in produced gas. The composition and quantity of gas and the amount of air are defined by modeling biomass residues gasification process. The gas (290-400m3/h for 0.5- 0.7MW biomass input obtained by gasification at 800oC with air at atmospheric pressure contains 14% H2, 27% CO, 9% CO2, 2% CH4, and 48% N2, and its net heating value is 4.8-6 MJ/Nm3. The expected gasifier efficiency is up to 80%. The review of the work on biomass gasification has shown that the development of technology has reached the mature stage. There are CHP plants with biomass gasification operating as demonstration plants and several gasification demonstration units are successfully oriented to biofuel production. No attempt has been made here to address the economic feasibility of the system. Economics will be the part of a later work as firmer data are acquired.

  19. Optimal Scheduling of a Multi-Carrier Energy Hub Supplemented By Battery Energy Storage Systems

    DEFF Research Database (Denmark)

    Javadi, Mohammad Sadegh; Anvari-Moghaddam, Amjad; Guerrero, Josep M.

    2017-01-01

    This paper introduces a management model for optimal scheduling of a multi-carrier energy hub. In the proposed hub, three types of assets are considered: dispersed generating systems (DGs) such as micro-combined heat and power (mCHP) units, storage devices such as battery-based electrical storage...... systems (ESSs), and heating/cooling devices such as electrical heater, heat-pumps and absorption chillers. The optimal scheduling and management of the examined energy hub assets in line with electrical transactions with distribution network is modeled as a mixed-integer non-linear optimization problem...

  20. Advanced CHP Control Algorithms: Scope Specification

    Energy Technology Data Exchange (ETDEWEB)

    Katipamula, Srinivas; Brambley, Michael R.

    2006-04-28

    The primary objective of this multiyear project is to develop algorithms for combined heat and power systems to ensure optimal performance, increase reliability, and lead to the goal of clean, efficient, reliable and affordable next generation energy systems.

  1. 75 FR 39437 - Optimizing the Security of Biological Select Agents and Toxins in the United States

    Science.gov (United States)

    2010-07-08

    ... Services and Agriculture shall, through their ongoing review of the biological Select Agents and Toxins... Executive Order 13546--Optimizing the Security of Biological Select Agents and Toxins in the United States... July 2, 2010 Optimizing the Security of Biological Select Agents and Toxins in the United States By the...

  2. Study on the Effect of the Separating Unit Optimization on the Economy of Stable Isotope Separation

    Directory of Open Access Journals (Sweden)

    YANG Kun

    2015-01-01

    Full Text Available An economic criterion called as yearly net profit of single separating unit (YNPSSU was presented to evaluate the influence of structure optimization on the economy. Using YNPSSU as a criterion, economic analysis was carried out for the structure optimization of separating unit in the case of separating SiF4 to obtain the 28Si and 29Si isotope. YNPSSU was calculated and compared with that before optimization. The results showed that YNPSSU was increased by 12.3% by the structure optimization. Therefore, the structure optimization could increase the economy of the stable isotope separation effectively.

  3. Load scheduling for decentralized CHP plants

    DEFF Research Database (Denmark)

    Nielsen, Henrik Aalborg, orlov 31.07.2008; Madsen, Henrik; Nielsen, Torben Skov

    .91) the calculations can be performed quickly enough to allow use to be applicable in practice. One optimal schedule covering one week can easily be found within 5 to 10 seconds. When considering many possible realizations of the future heat demand some techniques are needed to reduce the amount of CPU time required....... The results indicate that it is possible to find optimal schedules for 100 realizations of heat demand using less than 3 minutes of CPU time. Furthermore, the methods allow for massive use of parallel processing....

  4. Reactive power control with CHP plants - A demonstration

    DEFF Research Database (Denmark)

    Nyeng, Preben; Østergaard, Jacob; Andersen, Claus A.

    2010-01-01

    power rating of 7.3 MW on two synchronous generators. A closed-loop control is implemented, that remote controls the CHP plant to achieve a certain reactive power flow in a near-by substation. The solution communicates with the grid operator’s existing SCADA system to obtain measurements from......In this project the potential for ancillary services provision by distributed energy resources is investigated. Specifically, the provision of reactive power control by combined heat and power plants is examined, and the application of the new standard for DER communication systems, IEC 61850...... lines to underground cables has changed the reactive power balance, and third, the TSO has introduced restrictions in the allowed exchange of reactive power between the transmission system and distribution grids (known as the Mvar-arrangement). The demonstration includes a CHP plant with an electric...

  5. Optimized 4-bit Quantum Reversible Arithmetic Logic Unit

    Science.gov (United States)

    Ayyoub, Slimani; Achour, Benslama

    2017-08-01

    Reversible logic has received a great attention in the recent years due to its ability to reduce the power dissipation. The main purposes of designing reversible logic are to decrease quantum cost, depth of the circuits and the number of garbage outputs. The arithmetic logic unit (ALU) is an important part of central processing unit (CPU) as the execution unit. This paper presents a complete design of a new reversible arithmetic logic unit (ALU) that can be part of a programmable reversible computing device such as a quantum computer. The proposed ALU based on a reversible low power control unit and small performance parameters full adder named double Peres gates. The presented ALU can produce the largest number (28) of arithmetic and logic functions and have the smallest number of quantum cost and delay compared with existing designs.

  6. Optimization methods for the Train Unit Shunting Problem

    DEFF Research Database (Denmark)

    Haahr, Jørgen Thorlund; Lusby, Richard Martin; Wagenaar, Joris Camiel

    2017-01-01

    We consider the Train Unit Shunting Problem, an important planning problem for passenger railway operators. This problem entails assigning train units from shunting yards to scheduled train services in such a way that the resulting operations are without conflicts. The problem arises at every...... shunting yard in the railway network and involves matching train units to arriving and departing train services as well as assigning the selected matchings to appropriate shunting yard tracks. We present an extensive comparison benchmark of multiple solution approaches for this problem, some of which...

  7. The effectiveness of heat pumps as part of CCGT-190/220 Tyumen CHP-1

    Directory of Open Access Journals (Sweden)

    Tretyakova Polina

    2017-01-01

    Full Text Available The article considers the possibility of increasing the energy efficiency of CCGT-190/220 Tyumen CHP-1 due to the utilization of low-grade heat given off in the condenser unit of the steam turbine. To assess the effectiveness of the proposed system, the indexes of thermal efficiency are given. As a result of a research the following conclusions are received: The heat-transfer agent heat pump, when heated uses low-grade heat TPP and increases heat output, but consumes the electricity. Using a heat pump is effective for a small temperature difference between the condenser and the evaporator. Good example is heating water before chemical treatment. This method is more efficient than using a replacement boiler and it is used in steam selection.

  8. Optimal Placement of Phasor Measurement Units with New Considerations

    DEFF Research Database (Denmark)

    Su, Chi; Chen, Zhe

    2010-01-01

    of these factors is taken into account in the proposed PMU placement method in this paper, which is the number of adjacent branches to the PMU located buses. The concept of full topological observability is adopted and a version of binary particle swarm optimization (PSO) algorithm is utilized. Results from...

  9. Optimal Location of Marine Forces Reserve Units by Demographics

    Science.gov (United States)

    2014-06-01

    DEMOGRAPHICS Paul M. Brisker Captain, United States Marine Corps B.S., Ohio State University, 2004 Submitted in partial fulfillment of the...Pensacola, FL a28 Huntsville, AL a29 Hunter Army Airfield/Savannah, GA Joint Base Charleston, SC North Charleston, SC a30 Augusta, GA Marietta /Smyrna

  10. EPA's Air Quality Rules for Reciprocating Internal Combustion Engines (RICE) and their Application to CHP (Webinar) – June 24, 2014

    Science.gov (United States)

    This webinar discusses the effect of EPA's air quality regulations on CHP facilities and stationary RICE, and describes how CHP systems can comply with air quality regulations by using stationary RICE.

  11. Characterization of ultrafine and fine particles from CHP Plants

    Energy Technology Data Exchange (ETDEWEB)

    2009-08-15

    Samples of particles collected at CHP plants in the project 'Survey of emissions from CHP Plants' have been analysed in this project to give information on the morphology and chemical composition of individual particle size classes. The objective of this project was to characterize ultrafine and fine particles emitted to the atmosphere from Danish CHP plants. Nine CHP plants were selected in the Emission Survey Project as being representative for the different types of CHP plants operating in Denmark: 1) Three Waste-to Energy (WTE) plants. 2) Three biomass fired (BM) plants (two straw fired, one wood/saw dust fired). 3) Two gas fired (GF) plants (one natural gas, one landfill gas fired). 4) One gasoil (GO) fired plant. At the WTE and BM plants, various types of emission control systems implemented. The results from these plants represent the composition and size distribution of combustion particles that are emitted from the plants emission control systems. The measured emissions of particles from the waste-to-energy plants WTE1-3 are generally very low. The number and mass concentrations of ultrafine particles (PM{sub 0.1}) were particularly low in the flue gas from WTE2 and WTE3, where bag filters are used for the reduction of particle emissions. The EDX analysis of particles from the WTE plants indicates that the PM{sub 0.1} that penetrates the ECS at WTE can contain high fractions of metals such as Fe, Mn and Cu. The SEM analysis of particles from WTE1-3 showed that the particles were generally porous and irregular in shape. The concentrations of particles in the flue gas from the biomass plants were generally higher than found for the WTE plants. The time series results showed that periodical, high concentration peaks of PM emissions occur from BM1 and BM2. The chemical composition of the particles emitted from the three biomass plants is generally dominated by C, O and S, and to some extend also Fe and Si. A high amount of Cu was found in selected

  12. A MATHEMATICAL MODEL OF CHP 2000 TYPE PROGRESSIVE GEAR

    Directory of Open Access Journals (Sweden)

    Paweł Lonkwic

    2016-12-01

    Full Text Available The project of CHP2000 type progressive gear has been presented in the article. The offered solution from its construction point of view differs from the existing solutions due to the application of Belleville springs packets supporting the braking roller cam and achieving a flexible range of the gear loading. The standard concept of the gear loading within a mathematical and a geometrical model has been presented in the article. The proposed solution can be used in the friction lifts with the loading capacity from 8500 up to 20000 N.

  13. 76 FR 5832 - International Business Machines (IBM), Software Group Business Unit, Optim Data Studio Tools QA...

    Science.gov (United States)

    2011-02-02

    ... Employment and Training Administration International Business Machines (IBM), Software Group Business Unit... at International Business Machines (IBM), Software Group Business Unit, Optim Data Studio Tools QA... IBM employees working on the relevant product within the Data Studio Tools QA on a part-time basis and...

  14. Some optimal partial-unit-memory codes. [time-invariant binary convolutional codes

    Science.gov (United States)

    Lauer, G. S.

    1979-01-01

    A class of time-invariant binary convolutional codes is defined, called partial-unit-memory codes. These codes are optimal in the sense of having maximum free distance for given values of R, k (the number of encoder inputs), and mu (the number of encoder memory cells). Optimal codes are given for rates R = 1/4, 1/3, 1/2, and 2/3, with mu not greater than 4 and k not greater than mu + 3, whenever such a code is better than previously known codes. An infinite class of optimal partial-unit-memory codes is also constructed based on equidistant block codes.

  15. PORFLOW Simulations Supporting Saltstone Disposal Unit Design Optimization

    Energy Technology Data Exchange (ETDEWEB)

    Flach, G. P. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Hang, T. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Taylor, G. A. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)

    2015-12-10

    SRNL was requested by SRR to perform PORFLOW simulations to support potential cost-saving design modifications to future Saltstone Disposal Units in Z-Area (SRR-CWDA-2015-00120). The design sensitivity cases are defined in a modeling input specification document SRR-CWDA-2015-00133 Rev. 1. A high-level description of PORFLOW modeling and interpretation of results are provided in SRR-CWDA-2015-00169. The present report focuses on underlying technical issues and details of PORFLOW modeling not addressed by the input specification and results interpretation documents. Design checking of PORFLOW modeling is documented in SRNL-L3200-2015-00146.

  16. CONTROL OPTIMIZATION OF WIND UNIT WITH HELICOID VERTICALLY AXIAL WINDMILL AND SYNCHRONOUS MAGNETO-ELECTRIC GENERATOR

    Directory of Open Access Journals (Sweden)

    М. М. Оlеshkеvich

    2005-01-01

    Full Text Available The paper considers a helicoid vertically axial windmill geared to synchronous magneto-electric generator which operates for a power system or an independent resistive load. In order to optimize operational modes of a wind power unit a mathematical model and software have been developed and a number of calculative experiments have been carried out. The obtained law of wind unit control makes it possible to ensure maximum power output and stability in a wind unit operation.

  17. Operational Optimization of Large-Scale Parallel-Unit SWRO Desalination Plant Using Differential Evolution Algorithm

    Science.gov (United States)

    Wang, Xiaolong; Jiang, Aipeng; Jiangzhou, Shu; Li, Ping

    2014-01-01

    A large-scale parallel-unit seawater reverse osmosis desalination plant contains many reverse osmosis (RO) units. If the operating conditions change, these RO units will not work at the optimal design points which are computed before the plant is built. The operational optimization problem (OOP) of the plant is to find out a scheduling of operation to minimize the total running cost when the change happens. In this paper, the OOP is modelled as a mixed-integer nonlinear programming problem. A two-stage differential evolution algorithm is proposed to solve this OOP. Experimental results show that the proposed method is satisfactory in solution quality. PMID:24701180

  18. Optimal Solutions for Load Sharing between Units of a Combined Heat and Power Plant

    Directory of Open Access Journals (Sweden)

    Shchinnikov P. A.

    2017-12-01

    Full Text Available The article presents the optimization method of load division between combined heat and power plant units. The method used the power unit division into functioning parts and the differential-exergy method. This method allowed presenting the unit as a structural diagram where exergetic subsystems are fuel supply, steam generator, turbine, generator and electrical equipment, water supply and regeneration, heat supply to the consumer. The differential-exergy method was based on a combination of exergy analysis and optimization method of economic efficiency criteria using uncertain Lagrange multipliers. The use of the exergy function of goal allowed avoiding the problem of division of fuel costs for each type of product that was important at optimization. The optimization criterion, its parameters and limitations were developed as well. These parameters can extend traditional technical and economic analysis of the combined heat and power plants operating mode, as they take into account thermodynamically rigorous division of fuel costs between heat and electric power at their complex production on the combined heat and power plants. The use of the differential-exergy method in optimizing the load distribution of the power units of the combined heat and power plants makes possible obtaining of fuel savings of 1.5 to 3%. It has been shown that if the parameters of power units deteriorate, the application of the method makes it possible to have the best performance of the power plant when it is compared with functioning of combined heat and power units at proportional loading.

  19. Optimized Laplacian image sharpening algorithm based on graphic processing unit

    Science.gov (United States)

    Ma, Tinghuai; Li, Lu; Ji, Sai; Wang, Xin; Tian, Yuan; Al-Dhelaan, Abdullah; Al-Rodhaan, Mznah

    2014-12-01

    In classical Laplacian image sharpening, all pixels are processed one by one, which leads to large amount of computation. Traditional Laplacian sharpening processed on CPU is considerably time-consuming especially for those large pictures. In this paper, we propose a parallel implementation of Laplacian sharpening based on Compute Unified Device Architecture (CUDA), which is a computing platform of Graphic Processing Units (GPU), and analyze the impact of picture size on performance and the relationship between the processing time of between data transfer time and parallel computing time. Further, according to different features of different memory, an improved scheme of our method is developed, which exploits shared memory in GPU instead of global memory and further increases the efficiency. Experimental results prove that two novel algorithms outperform traditional consequentially method based on OpenCV in the aspect of computing speed.

  20. Optimized heat exchanger unit in a thermoacoustic refrigerator

    Science.gov (United States)

    El-Fawal, Mawahib Hassan; Mohd-Ghazali, Normah

    2012-06-01

    Due to concern over the environmental impact caused by hazardous refrigerants, the last ten years or so has seen increasing research into thermoacoustic refrigeration. A thermoacoustic refrigerator is a device which uses acoustic power to pump heat. It holds the merits of simple mechanical design, absence of harmful refrigerants and having no or few moving parts. However, the performance of the thermoacoustic refrigerator, particularly the standing wave types, is currently not competitive compared to its counterpart conventional vapor-compression refrigerator. Thermoacoustic refrigeration prototypes, built up-to-date, achieved 0.1-0.2 relative coefficient of performance (COPR) compared with that of 0.33-0.5 for the conventional vapor-compression refrigerators. The poor heat exchanger design is one of the reasons for this poor efficiency. This paper discussed the influence of the thermoacoustic refrigerator heat exchanger's parameters on its design and the optimization of the performance of the system using the Lagrange multiplier method. The results showed that, the dissipated power is less than the published value by about 49% in the cold heat exchanger and about 38.5% in the hot heat exchanger. Furthermore, the increase of the cold heat exchanger effectiveness is found to be 3%. Thus, the decrease in the dissipated power in both heat exchangers with effective cold heat exchanger increases the performance of the thermoacoustic refrigerator.

  1. Optimal Role of the Nephrologist in the Intensive Care Unit.

    Science.gov (United States)

    Askenazi, D J; Heung, Michael; Connor, Michael J; Basu, Rajit K; Cerdá, Jorge; Doi, Kent; Koyner, Jay L; Bihorac, Azra; Golestaneh, Ladan; Vijayan, Anitha; Okusa, Mark D; Faubel, Sarah

    2017-01-01

    As advances in Critical Care Medicine continue, critically ill patients are surviving despite the severity of their illness. The incidence of acute kidney injury (AKI) has increased, and its impact on clinical outcomes as well as medical expenditures has been established. The role, indications and technological advancements of renal replacement therapy (RRT) have evolved, allowing more effective therapies with less complications. With these changes, Critical Care Nephrology has become an established specialty, and ongoing collaborations between critical care physicians and nephrologist have improved education of multi-disciplinary team members and patient care in the ICU. Multidisciplinary programs to support these changes have been stablished in some hospitals to maximize the delivery of care, while other programs have continue to struggle in their ability to acquire the necessary resources to maximize outcomes, educate their staff, and develop quality initiatives to evaluate and drive improvements. Clearly, the role of the nephrologist in the ICU has evolved, and varies widely among institutions. This special article will provide insights that will hopefully optimize the role of the nephrologist as the leader of the acute care nephrology program, as clinician for critically ill patients, and as teacher for all members of the health care team. © 2016 S. Karger AG, Basel.

  2. Optimization of Fuel Consumption and Emissions for Auxiliary Power Unit Based on Multi-Objective Optimization Model

    Directory of Open Access Journals (Sweden)

    Yongpeng Shen

    2016-02-01

    Full Text Available Auxiliary power units (APUs are widely used for electric power generation in various types of electric vehicles, improvements in fuel economy and emissions of these vehicles directly depend on the operating point of the APUs. In order to balance the conflicting goals of fuel consumption and emissions reduction in the process of operating point choice, the APU operating point optimization problem is formulated as a constrained multi-objective optimization problem (CMOP firstly. The four competing objectives of this CMOP are fuel-electricity conversion cost, hydrocarbon (HC emissions, carbon monoxide (CO emissions and nitric oxide (NO x emissions. Then, the multi-objective particle swarm optimization (MOPSO algorithm and weighted metric decision making method are employed to solve the APU operating point multi-objective optimization model. Finally, bench experiments under New European driving cycle (NEDC, Federal test procedure (FTP and high way fuel economy test (HWFET driving cycles show that, compared with the results of the traditional fuel consumption single-objective optimization approach, the proposed multi-objective optimization approach shows significant improvements in emissions performance, at the expense of a slight drop in fuel efficiency.

  3. Optimal dental age estimation practice in United Arab Emirates' children.

    Science.gov (United States)

    Altalie, Salem; Thevissen, Patrick; Fieuws, Steffen; Willems, Guy

    2014-03-01

    The aim of the study was to detect whether the Willems model, developed on a Belgian reference sample, can be used for age estimations in United Arab Emirates (UAE) children. Furthermore, it was verified that if added third molars development information in children provided more accurate age predictions. On 1900 panoramic radiographs, the development of left mandibular permanent teeth (PT) and third molars (TM) was registered according the Demirjian and the Kohler technique, respectively. The PT data were used to verify the Willems model and to develop a UAE model and to verify it. Multiple regression models with PT, TM, and PT + TM scores as independent and age as dependent factor were developed. Comparing the verified Willems- and the UAE model revealed differences in mean error of -0.01 year, mean absolute error of 0.01 year and root mean squared error of 0.90 year. Neglectable overall decrease in RMSE was detected combining PM and TM developmental information. © 2013 American Academy of Forensic Sciences.

  4. Optimal Capacity Allocation of Large-Scale Wind-PV-Battery Units

    Directory of Open Access Journals (Sweden)

    Kehe Wu

    2014-01-01

    Full Text Available An optimal capacity allocation of large-scale wind-photovoltaic- (PV- battery units was proposed. First, an output power model was established according to meteorological conditions. Then, a wind-PV-battery unit was connected to the power grid as a power-generation unit with a rated capacity under a fixed coordinated operation strategy. Second, the utilization rate of renewable energy sources and maximum wind-PV complementation was considered and the objective function of full life cycle-net present cost (NPC was calculated through hybrid iteration/adaptive hybrid genetic algorithm (HIAGA. The optimal capacity ratio among wind generator, PV array, and battery device also was calculated simultaneously. A simulation was conducted based on the wind-PV-battery unit in Zhangbei, China. Results showed that a wind-PV-battery unit could effectively minimize the NPC of power-generation units under a stable grid-connected operation. Finally, the sensitivity analysis of the wind-PV-battery unit demonstrated that the optimization result was closely related to potential wind-solar resources and government support. Regions with rich wind resources and a reasonable government energy policy could improve the economic efficiency of their power-generation units.

  5. Energy-Exergy, Environmental and Economic Criteria in Combined Heat and Power (CHP Plants: Indexes for the Evaluation of the Cogeneration Potential

    Directory of Open Access Journals (Sweden)

    Marco F. Torchio

    2013-05-01

    Full Text Available In the first part of this work, combined heat and power (CHP criteria pertaining to energy, exergy, environmental (pollutant emission and economic aspects, have been investigated and compared. Although the constraints in legislation usually refer to energy efficiency, primary energy savings and greenhouse gas savings, other criteria should also be taken into account in order to obtain a better evaluation of a cogeneration plant. Here particular attention has been paid to saving indexes for both an individual CHP-unit and for a CHP-system, that is the complete system with all the cogeneration units and the auxiliary plants necessary to cover the users’ demand. Five indexes, named potential indexes, have been introduced to evaluate the cogeneration potential: one for energy saving, one for exergy, two for environmental aspects (global and local scale and one for economic aspects. Finally, some indexes analysed in the paper have been applied to a case study concerning a district heating cogeneration system, and the different behaviour of the energy-exergy, environmental and economic aspects has been discussed.

  6. The Association between Optimism and Serum Antioxidants in the Midlife in the United States Study

    Science.gov (United States)

    Boehm, Julia K.; Williams, David R.; Rimm, Eric B.; Ryff, Carol; Kubzansky, Laura D.

    2012-01-01

    Objective Psychological and physical health are often conceptualized as the absence of disease, but less research addresses positive psychological and physical functioning. For example, optimism has been linked with reduced disease risk and biological dysfunction, but very little research has examined associations with markers of healthy biological functioning. Thus, we investigated the association between two indicators of positive health: optimism and serum antioxidants. Methods The cross-sectional association between optimism and antioxidant concentrations was examined in 982 men and women from the Midlife in the United States study. Primary measures included self-reported optimism (assessed with the revised Life Orientation Test) and serum concentrations of nine different antioxidants (carotenoids and Vitamin E). Regression analyses examined the relationship between optimism and antioxidant concentrations in models adjusted for demographics, health status, and health behaviors. Results For every standard deviation increase in optimism, carotenoid concentrations increased by 3–13% in age-adjusted models. Controlling for demographic characteristics and health status attenuated this association. Fruit and vegetable consumption and smoking status were identified as potential pathways underlying the association between optimism and serum carotenoids. Optimism was not significantly associated with Vitamin E. Conclusions Optimism was associated with greater carotenoid concentrations and this association was partially explained by diet and smoking status. The direction of effects cannot be conclusively determined. Effects may be bidirectional given that optimists are likely to engage in health behaviors associated with more serum antioxidants, and more serum antioxidants are likely associated with better physical health that enhances optimism. PMID:23257932

  7. Probability distribution functions for unit hydrographs with optimization using genetic algorithm

    Science.gov (United States)

    Ghorbani, Mohammad Ali; Singh, Vijay P.; Sivakumar, Bellie; H. Kashani, Mahsa; Atre, Atul Arvind; Asadi, Hakimeh

    2017-05-01

    A unit hydrograph (UH) of a watershed may be viewed as the unit pulse response function of a linear system. In recent years, the use of probability distribution functions (pdfs) for determining a UH has received much attention. In this study, a nonlinear optimization model is developed to transmute a UH into a pdf. The potential of six popular pdfs, namely two-parameter gamma, two-parameter Gumbel, two-parameter log-normal, two-parameter normal, three-parameter Pearson distribution, and two-parameter Weibull is tested on data from the Lighvan catchment in Iran. The probability distribution parameters are determined using the nonlinear least squares optimization method in two ways: (1) optimization by programming in Mathematica; and (2) optimization by applying genetic algorithm. The results are compared with those obtained by the traditional linear least squares method. The results show comparable capability and performance of two nonlinear methods. The gamma and Pearson distributions are the most successful models in preserving the rising and recession limbs of the unit hydographs. The log-normal distribution has a high ability in predicting both the peak flow and time to peak of the unit hydrograph. The nonlinear optimization method does not outperform the linear least squares method in determining the UH (especially for excess rainfall of one pulse), but is comparable.

  8. Multiobjective Optimization of a Counterrotating Type Pump-Turbine Unit Operated at Turbine Mode

    Directory of Open Access Journals (Sweden)

    Jin-Hyuk Kim

    2014-05-01

    Full Text Available A multiobjective optimization for improving the turbine output and efficiency of a counterrotating type pump-turbine unit operated at turbine mode was carried out in this work. The blade geometry of both the runners was optimized using a hybrid multiobjective evolutionary algorithm coupled with a surrogate model. Three-dimensional Reynolds-averaged Navier-Stokes equations with the shear stress transport turbulence model were discretized by finite volume approximations and solved on hexahedral grids to analyze the flow in the pump-turbine unit. As major hydrodynamic performance parameters, the turbine output and efficiency were selected as objective functions with two design variables related to the hub profiles of both the runner blades. These objectives were numerically assessed at twelve design points selected by Latin hypercube sampling in the design space. Response surface approximation models for the objectives were constructed based on the objective function values at the design points. A fast nondominated sorting genetic algorithm for the local search coupled with the response surface approximation models was applied to determine the global Pareto-optimal solutions. The trade-off between the two objectives was determined and described with respect to the Pareto-optimal solutions. The results of this work showed that the turbine outputs and efficiencies of optimized pump-turbine units were simultaneously improved in comparison to the reference unit.

  9. Is micro-CHP price controllable under price signal controlled Virtual Power Plants?

    DEFF Research Database (Denmark)

    You, Shi; Træholt, Chresten; Poulsen, Bjarne

    2011-01-01

    ) like aggregators. Compared to the centralized direct control scheme, a decentralized control scheme “controlby- price” is proposed for the VPP operation. The corresponding scheme has advantages in scalability, transparency and simplicity. In this context, a short term economic analysis is conducted...... for three different micro-CHP systems to investigate the feasibility of being controlled by price. Such analysis is relevant for both controller designs for micro-CHP systems and VPP related operations. The results indicate that controlling the micro-CHP systems by price is feasible but could result...

  10. Commitment and dispatch of heat and power units via affinely adjustable robust optimization

    DEFF Research Database (Denmark)

    Zugno, Marco; Morales González, Juan Miguel; Madsen, Henrik

    2016-01-01

    The joint management of heat and power systems is believed to be key to the integration of renewables into energy systems with a large penetration of district heating. Determining the day-ahead unit commitment and production schedules for these systems is an optimization problem subject...... to uncertainty stemming from the unpredictability of demand and prices for heat and electricity. Furthermore, owing to the dynamic features of production and heat storage units as well as to the length and granularity of the optimization horizon (e.g., one whole day with hourly resolution), this problem...

  11. Optimization in Fuzzy Economic Order Quantity (FEOQ Model with Deteriorating Inventory and Units Lost

    Directory of Open Access Journals (Sweden)

    Monalisha Pattnaik

    2014-09-01

    Full Text Available Background: This model presents the effect of deteriorating items in fuzzy optimal instantaneous replenishment for finite planning horizon. Accounting for holding cost per unit per unit time and ordering cost per order have traditionally been the case of modeling inventory systems in fuzzy environment. These imprecise parameters defined on a bounded interval on the axis of real numbers and the physical characteristics of stocked items dictate the nature of inventory policies implemented to manage and control in the production system.   Methods: The modified fuzzy EOQ (FEOQ model is introduced, it assumes that a percentage of the on-hand inventory is wasted due to deterioration and considered as an enhancement to EOQ model to determine the optimal replenishment quantity so that the net profit is maximized. In theoretical analysis, the necessary and sufficient conditions of the existence and uniqueness of the optimal solutions are proved and further the concavity of the fuzzy net profit function is established. Computational algorithm using the software LINGO 13.0 version is developed to find the optimal solution.   Results and conclusions: The results of the numerical analysis enable decision-makers to quantify the effect of units lost due to deterioration on optimizing the fuzzy net profit for the retailer. Finally, sensitivity analyses of the optimal solution with respect the major parameters are also carried out. Furthermore fuzzy decision making is shown to be superior then crisp decision making in terms of profit maximization. 

  12. Reactive power control with CHP plants - A demonstration

    DEFF Research Database (Denmark)

    Nyeng, Preben; Østergaard, Jacob; Andersen, Claus A.

    2010-01-01

    -7- 420, is investigated as a means to improve the control possibilities. To gain first-hand experience on the topic, a demonstration case has been designed and implemented in the project. The demonstration case is based on the issue of reactive power balancing in distribution grids, an issue...... that is attracting increasing attention from the distribution grid operators due to three main reasons, that all call for flexible reactive power control resources: First, the presence of DER, like wind turbines and CHP plants, makes the conditions less predictable, second, the intensive transform from overhead......In this project the potential for ancillary services provision by distributed energy resources is investigated. Specifically, the provision of reactive power control by combined heat and power plants is examined, and the application of the new standard for DER communication systems, IEC 61850...

  13. Speedup for quantum optimal control from automatic differentiation based on graphics processing units

    Science.gov (United States)

    Leung, Nelson; Abdelhafez, Mohamed; Koch, Jens; Schuster, David

    2017-04-01

    We implement a quantum optimal control algorithm based on automatic differentiation and harness the acceleration afforded by graphics processing units (GPUs). Automatic differentiation allows us to specify advanced optimization criteria and incorporate them in the optimization process with ease. We show that the use of GPUs can speedup calculations by more than an order of magnitude. Our strategy facilitates efficient numerical simulations on affordable desktop computers and exploration of a host of optimization constraints and system parameters relevant to real-life experiments. We demonstrate optimization of quantum evolution based on fine-grained evaluation of performance at each intermediate time step, thus enabling more intricate control on the evolution path, suppression of departures from the truncated model subspace, as well as minimization of the physical time needed to perform high-fidelity state preparation and unitary gates.

  14. Optimal placement and sizing of multiple distributed generating units in distribution

    Directory of Open Access Journals (Sweden)

    D. Rama Prabha

    2016-06-01

    Full Text Available Distributed generation (DG is becoming more important due to the increase in the demands for electrical energy. DG plays a vital role in reducing real power losses, operating cost and enhancing the voltage stability which is the objective function in this problem. This paper proposes a multi-objective technique for optimally determining the location and sizing of multiple distributed generation (DG units in the distribution network with different load models. The loss sensitivity factor (LSF determines the optimal placement of DGs. Invasive weed optimization (IWO is a population based meta-heuristic algorithm based on the behavior of weeds. This algorithm is used to find optimal sizing of the DGs. The proposed method has been tested for different load models on IEEE-33 bus and 69 bus radial distribution systems. This method has been compared with other nature inspired optimization methods. The simulated results illustrate the good applicability and performance of the proposed method.

  15. Structural optimization of the fibre-reinforced composite substructure in a three-unit dental bridge.

    Science.gov (United States)

    Shi, Li; Fok, Alex S L

    2009-06-01

    Failures of fixed partial dentures (FPDs) made of fibre-reinforced composites (FRC) have been reported in many clinical and in vitro studies. The types of failure include debonding at the composite-tooth interface, delamination of the veneering material from the FRC substructure and fracture of the pontic. The design of the FRC substructure, i.e. the position and orientation of the fibres, will affect the fracture resistance of the FPD. The purpose of this study was to find an optimal arrangement of the FRC substructure, by means of structural optimization, which could minimize the failure-initiating stresses in a three-unit FPD. A structural optimization method mimicking biological adaptive growth was developed for orthotropic materials such as FRC and incorporated into the finite element (FE) program ABAQUS. Using the program, optimization of the fibre positions and directions in a three-unit FPD was carried out, the aim being to align the fibre directions with those of the maximum principal stresses. The optimized design was then modeled and analyzed to verify the improvements in mechanical performance of the FPD. Results obtained from the optimization suggested that the fibres should be placed at the bottom of the pontic, forming a U-shape substructure that extended into the connectors linking the teeth and the pontic. FE analyses of the optimized design indicated stress reduction in both the veneering composite and at the interface between the veneer and the FRC substructure. The optimized design obtained using FE-based structural optimization can potentially improve the fracture resistance of FPDs by reducing some of the failure-initiating stresses. Optimization methods can therefore be a useful tool to provide sound scientific guidelines for the design of FRC substructures in FPDs.

  16. Experimental investigation of domestic micro-CHP based on the gas boiler fitted with ORC module

    Directory of Open Access Journals (Sweden)

    Wajs Jan

    2016-09-01

    Full Text Available The results of investigations conducted on the prototype of vapour driven micro-CHP unit integrated with a gas boiler are presented. The system enables cogeneration of heat and electric energy to cover the energy demand of a household. The idea of such system is to produce electricity for own demand or for selling it to the electric grid – in such situation the system user will became the prosumer. A typical commercial gas boiler, additionally equipped with an organic Rankine cycle (ORC module based on environmentally acceptable working fluid can be regarded as future generation unit. In the paper the prototype of innovative domestic cogenerative ORC system, consisting of a conventional gas boiler and a small size axial vapour microturbines (in-house designed for ORC and the commercially available for Rankine cycle (RC, evaporator and condenser were scrutinised. In the course of study the fluid working temperatures, rates of heat, electricity generation and efficiency of the whole system were obtained. The tested system could produce electricity in the amount of 1 kWe. Some preliminary tests were started with water as working fluid and the results for that case are also presented. The investigations showed that domestic gas boiler was able to provide the saturated/superheated ethanol vapour (in the ORC system and steam (in the RC system as working fluids.

  17. Experimental investigation of domestic micro-CHP based on the gas boiler fitted with ORC module

    Science.gov (United States)

    Wajs, Jan; Mikielewicz, Dariusz; Bajor, Michał; Kneba, Zbigniew

    2016-09-01

    The results of investigations conducted on the prototype of vapour driven micro-CHP unit integrated with a gas boiler are presented. The system enables cogeneration of heat and electric energy to cover the energy demand of a household. The idea of such system is to produce electricity for own demand or for selling it to the electric grid - in such situation the system user will became the prosumer. A typical commercial gas boiler, additionally equipped with an organic Rankine cycle (ORC) module based on environmentally acceptable working fluid can be regarded as future generation unit. In the paper the prototype of innovative domestic cogenerative ORC system, consisting of a conventional gas boiler and a small size axial vapour microturbines (in-house designed for ORC and the commercially available for Rankine cycle (RC)), evaporator and condenser were scrutinised. In the course of study the fluid working temperatures, rates of heat, electricity generation and efficiency of the whole system were obtained. The tested system could produce electricity in the amount of 1 kWe. Some preliminary tests were started with water as working fluid and the results for that case are also presented. The investigations showed that domestic gas boiler was able to provide the saturated/superheated ethanol vapour (in the ORC system) and steam (in the RC system) as working fluids.

  18. In-vitro Characterization of Optimized Multi-Unit Dosage Forms of ...

    African Journals Online (AJOL)

    The objective of this study is to compare the drug release profile of an optimized multi-unit dose (MU) tablet consisting of rapid and slow release components, a formulated sustained released tablet and two brands of sustained release tablet formulations in the market with a designed model. The fast release component ...

  19. In-vitro Characterization of Optimized Multi-Unit Dosage Forms of ...

    African Journals Online (AJOL)

    Michael Horsfall

    In-vitro Characterization of Optimized Multi-Unit Dosage Forms of Theophylline and its Solid State Characterisation. *1UHUMWANGHO, M U; 2RAMANA, MURTHY K V. 1Department of Pharmaceutics and Pharmaceutical Technology, Faculty of Pharmacy, University of Benin, Nigeria. 2University College of Pharmaceutical ...

  20. Optimization of existing combined heat and power generating units. Optimalisatie bestaande warmte/kracht-centrales

    Energy Technology Data Exchange (ETDEWEB)

    Klein Teeselink, H. (HoSt, Subsidiary Company of Holec Projects and Stork Ketels, Hengelo (Netherlands))

    1995-01-01

    A lot of the cogeneration units, built in the early eighties do not function optimally. The main causes of malfunctioning are bad management, limited instrumentation, decrease of steam demand, limited maintenance, contamination, aging, and other specific bottlenecks in the system. The application of improved monitoring systems can prevent, track or adjust disturbances and imperfections. 2 figs., 1 ill.

  1. Development of a biorefinery optimized biofuel supply curve for the western United States

    Science.gov (United States)

    Nathan Parker; Peter Tittmann; Quinn Hart; Richard Nelson; Ken Skog; Anneliese Schmidt; Edward Gray; Bryan Jenkins

    2010-01-01

    A resource assessment and biorefinery siting optimization model was developed and implemented to assess potential biofuel supply across the Western United States from agricultural, forest, urban, and energy crop biomass. Spatial information including feedstock resources, existing and potential refinery locations and a transportation network model is provided to a mixed...

  2. Initial Market Assessment for Small-Scale Biomass-Based CHP

    Energy Technology Data Exchange (ETDEWEB)

    Brown, E.; Mann, M.

    2008-01-01

    The purpose of this report is to reexamine the energy generation market opportunities for biomass CHP applications smaller than 20 MW. This paper provides an overview of the benefits of and challenges for biomass CHP in terms of policy, including a discussion of the drivers behind, and constraints on, the biomass CHP market. The report provides a summary discussion of the available biomass supply types and technologies that could be used to feed the market. Two primary markets are outlined--rural/agricultural and urban--for small-scale biomass CHP, and illustrate the primary intersections of supply and demand for those markets. The paper concludes by summarizing the potential markets and suggests next steps for identifying and utilizing small-scale biomass.

  3. Optimal Capacity Configuration for Energy Hubs Considering Part-Load Characteristics of Generation Units

    Directory of Open Access Journals (Sweden)

    Shan Deng

    2017-11-01

    Full Text Available The simulation model is one of the key points affecting the optimal planning and operation of energy hubs (EHs. Since treating the efficiencies of generation units as constants would significantly simplify the calculation, only a simplified model is investigated in most research works. In this paper, aiming at optimizing the capacity configuration of an EH, we present a part-load characteristics-based (PLCB model, in which the efficiencies of generation units will change with the fluctuating load. Based on the PLCB model, the accuracy of the EH model can be improved. Furthermore, a two-stage planning method is proposed to solve the optimal capacity configuration problem of the EH. Group Search Optimizer (GSO is used to determine the optimal size in the first stage, and a mathematical programming method is applied to obtain the optimal operation of the EH in the second stage. Comparative studies using the PLCB model and the simplified model are performed to examine the impacts of equipment part-load characteristics on the sizing results. Simulation results indicate that the proposed model appears to have a better economic performance than the simplified model.

  4. Modeling and simulation of a residential micro-CHP system based on HT-PEMFC technology

    DEFF Research Database (Denmark)

    Arsalis, Alexandros; Nielsen, Mads Pagh; Kær, Søren Knudsen

    2009-01-01

    Combined-heat-and-power (CHP) technology is a well known and proved method to produce simultaneously power and heat at high efficiencies. This can be further improved by the introduction of a novel micro-CHP residential system based on High Temperature-Proton Exchange Membrane Fuel Cell (HT-PEMFC...... is simulated in LabVIEW environment to provide the ability of Data Acquisition of actual components and thereby more realistic design in the future....

  5. Optimal placement of fast cut back units based on the theory of cellular automata and agent

    Science.gov (United States)

    Yan, Jun; Yan, Feng

    2017-06-01

    The thermal power generation units with the function of fast cut back could serve power for auxiliary system and keep island operation after a major blackout, so they are excellent substitute for the traditional black-start power sources. Different placement schemes for FCB units have different influence on the subsequent restoration process. Considering the locality of the emergency dispatching rules, the unpredictability of specific dispatching instructions and unexpected situations like failure of transmission line energization, a novel deduction model for network reconfiguration based on the theory of cellular automata and agent is established. Several indexes are then defined for evaluating the placement schemes for FCB units. The attribute weights determination method based on subjective and objective integration and grey relational analysis are combinatorically used to determine the optimal placement scheme for FCB unit. The effectiveness of the proposed method is validated by the test results on the New England 10-unit 39-bus power system.

  6. Optimization Solutions for Improving the Performance of the Parallel Reduction Algorithm Using Graphics Processing Units

    Directory of Open Access Journals (Sweden)

    Ion LUNGU

    2012-01-01

    Full Text Available In this paper, we research, analyze and develop optimization solutions for the parallel reduction function using graphics processing units (GPUs that implement the Compute Unified Device Architecture (CUDA, a modern and novel approach for improving the software performance of data processing applications and algorithms. Many of these applications and algorithms make use of the reduction function in their computational steps. After having designed the function and its algorithmic steps in CUDA, we have progressively developed and implemented optimization solutions for the reduction function. In order to confirm, test and evaluate the solutions' efficiency, we have developed a custom tailored benchmark suite. We have analyzed the obtained experimental results regarding: the comparison of the execution time and bandwidth when using graphic processing units covering the main CUDA architectures (Tesla GT200, Fermi GF100, Kepler GK104 and a central processing unit; the data type influence; the binary operator's influence.

  7. Optimal Sizing and Sitting of Smart Microgrid Units under Pool Electricity Market

    DEFF Research Database (Denmark)

    Hakimi, Seyed Mehdi; Hajizadeh, Amin

    2017-01-01

    different optimization tools are considered. First, a game-theoretical (GT) model has been used for bidding strategy of smart microgrid as a price-maker, in a long-term electricity market. Secondly, a particle swarm optimization (PSO) algorithm is employed to obtain the best cost value of smart microgrids......This paper presents an approach for optimal sizing and sitting of distribution generation units in smart microgrid under pool electricity market to reduce total cost and power loss of whole smart microgrid. The costs comprise capital cost, replacement cost, operation and maintenance cost, fuel cost......, reliability cost, power loss cost and selling and buying electricity cost. The new idea of this paper is the investigation of pool electricity market aspects in optimization of smart microgrid. On the other hand, cost minimization of smart microgrid is related to their bidding strategies. Therefore two...

  8. Location optimization of remote gain unit in ultralong span repeaterless optical transmission system

    Science.gov (United States)

    Xiong, Huang; Shan, Yuanyuan; Sun, Junqiang

    2017-03-01

    The influences of the remote gain unit (RGU) location on ultralong span repeaterless optical transmission system with different bit rates and the number of the signal channels is discussed in this paper. The experimental results show that the optimal location of the RGU can always exist for obtaining the minimum signal bit error rate at receiver with a fixed transmission distance. The optimization location of the RGU is entirely dependent on the total transmission length and the number of channel in the wavelength division multiplexing (WDM) system. When the 1480-nm pump power is set about 1 W, the span of the repeaterless WDM transmission system can be extended to 402 km through optimizing the location of the RGU. The optimal configuration scheme of the RGU can provide a potential application to increase the transmission spans for undersea transmission systems, electric power transmission systems, and the other special trades.

  9. Process Intensification in Fuel Cell CHP Systems, the ReforCELL Project

    Directory of Open Access Journals (Sweden)

    José Luis Viviente

    2016-10-01

    Full Text Available This paper reports the findings of a FP7/FCH JU project (ReforCELL that developed materials (catalysts and membranes and an advance autothermal membrane reformer for a micro Combined Heat and Power (CHP system of 5 kWel based on a polymer electrolyte membrane fuel cell (PEMFC. In this project, an active, stable and selective catalyst was developed for the reactions of interest and its production was scaled up to kg scale (TRL5 (TRL: Technology Readiness Level. Simultaneously, new membranes for gas separation were developed. In particular, dense supported thin palladium-based membranes were developed for hydrogen separation from reactive mixtures. These membranes were successfully scaled up to TRL4 and used in lab-scale reactors for fluidized bed steam methane reforming (SMR and autothermal reforming (ATR and in a prototype reactor for ATR. Suitable sealing techniques able to integrate the different membranes in lab-scale and prototype reactors were also developed. The project also addressed the design and optimization of the subcomponents (BoP for the integration of the membrane reformer to the fuel cell system.

  10. Novel Fuzzy-IWO Method for Reconfiguration Simultaneous Optimal DG Units Allocation

    Directory of Open Access Journals (Sweden)

    Hajar Bagheri

    2015-07-01

    Full Text Available This paper presents a new hybrid method for optimal multi-objective reconfiguration simultaneous determining the optimal size and location of Distributed Generation (DG in a distribution feeder. The purposes of this research are reducing the losses, improving the voltage profile and equalizing the feeder load balancing in a distribution system. Invasive Weed Optimization (IWO is used to simultaneously reconfigure and identify the optimal capacity and location for installation of DG units in the distribution network. In order to facilitate the algorithm for multi-objective search ability, the optimization problem is formulated for minimizing fuzzy performance indices. The multi-objective optimization problem is transformed into a fuzzy inference system (FIS, where each objective function is quantified into a set of fuzzy objectives selected by fuzzy membership functions. The proposed method is validated using the IEEE 33 bus test system at nominal load. The obtained results prove this combined technique is more accurate and has an efficient convergence property compared to other intelligent search algorithms. Also, the obtained results lead to the conclusion that multi-objective reconfiguration along with placement of DGs can be more beneficial than separate single-objective optimization.

  11. Biomass gasification for CHP with dry gas cleaning and regenerative heat recovery

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2002-05-01

    Small scale CHP plants based on biomass gasification technologies are generally expensive and not very efficient due to gas quality problems which increase operation and maintenance cost as well as breakdown. To overcome this situation the team has developed, integrated and tested a complete biomass gasification combine heat and power prototype plant of 250 kWth equipped with a specifically developed dry gas cleaning and heat recovery system. The dry gas cleaning device is a simple dry gas regenerative heat exchanger where tars are stopped by condensation but working at a temperature above due point in order to avoid water condensation. Two types of heat particles separation devices have been tested in parallel multi-cyclone and ceramic filters. After several month spent on modelling design, construction and optimisation, a full test campaign of 400 hours continuous monitoring has been done where all working parameters has been monitored and gas cleaning device performances has been assessed. Results have shown: Inappropriateness of the ceramic filters for the small scale unit due to operation cost and too high sensibility of the filters to the operation conditions fluctuating in a wide range, despite a very high particle separation efficiency 99 %; Rather good efficiency of the multi-cyclone 72% but not sufficient for engine safety. Additional conventional filters where necessary for the finest part; Inappropriateness of the dry gas heat exchanger device for tar removal partly due to a low tar content of the syngas generated, below 100 mg/Nm{sup 3} , but also due to their composition which would have imposed, to be really efficient, a theoretical condensing temperature of 89 C below the water condensation temperature. These results have been confirmed by laboratory tests and modelling. However the tar cracking phase have shown very interesting results and proved the feasibility of thermal cracking with full cleaning of the heat exchanger without further mechanical

  12. A new approach in CHP steam turbines thermodynamic cycles computations

    Directory of Open Access Journals (Sweden)

    Grković Vojin R.

    2012-01-01

    Full Text Available This paper presents a new approach in mathematical modeling of thermodynamic cycles and electric power of utility district-heating and cogeneration steam turbines. The approach is based on the application of the dimensionless mass flows, which describe the thermodynamic cycle of a combined heat and power steam turbine. The mass flows are calculated relative to the mass flow to low pressure turbine. The procedure introduces the extraction mass flow load parameter νh which clearly indicates the energy transformation process, as well as the cogeneration turbine design features, but also its fitness for the electrical energy system requirements. The presented approach allows fast computations, as well as direct calculation of the selected energy efficiency indicators. The approach is exemplified with the calculation results of the district heat power to electric power ratio, as well as the cycle efficiency, versus νh. The influence of νh on the conformity of a combined heat and power turbine to the grid requirements is also analyzed and discussed. [Projekat Ministarstva nauke Republike Srbije, br. 33049: Development of CHP demonstration plant with gasification of biomass

  13. Design considerations for effective control of an afterburner sub-system in a combined heat and power (CHP) fuel cell system (FCS)

    Science.gov (United States)

    Colella, Whitney G.

    This article investigates various control strategies for a combined heat and power (CHP) fuel cell system (FCS), with a specific focus on the afterburner sub-system. The afterburner sub-system recovers heat and by-products from the excess fuel and oxidant not consumed within the fuel cell. The overall performance of a CHP FCS depends crucially on the control of the afterburner sub-system because the control of this sub-system (1) determines the extent of thermal energy recovered from the system, between 35 and 55% of fuel energy input; (2) establishes the rate limiting step in the control of the overall CHP FCS because the rate at which the afterburner can combust excess fuel and oxidant safely and raise steam affects the rate at which the fuel cell's electrical power output can change; and (3) impacts upstream mass and energy flows strongly, such as the system's overall water balance and also the raising of steam for the upstream fuel processor and cathode humidification, as this is the point in the system where the CHP FCS becomes closed loop for heat and mass flows. Using an Aspen Plus ® chemical engineering model of the CHP FCS, this article (1) identifies potential challenges in operating the afterburner sub-system, (2) discusses various options for ameliorating those challenges, and (3) recommends viable solutions. The two challenges it discusses in detail are (1) the danger of overheating the afterburner, and (2) the danger of overheating a downstream steam generator. Regarding the first challenge, in the low anode hydrogen utilization (AHU) range (66-85%) specified by some fuel cell manufacturers, the afterburner is in danger of overheating beyond its maximum rated operating point. Regarding the second challenge, also at low anode hydrogen utilizations, the steam generator is in danger of overheating beyond its maximum rated operating point. This article demonstrates that one solution for overcoming these challenges is to dilute the afterburner's stream

  14. Three-dimensional reconstruction of statistically optimal unit cells of polydisperse particulate composites from microtomography.

    Science.gov (United States)

    Lee, H; Brandyberry, M; Tudor, A; Matous, K

    2009-12-01

    In this paper, we present a systematic approach for characterization and reconstruction of statistically optimal representative unit cells of polydisperse particulate composites. Microtomography is used to gather rich three-dimensional data of a packed glass bead system. First-, second-, and third-order probability functions are used to characterize the morphology of the material, and the parallel augmented simulated annealing algorithm is employed for reconstruction of the statistically equivalent medium. Both the fully resolved probability spectrum and the geometrically exact particle shapes are considered in this study, rendering the optimization problem multidimensional with a highly complex objective function. A ten-phase particulate composite composed of packed glass beads in a cylindrical specimen is investigated, and a unit cell is reconstructed on massively parallel computers. Further, rigorous error analysis of the statistical descriptors (probability functions) is presented and a detailed comparison between statistics of the voxel-derived pack and the representative cell is made.

  15. Unit Commitment Mempertimbangkan Fungsi Biaya Pembangkitan Tak Mulus Dengan Metode Binnary Particle Swarm Optimization

    Directory of Open Access Journals (Sweden)

    Fahrizal Fitra Utama

    2017-01-01

    Full Text Available Abstrak – Tulisan ini berkaitan dengan penjadwalan unit pembangkit, atau lenih dikenal sebagai Unit Commitment (UC. Pada umumnya fungsi biaya pembangkitan yang digunakan adalah quadratic programming, namun makalah ini menggunakan fungsi biaya pembangkitan tidak - mulus (Non-Smooth Cost Function. Permasalahan pada NSGCF sulit untuk dikerjakan menggunakan teknik konvensional seperti pemrograman kuadrat, teknik metaheuristik , metode Particle Swarm Optimization disini digunakan untuk memecahkan economic dispatch yang merupakan bagian dari UC . Pada UC terdapat beberapa parameter seperti waktu nyala minimal, waktu padam minimal, biaya start dan biaya pemadaman. Selain itu, cadangan berputar ikut diperhitungkan . Karena UC adalah masalah optimasi biner, maka metode Binary Particle Swarm Optimization ( BPSO diterapkan untuk menyelesaikan UC . Untuk menunjukkan penerapannya, sistem dengan 6 generator yang akan digunakan

  16. Optimization of Combine Heat and Power Plants in the Russian Wholesale Power Market Conditions

    Directory of Open Access Journals (Sweden)

    I. A. Chuchueva

    2015-01-01

    Full Text Available The paper concerns the relevant problem to optimize the combine heat and power (CHP plants in the Russian wholesale power market conditions. Since 1975 the CHP plants specialists faced the problem of fuel rate or fuel cost reduction while ensuring the fixed level of heat and power production. The optimality criterion was the fuel rate or fuel cost which has to be minimized. Produced heat and power was paid by known tariff. Since the power market started in 2006 the power payment scheme has essentially changed: produced power is paid by market price. In such condition a new optimality criterion the paper offers is a profit which has to be maximized for the given time horizon. Depending on the optimization horizon the paper suggests four types of the problem urgency, namely: long-term, mid-term, short-term, and operative optimization. It clearly shows that the previous problem of fuel cost minimization is a special case of profit maximization problem. To bring the problem to the mixed-integer linear programming problem a new linear characteristic curves of steam and gas turbine are introduced. Error of linearization is 0.6%. The formal statement of the problem of short-term CHP plants optimization in the market conditions is offered. The problem was solved with IRM software (OpenLinkInternational for seven power plants of JSC “Quadra”: Dyagilevskaya CHP, Kurskaya CHP-1, Lipetskaya CHP-2, Orlovskaya CHP, Kurskaya CHP NWR, Tambovskaya CHP, and Smolenskaya CHP-2.The conducted computational experiment showed that a potential profit is between 1.7% and 4.7% of the fuel cost of different CHP plants and depends on the power plant operation conditions. The potential profit value is 2–3 times higher than analogous estimations, which were obtained solving fuel cost minimization problem. The perspectives of the work are formalization of mid-term and long-term CHP plants optimization problem and development of domestic software for the new problem

  17. Scheduling a Wind Hydro-Pumped-Storage Unit Considering the Economical Optimization

    OpenAIRE

    Ghaisi, Milad; Rahmani, Milad; Gharghabi, Pedram; Zoghi, Ali; Hosseinian, Seyed Hossein

    2017-01-01

    International audience; In this paper a new approach has been introduced to find the optimum capacity of a wind farm to cooperate with a hydro-pumped-storage in order to maximize the income and optimize the payback period of their combination. First, Monte Carlo method has been used to generate the annual price and wind speed values. Then, an operating policy has been considered to schedule each unit generating and saving the produced energy by the wind farm. Subsequently, simulations have be...

  18. Multiobjective Optimization of a Benfield HiPure Gas Sweetening Unit

    Directory of Open Access Journals (Sweden)

    Richard Ochieng

    2013-01-01

    Full Text Available We show how a multiobjective bare-bones particle swarm optimization can be used for a process parameter tuning and performance enhancement of a natural gas sweetening unit. This has been made through maximization of hydrocarbon recovery and minimization of the total energy of the process as the two objectives of the optimization. A trade-off exists between these two objectives as illustrated by the Pareto front. This algorithm has been applied to a sweetening unit that uses the Benfield HiPure process. Detailed models of the natural gas unit are developed in ProMax process simulator and integrated to the multi-objective optimization developed in visual basic environment (VBA. In this study, the solvent circulation rates, stripper pressure and reboiler duties are considered as the decision variables while hydrogen sulfide and carbon dioxide concentrations in the sweetened gas are considered as process constraints. The upper and lower bounds of the decision variables are obtained through a parametric sensitivity analysis of the models. The Pareto sets show a significant improvement in hydrocarbon recovery and a decent reduction in the heat consumption of the process.

  19. Deterministic and Robust Optimization Approach for Single Artillery Unit Fire Scheduling Problem

    Directory of Open Access Journals (Sweden)

    Yong Baek Choi

    2017-10-01

    Full Text Available In this study, deterministic and robust optimization models for single artillery unit fire scheduling are developed to minimize the total enemy threat to friendly forces by considering the enemy target threat level, enemy target destruction time, and target firing preparation time simultaneously. Many factors in war environments are uncertain. In particular, it is difficult to evaluate the threat levels of enemy targets definitively. We consider the threat level of an enemy target to be an uncertain parameter and propose a robust optimization model that minimizes the total enemy threat to friendly forces. The robust optimization model represents a semi-infinite problem that has infinitely many constraints. Therefore, we reformulate the robust optimization model into a tractable robust counterpart formulation with a finite number of constraints. In the robust counterpart formulation with cardinality-constrained uncertainty, the conservativeness and robustness of the solution can be adjusted with an uncertainty degree, Γ. Further, numerical experiments are conducted to verify that the robust counterpart formulation with cardinality-constrained uncertainty can be made equivalent to the deterministic optimization model and the robust counterpart formulation with box uncertainty by setting Γ accordingly.

  20. Regulatory Compliance and Environmental Benefit Analysis of Combined Heat and Power (CHP Systems in Taiwan

    Directory of Open Access Journals (Sweden)

    Wen-Tien Tsai

    2013-01-01

    Full Text Available The energy conservation achieved by utilizing waste heat in the energy and industrial sectors has became more and more important after the energy crisis in the 1970s because it plays a vital role in the potential energy-efficiency improvement. In this regard, cogeneration (combined heat and power, CHP systems are thus becoming attractive due to the energy, economic, and environmental policies for pursuing stable electricity supply, sustainable development and environmental pollution mitigation in Taiwan. The objective of this paper is to present an updated analysis of CHP systems in Taiwan during the period from 1990 to 2010. The description in the paper is thus based on an analysis of electricity supply/consumption and its sources from CHP systems during the past two decades, and centered on two important regulations in compliance with CHP systems (i.e., Energy Management Law and Environmental Impact Assessment Act. Based on the total net power generation from CHP systems (i.e., 35,626 GWh in 2011, it was found that the carbon dioxide reduction benefits were estimated to be around 20,000 Gg.

  1. Sizing Combined Heat and Power Units and Domestic Building Energy Cost Optimisation

    Directory of Open Access Journals (Sweden)

    Dongmin Yu

    2017-06-01

    Full Text Available Many combined heat and power (CHP units have been installed in domestic buildings to increase energy efficiency and reduce energy costs. However, inappropriate sizing of a CHP may actually increase energy costs and reduce energy efficiency. Moreover, the high manufacturing cost of batteries makes batteries less affordable. Therefore, this paper will attempt to size the capacity of CHP and optimise daily energy costs for a domestic building with only CHP installed. In this paper, electricity and heat loads are firstly used as sizing criteria in finding the best capacities of different types of CHP with the help of the maximum rectangle (MR method. Subsequently, the genetic algorithm (GA will be used to optimise the daily energy costs of the different cases. Then, heat and electricity loads are jointly considered for sizing different types of CHP and for optimising the daily energy costs through the GA method. The optimisation results show that the GA sizing method gives a higher average daily energy cost saving, which is 13% reduction compared to a building without installing CHP. However, to achieve this, there will be about 3% energy efficiency reduction and 7% input power to rated power ratio reduction compared to using the MR method and heat demand in sizing CHP.

  2. Populations receiving optimally fluoridated public drinking water--United States, 1992-2006.

    Science.gov (United States)

    2008-07-11

    Water fluoridation has been identified by CDC as one of 10 great public health achievements of the 20th century. The decline in the prevalence and severity of dental caries (tooth decay) in the United States during the past 60 years has been attributed largely to the increased use of fluoride. Community water fluoridation is an equitable and cost-effective method for delivering fluoride to the community. A Healthy People 2010 objective is to increase to 75% the proportion of the U.S. population served by community water systems who receive optimally fluoridated water. To update and revise previous reports on fluoridation in the United States and describe progress toward the Healthy People 2010 objective, CDC analyzed fluoridation data for the period 1992-2006 from the 50 states and District of Columbia (DC). The results indicated that the percentage of the U.S. population served by community water systems who received optimally fluoridated water increased from 62.1% in 1992, to 65.0% in 2000, and 69.2% in 2006, and those percentages varied substantially by state. Public health officials and policymakers in states with lower percentages of residents receiving optimal water fluoridation should consider increasing their efforts to promote fluoridation of community water systems to prevent dental caries.

  3. Procuring Stationary Fuel Cells For CHP: A Guide for Federal Facility Decision Makers

    Energy Technology Data Exchange (ETDEWEB)

    Stinton, David P [ORNL; McGervey, Joseph [SRA International, Inc.; Curran, Scott [ORNL

    2011-11-01

    Federal agency leaders are expressing growing interest in using innovative fuel cell combined heat and power (CHP) technology at their sites, motivated by both executive branch sustainability targets and a desire to lead by example in the transition to a clean energy economy. Fuel cell CHP can deliver reliable electricity and heat with 70% to 85% efficiency. Implementing this technology can be a high efficiency, clean energy solution for agencies striving to meet ambitious sustainability requirements with limited budgets. Fuel cell CHP systems can use natural gas or renewable fuels, such as biogas. Procuring Stationary Fuel Cells for CHP: A Guide for Federal Facility Decision Makers presents an overview of the process for planning and implementing a fuel cell CHP project in a concise, step-by-step format. This guide is designed to help agency leaders turn their interest in fuel cell technology into successful installations. This guide concentrates on larger (100 kW and greater) fuel cell CHP systems and does not consider other fuel cell applications such as cars, forklifts, backup power supplies or small generators (<100 kW). Because fuel cell technologies are rapidly evolving and have high up front costs, their deployment poses unique challenges. The electrical and thermal output of the CHP system must be integrated with the building s energy systems. Innovative financing mechanisms allow agencies to make a make versus buy decision to maximize savings. This guide outlines methods that federal agencies may use to procure fuel cell CHP systems with little or no capital investment. Each agency and division, however, has its own set of procurement procedures. This guide was written as a starting point, and it defers to the reader s set of rules if differences exist. The fuel cell industry is maturing, and project developers are gaining experience in working with federal agencies. Technology improvements, cost reductions, and experienced project developers are making

  4. Micro scale CHP based on biomass intelligent heat transfer with thermoelectric generators

    Energy Technology Data Exchange (ETDEWEB)

    Moser, W.; Aigenbauer, S.; Heckmann, M.; Friedl, G. (Austrian Bioenergy Centre GmbH, Wieselburg (Austria)); Hofbauer, H. (Institute of Chemical Engineering, Vienna University of Technology (Austria))

    2007-07-01

    Pellet burners need auxiliary electrical power to provide CO{sub 2} balanced heat in a comfortable and environment friendly way. The idea is to produce this and some extra electricity within the device in order to save resources and to gain operation reliability and independency. An option for micro scale CHP is the usage of thermoelectric generators (TEGs). They allow direct conversion of heat into electrical power. They have the advantage of a long maintenance free durability and noiseless operation without moving parts or any working fluid. The useful heat remains almost unaffected and can still be used for heating. TEGs are predestined for the use in micro scale CHP based on solid biomass. In this paper the first results from the fully integrated prototype are presented. The performance of the TEG was observed for different loads and operating conditions in order to realise an optimised micro scale CHP based on solid biomass. (orig.)

  5. The scale of transition: an integrated study of the performance of CHP biomass plants in the Netherlands

    NARCIS (Netherlands)

    Proka, A.; Hisschemoller, M.; Papyrakis, E.

    2014-01-01

    Combined heat and power (CHP) plants using biomass are considered important to substantially increase the share of renewables in the total energy supply and meet ambitious climate targets. The analysis focuses on the links between the size of bio-fuelled CHP plants and their techno-economic and

  6. Optimization of the coherence function estimation for multi-core central processing unit

    Science.gov (United States)

    Cheremnov, A. G.; Faerman, V. A.; Avramchuk, V. S.

    2017-02-01

    The paper considers use of parallel processing on multi-core central processing unit for optimization of the coherence function evaluation arising in digital signal processing. Coherence function along with other methods of spectral analysis is commonly used for vibration diagnosis of rotating machinery and its particular nodes. An algorithm is given for the function evaluation for signals represented with digital samples. The algorithm is analyzed for its software implementation and computational problems. Optimization measures are described, including algorithmic, architecture and compiler optimization, their results are assessed for multi-core processors from different manufacturers. Thus, speeding-up of the parallel execution with respect to sequential execution was studied and results are presented for Intel Core i7-4720HQ и AMD FX-9590 processors. The results show comparatively high efficiency of the optimization measures taken. In particular, acceleration indicators and average CPU utilization have been significantly improved, showing high degree of parallelism of the constructed calculating functions. The developed software underwent state registration and will be used as a part of a software and hardware solution for rotating machinery fault diagnosis and pipeline leak location with acoustic correlation method.

  7. Multi-objective Optimization of a Solar Humidification Dehumidification Desalination Unit

    Science.gov (United States)

    Rafigh, M.; Mirzaeian, M.; Najafi, B.; Rinaldi, F.; Marchesi, R.

    2017-11-01

    In the present paper, a humidification–dehumidification desalination unit integrated with solar system is considered. In the first step mathematical model of the whole plant is represented. Next, taking into account the logical constraints, the performance of the system is optimized. On one hand it is desired to have higher energetic efficiency, while on the other hand, higher efficiency results in an increment in the required area for each subsystem which consequently leads to an increase in the total cost of the plant. In the present work, the optimum solution is achieved when the specific energy of the solar heater and also the areas of humidifier and dehumidifier are minimized. Due to the fact that considered objective functions are in conflict, conventional optimization methods are not applicable. Hence, multi objective optimization using genetic algorithm which is an efficient tool for dealing with problems with conflicting objectives has been utilized and a set of optimal solutions called Pareto front each of which is a tradeoff between the mentioned objectives is generated.

  8. Optimizing energy management of decentralized photovoltaic. Fuel cell - direct storage - power supply units

    Energy Technology Data Exchange (ETDEWEB)

    Bocklisch, Thilo; Schufft, Wolfgang; Bocklisch, Steffen [Chemnitz Univ. of Technology (TUC) (Germany)

    2010-07-01

    This paper presents a new optimizing energy management concept for decentralized power supply units. Main goal is the coordinated utilization of dynamically controllable combined-heat-and-power-plants (e.g. fuel cell cogeneration plants) and electrochemical direct storages (e.g. future electric car batteries) for the active balancing of fluctuating renewable energy generation (e.g. building integrated photovoltaics) and fluctuation electricity consumption. The self-utilization and partial storage of renewable energy helps to stabilize the grid in a ''bottom-up'' approach. The new energy mangement concept features a three-layer control structure, which aims for the optimization of the power flows, minimizing the fuel consumption and the dynamic stress imposed onto the fuel cell. (orig.)

  9. Optimization of Boiler Control to Improve the Load-following Capability of Power-plant Units

    DEFF Research Database (Denmark)

    Mortensen, J. H.; Mølbak, T.; Andersen, Palle

    1998-01-01

    The capability to perform fast load changes has been an important issue in the power market, and will become increasingly more so due to the incresing commercialisation of the European power market. An optimizing control system for improving the load-following capability of power-plant units has...... therefore been developed. The system is implemented as a complement, producing control signals to be added to those of the existing boiler control system, a concept which has various practical advantages in terms of implementation and commissioning. The optimizing control system takes account...... of the multivariable and load-de*pendent nonlinear characteristics of the boiler process, as a scheduled LQG controller with feedforward action is utilized. The LQG controller improves the control of critical pro*cess variables, making it possible to increase the load-following capability of a specific plant. Field...

  10. Optimization of Boiler Control to Improve the Load-following Capability of Power-plant Units

    DEFF Research Database (Denmark)

    Mortensen, J. H.; Mølbak, T.; Andersen, Palle

    The capability to perform fast load changes has been an important issue in the power market, and will become increasingly more so due to the incresing commercialisation of the European power market. An optimizing control system for improving the load-following capability of power-plant units has...... therefore been developed. The system is implemented as a complement, producing control signals to be added to those of the existing boiler control system, a concept which has various practical advantages in terms of implementation and commissioning. The optimizing control system takes account...... of the multivariable and load-de*pendent nonlinear characteristics of the boiler process, as a scheduled LQG controller with feedforward action is utilized. The LQG controller improves the control of critical pro*cess variables, making it possible to increase the load-following capability of a specific plant. Field...

  11. Optimized control unit for solar combi systems; Commande optimale de systemes solaires combines

    Energy Technology Data Exchange (ETDEWEB)

    Prud' homme, T.; Gillet, D.

    2003-07-01

    This report presents in detail the development of an optimized control unit for solar combi systems designed for both space heating and domestic hot water preparation. The objective is to minimize the heat supply from the auxiliary gas heater while providing high indoor comfort to the occupants. The authors suggest a dynamic model for the building, designed to be easily adapted to different types of building. Its main parameters are automatically identified. On the contrary, the solar-heating-system dynamic model is the same for all buildings. The system control strategy relies on these dynamic models and on real-time weather forecast from the meteorological institute, in particular the predicted outdoor temperature. The parameter identification is repeated at regular intervals to enable the control system to learn from possible errors and improve optimization. The auxiliary energy savings are estimated to be 13% compared to usual control strategies.

  12. ECONOMIC ASPECTS OF DESIGNING, CONSTRUCTION AND OPERATION OF MINI-CHP IN BELARUS

    Directory of Open Access Journals (Sweden)

    Kovalev I.L.

    2013-08-01

    Full Text Available The article raised questions of efficiency of operation of CHP in industrial enterprises in Belarus, as well as the problem of cross-subsidies in the energy sector of the Republic and its negative impact on the economy as a whole. Data of the electricity tariffs for households and industrial consumers in Belarus and the countries the EU have been presented and analyzed. Main economic indicators and results of operation of a number of mini–CHP, which were built in Belarus over the last ten years, have been analyzed. The operating results have been compared with a view to economic efficiency of all investigated local energy facilities.

  13. A price mechanism for supply demand matching in local grid of households with micro-CHP

    Directory of Open Access Journals (Sweden)

    Scherpen J. M. A.

    2012-10-01

    Full Text Available This paper describes a dynamic price mechanism to coordinate eletric power generation from micro Combined Heat and Power (micro-CHP systems in a network of households. It is assumed that the households are prosumers, i.e. both producers and consumers of electricity. The control is done on household level in a completely distributed manner. Avoiding a centralized controller both eases computation complexity and preserves communication structure in the network. Local information is used to decide to turn on or off the micro-CHP, but through price signals between the prosumers the network as a whole operates in a cooperative way.

  14. A price mechanism for supply demand matching in local grid of households with micro-CHP

    Science.gov (United States)

    Larsen, G. K. H.; van Foreest, N. D.; Scherpen, J. M. A.

    2012-10-01

    This paper describes a dynamic price mechanism to coordinate eletric power generation from micro Combined Heat and Power (micro-CHP) systems in a network of households. It is assumed that the households are prosumers, i.e. both producers and consumers of electricity. The control is done on household level in a completely distributed manner. Avoiding a centralized controller both eases computation complexity and preserves communication structure in the network. Local information is used to decide to turn on or off the micro-CHP, but through price signals between the prosumers the network as a whole operates in a cooperative way.

  15. Optimal design of compact organic Rankine cycle units for domestic solar applications

    DEFF Research Database (Denmark)

    Barbazza, Luca; Pierobon, Leonardo; Mirandola, Alberto

    2014-01-01

    Organic Rankine cycle turbogenerators are a promising technology to transform the solar radiation harvested by solar collectors into electric power. The present work aims at sizing a small-scale organic Rankine cycle unit by tailoring its design for domestic solar applications. Stringent design...... solar collectors (hot water temperature equal to 75 degrees C), R1234yf is the optimal solution. The heat exchanger volume ranges between 6.0 and 23.0 dm(3), whereas the thermal efficiency is around 4.5%. R1234ze is the best working fluid employing parabolic solar collectors (hot water temperature equal...

  16. Multi-period MINLP model for optimising operation and structural changes to CHP plants in district heating networks with long-term thermal storage

    Energy Technology Data Exchange (ETDEWEB)

    Tveit, Tor-Martin; Savola, Tuula; Fogelholm, Carl-Johan [Helsinki University of Technology, Faculty of Engineering and Architecture, Department of Energy Technology, P.O. Box 4400, FI-02015 TKK (Finland); Gebremedhin, Alemayehu [Linkoeping University, IEI, Division of Energy Systems, SE-581 83 Linkoeping (Sweden)

    2009-03-15

    By using thermal storages it is possible to decouple the generation of power and heat, and it can also lead to an reduction in investments, as the storage can be used to cover the peak load periods. This work presents a MINLP model that can be used for analysing new investments and the long-term operation of CHP plants in a district heating network with long-term thermal storage. The model presented in this work includes the non-linear off-design behaviour of the CHP plants as well as a generic mathematical model of the thermal storage, without the need to fix temperatures and pressure. The model is formulated in such a way that it is suitable for deterministic MINLP solvers. The model is non-convex, and subsequently global optimality cannot be guaranteed with local solvers. In order to reduce the chance of obtaining a poor local optimum compared to the global optimum, the model should be solved many times with the initial values varying randomly. It is possible to extract a lot of results from the model, for instance total annual profit, the optimal selection of process options, mass flow through the plant, and generated power from each plant. The formulation of the model makes it suitable for deterministic MINLP solvers. (author)

  17. Increased electrical efficiency in biofueled CHP plants by biomass drying; Oekat elutbyte i biobraensleeldade kraftvaermeanlaeggningar med hjaelp av foertorkning

    Energy Technology Data Exchange (ETDEWEB)

    Berntsson, Mikael; Thorson, Ola; Wennberg, Olle

    2010-09-15

    In this report, integrated biofuel drying has been studied for two cases. One is the existing CHP plant at ENA Energi AB in Enkoeping and the other is a theoretical case. The thought plant is assumed to have a steam generating performance that is probable for a future CHP plant optimised for power production. The CHP plant at ENA Energi with its integrated bed drying system has been used as a model in this study. The plant has a grate fired boiler with the capacity to co-produce 24 MW electricity and 55 MW heat. It is designed to use biofuel with moisture content between 40 and 55 %. However, the boiler is able to manage even dryer fuels with the moisture content of about 35 % without complications. Since the boiler operates on part load during most of the season, there are free capacity which can be used for delivering heat to the drying system. The increased power production is a result of mainly two factors: Increased demand of heat as the dryer uses district heating and thus improved possibility to produce steam; and, The season of operation can be extended, since the point where the minimum load of the boiler occurs can be pushed forward as a result of increased demand of heat. For future CHP plants, an optimised plant has been used as a model. The steam data is assumed to be 170 bar and 540 deg C with reheating. For this plant, both on-site and offsite drying have been studied. The case study comprises a whole season of operation and the fuel is assumed to be dried from 50 to 10 %. The size of the optimised plant is as to fit the dimension of a main production unit in a district heating net equal to the tenth largest in Sweden. Heat delivery is assumed to be 896 GWh/year and the maximum heat delivery of district heating is 250 MW. The sizing of the boiler is made to maximise the production of electricity, and thus dependent of the drying strategy used. Flue gas condensation is assumed to be used as much as possible. It decreases the basis for power production

  18. Incoherent Dictionary Learning Method Based on Unit Norm Tight Frame and Manifold Optimization for Sparse Representation

    Directory of Open Access Journals (Sweden)

    HongZhong Tang

    2016-01-01

    Full Text Available Optimizing the mutual coherence of a learned dictionary plays an important role in sparse representation and compressed sensing. In this paper, a efficient framework is developed to learn an incoherent dictionary for sparse representation. In particular, the coherence of a previous dictionary (or Gram matrix is reduced sequentially by finding a new dictionary (or Gram matrix, which is closest to the reference unit norm tight frame of the previous dictionary (or Gram matrix. The optimization problem can be solved by restricting the tightness and coherence alternately at each iteration of the algorithm. The significant and different aspect of our proposed framework is that the learned dictionary can approximate an equiangular tight frame. Furthermore, manifold optimization is used to avoid the degeneracy of sparse representation while only reducing the coherence of the learned dictionary. This can be performed after the dictionary update process rather than during the dictionary update process. Experiments on synthetic and real audio data show that our proposed methods give notable improvements in lower coherence, have faster running times, and are extremely robust compared to several existing methods.

  19. State Feedback H∞ Control of Power Units Based on an Improved Particle Swarm Optimization

    Directory of Open Access Journals (Sweden)

    Zhongqiang Wu

    2015-01-01

    Full Text Available A new state feedback H∞ control scheme is presented used in the boiler-turbine power units based on an improved particle swarm optimizing algorithm. Firstly, the nonlinear system is transformed into a linear time-varying system; then the H∞ control problem is transformed into the solution of a Riccati equation. The control effect of H∞ controller depends on the selection of matrix P, so an improved particle swarm optimizing (PSO algorithm by introducing differential evolution algorithm is used to solve the Riccati equation. The main purpose is that mutation and crossover are introduced for a new population, and the population diversity is improved. It is beneficial to eliminate stagnation caused by premature convergence, and the algorithm convergence rate is improved. Finally, the real-time optimizing of the controller parameters is realized. Theoretical analysis and simulation results show that a state feedback H∞ controller can be obtained, which can ensure asymptotic stability of the system, and the double objectives of stabilizing system and suppressing the disturbance are got. The system can work well over a large range working point.

  20. Research of Coalbed Methane Development Well-Type Optimization Method Based on Unit Technical Cost

    Directory of Open Access Journals (Sweden)

    Shiqun Li

    2016-08-01

    Full Text Available Coalbed Methane (CBM is a high-quality unconventional energy resource. The successful development and utilization of a CBM resource needs to consider technical feasibility and economic viability. These factors are also necessary for the improvement of production safety in coal mines, reducing carbon emission, and optimizing energy structure. Because of its unique resource characteristics, surface drilling is the prevailing development approach all over the world. Directional and horizontal wells are generally the two major well-types for CBM development. Development well-type is an important factor affecting CBM efficient development, as it is a key factor in the process of the economic and effective development of CBM resource. In this paper, a method based on Unit Technical Cost (UTC will be constructed from the perspective of economic viability, and will be used for more simple and accurate optimization of CBM. This method is used for practical well-type optimization in two major CBM development basins in China, and the application results prove that this method is scientifically accurate and feasible.

  1. An optimization algorithm for joint mechanics estimate using inertial measurement unit data during a squat task.

    Science.gov (United States)

    Bonnet, Vincent; Mazzà, Claudia; Fraisse, Philippe; Cappozzo, Aurelio

    2011-01-01

    The use of dynamic optimization as a tool to estimate joint kinematics and kinetics, and ground reaction forces using data from a single inertial measurement unit (IMU) positioned on the lower trunk was investigated. The feasibility of this approach and its accuracy was explored for the analysis of a squat task, focusing on the ankle, knee and hip joints. An optimal motor control strategy aimed at minimizing the sum of the intersegmental couples and of their time derivatives was imposed to estimate the mechanics of a three-segment sagittal model. Moreover, in the optimization process constraints to the measured vertical acceleration, to the maximal vertical IMU excursion, and with regard to the maintenance of dynamic balance were imposed. Experiments were performed using 10 volunteers. Data were collected from the IMU, from a stereophotogrammetric system (SS) and from a force platform for validation purposes. Results showed a very good consistency of the model output with the lower limb joint trajectories, as obtained using the SS, and with the measured vertical component of the ground reaction (low root mean square differences (<10%) and high correlation coefficients (0.98)).

  2. Load control in low voltage level of the electricity grid using µCHP appliances

    NARCIS (Netherlands)

    Bosman, M.G.C.; Bakker, Vincent; Molderink, Albert; Hurink, Johann L.; Smit, Gerardus Johannes Maria

    2008-01-01

    The introduction of microCHP (Combined Heat and Power) appliances and other means of distributed generation causes a shift in the way electricity is produced and consumed. Households themselves produce electricity and deliver the surplus to the grid. In this way, the distributed generation also has

  3. A Compound Herbal Preparation (CHP) in the Treatment of Children with ADHD: A Randomized Controlled Trial

    Science.gov (United States)

    Katz, M.; Adar Levine, A.; Kol-Degani, H.; Kav-Venaki, L.

    2010-01-01

    Objective: Evaluation of the efficacy of a patented, compound herbal preparation (CHP) in improving attention, cognition, and impulse control in children with ADHD. Method: Design: A randomized, double-blind, placebo-controlled trial. Setting: University-affiliated tertiary medical center. Participants: 120 children newly diagnosed with ADHD,…

  4. EFFICIENCY OF THE USE OF HEAT PUMPS ON THE CHP PLANTS

    Directory of Open Access Journals (Sweden)

    Juravleov A.A.

    2007-04-01

    Full Text Available The work is dedicated to the calculus of the efficiency of the use of heat pumps on the CHP plants. There are presented the interdependences between the pay-back period and NPV of heat pump and the price of 1 kWt of thermal power of heat pump and of the tariff of electricity.

  5. Innovative Hybrid CHP systems for high temperature heating plant in existing buildings

    NARCIS (Netherlands)

    de Santoli, Livio; Lo Basso, Gianluigi; Nastasi, B.; d’Ambrosio Alfano, Francesca R.; Mazzarella and Piercarlo, Livio

    2017-01-01

    This paper deals with the potential role of new hybrid CHP systems application providing both electricity and heat which are compatible with the building architectural and landscape limitations. In detail, three different plant layout options for high temperature heat production along with the

  6. A price mechanism for supply demand matching in local grid of households with micro-CHP

    NARCIS (Netherlands)

    Larsen, G.K.H.; van Foreest, N.D.; Scherpen, J.M.A.

    2012-01-01

    This paper describes a dynamic price mechanism to coordinate eletric power generation from micro Combined Heat and Power (micro-CHP) systems in a network of households. It is assumed that the households are prosumers, i.e. both producers and consumers of electricity. The control is done on household

  7. Changes of the thermodynamic parameters in failure conditions of the micro-CHP cycle

    Science.gov (United States)

    Matysko, Robert; Mikielewicz, Jarosław; Ihnatowicz, Eugeniusz

    2014-03-01

    The paper presents the calculations for the failure conditions of the ORC (organic Rankine cycle) cycle in the electrical power system. It analyses the possible reasons of breakdown, such as the electrical power loss or the automatic safety valve failure. The micro-CHP (combined heat and power) system should have maintenance-free configuration, which means that the user does not have to be acquainted with all the details of the ORC system operation. However, the system should always be equipped with the safety control systems allowing for the immediate turn off of the ORC cycle in case of any failure. In case of emergency, the control system should take over the safety tasks and protect the micro-CHP system from damaging. Although, the control systems are able to respond quickly to the CHP system equipped with the inertial systems, the negative effects of failure are unavoidable and always remain for some time. Moreover, the paper presents the results of calculations determining the inertia for the micro-CHP system of the circulating ORC pump, heat removal pump (cooling condenser) and the heat supply pump in failure conditions.

  8. Calorimetric studies and lessons on fires and explosions of a chemical plant producing CHP and DCPO

    Energy Technology Data Exchange (ETDEWEB)

    Hsu, Jing-Ming; Su, Mao-Sheng; Huang, Chiao-Ying [Department of Occupational Safety and Health, Chia Nan University of Pharmacy and Science, Tainan, Taiwan, ROC (China); Duh, Yih-Shing, E-mail: yihshingduh@yahoo.com.tw [Department of Safety, Health and Environmental Engineering, National United University, No. 1 Lien-Da, Miaoli, Taiwan, ROC (China)

    2012-05-30

    Highlights: Black-Right-Pointing-Pointer We analyzed fire and explosion incidents in a plant producing CHP and DCPO. Black-Right-Pointing-Pointer Data from calorimeters reveal causes and phenomena associated with the incidents. Black-Right-Pointing-Pointer The credible worst scenario was thermal explosion. Black-Right-Pointing-Pointer Incidents may be avoided by implementing DIERS methodology. - Abstract: Cumene hydroperoxide (CHP) has been used in producing phenol, dicumyl peroxide (DCPO) and as an initiator for synthesizing acrylonitrile-butadiene-styrene (ABS) resin by copolymerization in Taiwan. Four incidents of fire and explosion induced by thermal runaway reactions were occurred in a same plant producing CHP, DCPO and bis-(tert-butylperoxy isopropyl) benzene peroxide (BIBP). The fourth fire and explosion occurred in the CHP reactor that resulted in a catastrophic damage in reaction region and even spread throughout storage area. Descriptions on the occurrences of these incidents were assessed by the features of processes, reaction schemes and unexpected side reactions. Calorimetric data on thermokinetics and pressure were used for explaining the practical consequences or which the worst cases encountered in this kind of plant. Acceptable risk associated with emergency relief system design is vital for a plant producing organic peroxide. These basic data for designing an inherently safer plant can be conducted from adiabatic calorimetry. An encouraging deduction has been drawn here, these incidents may be avoided by the implementation of API RP 520, API RP 521, DIERS technology, OSHA 1910.119 and AIChE's CCPS recommended PSM elements.

  9. Pilot test and optimization of plasma based DeNO{sub x}. Final report

    Energy Technology Data Exchange (ETDEWEB)

    Stamate, E.; Chen, W.; Michelsen, P.K. (Risoe DTU. PLF, Roskilde (Denmark)); Joergensen, L.; Jensen, T.K.; Kristensen, P.G.; Tobiasen, L.; Simonsen, P. (Dansk Gasteknisk Center, Hoersholm (Denmark))

    2010-12-15

    A technique for NO{sub x} reduction for combustion processes was examined. The technique is based on injecting ozone into the NO{sub x} containing flue gas where it will react with NO{sub x}, forming an anhydride of nitric acid, N{sub 2}O{sub 5}. N{sub 2}O{sub 5} is easily removed later using a water scrubber. The technique was tested on a gas engine based CHP unit and a CHP unit based on a straw-fired boiler and a steam turbine. It was found that: 1) NO{sub x} emissions can be reduced by more than 95 % by adding ozone to the flue gas; 2) The technique is applicable on flue gas from biomass combustion despite the presence of compounds such as SO{sub 2} and HCl; 3) Reduction of NO{sub x} emissions requires approximately half as much O{sub 3} when it is applied to the natural gas fired engine unit compared to the straw-fired boiler unit; 4) The higher O{sub 3} consumption on straw-fired units is due both to higher flue gas temperature and to larger NO{sub x} fluctuations in the flue gas compared to the gas engine unit; 5) For the gas engine unit the formaldehyde emission was reduced by 60%; 6) SO{sub 2} emissions are eliminated by the deNO{sub x} unit. It can be concluded that at present the plasma deNO{sub x} process suffers from too high capital and operating costs and too low plant operating time to be an attractive alternative for gas engine CHP plants. Furthermore, there is only a small gap of approx. 25 % between the specific ozone consumption obtained at the pilot test in Ringsted and the theoretically achievable value. This difference is too small to have a major impact on process economy in case of an optimized deNO{sub x} process. At straw fired plants the technology tends to be more promising for several reasons: 1) Significant potential for optimizing specific ozone consumption. 2) Larger NO{sub x} reduction due to the fact that higher concentration levels in the flue gas generate higher income from e.g. fertilizer sales. 3) Reduced or zero SO{sub 2

  10. The Chp1–Tas3 core is a multifunctional platform critical for gene silencing by RITS

    Energy Technology Data Exchange (ETDEWEB)

    Schalch, Thomas; Job, Godwin; Shanker, Sreenath; Partridge, Janet F.; Joshua-Tor, Leemor

    2011-11-13

    RNA interference (RNAi) is critical for the assembly of heterochromatin at Schizosaccharomyces pombe centromeres. Central to this process is the RNA-induced initiation of transcriptional gene silencing (RITS) complex, which physically anchors small noncoding RNAs to chromatin. RITS includes Ago1, the chromodomain protein Chp1, and Tas3, which forms a bridge between Chp1 and Ago1. Chp1 is a large protein with no recognizable domains, apart from its chromodomain. Here we describe how the structured C-terminal half of Chp1 binds the Tas3 N-terminal domain, revealing the tight association of Chp1 and Tas3. The structure also shows a PIN domain at the C-terminal tip of Chp1 that controls subtelomeric transcripts through a post-transcriptional mechanism. We suggest that the Chp1–Tas3 complex provides a solid and versatile platform to recruit both RNAi-dependent and RNAi-independent gene-silencing pathways for locus-specific regulation of heterochromatin.

  11. Evaluation of Combined Heat and Power (CHP Systems Using Fuzzy Shannon Entropy and Fuzzy TOPSIS

    Directory of Open Access Journals (Sweden)

    Fausto Cavallaro

    2016-06-01

    Full Text Available Combined heat and power (CHP or cogeneration can play a strategic role in addressing environmental issues and climate change. CHP systems require less fuel than separate heat and power systems in order to produce the same amount of energy saving primary energy, improving the security of the supply. Because less fuel is combusted, greenhouse gas emissions and other air pollutants are reduced. If we are to consider the CHP system as “sustainable”, we must include in its assessment not only energetic performance but also environmental and economic aspects, presenting a multicriteria issue. The purpose of the paper is to apply a fuzzy multicriteria methodology to the assessment of five CHP commercial technologies. Specifically, the combination of the fuzzy Shannon’s entropy and the fuzzy Technique for Order of Preference by Similarity to Ideal Solution (TOPSIS approach will be tested for this purpose. Shannon’s entropy concept, using interval data such as the α-cut, is a particularly suitable technique for assigning weights to criteria—it does not require a decision-making (DM to assign a weight to the criteria. To rank the proposed alternatives, a fuzzy TOPSIS method has been applied. It is based on the principle that the chosen alternative should be as close as possible to the positive ideal solution and be as far as possible from the negative ideal solution. The proposed approach provides a useful technical–scientific decision-making tool that can effectively support, in a consistent and transparent way, the assessment of various CHP technologies from a sustainable point of view.

  12. Biomass fired small-scale CHP technologies - Present status and possibilities

    Energy Technology Data Exchange (ETDEWEB)

    Konttinen, J. (Univ. of Jyvaeskylae, Jyvaeskylae (Finland), Renewable energy programme), e-mail: jukontti@jyu.fi; Linna, V. (VTT Technical Research Centre of Finland, Jyvaeskylae (Finland)), e-mail: veli.linna@vtt.fi; Uusi-Maahi, I. (Keulink Oy, Keuruu (Finland)), e-mail: ilkka.uusi-maahi@keulink.fi

    2010-07-01

    The competitiveness of biomass-fuelled CHP (Combined Heat and Power) production technologies is rising. Small-scale (or micro-CHP) means power and heat production in the scale of 10...1000 kW{sub e} by combustion or gasification of biomass. A survey about the commercial potential and technologies in Europe of micro-CHP was made by the University of Jyvaeskylae and VTT (Technical Research Centre of Finland). The survey was funded by Keulink Oy and Jyvaeskylae Innovation Oy. According to the results of the literature survey, the most promising technologies for power production are based on so called ORC (Organic Rankine Cycle) and Stirling engines. Woody-type of biomass is the best raw material for these applications. With the small-scale technologies, the power production efficiency can vary in the range of 15...30 % of the biomass thermal input. New innovative technologies for small-scale CHP application of woody biomass are being developed by private companies in Central and Northern Finland. Some of these are presented in more detail. The technologies are either based on combustion or gasification of wood-based biomass. Using the product gas in combustion engines requires cleaning, which can be carried out with innovative dry or wet clearing processes. Dry cleaning is possible with catalysts and wet cleaning with scrubbers. The small-scale CHP technologies offer significant potential in local consumption sites of power and heat, such as greenhouses and farms. So called 'eco-villages' are also being built to demonstrate this potential. The possibilities for producing liquid transport fuels, such as biodiesel, are also discussed in this paper. (orig.)

  13. Hydrodynamic optimization of trust ring pump and lubricating oil system for large hydroelectric units thrust bearing

    Science.gov (United States)

    Lai, X.; Lu, Z.; Zhang, X.; Yang, S.

    2014-03-01

    Thrust-ring-pump is a kind of extreme-low specific speed centrifugal pump with special structure as numerous restrictions form thrust bearing and operation conditions of hydro turbine generator unit. Because the oil circulating and cooling system with thrust-ring- pump has a lot of advantages in maintenance and compactness in structure, it has widely been used in large and medium-sized hydro-generator units. Since the diameter and the speed of the thrust ring is limited by the generator set, the matching relationship between the flow passage inside the thrust ring (equivalent to impeller) and oil bath (equivalent to volute) has great influence on hydrodynamic performance of thrust-ring-pump, additionally, the head and discharge are varying with the operation conditions of hydro-generator unit and characteristic of the oil circulating and cooling system. As so far, the empirical calculation method is employed during the actual engineering design, in order to guarantee the operating performance of the oil circulating and cooling system with thrust-ring-pump at different conditions, a collaborative hydrodynamic design and optimization of both the oil circulating and cooling system and thrust-ring-pump is purposed in this paper. Firstly, the head and discharge required at different conditions are decided by 1D flow numerical simulation of the oil circulating and cooling system. Secondly, the flow passages of thrust-ring-pump are empirically designed under the restrictions of diameter and the speed of the thrust ring according to the head and discharge from the simulation. Thirdly, the flow passage geometry matching optimization between holes inside the thrust ring and oil bath is implemented by means of 3D flow simulation and performance prediction. Then, the pumps and the oil circulating and cooling system are collaborative hydrodynamic optimized with predicted head- discharge curve and the efficiency-discharge curve of thrust-ring-pump. The presented methodology has

  14. Optimization of cord blood unit sterility testing: impact of dilution, analysis delay, and inhibitory substances.

    Science.gov (United States)

    Girard, Mélissa; Laforce-Lavoie, Audrey; de Grandmont, Marie Joëlle; Cayer, Marie-Pierre; Fournier, Diane; Delage, Gilles; Thibault, Louis

    2017-08-01

    Different methods are used by cord blood banks to prepare samples for sterility testing. Suboptimal methods can result in the release of contaminated products. In our organization, samples are prepared by diluting the final product in RPMI-1640 medium. In this work, we have compared our method with different approaches to verify whether optimization should be sought. Cord blood units (n = 6 units per bacterial strain) characterized to contain inhibitory substances or not were inoculated (10 colony-forming units/mL) with Streptococcus agalactiae, Staphylococcus epidermidis, Klebsiella pneumoniae, Escherichia coli, or Bacteroides fragilis. After plasma and red blood cell removal, stem cell concentrates were diluted in RPMI-1640, thioglycollate, or the unit's plasma. These products, as well as final product, plasma, and red blood cell fractions, were held from 0 to 72 hours at 20 to 24°C before inoculation in culture bottles and detection using the BacT/ALERT 3D system. Dilution of cell concentrates in RPMI-1640 allowed bacterial detection in 93.3% of noninhibitory cord blood samples after a 24-hour storage period. Thioglycollate medium better promoted bacterial growth in inhibitory cord blood samples that were held for 72 hours before testing (66.7%) compared with RPMI-1640 (45.0%). Less than 33% of all spiked plasma samples were detected by the BacT/ALERT 3D system. Diluting cord blood samples in culture medium containing bacterial growth promoting substances is a suitable option for sterility testing, whereas the use of plasma should be proscribed, because it might lead to false-negative results. Because inhibitory substances affect bacterial growth, inoculation of culture bottles should be done rapidly after sample preparation. © 2017 AABB.

  15. Experimental investigation of an eight-qubit unit cell in a superconducting optimization processor

    Science.gov (United States)

    Harris, R.; Johnson, M. W.; Lanting, T.; Berkley, A. J.; Johansson, J.; Bunyk, P.; Tolkacheva, E.; Ladizinsky, E.; Ladizinsky, N.; Oh, T.; Cioata, F.; Perminov, I.; Spear, P.; Enderud, C.; Rich, C.; Uchaikin, S.; Thom, M. C.; Chapple, E. M.; Wang, J.; Wilson, B.; Amin, M. H. S.; Dickson, N.; Karimi, K.; MacReady, B.; Truncik, C. J. S.; Rose, G.

    2010-07-01

    A superconducting chip containing a regular array of flux qubits, tunable interqubit inductive couplers, an XY-addressable readout system, on-chip programmable magnetic memory, and a sparse network of analog control lines has been studied. The architecture of the chip and the infrastructure used to control it were designed to facilitate the implementation of an adiabatic quantum optimization algorithm. The performance of an eight-qubit unit cell on this chip has been characterized by measuring its success in solving a large set of random Ising spin-glass problem instances as a function of temperature. The experimental data are consistent with the predictions of a quantum mechanical model of an eight-qubit system coupled to a thermal environment. These results highlight many of the key practical challenges that we have overcome and those that lie ahead in the quest to realize a functional large-scale adiabatic quantum information processor.

  16. Characterization of seven United States coal regions. The development of optimal terrace pit coal mining systems

    Energy Technology Data Exchange (ETDEWEB)

    Wimer, R.L.; Adams, M.A.; Jurich, D.M.

    1981-02-01

    This report characterizes seven United State coal regions in the Northern Great Plains, Rocky Mountain, Interior, and Gulf Coast coal provinces. Descriptions include those of the Fort Union, Powder River, Green River, Four Corners, Lower Missouri, Illinois Basin, and Texas Gulf coal resource regions. The resource characterizations describe geologic, geographic, hydrologic, environmental and climatological conditions of each region, coal ranks and qualities, extent of reserves, reclamation requirements, and current mining activities. The report was compiled as a basis for the development of hypothetical coal mining situations for comparison of conventional and terrace pit surface mining methods, under contract to the Department of Energy, Contract No. DE-AC01-79ET10023, entitled The Development of Optimal Terrace Pit Coal Mining Systems.

  17. Emissions from decentralised CHP plants 2007 - Energinet.dk Environmental project no. 07/1882. Project report 5 - Emission factors and emission inventory for decentralised CHP production

    Energy Technology Data Exchange (ETDEWEB)

    Nielsen, Malene; Nielsen, Ole-Kenneth; Thomsen, M.

    2010-06-15

    Updated emission factors for decentralised combined heat and power (CHP) plants with a capacity < 25MWe have been estimated based on project emission measurements as well as emission measurements performed in recent years that were collected. The emission factors valid for 2006/2007 have been estimated for the plant technologies: Municipal solid waste (MSW) incineration plants, plants combusting straw or wood, natural gas fuelled reciprocating engines, biogas fuelled engines, natural gas fuelled gas turbines, gas oil fuelled reciprocating engines, gas oil fuelled gas turbines, steam turbines combusting residual oil and reciprocating engines combusting biomass producer gas based on wood. The emission factors for MSW incineration plants are much lower than the emission factors that were estimated for year 2000. The considerable reduction in the emission factors is a result of lower emission limit values in Danish legislation since 2006 that has lead to installation of new and improved flue gas cleaning systems in most MSW incineration plants. For CHP plants combusting wood or straw no major technical improvements have been implemented. The emission factors for natural gas fuelled reciprocating engines have been reduced since year 2000 as a result of technical improvements that have been carried out due to lower emission limit values in Danish legislation. The NO{sub x} emission factor for natural gas fuelled gas turbines has decreased 62 % since year 2000. This is a result of installation of low-NO{sub x} burners in almost all gas turbines that has been necessary to meet new emission limits in Danish legislation. The emission measurements programme included screening of the emissions of HCB, PCB, PCDD/-F and PBDD/-F. Compared to the Danish national emission decentralized CHP plants are major emission sources for CH{sub 4}, NO{sub x}, SO{sub 2}, heavy metals and HCB. (author)

  18. Research, Development and Demonstration of Micro-CHP System for Residential Applications

    Energy Technology Data Exchange (ETDEWEB)

    Karl Mayer

    2010-03-31

    ECR International and its joint venture company, Climate Energy, are at the forefront of the effort to deliver residential-scale combined heat and power (Micro-CHP) products to the USA market. Part of this substantial program is focused on the development of a new class of steam expanders that offers the potential for significantly lower costs for small-scale power generation technology. The heart of this technology is the scroll expander, a machine that has revolutionized the HVAC refrigerant compressor industry in the last 15 years. The liquid injected cogeneration (LIC) technology is at the core of the efforts described in this report, and remains an excellent option for low cost Micro-CHP systems. ECR has demonstrated in several prototype appliances that the concept for LIC can be made into a practical product. The continuing challenge is to identify economical scroll machine designs that will meet the performance and endurance requirements needed for a long life appliance application. This report describes the numerous advances made in this endeavor by ECR International. Several important advances are described in this report. Section 4 describes a marketing and economics study that integrates the technical performance of the LIC system with real-world climatic data and economic analysis to assess the practical impact that different factors have on the economic application of Micro-CHP in residential applications. Advances in the development of a working scroll steam expander are discussed in Section 5. A rigorous analytical assessment of the performance of scroll expanders, including the difficult to characterize impact of pocket to pocket flank leakage, is presented in Section 5.1. This is followed with an FEA study of the thermal and pressure induced deflections that would result from the normal operation of an advanced scroll expander. Section 6 describes the different scroll expanders and test fixtures developed during this effort. Another key technical

  19. Treatment of District Energy CHP Outputs in LEED® for Building Design and Construction: New Construction and Major Renovations

    Science.gov (United States)

    This fact sheet summarizes how buildings connected to a CHP- equipped district energy system can earn more LEED® points than they could otherwise earn. It presents guidance for meeting the LEED® Minimum Energy Performance prerequisite and calculating point

  20. High Affinity Binding of Chp1 Chromodomain to K9 Methylated Histone H3 is Required to Establish Centromeric Hterochromatin

    Energy Technology Data Exchange (ETDEWEB)

    Schalch, T.; Job, G; Noffsinger, V; Shanker, S; Kuscu, C; Joshua-Tor, L; Partridge, J

    2009-01-01

    In fission yeast, assembly of centromeric heterochromatin requires the RITS complex, which consists of Ago1, Tas3, Chp1, and siRNAs derived from centromeric repeats. Recruitment of RITS to centromeres has been proposed to depend on siRNA-dependent targeting of Ago1 to centromeric sequences. Previously, we demonstrated that methylated lysine 9 of histone H3 (H3K9me) acts upstream of siRNAs during heterochromatin establishment. Our crystal structure of Chp1's chromodomain in complex with a trimethylated lysine 9 H3 peptide reveals extensive sites of contact that contribute to Chp1's high-affinity binding. We found that this high-affinity binding is critical for the efficient establishment of centromeric heterochromatin, but preassembled heterochromatin can be maintained when Chp1's affinity for H3K9me is greatly reduced.

  1. CHP and Local Governments: Case Studies and EPA’s New Guide (Webinar) – September 30, 2014

    Science.gov (United States)

    This webinar presents two case studies of CHP development projects undertaken through cooperation between private companies and government entities, and introduces an EPA guide to assist local governments to reduce greenhouse gas (GHG) emissions.

  2. Integrated HT-PEMFC and multi-fuel reformer for micro CHP. Final report

    Energy Technology Data Exchange (ETDEWEB)

    2010-07-01

    The project was initiated in April 2008 and completed by the end of March 2010. The project consortium consisted of: Dantherm Power, Serenergy and Department of Energy Technology at Aalborg University (project manager). The activities were coordinated with the project ''Nordjysk H2FC Center'' funded by the Region of Northern Jutland. A number of experimental characterization methods were developed through this project to improve the understanding in fuel cell performance under different operating conditions. In particular the application of Electrochemical Impedance Spectroscopy was found useful and lead to new information about individual losses in the fuel cell. Techniques to measure local temperatures of the MEA were also successfully developed. Durability studies were made on single cells as well as complete stacks. A dedicated test facility was constructed in a container to isolate the test from disturbances that occur in the laboratory. The stack tests were run for just above 6 months with few interruptions and it was found that single cell and stack degradation rates were comparable. Operation temperature was found to have the most pronounced influence on degradation. The information formed the basis for a simple modeling tool to optimize the stack operating temperature versus reformate gas CO concentration. The activities on multi-fuel reformer development were mostly focused on two issues; manufacturability and analyses of flow distribution and heat transfer. The latter was required since these areas these turned out to cause challenges in the reactor design. Through a combination of experimental tests, CFD analyses and flow network modeling design modifications were suggested to improve flow distribution on both the flue gas side and the reformate side. Most of these design changes were not validated in this project through the construction and test of a new reformer. In spite of the problems identifies, the reformed successfully

  3. Optimizing landslide susceptibility zonation: Effects of DEM spatial resolution and slope unit delineation on logistic regression models

    Science.gov (United States)

    Schlögel, R.; Marchesini, I.; Alvioli, M.; Reichenbach, P.; Rossi, M.; Malet, J.-P.

    2018-01-01

    We perform landslide susceptibility zonation with slope units using three digital elevation models (DEMs) of varying spatial resolution of the Ubaye Valley (South French Alps). In so doing, we applied a recently developed algorithm automating slope unit delineation, given a number of parameters, in order to optimize simultaneously the partitioning of the terrain and the performance of a logistic regression susceptibility model. The method allowed us to obtain optimal slope units for each available DEM spatial resolution. For each resolution, we studied the susceptibility model performance by analyzing in detail the relevance of the conditioning variables. The analysis is based on landslide morphology data, considering either the whole landslide or only the source area outline as inputs. The procedure allowed us to select the most useful information, in terms of DEM spatial resolution, thematic variables and landslide inventory, in order to obtain the most reliable slope unit-based landslide susceptibility assessment.

  4. Optimal design of compact organic Rankine cycle units for domestic solar applications

    Directory of Open Access Journals (Sweden)

    Barbazza Luca

    2014-01-01

    Full Text Available Organic Rankine cycle turbogenerators are a promising technology to transform the solar radiation harvested by solar collectors into electric power. The present work aims at sizing a small-scale organic Rankine cycle unit by tailoring its design for domestic solar applications. Stringent design criteria, i. e., compactness, high performance and safe operation, are targeted by adopting a multi-objective optimization approach modeled with the genetic algorithm. Design-point thermodynamic variables, e. g., evaporating pressure, the working fluid, minimum allowable temperature differences, and the equipment geometry, are the decision variables. Flat plate heat exchangers with herringbone corrugations are selected as heat transfer equipment for the preheater, the evaporator and the condenser. The results unveil the hyperbolic trend binding the net power output to the heat exchanger compactness. Findings also suggest that the evaporator and condenser minimum allowable temperature differences have the largest impact on the system volume and on the cycle performances. Among the fluids considered, the results indicate that R1234yf and R1234ze are the best working fluid candidates. Using flat plate solar collectors (hot water temperature equal to 75 °C, R1234yf is the optimal solution. The heat exchanger volume ranges between 6.0 and 23.0 dm3, whereas the thermal efficiency is around 4.5%. R1234ze is the best working fluid employing parabolic solar collectors (hot water temperature equal to 120 °C. In such case the thermal efficiency is around 6.9%, and the heat exchanger volume varies from 6.0 to 18.0 dm3.

  5. SpecOp: Optimal Extraction Software for Integral Field Unit Spectrographs

    Science.gov (United States)

    McCarron, Adam; Ciardullo, Robin; Eracleous, Michael

    2018-01-01

    The Hobby-Eberly Telescope’s new low resolution integral field spectrographs, LRS2-B and LRS2-R, each cover a 12”x6” area on the sky with 280 fibers and generate spectra with resolutions between R=1100 and R=1900. To extract 1-D spectra from the instrument’s 3D data cubes, a program is needed that is flexible enough to work for a wide variety of targets, including continuum point sources, emission line sources, and compact sources embedded in complex backgrounds. We therefore introduce SpecOp, a user-friendly python program for optimally extracting spectra from integral-field unit spectrographs. As input, SpecOp takes a sky-subtracted data cube consisting of images at each wavelength increment set by the instrument’s spectral resolution, and an error file for each count measurement. All of these files are generated by the current LRS2 reduction pipeline. The program then collapses the cube in the image plane using the optimal extraction algorithm detailed by Keith Horne (1986). The various user-selected options include the fraction of the total signal enclosed in a contour-defined region, the wavelength range to analyze, and the precision of the spatial profile calculation. SpecOp can output the weighted counts and errors at each wavelength in various table formats using python’s astropy package. We outline the algorithm used for extraction and explain how the software can be used to easily obtain high-quality 1-D spectra. We demonstrate the utility of the program by applying it to spectra of a variety of quasars and AGNs. In some of these targets, we extract the spectrum of a nuclear point source that is superposed on a spatially extended galaxy.

  6. Experiences from operation of different expansion devices for application in domestic micro CHP

    Science.gov (United States)

    Mikielewicsz, Dariusz; Mikielewicz, Jarosław; Wajs, Jan

    2010-10-01

    In the paper presented are experiences from operation of three different expansion devices for possible implementation in the domestic micro CHP. These were the modified scroll expander and two designs based on the variable working chamber volume pneumatic devices. Experiments showed the superiority of both "pneumatic devices" over the scroll expander, indicating the possible internal efficiencies in the range of 61 82Such efficiencies are very attractive, especially at the higher end of that range. The volume of these devices is much smaller than the scroll expander which makes it again more suitable for a domestic micro CHP. Small rotational velocities enable to conclude that connection to electricity grid will also be simpler in the case of "pneumatic devices". The "pneumatic devices" under scrutiny here could be an alternative to the typical vapour turbine in the ORC cycle, which is in the process of development at the IFFM.

  7. Simulation and Optimization of Vacuum Swing Adsorption Units for Spacesuit Carbon Dioxide and Humidity Control

    Science.gov (United States)

    Swickrath, Michael J.; Anderson, Molly; McMillin, Summer; Broerman, Craig

    2011-01-01

    Controlling carbon dioxide (CO2) and humidity levels in a spacesuit is critical to ensuring both the safety and comfort of an astronaut during extra-vehicular activity (EVA). Traditionally, this has been accomplished utilizing either non-regenerative lithium hydroxide (LiOH) or regenerative but heavy metal oxide (MetOx) canisters which pose a significant weight burden. Although such technology enables air revitalization, the volume requirements to store the waste canisters as well as the mass to transport multiple units become prohibitive as mission durations increase. Consequently, motivation exists toward developing a fully regenerative technology for spacesuit environmental control. The application of solid amine materials with vacuum swing adsorption technology has shown the capacity to control CO2 while concomitantly managing humidity levels through a fully regenerative cycle eliminating constraints imposed with the traditional technologies. Prototype air revitalization units employing this technology have been fabricated in both a rectangular and cylindrical geometry. Experimental results for these test articles have been collected and are described herein. In order to accelerate the developmental efforts, an axially-dispersed plug flow model with an accompanying energy balance has been established and correlated with the experimental data. The experimental and simulation results display good agreement for a variety of flow rates (110-170 ALM), replicated metabolic challenges (100-590 Watts), and atmosphere pressures under consideration for the spacesuit (248 and 760 mm Hg). The testing and model results lend insight into the operational capabilities of these devices as well as the influence the geometry of the device has on performance. In addition, variable metabolic profiles were imposed on the test articles in order to assess the ability of the technology to transition to new metabolic conditions. The advent of the model provides the capacity to apply

  8. Anti-diabetic effect of Cyclo-His-Pro (CHP)-enriched yeast ...

    African Journals Online (AJOL)

    The present study was designed to investigate the hypoglycemic effects of the daily oral dose of 0.50 to 0.75 g/kg of yeast hydrolysate (YH) containing high Cyclo-His-Pro (51.0 mg CHP/g YH) on normal and streptozotocin (STZ)-induced diabetic rats for 14 days. In STZ-induced diabetic rats, after administrations of the YH for ...

  9. Optimum steam data in bio-fuelled CHP; Optimala aangdata foer biobraensleeldade kraftvaermeverk

    Energy Technology Data Exchange (ETDEWEB)

    Steinwall, Pontus; Johansson, Kent; Svensson, Sven-Aake [Sycon Energikonsult AB, Malmoe (Sweden); Adolfson, Helene; Ekelund, Niclas [EPS Consulting AB, Vaenersborg (Sweden)

    2002-04-01

    This report deals with which steam data that gives the lowest electricity production cost in a biofuelled CHP. Three different sizes of CHP have been examined with a CFB of 30, 75 and 120 MWth. Calculations have been made to find how the investment cost depends on the steam data. The need of components, material and working time to build the boilers has been examined to find these costs. The costs for operation and maintenance are also affected by the steam data, especially the cost for high temperature corrosion at the superheaters. By data from other projects at Vaermeforsk the endurance of the superheaters has been estimated. The cost for manufacturing and changing the superheaters has been calculated with knowledge from projects carried through. The maintenance costs for the superheaters in are exponential to the steam data but rather proportional to the plant size at the same steam data. The steam data that is preferable has been examined by calculating the power production cost. The income from district heat is very important for the result why this is varied. The fuel price is 110 SEK/MWh but doesn't affect the result. Our conclusion is that in a CHP, credited with normal levels for the DH, should the steam temperature be under 500 deg C. The admission data should PN 160 or lower. High steam data are most interesting at low levels of the income from DH.

  10. Calorimetric studies and lessons on fires and explosions of a chemical plant producing CHP and DCPO.

    Science.gov (United States)

    Hsu, Jing-Ming; Su, Mao-Sheng; Huang, Chiao-Ying; Duh, Yih-Shing

    2012-05-30

    Cumene hydroperoxide (CHP) has been used in producing phenol, dicumyl peroxide (DCPO) and as an initiator for synthesizing acrylonitrile-butadiene-styrene (ABS) resin by copolymerization in Taiwan. Four incidents of fire and explosion induced by thermal runaway reactions were occurred in a same plant producing CHP, DCPO and bis-(tert-butylperoxy isopropyl) benzene peroxide (BIBP). The fourth fire and explosion occurred in the CHP reactor that resulted in a catastrophic damage in reaction region and even spread throughout storage area. Descriptions on the occurrences of these incidents were assessed by the features of processes, reaction schemes and unexpected side reactions. Calorimetric data on thermokinetics and pressure were used for explaining the practical consequences or which the worst cases encountered in this kind of plant. Acceptable risk associated with emergency relief system design is vital for a plant producing organic peroxide. These basic data for designing an inherently safer plant can be conducted from adiabatic calorimetry. An encouraging deduction has been drawn here, these incidents may be avoided by the implementation of API RP 520, API RP 521, DIERS technology, OSHA 1910.119 and AIChE's CCPS recommended PSM elements. Crown Copyright © 2012. Published by Elsevier B.V. All rights reserved.

  11. CHP efficiency of a 2000 × CPV system with reflective optics

    Science.gov (United States)

    Bonsignore, Gaetano; Gallitto, Aurelio Agliolo; Agnello, Simonpietro; Barbera, Marco; Gelardi, Franco M.; Sciortino, Luisa; Collura, Alfonso; Cicero, Ugo Lo; Milone, Sergio; Montagnino, Fabio M.; Paredes, Filippo; Cannas, Marco

    2015-09-01

    In this work we have developed a combined heat and power (CHP) prototype that operates at 2000 × concentration based on reflective optics. The receiver consists of a InGaP/InGaAs/Ge triple-junction solar cell in thermal contact with an aluminium heat sink driving a forced water flow. This CHP system was tested both indoor (DNI of 650 W/m2) and outdoor (DNI of 900 W/m2) under different conditions of fluid parameters as the flow rate (ranging from 0.2 liters/min to 1.2 liters/min) and temperature (ranging from 25 °C to 60 °C). Electrical and thermal power were determined by acquiring IV curves and by measuring the heat subtracted from the cell while it delivered the maximum electrical power, respectively. The obtained results demonstrate that this CHP system achieves a total efficiency of about 80%, shared between the electrical (30%) and the thermal one (50%).

  12. Access to benznidazole for Chagas disease in the United States-Cautious optimism?

    Directory of Open Access Journals (Sweden)

    Jonathan D Alpern

    2017-09-01

    Full Text Available Drugs for neglected tropical diseases (NTD are being excessively priced in the United States. Benznidazole, the first-line drug for Chagas disease, may become approved by the Food and Drug Administration (FDA and manufactured by a private company in the US, thus placing it at risk of similar pricing. Chagas disease is an NTD caused by Trypanosoma cruzi; it is endemic to Latin America, infecting 8 million individuals. Human migration has changed the epidemiology causing nonendemic countries to face increased challenges in diagnosing and managing patients with Chagas disease. Only 2 drugs exist with proven efficacy: benznidazole and nifurtimox. Benznidazole has historically faced supply problems and drug shortages, limiting accessibility. In the US, it is currently only available under an investigational new drug (IND protocol from the CDC and is provided free of charge to patients. However, 2 companies have stated that they intend to submit a New Drug Application (NDA for FDA approval. Based on recent history of companies acquiring licensing rights for NTD drugs in the US with limited availability, it is likely that benznidazole will become excessively priced by the manufacturer-paradoxically making it less accessible. However, if the companies can be taken at their word, there may be reason for optimism.

  13. Access to benznidazole for Chagas disease in the United States-Cautious optimism?

    Science.gov (United States)

    Alpern, Jonathan D; Lopez-Velez, Rogelio; Stauffer, William M

    2017-09-01

    Drugs for neglected tropical diseases (NTD) are being excessively priced in the United States. Benznidazole, the first-line drug for Chagas disease, may become approved by the Food and Drug Administration (FDA) and manufactured by a private company in the US, thus placing it at risk of similar pricing. Chagas disease is an NTD caused by Trypanosoma cruzi; it is endemic to Latin America, infecting 8 million individuals. Human migration has changed the epidemiology causing nonendemic countries to face increased challenges in diagnosing and managing patients with Chagas disease. Only 2 drugs exist with proven efficacy: benznidazole and nifurtimox. Benznidazole has historically faced supply problems and drug shortages, limiting accessibility. In the US, it is currently only available under an investigational new drug (IND) protocol from the CDC and is provided free of charge to patients. However, 2 companies have stated that they intend to submit a New Drug Application (NDA) for FDA approval. Based on recent history of companies acquiring licensing rights for NTD drugs in the US with limited availability, it is likely that benznidazole will become excessively priced by the manufacturer-paradoxically making it less accessible. However, if the companies can be taken at their word, there may be reason for optimism.

  14. An Optimized Multicolor Point-Implicit Solver for Unstructured Grid Applications on Graphics Processing Units

    Science.gov (United States)

    Zubair, Mohammad; Nielsen, Eric; Luitjens, Justin; Hammond, Dana

    2016-01-01

    In the field of computational fluid dynamics, the Navier-Stokes equations are often solved using an unstructuredgrid approach to accommodate geometric complexity. Implicit solution methodologies for such spatial discretizations generally require frequent solution of large tightly-coupled systems of block-sparse linear equations. The multicolor point-implicit solver used in the current work typically requires a significant fraction of the overall application run time. In this work, an efficient implementation of the solver for graphics processing units is proposed. Several factors present unique challenges to achieving an efficient implementation in this environment. These include the variable amount of parallelism available in different kernel calls, indirect memory access patterns, low arithmetic intensity, and the requirement to support variable block sizes. In this work, the solver is reformulated to use standard sparse and dense Basic Linear Algebra Subprograms (BLAS) functions. However, numerical experiments show that the performance of the BLAS functions available in existing CUDA libraries is suboptimal for matrices representative of those encountered in actual simulations. Instead, optimized versions of these functions are developed. Depending on block size, the new implementations show performance gains of up to 7x over the existing CUDA library functions.

  15. THE BREAKEVEN POINT GIVEN LIMIT COST USING BIOMASS CHP PLANT

    OpenAIRE

    Paula VOICU; Petruta MIHAI

    2015-01-01

    Biomass is a renewable source, non-fossil, from which can be obtained fuels, which can be used in power generation systems. The main difference of fossil fuels is the availability biomass in nature and that it is in continue "reproduction". The use its enable the use of materials that could be destined destruction, as a source of energy "renewable", though result with many ecological values. In this paper we will study, applying a calculation model in view optimal sizing of ...

  16. Optimization

    CERN Document Server

    Pearce, Charles

    2009-01-01

    Focuses on mathematical structure, and on real-world applications. This book includes developments in several optimization-related topics such as decision theory, linear programming, turnpike theory, duality theory, convex analysis, and queuing theory.

  17. Analytical optimization of digital subtraction mammography with contrast medium using a commercial unit

    Energy Technology Data Exchange (ETDEWEB)

    Rosado-Mendez, I.; Palma, B. A.; Brandan, M. E. [Instituto de Fisica, Universidad Nacional Autonoma de Mexico, 04510 Mexico City (Mexico)

    2008-12-15

    Contrast-medium-enhanced digital mammography (CEDM) is an image subtraction technique which might help unmasking lesions embedded in very dense breasts. Previous works have stated the feasibility of CEDM and the imperative need of radiological optimization. This work presents an extension of a former analytical formalism to predict contrast-to-noise ratio (CNR) in subtracted mammograms. The goal is to optimize radiological parameters available in a clinical mammographic unit (x-ray tube anode/filter combination, voltage, and loading) by maximizing CNR and minimizing total mean glandular dose (D{sub gT}), simulating the experimental application of an iodine-based contrast medium and the image subtraction under dual-energy nontemporal, and single- or dual-energy temporal modalities. Total breast-entrance air kerma is limited to a fixed 8.76 mGy (1 R, similar to screening studies). Mathematical expressions obtained from the formalism are evaluated using computed mammographic x-ray spectra attenuated by an adipose/glandular breast containing an elongated structure filled with an iodinated solution in various concentrations. A systematic study of contrast, its associated variance, and CNR for different spectral combinations is performed, concluding in the proposal of optimum x-ray spectra. The linearity between contrast in subtracted images and iodine mass thickness is proven, including the determination of iodine visualization limits based on Rose's detection criterion. Finally, total breast-entrance air kerma is distributed between both images in various proportions in order to maximize the figure of merit CNR{sup 2}/D{sub gT}. Predicted results indicate the advantage of temporal subtraction (either single- or dual-energy modalities) with optimum parameters corresponding to high-voltage, strongly hardened Rh/Rh spectra. For temporal techniques, CNR was found to depend mostly on the energy of the iodinated image, and thus reduction in D{sub gT} could be achieved

  18. Analytical optimization of digital subtraction mammography with contrast medium using a commercial unit.

    Science.gov (United States)

    Rosado-Méndez, I; Palma, B A; Brandan, M E

    2008-12-01

    Contrast-medium-enhanced digital mammography (CEDM) is an image subtraction technique which might help unmasking lesions embedded in very dense breasts. Previous works have stated the feasibility of CEDM and the imperative need of radiological optimization. This work presents an extension of a former analytical formalism to predict contrast-to-noise ratio (CNR) in subtracted mammograms. The goal is to optimize radiological parameters available in a clinical mammographic unit (x-ray tube anode/filter combination, voltage, and loading) by maximizing CNR and minimizing total mean glandular dose (D(gT)), simulating the experimental application of an iodine-based contrast medium and the image subtraction under dual-energy nontemporal, and single- or dual-energy temporal modalities. Total breast-entrance air kerma is limited to a fixed 8.76 mGy (1 R, similar to screening studies). Mathematical expressions obtained from the formalism are evaluated using computed mammographic x-ray spectra attenuated by an adipose/glandular breast containing an elongated structure filled with an iodinated solution in various concentrations. A systematic study of contrast, its associated variance, and CNR for different spectral combinations is performed, concluding in the proposal of optimum x-ray spectra. The linearity between contrast in subtracted images and iodine mass thickness is proven, including the determination of iodine visualization limits based on Rose's detection criterion. Finally, total breast-entrance air kerma is distributed between both images in various proportions in order to maximize the figure of merit CNR2/D(gT). Predicted results indicate the advantage of temporal subtraction (either single- or dual-energy modalities) with optimum parameters corresponding to high-voltage, strongly hardened Rh/Rh spectra. For temporal techniques, CNR was found to depend mostly on the energy of the iodinated image, and thus reduction in D(gT) could be achieved if the spectral energy

  19. Production optimization of cyanophycinase ChpEal from Pseudomonas alcaligenes DIP1.

    Science.gov (United States)

    Sallam, Ahmed; Kalkandzhiev, Dimitar; Steinbüchel, Alexander

    2011-11-07

    Pseudomonas alcaligenes DIP1 produces an extracellular cyanophycinase (CphEal). The corresponding gene (cphEal) was identified from subclones of a genomic DNA gene library by heterologously expressing the functionally active enzyme in Escherichia coli. The nucleotide sequence of the gene (1260 base pairs) was determined indicating a theoretical mass of 43.6 kDa (mature CphEal) plus a leader peptide of 2,6 kDa which corresponds well to the apparent molecular mass of 45 kDa as revealed by SDS-PAGE. The enzyme exhibited a high sequence identity of 91% with the extracellular cyanophycinase from P. anguilliseptica strain BI and carried an N-terminal Sec secretion signal peptide. Analysis of the amino acid sequence of cphE revealed a putative catalytic triad consisting of the serine motif GXSXG plus a histidine and a glutamate residue, suggesting a catalytic mechanism similar to serine-type proteases. The cyanophycinase (CphEal) was heterologously produced in two different E. coli strains (Top10 and BL21(DE3)) from two plasmid vectors (pBBR1MCS-4 and pET-23a(+)). The signal peptide of CphEal was cleaved in E. coli, suggesting active export of the protein at least to the periplasm. Substantial enzyme activity was also present in the culture supernatants. The extracellular cyanophycinase activities in E. coli were higher than activities in the wild type P. alcaligenes DIP1 in complex LB medium. Highest extracellular enzyme production was achieved with E. coli BL21(DE3) expressing CphEal from pBBR1MCS-4. Using M9 minimal medium was less effective, but the relatively low cost of mineral salt media makes these results important for the industrial-scale production of dipeptides from cyanophycin.

  20. Optimal Operation of Network-Connected Combined Heat and Powers for Customer Profit Maximization

    Directory of Open Access Journals (Sweden)

    Da Xie

    2016-06-01

    Full Text Available Network-connected combined heat and powers (CHPs, owned by a community, can export surplus heat and electricity to corresponding heat and electric networks after community loads are satisfied. This paper proposes a new optimization model for network-connected CHP operation. Both CHPs’ overall efficiency and heat to electricity ratio (HTER are assumed to vary with loading levels. Based on different energy flow scenarios where heat and electricity are exported to the network from the community or imported, four profit models are established accordingly. They reflect the different relationships between CHP energy supply and community load demand across time. A discrete optimization model is then developed to maximize the profit for the community. The models are derived from the intervals determined by the daily operation modes of CHP and real-time buying and selling prices of heat, electricity and natural gas. By demonstrating the proposed models on a 1 MW network-connected CHP, results show that the community profits are maximized in energy markets. Thus, the proposed optimization approach can help customers to devise optimal CHP operating strategies for maximizing benefits.

  1. Application of Numerical Optimization Methods to Perform Molecular Docking on Graphics Processing Units

    Directory of Open Access Journals (Sweden)

    M. A. Farkov

    2014-01-01

    Full Text Available An analysis of numerical optimization methods for solving a problem of molecular docking has been performed. Some additional requirements for optimization methods according to GPU architecture features were specified. A promising method for implementation on GPU was selected. Its implementation was described and performance and accuracy tests were performed.

  2. Prevalence of insufficient, borderline, and optimal hours of sleep among high school students - United States, 2007.

    Science.gov (United States)

    Eaton, Danice K; McKnight-Eily, Lela R; Lowry, Richard; Perry, Geraldine S; Presley-Cantrell, Letitia; Croft, Janet B

    2010-04-01

    We describe the prevalence of insufficient, borderline, and optimal sleep hours among U.S. high school students on an average school night. Most students (68.9%) reported insufficient sleep, whereas few (7.6%) reported optimal sleep. The prevalence of insufficient sleep was highest among female and black students, and students in grades 11 and 12. Published by Elsevier Inc.

  3. Determining the optimal model for role-substitution in NHS dental services in the United Kingdom.

    Science.gov (United States)

    Brocklehurst, Paul; Birch, Stephen; McDonald, Ruth; Tickle, Martin

    2013-09-24

    Role-substitution describes a model of dental care where Dental Care Professionals (DCPs) provide some of the clinical activity previously undertaken by General Dental Practitioners. This has the potential to increase technical efficiency, the capacity to care and reduce costs. Technical efficiency is defined as the production of the maximum amount of output from a given amount of input so that the service operates at the production frontier i.e. optimal level of productivity. Academic research into technical efficiency is becoming increasingly utilised in health care, although no studies have investigated the efficiency of NHS dentistry or role-substitution in high-street dental practices. The aim of this study is to examine the barriers and enablers that exist for role-substitution in general dental practices in the NHS and to determine the most technically efficient model for role-substitution. A screening questionnaire will be sent to DCPs to determine the type and location of role-substitutive models employed in NHS dental practices in the United Kingdom (UK). Semi-structured interviews will then be conducted with practice owners, DCPs and patients at selected sites identified by the questionnaire. Detail will be recorded about the organisational structure of the dental team, the number of NHS hours worked and the clinical activity undertaken. The interviews will continue until saturation and will record the views and attitudes of the members of the dental team. Final numbers of interviews will be determined by saturation.The second work-stream will examine the technical efficiency of the selected practices using Data Envelopment Analysis and Stochastic Frontier Modeling. The former is a non-parametric technique and is considered to be a highly flexible approach for applied health applications. The latter is parametric and is based on frontier regression models that estimate a conventional cost function. Maximising health for a given level and mix of resources

  4. Equilibrium simulation of a small scale gasification biomass CHP plant

    Energy Technology Data Exchange (ETDEWEB)

    Baggio, M.; Baratieri, M.; Grigiante, M. (Department of Environmental and Civil Engineering, University of Trento (Italy))

    2007-07-01

    One of the most important issues, in assessing the performance of IC engines fueled with biomass synthesis gas, is to have a good evaluation of the energy content of the producer gas per unit volume; in fact, as these are volumetric machines, it can be expected that the relevant properties are those of the inflow gas air mixture. For this purpose, in the present study a multiphase thermodynamic equilibrium analysis has been carried out providing an estimate of the gas composition and the yield of char along the conversion process. The aim of the present paper is then to provide a realistic estimate of the global energy efficiency of the process, by means of a whole balance of plant simulation; therefore, the enthalpy fluxes arising from the different components have been evaluated using the chemical equilibrium analysis for the reacting stages. The performed plant analysis demonstrates how the proposed coupling of a gasification reactor with an IC gas engine presents high conversion efficiencies and seems to be particularly suitable for distributed energy production, especially in small towns situated in rural zones, where there is often available a large quantity of biomass waste. (orig.)

  5. A Simultaneous Biogeography based Optimal Placement of DG Units and Capacitor Banks in Distribution Systems with Nonlinear Loads

    Science.gov (United States)

    Sadeghi, Hassan; Ghaffarzadeh, Navid

    2016-09-01

    This paper uses a new algorithm namely biogeography based optimization (BBO) intended for the simultaneous placement of the distributed generation (DG) units and the capacitor banks in the distribution network. The procedure of optimization has been conducted in the presence of nonlinear loads (a cause of harmonic injection). The purpose of simultaneous optimal placement of the DG and the capacitor is the reduction of active and reactive losses. The difference in the values of loss reduction at different levels of the load have been included in the objective function and the considered objective function includes the constraints of voltage, size and the number of DG units and capacitor banks and the allowable range of the total harmonic distortion (THD) of the total voltage in accordance with the IEEE 519 standards. In this paper the placement has been performed on two load types ie constant and mixed power, moreover the effects of load models on the results and the effects of optimal placement on reduction of the THD levels have also been analyzed. The mentioned cases have been studied on a 33 bus radial distribution system.

  6. Investigation of Continuous Gas Engine CHP Operation on Biomass Producer Gas

    DEFF Research Database (Denmark)

    Ahrenfeldt, Jesper; Henriksen, Ulrik Birk; Jensen, Torben Kvist

    2005-01-01

    heat from the exhaust gas is utilised for drying and pyrolysis of the biomass in the gasification system, and the engine directly controls the load of the gasifier. Two different control approaches have been applied and investigated: one where the flow rate of the producer gas is fixed and the engine......More than 2000 hours of gas engine operation with producer gas from biomass as fuel has been conducted on the gasification CHP demonstration and research plant, named “Viking” at the Technical University of Denmark. The gas engine is an integrated part of the entire gasification plant. The excess...

  7. Renewables and CHP with District Energy in Support of Sustainable Communities

    Energy Technology Data Exchange (ETDEWEB)

    Snoek, Chris

    2010-09-15

    This paper addresses the powerful idea of connecting many energy users to environmentally optimum energy sources through integrated community energy systems. Such systems require piping networks for distributing thermal energy, i.e., district heating and cooling (DHC) systems. The possibilities and advantages of the application of integrated energy concepts are discussed, including the economic and environmental benefits of integrating localized electrical generating systems (CHP), transportation systems, industrial processes and other thermal energy requirements. Examples of a number of operating systems are provided. Some of the R and D carried out by the IEA Implementing Agreement on District Heating and Cooling is also described.

  8. IN ANALYSIS OF IMPACT OF UNDERLOADING OF CHP ON THE EFICIENCY OF FUEL CONSUMPTION MOLDOVA

    Directory of Open Access Journals (Sweden)

    Postolaty V.M.

    2012-04-01

    Full Text Available The article presents an assessment of problems of extra-consumption of fuel resources in Moldova, as a result of underloading of CPH of national energy system, as well as, increasing share of electricity produced by condensing power plants for ensuring supply of established energy demand. It is shown that, every year, over-consumption of about 100 thou t.c.e. is observed at CHP, due to inefficient loading factor of regimes in which are forced to be operated power plants as a result of un-bounding or disconnections of some consumers of heating energy and un-coordinated policy in the field of heat supply.

  9. Modeling and Optimization of Woody Biomass Harvest and Logistics in the Northeastern United States

    Science.gov (United States)

    Hartley, Damon S.

    World energy consumption is at an all-time high and is projected to continue growing for the foreseeable future. Currently, much of the energy that is produced comes from non-renewable fossil energy sources, which includes the burden of increased greenhouse gas emissions and the fear of energy insecurity. Woody biomass is being considered as a material that can be utilized to reduce the burden caused by fossil energy. While the technical capability to convert woody biomass to energy has been known for a long period of time, the cost of the feedstock has been considered too costly to be implemented in a large commercial scale. Increasing the use of woody biomass as an energy source requires that the supply chains are setup in a way that minimizes cost, the locational factors that lead to development are understood, the facilities are located in the most favorable locations and local resource assessments can be made. A mixed integer linear programming model to efficiently configure woody biomass supply chain configurations and optimize the harvest, extraction, transport, storage and preprocessing of the woody biomass resources to provide the lowest possible delivered price. The characteristics of woody biomass, such as spatial distribution and low bulk density, tend to make collection and transport difficult as compared to traditional energy sources. These factors, as well as others, have an adverse effect on the cost of the feedstock. The average delivered cost was found to be between 64.69-98.31 dry Mg for an annual demand of 180,000 dry Mg. The effect of resource availability and required demand was examined to determine the impact that each would have on the total cost. The use of woody biomass for energy has been suggested as a way to improve rural economies through job creation, reduction of energy costs and regional development. This study examined existing wood using bio-energy facilities in the northeastern United States to define the drivers of

  10. Economic Potential of CHP in Detroit Edison Service Area: the Customer Perspective

    Energy Technology Data Exchange (ETDEWEB)

    Kelly, J.

    2003-10-10

    DOE's mission under the Distributed Energy and Electricity Reliability (DEER) Program is to strengthen America's electric energy infrastructure and provide utilities and consumers with a greater array of energy-efficient technology choices for generating, transmitting, distributing, storing, and managing demand for electric power and thermal energy. DOE recognizes that distributed energy technologies can help accomplish this mission. Distributed energy (DE) technologies have received much attention for the potential energy savings and electric power reliability assurances that may be achieved by their widespread adoption. Fueling the attention has been the desire to reduce greenhouse gas emissions and concern about easing power transmission and distribution system capacity limitations and congestion. However, these benefits may come at a cost to the electric utility companies in terms of lost revenue and other potential impacts on the distribution system. It is important to assess the costs and benefits of DE to consumers and distribution system companies. DOE commissioned this study to assess the costs and benefits of DE technologies to consumers and to better understand the effect of DE on the grid. Current central power generation units vent more waste heat (energy) than the entire transportation sector consumes and this wasted thermal energy is projected to grow by 45% within the next 20 years. Consumer investment in technologies that increase power generation efficiency is a key element of the DOE Energy Efficiency program. The program aims to increase overall cycle efficiency from 30% to 70% within 20 years as well. DOE wants to determine the impact of DE in several small areas within cities across the U.S. Ann Arbor, Michigan, was chosen as the city for this case study. Ann Arbor has electric and gas rates that can substantially affect the market penetration of DE. This case study analysis was intended to: (1) Determine what DE market penetration

  11. Optimization of hospital electronic information system in cardiac care unit: A participatory action research

    Directory of Open Access Journals (Sweden)

    tahereh Toulabi

    2013-02-01

    Conclusion: Optimized use of HIS prepared by easy availability to nursing care standards. It is recommended, by enhancing the HIS capabilities and interdisciplinary communication, safe and scientific cares, and accurate and fast record to be provided by technology.

  12. Assessment of the implementation issues for fuel cells in domestic and small scale stationary power generation and CHP applications

    Energy Technology Data Exchange (ETDEWEB)

    Graham, G.; Cruden, A.; Hart, J.

    2002-07-01

    This report discusses implementation issues associated with the use of fuel cells in <10 kW domestic, small-scale power generation and combined heat and power (CHP) operations in the UK. The report examines the key issues (fuel cell system standards and certification, fuel infrastructure, commercial issues and competing CHP technologies), before discussing non-technical issues including finance, ownership, import and export configuration, pricing structure, customer acceptability, installation, operation and training of servicing and commissioning personnel. The report goes on to discuss market and technical drivers, grid connection issues and solutions, operations and maintenance. Recommendations for the future are made.

  13. Integrated production and utility system approach for optimizing industrial unit operations

    Energy Technology Data Exchange (ETDEWEB)

    Agha, Mujtaba H.; Thery, Raphaele; Hetreux, Gilles; Le Lann, Jean Marc [Universite de Toulouse, Laboratoire de Genie Chimique (ENSIACET-INPT), 4 allee Emile Monso, BP 44362, 31432 Toulouse Cedex 4 (France); Hait, Alain [Universite de Toulouse, Institut Superieur de l' Aeronautique et de l' Espace, 10 av. E. Belin, 31055 Toulouse Cedex 4 (France)

    2010-02-15

    To meet utility demands some industrial units use onsite utility system. Traditionally, the management of such type of industrial units is carried out in three sequential steps: scheduling of the manufacturing unit by minimizing inventory, estimating the utility needs of manufacturing unit and finally operation planning of the utility system. This article demonstrates the value of an integrated approach which couples the scheduling of manufacturing unit with operational planning of the utility system. A discrete-time mixed integer linear programming (MILP) model is developed to compare traditional and integrated approaches. Results indicate that the integrated approach leads to significant reduction in energy costs and at the same time decreases the emissions of harmful gases. (author)

  14. Identification of an operon, Pil-Chp, that controls twitching motility and virulence in Xylella fastidiosa.

    Science.gov (United States)

    Cursino, Luciana; Galvani, Cheryl D; Athinuwat, Dusit; Zaini, Paulo A; Li, Yaxin; De La Fuente, Leonardo; Hoch, Harvey C; Burr, Thomas J; Mowery, Patricia

    2011-10-01

    Xylella fastidiosa is an important phytopathogenic bacterium that causes many serious plant diseases, including Pierce's disease of grapevines. Disease manifestation by X. fastidiosa is associated with the expression of several factors, including the type IV pili that are required for twitching motility. We provide evidence that an operon, named Pil-Chp, with genes homologous to those found in chemotaxis systems, regulates twitching motility. Transposon insertion into the pilL gene of the operon resulted in loss of twitching motility (pilL is homologous to cheA genes encoding kinases). The X. fastidiosa mutant maintained the type IV pili, indicating that the disrupted pilL or downstream operon genes are involved in pili function, and not biogenesis. The mutated X. fastidiosa produced less biofilm than wild-type cells, indicating that the operon contributes to biofilm formation. Finally, in planta the mutant produced delayed and less severe disease, indicating that the Pil-Chp operon contributes to the virulence of X. fastidiosa, presumably through its role in twitching motility.

  15. Spatial distribution of pollutants in the area of the former CHP plant

    Science.gov (United States)

    Cichowicz, Robert

    2018-01-01

    The quality of atmospheric air and level of its pollution are now one of the most important issues connected with life on Earth. The frequent nuisance and exceedance of pollution standards often described in the media are generated by both low emission sources and mobile sources. Also local organized energy emission sources such as local boiler houses or CHP plants have impact on air pollution. At the same time it is important to remember that the role of local power stations in shaping air pollution immission fields depends on the height of emitters and functioning of waste gas treatment installations. Analysis of air pollution distribution was carried out in 2 series/dates, i.e. 2 and 10 weeks after closure of the CHP plant. In the analysis as a reference point the largest intersection of streets located in the immediate vicinity of the plant was selected, from which virtual circles were drawn every 50 meters, where 31 measuring points were located. As a result, the impact of carbon dioxide, hydrogen sulfide and ammonia levels could be observed and analyzed, depending on the distance from the street intersection.

  16. Commitment and dispatch of heat and power units via affinely adjustable robust optimization

    DEFF Research Database (Denmark)

    Zugno, Marco; Morales González, Juan Miguel; Madsen, Henrik

    2016-01-01

    is in essence a multi-stage one. We propose a formulation based on robust optimization where recourse decisions are approximated as linear or piecewise-linear functions of the uncertain parameters. This approach allows for a rigorous modeling of the uncertainty in multi-stage decision-making without...... approach. Secondly, we appraise the gain obtained by switching from linear to piecewise-linear decision rules within robust optimization. Furthermore, we give directions for selecting the parameters defining the uncertainty set (size, budget) and assess the resulting trade-off between average profit...... compromising computational tractability. We perform an extensive numerical study based on data from the Copenhagen area in Denmark, which highlights important features of the proposed model. Firstly, we illustrate commitment and dispatch choices that increase conservativeness in the robust optimization...

  17. Optimizing Power Heterogeneous Functional Units for Dynamic and Static Power Reduction

    Directory of Open Access Journals (Sweden)

    Toshinori Sato

    2014-12-01

    Full Text Available Power consumption is the major constraint for modern microprocessor designs. In particular, static power consumption becomes a serious problem as the transistor size shrinks via semiconductor technology improvement. This paper proposes a technique that reduces the static power consumed by functional units. It exploits the activity rate of functional units and utilizes the power heterogeneous functional units. From detailed simulations, we investigate the conditions in which the proposed technique works effectively for simultaneous dynamic and static power reduction and find that we can reduce the total power by 11.2% if two out of four leaky functional units are replaced by leakless ones in the situation where the static power occupies half of the total power.

  18. Optimization Review: Lockwood Operable Unit 1 - Beall Source Area, Billings, Montana

    Science.gov (United States)

    The Lockwood Solvent Groundwater Plume Site (LSGPS) consists of two operable units (OUs) and is located on the outskirts of Billings, Montana in EPA Region 8. OU1 consists of contaminated soils and a chlorinated solvent groundwater plume associated with...

  19. Optimizing Schedules for Maritime Humanitarian Cooperative Engagements from a United States Navy Sea Base

    Science.gov (United States)

    2010-01-01

    scheduling problems at the oper- ational level fall in the broad category of the well- known vehicle routing problem ( VRP ), which entails designing the optimal...motivated by its practical relevance and by its con- siderable difficulty (Toth and Vigo 2002). GFSMP has requirements not typically found in a standard VRP

  20. Optimal Power Flow in three-phase islanded microgrids with inverter interfaced units

    DEFF Research Database (Denmark)

    Sanseverino, Eleonora Riva; Quang, Ninh Nguyen; Di Silvestre, Maria Luisa

    2015-01-01

    In this paper, the solution of the Optimal Power Flow (OPF) problem for three phase islanded microgrids is studied, the OPF being one of the core functions of the tertiary regulation level for an AC islanded microgrid with a hierarchical control architecture. The study also aims at evaluating...

  1. Optimization of the swing rate of steam generation units using genetic algorithm

    Energy Technology Data Exchange (ETDEWEB)

    Elshafei, M.; Habib, M.A.; Al-Zaharnah, I. [King Fahd Univ. of Petroleum and Minerals, Dhahran (Saudi Arabia); Al-Anizi, S.; Al-Awwad, M.Y.; Hajji, M. [Saudi Aramco (Saudi Arabia). Consulting Services Dept.

    2010-08-13

    Boilers are needed in a variety of situations to quickly respond to sudden and large steam load changes. However, fast firing rate causes transient changes in both the drum-boiler steam pressure and drum level, in addition to the possibility of developing of thermal stresses in the walls of steam risers. Previous studies have not addressed the issue of determining maximum boiler swing rates. The purpose of this study was to improve boiler response to sudden large steam demands within the safe limits of the boiler operation conditions. The paper presented a genetic algorithm based optimization scheme for maximizing the ability of the boiler to respond to large steam demand while keeping the fluctuations in pressure, steam quality, drum level, and feed rate within acceptable limits. The paper discussed the development of a nonlinear model for an actual boiler and how it was used to demonstrate the performance of the boiler before and after optimization. A brief description of the boiler dynamic model was presented and the conventional method of control of industrial boilers was outlined. The formulation of the optimization problem was presented. The simulation results were also discussed and the performance of the optimized control with the existing control were compared. It was concluded that the proposed framework decreases the firing rate overshoots, drum level fluctuation, and feed water oscillations, while maximizing the allowable rate of increase in steam delivery per minute, without compromising operation performance or safety. 9 refs., 4 figs.

  2. A new fuzzy framework for the optimal placement of phasor measurement units under normal and abnormal conditions

    Directory of Open Access Journals (Sweden)

    Ragab A. El-Sehiemy

    2017-12-01

    Full Text Available This paper presents a new procedure for finding the optimal placement of the phasor measurement units (PMUs in modern power grids to achieve full network observability under normal operating conditions, and also abnormal operating conditions such as a single line or PMU outage, while considering the availability of PMU measuring channels. The proposed modeling framework is implemented using the fuzzy binary linear programming (FBLP technique. Linear fuzzy models are proposed for the objective function and constraints alike. The proposed procedure is applied to five benchmark systems such as the IEEE 14-bus, 30-bus, 39-bus, 57-bus, and 118-bus. The numerical results demonstrate that the proposed framework is capable of finding a fine-tuned optimal solution with a simple model and acceptable solution characteristics compared with early works in the literature. Besides, four evaluation indices are introduced to assure the various criteria under study such as the observability depth, measurement redundancy, and robustness of the method under contingencies. The results show that full network observability can be met under normal conditions using 20% PMUs penetration; however, under contingencies, approximately 50% PMUs penetration is required. The novelty of the proposed procedure has proven the capability of the proposed linear fuzzy models to find better optimal number of PMUs with lower number of channels compared to other algorithms under various operating conditions. Hence, the proposed work represents a potential tool to monitor power systems, and it will help the operators in a smart grid environment. Keywords: Binary linear programming, Fuzzy models, Observability, Optimization, Phasor measurement unit, Smart grids

  3. Analysis and Choice of Optimal Heating Ventilation Air Conditioning System for a Teaching Unit

    Directory of Open Access Journals (Sweden)

    Marina Verdeş

    2007-01-01

    Full Text Available Under the conditions of present society in which providing an optimum interior comfort is confronted with the necessity of the energy consumption reduction, solving this problem depends on the factors which contribute to the achievements of this comfort. Modern buildings -- implicitly teaching unit -- may be equipped with installations which have low energy consumption, respective a heating, cooling and ventilating integrated system with heat pumps system which can assure all the required comfort conditions. This paper underlines the necessity to use the heat pump in heating system for a teaching unit, energetic and economic guides and the possibility to increase them when using cooling and heating mixed. The solution of heat pumps for heating of the teaching unit and the energetic and economic advantages of the system is made in study.

  4. Hybrid Solid Oxide Fuel Cell and Thermoelectric Generator for Maximum Power Output in Micro-CHP Systems

    DEFF Research Database (Denmark)

    Rosendahl, Lasse; Mortensen, Paw Vestergård; Enkeshafi, Ali A.

    2011-01-01

    and market segments which are not yet quantified. This paper quantifies a micro-CHP system based on a solid oxide fuel cell (SOFC) and a high-performance TE generator. Based on a 3 kW fuel input, the hybrid SOFC implementation boosts electrical output from 945 W to 1085 W, with 1794 W available for heating......One of the most obvious early market applications for thermoelectric generators (TEG) is decentralized micro combined heat and power (CHP) installations of 0.5 kWe to 5 kWe based on fuel cell technology. Through the use of TEG technology for waste heat recovery it is possible to increase...... the electricity production in micro-CHP systems by more than 15%, corresponding to system electrical efficiency increases of some 4 to 5 percentage points. This will make fuel cell-based micro-CHP systems very competitive and profitable and will also open opportunities in a number of other potential business...

  5. Combined heat and power (CHP) as a possible method for reduction of the CO2 footprint or organic greenhouse horticulture

    NARCIS (Netherlands)

    Vermeulen, P.C.M.

    2014-01-01

    In recent years, the horticultural sector has been confronted with questions about the carbon footprint of its products. In greenhouse cultures, energy consumption is the main component of the CO2 emission. To save energy, many Dutch greenhouse companies use CHP to heat their greenhouses. These

  6. Hybrid Solid Oxide Fuel Cell and Thermoelectric Generator for Maximum Power Output in Micro-CHP Systems

    Science.gov (United States)

    Rosendahl, L. A.; Mortensen, Paw V.; Enkeshafi, Ali A.

    2011-05-01

    One of the most obvious early market applications for thermoelectric generators (TEG) is decentralized micro combined heat and power (CHP) installations of 0.5 kWe to 5 kWe based on fuel cell technology. Through the use of TEG technology for waste heat recovery it is possible to increase the electricity production in micro-CHP systems by more than 15%, corresponding to system electrical efficiency increases of some 4 to 5 percentage points. This will make fuel cell-based micro-CHP systems very competitive and profitable and will also open opportunities in a number of other potential business and market segments which are not yet quantified. This paper quantifies a micro-CHP system based on a solid oxide fuel cell (SOFC) and a high-performance TE generator. Based on a 3 kW fuel input, the hybrid SOFC implementation boosts electrical output from 945 W to 1085 W, with 1794 W available for heating purposes.

  7. A comparison of cost-benefit analysis of biomass and natural gas CHP projects in Denmark and the Netherlands

    NARCIS (Netherlands)

    Groth, Tanja; Scholtens, Bert

    2016-01-01

    We investigate what drives differences in the project appraisal of biomass and natural gas combined heat and power (CHP) projects in two countries with very similar energy profiles. This is of importance as the European Commission is assessing the potential scope of harmonizing renewable electricity

  8. Experimental study and modeling of degradation phenomena in HTPEM fuel cell stacks for use in CHP systems

    DEFF Research Database (Denmark)

    Nielsen, Mads Pagh; Andreasen, Søren Juhl; Rasmussen, Peder Lund

    2009-01-01

    Degradation phenomena in HTPEM fuel cells for use in CHP systems were investigated experimentally and by modeling. It was found that the two main degradation mechanisms in HTPEM fuel cells are carbon corrosion and Pt agglomeration. On basis of this conclusion a mechanistic model, describing the d...

  9. A Bi-Level Particle Swarm Optimization Algorithm for Solving Unit Commitment Problems with Wind-EVs Coordinated Dispatch

    Science.gov (United States)

    Song, Lei; Zhang, Bo

    2017-07-01

    Nowadays, the grid faces much more challenges caused by wind power and the accessing of electric vehicles (EVs). Based on the potentiality of coordinated dispatch, a model of wind-EVs coordinated dispatch was developed. Then, A bi-level particle swarm optimization algorithm for solving the model was proposed in this paper. The application of this algorithm to 10-unit test system carried out that coordinated dispatch can benefit the power system from the following aspects: (1) Reducing operating costs; (2) Improving the utilization of wind power; (3) Stabilizing the peak-valley difference.

  10. A dynamic regrouping based sequential dynamic programming algorithm for unit commitment of combined heat and power systems

    DEFF Research Database (Denmark)

    Rong, Aiying; Hakonen, Henri; Lahdelma, Risto

    2009-01-01

    This paper addresses the unit commitment (UC) in multi-period combined heat and power (CHP) production planning under the deregulated power market. In CHP plants (units), generation of heat and power follows joint characteristics, which implies that it is difficult to determine the relative cost...... efficiency of the plants. We introduce in this paper the DRDP-RSC algorithm, which is a dynamic regrouping based dynamic programming (DP) algorithm based on linear relaxation of the ON/OFF states of the units, sequential commitment of units in small groups. Relaxed states of the plants are used to reduce...

  11. CHP expansion strategy in North Rhine-Westphalia. A blueprint for other regions; KWK-Ausbaustrategie in NRW. Eine Blaupause fuer andere Regionen

    Energy Technology Data Exchange (ETDEWEB)

    Holzapfel, Dominik [EnergieAgentur.NRW, Duesseldorf (Germany); Schneider, Sabine [EnergieAgentur.NRW, Wuppertal (Germany)

    2015-10-01

    The North Rhine-Westphalian state government intends to increase the share of combined heat and power (CHP) generation to at least 25 % by 2020. Since 2013, the campaign ''CHP.NRW - Power Meets Heat'' (''KWK.NRW - Strom trifft Waerme'') of the EnergyAgency.NRW, is has been running on behalf of the NRW Climate Protection Ministry, to publicise this technology and to promote its expansion. The campaign accompanies the State Government's CHP Stimulus Programme. The EnergyAgency.NRW has organised companies and research institutions, associations and interest groups under the umbrella of ''CHP.NRW - Power Meets Heat'', aiming at co-ordinated and intensified activities in the field of combined heat and power generation. The target of the initial-project ''roadmap/CHP.NRW'' of the ''Virtual Institute / CHP.NRW'' is to develop a guideline for the application and optimisation of CHP-systems.

  12. Full Monte Carlo-Based Biologic Treatment Plan Optimization System for Intensity Modulated Carbon Ion Therapy on Graphics Processing Unit.

    Science.gov (United States)

    Qin, Nan; Shen, Chenyang; Tsai, Min-Yu; Pinto, Marco; Tian, Zhen; Dedes, Georgios; Pompos, Arnold; Jiang, Steve B; Parodi, Katia; Jia, Xun

    2018-01-01

    One of the major benefits of carbon ion therapy is enhanced biological effectiveness at the Bragg peak region. For intensity modulated carbon ion therapy (IMCT), it is desirable to use Monte Carlo (MC) methods to compute the properties of each pencil beam spot for treatment planning, because of their accuracy in modeling physics processes and estimating biological effects. We previously developed goCMC, a graphics processing unit (GPU)-oriented MC engine for carbon ion therapy. The purpose of the present study was to build a biological treatment plan optimization system using goCMC. The repair-misrepair-fixation model was implemented to compute the spatial distribution of linear-quadratic model parameters for each spot. A treatment plan optimization module was developed to minimize the difference between the prescribed and actual biological effect. We used a gradient-based algorithm to solve the optimization problem. The system was embedded in the Varian Eclipse treatment planning system under a client-server architecture to achieve a user-friendly planning environment. We tested the system with a 1-dimensional homogeneous water case and 3 3-dimensional patient cases. Our system generated treatment plans with biological spread-out Bragg peaks covering the targeted regions and sparing critical structures. Using 4 NVidia GTX 1080 GPUs, the total computation time, including spot simulation, optimization, and final dose calculation, was 0.6 hour for the prostate case (8282 spots), 0.2 hour for the pancreas case (3795 spots), and 0.3 hour for the brain case (6724 spots). The computation time was dominated by MC spot simulation. We built a biological treatment plan optimization system for IMCT that performs simulations using a fast MC engine, goCMC. To the best of our knowledge, this is the first time that full MC-based IMCT inverse planning has been achieved in a clinically viable time frame. Copyright © 2017 Elsevier Inc. All rights reserved.

  13. Energy policy responses to the climate change challenge: The consistency of European CHP, renewables and energy efficiency policies

    Energy Technology Data Exchange (ETDEWEB)

    Grohnheit, P.E.

    1999-09-01

    This report is Volume 14 of individual reports of the Shared Analysis Project prepared for the European Commission, Directorate General for Energy. The three major objectives of the project were: to design a common framework of energy analysis that aimed to involve all Member States and the experts of industrial research groups (the shared approach to energy analysis); To analyse generic EU-wide issues important for energy policy and for future energy demand and production, putting particular emphasis on world energy market trends, strategic energy policy responses to the Kyoto process, and evaluation of response strategies to increasing energy import dependence and to climate change activities; to carry out quantitative analyses of energy trends and scenarios as an input for discussion. The present volume considers three main issues concerning energy policy responses to the climate change challenge: the penetration of CHP and renewables according to official objectives, focusing on infrastructure and institutions rather than technology; the consistency of promotion of CHP, renewables and energy savings at the same time; consumers' choices and priorities in a liberalised market. The volume describes examples of policies in several Member States for these technologies with emphasis on CHP for both large-scale and small-scale district heating systems. The penetration of CHP technologies is analysed quantitatively using a traditional optimisation model approach for stylised regions with heat markets suitable for CHP and facing a competitive European market for electricity. The Joint Final Report of the project, titled 'Economic Foundations for Energy Policy' is published as a Special Issue of Energy in Europe, December 1999. All reports are available on the Internet, www.shared-analysis.fhg.de/ The project started in January 1998, involving about 100 months of scientific labour. The project consortium consisted of nine member institutes co-ordinated by

  14. Optimization study of a transportable neutron radiography unit based on a compact neutron generator

    Energy Technology Data Exchange (ETDEWEB)

    Fantidis, J.G. [Laboratory of Nuclear Technology, School of Engineering, ' Democritus' University of Thrace, Xanthi (Greece); Nicolaou, G.E., E-mail: nicolaou@ee.duth.g [Laboratory of Nuclear Technology, School of Engineering, ' Democritus' University of Thrace, Xanthi (Greece); Tsagas, N.F. [Laboratory of Nuclear Technology, School of Engineering, ' Democritus' University of Thrace, Xanthi (Greece)

    2010-06-21

    A transportable fast and thermal neutron radiography system, incorporating a compact DD neutron generator, has been simulated using the MCNPX code. The materials considered were compatible with the European Union Directive on 'Restriction of Hazardous Substances'(RoHS) 2002/95/EC, hence excluding the use of cadmium and lead. Appropriate collimators were simulated for each of the radiography modes. With suitable aperture and collimator designs, it was possible to optimize the parameters for both fast and thermal neutron radiographies, for a wide range of values of the collimator ratio. The system simulated allows different object sizes to be studied with a wide range of radiography parameters.

  15. Optimal platform skewing for Space Shuttle inertial measurement unit redundancy management

    Science.gov (United States)

    Rasmussen, M. C.

    1980-01-01

    Constraints are applied to a general quaternion which describes the skewing between platforms of the Space Shuttle IMU. Once a skewing is derived, the use of the failure magnitude to threshold ratio makes possible predictions of the identification sensitivities for various failure modes. This in turn simplifies analyses and identifies portions of the flight envelope where second failure coverage is lacking. The square root of 6 and square root of 2 skewings have been baselined for use during nominal entry; the realignment software will be used on orbit to reskew the IMUs to the optimal configuration.

  16. The effectiveness of absorption heat pumps application for the increase of economic efficiency of CHP operation

    Directory of Open Access Journals (Sweden)

    Luzhkovoy Dmitriy S.

    2017-01-01

    Full Text Available The article deals with a comparative analysis of CHP operational efficiency in various working modes before and after the absorption heat pumps installation. The calculation was performed using a mathematical model of the extraction turbine PT- 80/100-130/13. Absorption heat pumps of LLC “OKB Teplosibmash” were used as AHP models for the analysis. The most effective way of absorption lithium-bromide heat pumps application as a part of the turbine PT-80/100-130/13 turned out to be their usage in a heat-producing mode during a non-heating season with a load of hot water supply. For this mode the dependence of the turbine heat efficiency on the heat load of the external consumer at a given throttle flow was analyzed.

  17. Trial operation of a phosphoric acid fuel cell (PC25) for CHP applications in Europe

    Energy Technology Data Exchange (ETDEWEB)

    Uhrig, M.; Droste, W.; Wolf, D. [Ruhrgas AG, Dorsten (Germany)

    1996-12-31

    In Europe, ten 200 kW phosphoric acid fuel cells (PAFCs) produced by ONSI (PC25) are currently in operation. Their operators collaborate closely in the European Fuel Cell Users Group (EFCUG). The experience gained from trial operation by the four German operators - HEAG, HGW/HEW, Thyssengas and Ruhrgas - coincides with that of the other European operators. This experience can generally be regarded as favourable. With a view to using fuel cells in combined heat and power generation (CHP), the project described in this report, which was carried out in cooperation with the municipal utility of Bochum and Gasunie of the Netherlands, aimed at gaining experience with the PC 25 in field operation under the specific operating conditions prevailing in Europe. The work packages included heat-controlled operation, examination of plant behavior with varying gas properties and measurement of emissions under dynamic load conditions. The project received EU funding under the JOULE programme.

  18. Economic feasibility of CHP facilities fueled by biomass from unused agriculture land

    DEFF Research Database (Denmark)

    Pfeifer, Antun; Dominkovic, Dominik Franjo; Ćosić, Boris

    2016-01-01

    work and is now used to investigate the conditions in which such energy facilities could be feasible. The overall potential of biomass from short rotation coppice cultivated on unused agricultural land in the scenarios with 30% of the area is up to 10PJ/year. The added value of fruit trees pruning......In this paper, the energy potential of biomass from growing short rotation coppice on unused agricultural land in the Republic of Croatia is used to investigate the feasibility of Combined Heat and Power (CHP) facilities fueled by such biomass. Large areas of agricultural land that remain unused...... for food crops, represent significant potential for growing biomass that could be used for energy. This biomass could be used to supply power plants of up to 15MWe in accordance with heat demands of the chosen locations. The methodology for regional energy potential assessment was elaborated in previous...

  19. Emissions from decentralised CHP plants 2007 - Energinet.dk Environmental project no. 07/1882

    DEFF Research Database (Denmark)

    Nielsen, Malene; Nielsen, Ole-Kenneth; Thomsen, Marianne

    Updated emission factors for decentralised combined heat and power (CHP) plants with a capacity project emission measurements as well as emission measurements performed in recent years that were collected. The emission factors valid for 2006/2007 have been...... estimated for the plant technologies: Municipal solid waste (MSW) incineration plants, plants combusting straw or wood, natural gas fuelled reciprocating engines, biogas fuelled engines, natural gas fuelled gas turbines, gas oil fuelled reciprocating engines, gas oil fuelled gas turbines, steam turbines...... combusting residual oil and reciprocating engines combusting biomass producer gas based on wood. The emission factors for MSW incineration plants are much lower than the emission factors that were estimated for year 2000. The considerable reduction in the emission factors is a result of lower emission limit...

  20. Fuel cell power plants for decentralised CHP applications; Brennstoffzellen-Kraftwerke fuer dezentrale KWK-Anwendungen

    Energy Technology Data Exchange (ETDEWEB)

    Ohmer, Martin; Mattner, Katja [FuelCell Energy Solutions GmbH, Dresden (Germany)

    2015-06-01

    Fuel cells are the most efficient technology to convert chemical energy into electricity and heat and thus they could have a major impact on reducing fuel consumption, CO{sub 2} and other emissions (NO{sub x}, SO{sub x} and particulate matter). Fired with natural or biogas and operated with an efficiency of up to 49 % a significant reduction of fuel costs can be achieved in decentralised applications. Combined heat and power (CHP) configurations add value for a wide range of industrial applications. The exhaust heat of approximately 400 C can be utilised for heating purposes and the production of steam. Besides, it can be also fed directly to adsorption cooling systems. With more than 110 fuel cell power plants operating worldwide, this technology is a serious alternative to conventional gas turbines or gas engines.

  1. Energy and economic effects of CHP with combined technologies of corn cobs gasification and gas turbines

    Directory of Open Access Journals (Sweden)

    Guteša Milana M.

    2016-01-01

    Full Text Available This paper presents the performance and economic analysis of the gas turbine with co-firing gas from corn cob gasification and natural gas. Adiabatic and non-adiabatic expansion in the turbine is considered. The analysis is performed parametrically with corn cob gasification gas and natural gas ratio. The volumetric energy content of fuels with different share of gas from the corn cob gasification therefore, with different calorific values, is compared by means of the Wobbe Index. In energy and economic analyses, the following configurations are dealt with: single manifold, dual manifold and separate gas systems. [Projekat Ministarstva nauke Republike Srbije, br. 33049: The Development of CHP Demonstration Plant with Biomass Gasification

  2. The methodology of designing and optimizing microalgal unit in BLSS based on system dynamics and computer simulation

    Science.gov (United States)

    Hu, Dawei; Liu, Hong; Hu, Enzhu; Li, Ming

    In a sense, the Bioregenerative Life Support System (BLSS) and its components stably and robustly work at a prescribed point is significant for both safety and reliability of BLSS. In the article, the objectives are to design and optimize an important subsystem in BLSS, unit of microalge, to make it gradually stabilize at a required work point and have the best response specifications. The methods include several steps as follows: Firstly, the mathematical models of subunits of microalgal unit depicted by state-space equations which consisted of first-order nonlinear ordinary differential equations were developed, and based on mathematical models and simulation models of subunits developed by Matlab/Simulink to design structures of microalgal unit by series, parallel and feedback connecting the different subunits into a whole model: dx/dt=f(p, x), p and x was parameters vector and state variables vector respectively; Secondly, made f(p, x)=0 solve p and linearization process at the prescribed point were conducted, and then got state matrix. According to system dynamics and Hurwitz principles, the linear system is gradually stable, and have ideal dynamic performances, if its all poles (i.e.eigenvalues of state matrix) are located on the left-half of complex plane and a pair of dominant complex-conjugate poles which can provide appropriate damping ratio to determine the characteristics of transient response are existed, and its nonlinear counterpart must have similar dynamic characteristics at the prescribed point. Optimized and solved systematic parameters based on computer simulation by a combination of Quasi-Newton method, genetic algorithms, root-locus method, Nyquist stability criterion, and so on. If the desired parameters could not be found, the processes of unit structure changed or compensated design were tentatively conducted. The results show that after system and parameters have been appropriately designed and optimized, which could make the linear system

  3. Experimental investigation of a 125 kW twin-fire fixed bed gasification pilot plant and comparison to the results of a 2 MW combined heat and power plant (CHP)

    Energy Technology Data Exchange (ETDEWEB)

    Kramreiter, Robert; Url, Michael; Kotik, Jan; Hofbauer, Hermann [Institute of Chemical Engineering, Vienna University of Technology, Getreidemarkt 9/166, A-1060 Vienna (Austria)

    2008-01-15

    Fixed bed biomass gasification is a promising technology to produce heat and power from a renewable energy source. A twin-fire fixed bed gasifier based CHP plant was realized in the year 2003 in Wr. Neustadt, Austria. Wood chips are used as fuel, which are dried and sieved before being gasified to a low calorific gas of about 5.8 MJ/Nm{sup 3}{sub dry}. Before the clean gas is fed into a gas engine a cyclone and a RME (rapemethylester)/H{sub 2}O quench system followed by a wet electrostatic precipitator (ESP) is used for gas cleaning. The CHP plant has a fuel power of 2 MW{sub th} and an electric output of 550 kW{sub el}. As scale up and optimization tool a hot test rig with a capacity of 125 kW{sub th} was built. Basic parameters like the type of wood chips, power and air distribution were varied to investigate the effect on gas composition, tar content in the producer gas and carbon content in the ash. Additionally a temperature profile over the height of the 125 kW hot test rig was measured. Furthermore, the results from the hot test rig are discussed and compared with the results from the 2 MW{sub th} demonstration plant. (author)

  4. Manufacturing optimization of the technological unit for crushing the dressing coal products

    Energy Technology Data Exchange (ETDEWEB)

    Kalinowski, K.

    1984-01-01

    The optimization of coal preparation is discussed. Run-of-mine coal fed to a screen is separated into 2 classes: to 80 mm and above 80 mm. Coal slurry is separated from the size fraction below 80 mm using a clarifier. After slurry separation, the coal is prepared by jigging (three-product preparation). Two separating densities are used: 1.4 and 1.8 t/m/sup 3/. By-product supplied by jigging is crushed and is prepared in another jig system. Optimization of by-product crushing and secondary jigging is discussed. A procedure for selecting the optimum crushing size and the optimum separation density is analyzed. The procedure is based on simulation methods using models developed by the US Bureau of Mines and by S. Cierpisz and A. Tatarkiewicz. The optimum crushing size of coal and the optimum separation density for 8 coal types from one coal mine are determined. The aim is to increase yields of coal concentrate with ash content below the permissible level. 3 references.

  5. Implications of the modelling of stratified hot water storage tanks in the simulation of CHP plants

    Energy Technology Data Exchange (ETDEWEB)

    Campos Celador, A., E-mail: alvaro.campos@ehu.es [ENEDI Research Group-University of the Basque Country, Departamento de Maquinas y Motores Termicos, E.T.S.I. de Bilbao Alameda de Urquijo, s/n 48013 Bilbao, Bizkaia (Spain); Odriozola, M.; Sala, J.M. [ENEDI Research Group-University of the Basque Country, Departamento de Maquinas y Motores Termicos, E.T.S.I. de Bilbao Alameda de Urquijo, s/n 48013 Bilbao, Bizkaia (Spain)

    2011-08-15

    Highlights: {yields} Three different modelling approaches for simulation of hot water tanks are presented. {yields} The three models are simulated within a residential cogeneration plant. {yields} Small differences in the results are found by an energy and exergy analysis. {yields} Big differences between the results are found by an advanced exergy analysis. {yields} Results on the feasibility study are explained by the advanced exergy analysis. - Abstract: This paper considers the effect that different hot water storage tank modelling approaches have on the global simulation of residential CHP plants as well as their impact on their economic feasibility. While a simplified assessment of the heat storage is usually considered in the feasibility studies of CHP plants in buildings, this paper deals with three different levels of modelling of the hot water tank: actual stratified model, ideal stratified model and fully mixed model. These three approaches are presented and comparatively evaluated under the same case of study, a cogeneration plant with thermal storage meeting the loads of an urbanisation located in the Bilbao metropolitan area (Spain). The case of study is simulated by TRNSYS for each one of the three modelling cases and the so obtained annual results are analysed from both a First and Second-Law-based viewpoint. While the global energy and exergy efficiencies of the plant for the three modelling cases agree quite well, important differences are found between the economic results of the feasibility study. These results can be predicted by means of an advanced exergy analysis of the storage tank considering the endogenous and exogenous exergy destruction terms caused by the hot water storage tank.

  6. Individually optimized hemodynamic therapy reduces complications and length of stay in the intensive care unit: a prospective, randomized controlled trial.

    Science.gov (United States)

    Goepfert, Matthias S; Richter, Hans Peter; Zu Eulenburg, Christine; Gruetzmacher, Janna; Rafflenbeul, Erik; Roeher, Katharina; von Sandersleben, Alexandra; Diedrichs, Stefan; Reichenspurner, Herrmann; Goetz, Alwin E; Reuter, Daniel A

    2013-10-01

    The authors hypothesized that goal-directed hemodynamic therapy, based on the combination of functional and volumetric hemodynamic parameters, improves outcome in patients with cardiac surgery. Therefore, a therapy guided by stroke volume variation, individually optimized global end-diastolic volume index, cardiac index, and mean arterial pressure was compared with an algorithm based on mean arterial pressure and central venous pressure. This prospective, controlled, parallel-arm, open-label trial randomized 100 coronary artery bypass grafting and/or aortic valve replacement patients to a study group (SG; n = 50) or a control group (CG; n = 50). In the SG, hemodynamic therapy was guided by stroke volume variation, optimized global end-diastolic volume index, mean arterial pressure, and cardiac index. Optimized global end-diastolic volume index was defined before and after weaning from cardiopulmonary bypass and at intensive care unit (ICU) admission. Mean arterial pressure and central venous pressure served as hemodynamic goals in the CG. Therapy was started immediately after induction of anesthesia and continued until ICU discharge criteria, serving as primary outcome parameter, were fulfilled. Intraoperative need for norepinephrine was decreased in the SG with a mean (±SD) of 9.0 ± 7.6 versus 14.9 ± 11.1 µg/kg (P = 0.002). Postoperative complications (SG, 40 vs. CG, 63; P = 0.004), time to reach ICU discharge criteria (SG, 15 ± 6 h; CG, 24 ± 29 h; P therapy based on cardiac index, stroke volume variation, and optimized global end-diastolic volume index reduces complications and length of ICU stay after cardiac surgery.

  7. Unit Commitment Pada Sistem Pembangkitan Tenaga Angin Untuk Mengurangi Emis Menggunakan Particle Swarm Optimization

    Directory of Open Access Journals (Sweden)

    Muhammad Arindra

    2017-01-01

    Full Text Available ABSTRAK Permintaan daya listrik yang terus bertambah menyebabkan daya listrik yang disuplai oleh pembangkit menjadi lebih besar. Kondisi beban yang harus disuplai pembangkit selalu berubah-ubah tiap waktunya, maka penyaluran energi listrik haruslah sesuai antara energi yang terbangkitkan oleh pembangkit dengan jumlah beban yang harus disuplai untuk memperoleh biaya pembangkitan yang paling ekonomis. Pada Tugas Akhir ini untuk mendapatkan biaya yang ekonomis akan dilakukan penjadwalan pembangkit yang optimal. Penjadwalan pembangkitan bertujuan untuk mendapatkan biaya operasional yang minimum tetapi tetap dapat memenuhi permintaan beban yang ada. Penggunaan generator dengan bahan bakar fosil dapat memberikan efek pencemaran lingkungan akibat emisi sisa dari pembakaran. Melihat permasalahan yang ada, penggunaan turbin angin, merupakan solusi yang tepat. Penggunaan turbin angin amat bermanfaat untuk mengurangi emisi yang dihasilkan oleh generator konvensional. Selain dapat mengurangi emisi yang dihasilkan, penggunaan turbin angin dapat mengurangi biaya operasional, karena penggunaan turbin angin tidak memerlukan energi fosil sebagai bahan bakar.

  8. Model-predictive control and real-time optimization of a cat cracker unit

    Directory of Open Access Journals (Sweden)

    Stig Strand

    1997-04-01

    Full Text Available A project for control and optimization of the Residual Catalytic Cracking Process at the Mongstad refinery is near completion. Four model-predictive control applications have been successfully implemented, using the IDCOM control software from Setpoint Inc. The most attractive feature of the controller is the well-defined control prioritizing hierarchy, and the linear impulse-response models have proved to give satisfactory performance on this process. Excitation and identification of the dynamic models proved to be a difficult task, and careful design and monitoring of the tests was mandatory in order to produce good results. Multi-variable Pseudo Random Binary Test Sequences were used for the excitation. Technical performance and operator acceptance of the new control functions have been good, but it is realized that a continuing effort is needed to fine-tune and maintain such functions.

  9. Optimization of Geological Environments for Carbon Dioxide Disposan in Saline Aquifers in the United States

    Energy Technology Data Exchange (ETDEWEB)

    Hovorka, Susan

    1999-02-01

    Recent research and applications have demonstrated technologically feasible methods, defined costs, and modeled processes needed to sequester carbon dioxide (CO{sub 2}) in saline-water-bearing formations (aquifers). One of the simplifying assumptions used in previous modeling efforts is the effect of real stratigraphic complexity on transport and trapping in saline aquifers. In this study we have developed and applied criteria for characterizing saline aquifers for very long-term sequestration of CO{sub 2}. The purpose of this pilot study is to demonstrate a methodology for optimizing matches between CO{sub 2} sources and nearby saline formations that can be used for sequestration. This project identified 14 geologic properties used to prospect for optimal locations for CO{sub 2} sequestration in saline-water-bearing formations. For this demonstration, we digitized maps showing properties of saline formations and used analytical tools in a geographic information system (GIS) to extract areas that meet variably specified prototype criteria for CO{sub 2} sequestration sites. Through geologic models, realistic aquifer properties such as discontinuous sand-body geometry are determined and can be used to add realistic hydrologic properties to future simulations. This approach facilitates refining the search for a best-fit saline host formation as our understanding of the most effective ways to implement sequestration proceeds. Formations where there has been significant drilling for oil and gas resources as well as extensive characterization of formations for deep-well injection and waste disposal sites can be described in detail. Information to describe formation properties can be inferred from poorly known saline formations using geologic models in a play approach. Resulting data sets are less detailed than in well-described examples but serve as an effective screening tool to identify prospects for more detailed work.

  10. Short-term bulk energy storage system scheduling for load leveling in unit commitment: modeling, optimization, and sensitivity analysis

    Science.gov (United States)

    Hemmati, Reza; Saboori, Hedayat

    2016-01-01

    Energy storage systems (ESSs) have experienced a very rapid growth in recent years and are expected to be a promising tool in order to improving power system reliability and being economically efficient. The ESSs possess many potential benefits in various areas in the electric power systems. One of the main benefits of an ESS, especially a bulk unit, relies on smoothing the load pattern by decreasing on-peak and increasing off-peak loads, known as load leveling. These devices require new methods and tools in order to model and optimize their effects in the power system studies. In this respect, this paper will model bulk ESSs based on the several technical characteristics, introduce the proposed model in the thermal unit commitment (UC) problem, and analyze it with respect to the various sensitive parameters. The technical limitations of the thermal units and transmission network constraints are also considered in the model. The proposed model is a Mixed Integer Linear Programming (MILP) which can be easily solved by strong commercial solvers (for instance CPLEX) and it is appropriate to be used in the practical large scale networks. The results of implementing the proposed model on a test system reveal that proper load leveling through optimum storage scheduling leads to considerable operation cost reduction with respect to the storage system characteristics. PMID:27222741

  11. Short-term bulk energy storage system scheduling for load leveling in unit commitment: modeling, optimization, and sensitivity analysis.

    Science.gov (United States)

    Hemmati, Reza; Saboori, Hedayat

    2016-05-01

    Energy storage systems (ESSs) have experienced a very rapid growth in recent years and are expected to be a promising tool in order to improving power system reliability and being economically efficient. The ESSs possess many potential benefits in various areas in the electric power systems. One of the main benefits of an ESS, especially a bulk unit, relies on smoothing the load pattern by decreasing on-peak and increasing off-peak loads, known as load leveling. These devices require new methods and tools in order to model and optimize their effects in the power system studies. In this respect, this paper will model bulk ESSs based on the several technical characteristics, introduce the proposed model in the thermal unit commitment (UC) problem, and analyze it with respect to the various sensitive parameters. The technical limitations of the thermal units and transmission network constraints are also considered in the model. The proposed model is a Mixed Integer Linear Programming (MILP) which can be easily solved by strong commercial solvers (for instance CPLEX) and it is appropriate to be used in the practical large scale networks. The results of implementing the proposed model on a test system reveal that proper load leveling through optimum storage scheduling leads to considerable operation cost reduction with respect to the storage system characteristics.

  12. Delayed coking unit preheat train optimization; Otimizacao do preaquecimento das Unidades de Coque

    Energy Technology Data Exchange (ETDEWEB)

    Marins, Edson R.; Geraldelli, Washington O.; Barros, Francisco C. [PETROBRAS, Rio de Janeiro, RJ (Brazil). Centro de Pesquisas (CENPES)

    2004-07-01

    The oil industry has been investing in research and development of new techniques and process improvements with the objective to increase the residual fraction profitability and to fulfill the market demands. The adequacy of the refining scheme has led to the development of bottom of the barrel processes that has the objective to convert heavy fractions into products of higher aggregate value. In this context, the process of Delayed Coking presents a great importance in the production of distillates in the diesel range as well as the processing of heavy residues, mostly in the markets where the fuel oil consumption is being reduced. With the approach to help PETROBRAS decide which route to follow during new designs of Delayed Coking units, this work presents a comparative study of the preheat train performance among the energy recovery to preheat the feed, in contrast with preheating the feed and generating steam, simultaneously. In this study the Pinch Technology methodology was used as a procedure for heat integration with the objective of getting the maximum energy recovery from the process, finding the best trade-off between operational cost and investment cost. The alternative of steam generation aims to provide an appropriate flexibility in Delayed Coking units design and operation. (author)

  13. Process-Related Barriers to Optimizing Enteral Nutrition in a Tertiary Medical Intensive Care Unit.

    Science.gov (United States)

    Kozeniecki, Michelle; McAndrew, Natalie; Patel, Jayshil J

    2016-02-01

    Enteral nutrition (EN) is the preferred route of nutrient delivery in critically ill patients. Research has consistently described an incomplete delivery of EN in critically ill patients. The purpose of this study was to investigate barriers to reach and maintain >90% prescribed EN among critically ill medical intensive care unit (ICU) patients. We performed a retrospective cohort quality improvement study of patients ≥ 18 years of age admitted to a tertiary medical ICU and referred for EN from October 1-December 31, 2013. We excluded patients who received intermittent or bolus feeding. Demographic, clinical, and nutrition data were collected. Potential barriers to EN were categorized a priori. Seventy-eight patients receiving 344 days of EN were included in the study. EN was initiated at a median of 32 hours (interquartile range, 18.5-75 hours) after ICU admission. Initiation and advancement of EN was identified as the most common reason for Nutrition.

  14. Optimal location of centralized biodigesters for small dairy farms: A case study from the United States

    Directory of Open Access Journals (Sweden)

    Deep Mukherjee

    2015-06-01

    Full Text Available Anaerobic digestion technology is available for converting livestock waste to bio-energy, but its potential is far from fully exploited in the United States because the technology has a scale effect. Utilization of the centralized anaerobic digester (CAD concept could make the technology economically feasible for smaller dairy farms. An interdisciplinary methodology to determine the cost minimizing location, size, and number of CAD facilities in a rural dairy region with mostly small farms is described. This study employs land suitability analysis, operations research model and Geographical Information System (GIS tools to evaluate the environmental, social, and economic constraints in selecting appropriate sites for CADs in Windham County, Connecticut. Results indicate that overall costs are lower if the CADs are of larger size and are smaller in number.

  15. Structure and Function: Planning a New Intensive Care Unit to Optimize Patient Care

    Directory of Open Access Journals (Sweden)

    Jozef Kesecioğlu

    2014-08-01

    Full Text Available To survey the recent medical literature reporting effects of intensive care unit (ICU design on patients’ and family members’ well-being, safety and functionality. Features of ICU design linked to the needs of patients and their family are single-rooms, privacy, quiet surrounding, exposure to daylight, views of nature, prevention of infection, a family area and open visiting hours. Other features such as safety, working procedures, ergonomics and logistics have a direct impact on the patient care and the nursing and medical personnel. An organization structured on the needs of the patient and their family is mandatory in designing a new intensive care. The main aims in the design of a new department should be patient centered care, safety, functionality, innovation and a future-proof concept.

  16. Optimization of Parallel Legendre Transform using Graphics Processing Unit (GPU) for a Geodynamo Code

    Science.gov (United States)

    Lokavarapu, H. V.; Matsui, H.

    2015-12-01

    Convection and magnetic field of the Earth's outer core are expected to have vast length scales. To resolve these flows, high performance computing is required for geodynamo simulations using spherical harmonics transform (SHT), a significant portion of the execution time is spent on the Legendre transform. Calypso is a geodynamo code designed to model magnetohydrodynamics of a Boussinesq fluid in a rotating spherical shell, such as the outer core of the Earth. The code has been shown to scale well on computer clusters capable of computing at the order of 10⁵ cores using Message Passing Interface (MPI) and Open Multi-Processing (OpenMP) parallelization for CPUs. To further optimize, we investigate three different algorithms of the SHT using GPUs. One is to preemptively compute the Legendre polynomials on the CPU before executing SHT on the GPU within the time integration loop. In the second approach, both the Legendre polynomials and the SHT are computed on the GPU simultaneously. In the third approach , we initially partition the radial grid for the forward transform and the harmonic order for the backward transform between the CPU and GPU. There after, the partitioned works are simultaneously computed in the time integration loop. We examine the trade-offs between space and time, memory bandwidth and GPU computations on Maverick, a Texas Advanced Computing Center (TACC) supercomputer. We have observed improved performance using a GPU enabled Legendre transform. Furthermore, we will compare and contrast the different algorithms in the context of GPUs.

  17. A coordinated dispatch model for electricity and heat in a Microgrid via particle swarm optimization

    DEFF Research Database (Denmark)

    Xu, Lizhong; Yang, Guangya; Xu, Zhao

    2013-01-01

    , detailed combined heat and power (CHP) model is developed. The part load performance of CHP is modeled by curve fitting method. Furthermore, electric heater is introduced into the model to improve the economy of Microgrid operation and enhance the flexibility of the Microgrid by electricity-heat conversion......This paper develops a coordinated electricity and heat dispatching model for Microgrid under day-ahead environment. In addition to operational constraints, network loss and physical limits are addressed in this model, which are always ignored in previous work. As an important component of Microgrid....... Particle swarm optimization (PSO) is employed to solve this model for the operation schedule to minimize the total operational cost of Microgrid by coordinating the CHP, electric heater, boiler and heat storage. The efficacy of the model and methodology is verified with different operation scenarios....

  18. A United Method for Sensitivity Analysis of the Locational Marginal Price Based on the Optimal Power Flow

    Directory of Open Access Journals (Sweden)

    Liu Yang

    2014-01-01

    Full Text Available Locational marginal prices (LMPs are influenced by various factors in the electricity market; knowing the sensitivity information of LMPs is very important for both the purchase and the consumer. This paper presents a united method to compute the sensitivities of LMPs based on the optimal power flow (OPF. The Karush-Kuhn-Tucher (KKT system to solve LMPs can be transferred into an equation system by using an NCP function, and then by using the properties of the derivative of the semismooth NCP function, this paper provides a simultaneous obtention of the sensitivities of LMPs with respect to power demands, the cost of production, voltage boundary, and so forth. Numerical examples illustrate the concepts presented and the proposed methodology by a 6-bus electric energy system. Some relevant conclusions are drawn in the end.

  19. Planning intensive care unit design using computer simulation modeling: optimizing integration of clinical, operational, and architectural requirements.

    Science.gov (United States)

    OʼHara, Susan

    2014-01-01

    Nurses have increasingly been regarded as critical members of the planning team as architects recognize their knowledge and value. But the nurses' role as knowledge experts can be expanded to leading efforts to integrate the clinical, operational, and architectural expertise through simulation modeling. Simulation modeling allows for the optimal merge of multifactorial data to understand the current state of the intensive care unit and predict future states. Nurses can champion the simulation modeling process and reap the benefits of a cost-effective way to test new designs, processes, staffing models, and future programming trends prior to implementation. Simulation modeling is an evidence-based planning approach, a standard, for integrating the sciences with real client data, to offer solutions for improving patient care.

  20. Optical network unit placement in Fiber-Wireless (FiWi) access network by Moth-Flame optimization algorithm

    Science.gov (United States)

    Singh, Puja; Prakash, Shashi

    2017-07-01

    Hybrid wireless-optical broadband access network (WOBAN) or Fiber-Wireless (FiWi) is the integration of wireless access network and optical network. This hybrid multi-domain network adopts the advantages of wireless and optical domains and serves the demand of technology savvy users. FiWi exhibits the properties of cost effectiveness, robustness, flexibility, high capacity, reliability and is self organized. Optical Network Unit (ONU) placement problem in FiWi contributes in simplifying the network design and enhances the performance in terms of cost efficiency and increased throughput. Several individual-based algorithms, such as Simulated Annealing (SA), Tabu Search, etc. have been suggested for ONU placement, but these algorithms suffer from premature convergence (trapping in a local optima). The present research work undertakes the deployment of FiWi and proposes a novel nature-inspired heuristic paradigm called Moth-Flame optimization (MFO) algorithm for multiple optical network units' placement. MFO is a population based algorithm. Population-based algorithms are better in handling local optima avoidance. The simulation results are compared with the existing Greedy and Simulated Annealing algorithms to optimize the position of ONUs. To the best of our knowledge, MFO algorithm has been used for the first time in this domain, moreover it has been able to provide very promising and competitive results. The performance of MFO algorithm has been analyzed by varying the 'b' parameter. MFO algorithm results in faster convergence than the existing strategies of Greedy and SA and returns a lower value of overall cost function. The results exhibit the dependence of the objective function on the distribution of wireless users also.

  1. Automatic delineation of geomorphological slope units with r.slopeunits v1.0 and their optimization for landslide susceptibility modeling

    Directory of Open Access Journals (Sweden)

    M. Alvioli

    2016-11-01

    Full Text Available Automatic subdivision of landscapes into terrain units remains a challenge. Slope units are terrain units bounded by drainage and divide lines, but their use in hydrological and geomorphological studies is limited because of the lack of reliable software for their automatic delineation. We present the r.slopeunits software for the automatic delineation of slope units, given a digital elevation model and a few input parameters. We further propose an approach for the selection of optimal parameters controlling the terrain subdivision for landslide susceptibility modeling. We tested the software and the optimization approach in central Italy, where terrain, landslide, and geo-environmental information was available. The software was capable of capturing the variability of the landscape and partitioning the study area into slope units suited for landslide susceptibility modeling and zonation. We expect r.slopeunits to be used in different physiographical settings for the production of reliable and reproducible landslide susceptibility zonations.

  2. Automatic delineation of geomorphological slope units with r.slopeunits v1.0 and their optimization for landslide susceptibility modeling

    Science.gov (United States)

    Alvioli, Massimiliano; Marchesini, Ivan; Reichenbach, Paola; Rossi, Mauro; Ardizzone, Francesca; Fiorucci, Federica; Guzzetti, Fausto

    2016-11-01

    Automatic subdivision of landscapes into terrain units remains a challenge. Slope units are terrain units bounded by drainage and divide lines, but their use in hydrological and geomorphological studies is limited because of the lack of reliable software for their automatic delineation. We present the r.slopeunits software for the automatic delineation of slope units, given a digital elevation model and a few input parameters. We further propose an approach for the selection of optimal parameters controlling the terrain subdivision for landslide susceptibility modeling. We tested the software and the optimization approach in central Italy, where terrain, landslide, and geo-environmental information was available. The software was capable of capturing the variability of the landscape and partitioning the study area into slope units suited for landslide susceptibility modeling and zonation. We expect r.slopeunits to be used in different physiographical settings for the production of reliable and reproducible landslide susceptibility zonations.

  3. Experimental study and modeling of degradation phenomena in HTPEM fuel cell stacks for use in CHP systems

    OpenAIRE

    Nielsen, Mads Pagh; Andreasen, Søren Juhl; Rasmussen, Peder Lund; Kær, Søren Knudsen

    2009-01-01

    Degradation phenomena in HTPEM fuel cells for use in CHP systems were investigated experimentally and by modeling. It was found that the two main degradation mechanisms in HTPEM fuel cells are carbon corrosion and Pt agglomeration. On basis of this conclusion a mechanistic model, describing the degradation caused by these phenomena, is suggested. Using the proposed model, information about optimum operational temperatures is derived. To investigate how the degradation propagates on stack leve...

  4. Stochastic Multicriteria Acceptability Analysis for Evaluation of Combined Heat and Power Units

    Directory of Open Access Journals (Sweden)

    Haichao Wang

    2014-12-01

    Full Text Available Combined heat and power (CHP is a promising technology that can contribute to energy efficiency and environmental protection. More CHP-based energy systems are planned for the future. This makes the evaluation and selection of CHP systems very important. In this paper, 16 CHP units representing different technologies are taken into account for multicriteria evaluation with respect to the end users’ requirements. These CHP technologies cover a wide range of power outputs and fuel types. They are evaluated from the energy, economy and environment (3E points of view, specifically including the criteria of efficiency, investment cost, electricity cost, heat cost, CO2 production and footprint. Uncertainties and imprecision are common both in criteria measurements and weights, therefore the stochastic multicriteria acceptability analysis (SMAA model is used in aiding this decision making problem. These uncertainties are treated better using a probability distribution function and Monte Carlo simulation in the model. Moreover, the idea of “feasible weight space (FWS” which represents the union of all preference information from decision makers (DMs is proposed. A complementary judgment matrix (CJM is introduced to determine the FWS. It can be found that the idea of FWS plus CJM is well compatible with SMAA and thus make the evaluation reliable.

  5. Microbiological Contamination at Workplaces in a Combined Heat and Power (CHP) Station Processing Plant Biomass.

    Science.gov (United States)

    Szulc, Justyna; Otlewska, Anna; Okrasa, Małgorzata; Majchrzycka, Katarzyna; Sulyok, Michael; Gutarowska, Beata

    2017-01-21

    The aim of the study was to evaluate the microbial contamination at a plant biomass processing thermal power station (CHP). We found 2.42 × 10³ CFU/m³ of bacteria and 1.37 × 10⁴ CFU/m³ of fungi in the air; 2.30 × 10⁷ CFU/g of bacteria and 4.46 × 10⁵ CFU/g of fungi in the biomass; and 1.61 × 10² CFU/cm² bacteria and 2.39 × 10¹ CFU/cm² fungi in filtering facepiece respirators (FFRs). Using culture methods, we found 8 genera of mesophilic bacteria and 7 of fungi in the air; 10 genera each of bacteria and fungi in the biomass; and 2 and 5, respectively, on the FFRs. Metagenomic analysis (Illumina MiSeq) revealed the presence of 46 bacterial and 5 fungal genera on the FFRs, including potential pathogens Candida tropicalis, Escherichia coli, Prevotella sp., Aspergillus sp., Penicillium sp.). The ability of microorganisms to create a biofilm on the FFRs was confirmed using scanning electron microscopy (SEM). We also identified secondary metabolites in the biomass and FFRs, including fumigaclavines, quinocitrinines, sterigmatocistin, and 3-nitropropionic acid, which may be toxic to humans. Due to the presence of potential pathogens and mycotoxins, the level of microbiological contamination at workplaces in CHPs should be monitored.

  6. CHP HIGHER EDUCATION, SCHOLARSHIPS AND DEMAND ABROAD ARE POLITICS (1942-1947

    Directory of Open Access Journals (Sweden)

    Suat ZEYREK

    2016-04-01

    Full Text Available Turkey was followed by a very slow development in the course of the republic’s first year in higher education.By 1955, there are only two universities in the three cities in Turkey.Although the new university will be declared opened by Ismet Inonu’s mouth several times it was not possible for various reasons.Turkey’s economic situation, the shortage of trained personel and it has been hampered by severe conditions of World War II.But even more important excuses should have prevented the spread of higher education in Turkey. This article will be presented in the light of the real causes of the problem of archival sources mentioned above.Period ruling party, the CHP’s higher education policy followed in scholarships and dormitories were investigated.CHP likely to promote higher education in the first primary education spread to the base and thus wants to create a higher demand.For this reason, it is necessary first of all to build infrastructure for higher education institutions and rules.Coming from big cities in different regions of Anatolia youth to take education to all students experience difficulties and inclusive, egalitarian policies were followed.

  7. Conceptual study of a 250 kW planar SOFC system for CHP application

    Science.gov (United States)

    Fontell, E.; Kivisaari, T.; Christiansen, N.; Hansen, J.-B.; Pålsson, J.

    In August 2002, Wärtsilä Corporation and Haldor Topsøe A/S entered into a co-operation agreement to start joint development program within the planar SOFC technology. The development program aims to bring to the market highly efficient, clean and cost competitive fuel cell systems with power outputs above 200 kW for distributed power generation with CHP and for marine applications. In this study, the product concept for a 250 kW natural gas-fuelled atmospheric SOFC plant has been studied. The process has been calculated and optimised for high electrical efficiency. In the calculations, system efficiencies more than 55-85% (electrical co-generation) have been reached. The necessary balance of plant (BoP) components have been identified and the concept for grid connection has been defined. The BoP includes fuel and air supply, anode re-circulation, start-up steam, purge gas, exhaust gas heat recovery, back-up power, power electronics and control system. Based on the analysed system and component information, a conceptual design and cost break down structure for the product have been made. The cost breakdown shows that the stack, system control and power electronics are the major cost factors, while the remaining BoP equipment stands for a minor share of the manufacturing cost. Finally, the feasibility of the SOFC plants has been compared to gas engines.

  8. Balmorel: A model for analyses of the electricity and CHP markets in the Baltic Sea Region

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2001-03-01

    This report describes the motivations behind the development of the Balmorel model as well as the model itself. The purpose of the Balmorel project is to develop a model for analyses of the power and CHP sectors in the Baltic Sea Region. The model is directed towards the analysis of relevant policy questions to the extent that they contain substantial international aspects. The model is developed in response to the trend towards internationalisation in the electricity sector. This trend is seen in increased international trade of electricity, in investment strategies among producers and otherwise. Also environmental considerations and policies are to an increasing extent gaining an international perspective in relation to the greenhouse gasses. Further, the ongoing process of deregulation of the energy sector highlights this and contributes to the need for overview and analysis. A guiding principle behind the construction of the model has been that it may serve as a means of communication in relation to the policy issues that already are or that may become important for the region. Therefore, emphasis has been put on documentation, transparency and flexibility of the model. This is achieved in part by formulating the model in a high level modelling language, and by making the model, including data, available at the internet. Potential users of the Balmorel model include research institutions, consulting companies, energy authorities, transmission system operators and energy companies. (au)

  9. Graphics-processor-unit-based parallelization of optimized baseline wander filtering algorithms for long-term electrocardiography.

    Science.gov (United States)

    Niederhauser, Thomas; Wyss-Balmer, Thomas; Haeberlin, Andreas; Marisa, Thanks; Wildhaber, Reto A; Goette, Josef; Jacomet, Marcel; Vogel, Rolf

    2015-06-01

    Long-term electrocardiogram (ECG) often suffers from relevant noise. Baseline wander in particular is pronounced in ECG recordings using dry or esophageal electrodes, which are dedicated for prolonged registration. While analog high-pass filters introduce phase distortions, reliable offline filtering of the baseline wander implies a computational burden that has to be put in relation to the increase in signal-to-baseline ratio (SBR). Here, we present a graphics processor unit (GPU)-based parallelization method to speed up offline baseline wander filter algorithms, namely the wavelet, finite, and infinite impulse response, moving mean, and moving median filter. Individual filter parameters were optimized with respect to the SBR increase based on ECGs from the Physionet database superimposed to autoregressive modeled, real baseline wander. A Monte-Carlo simulation showed that for low input SBR the moving median filter outperforms any other method but negatively affects ECG wave detection. In contrast, the infinite impulse response filter is preferred in case of high input SBR. However, the parallelized wavelet filter is processed 500 and four times faster than these two algorithms on the GPU, respectively, and offers superior baseline wander suppression in low SBR situations. Using a signal segment of 64 mega samples that is filtered as entire unit, wavelet filtering of a seven-day high-resolution ECG is computed within less than 3 s. Taking the high filtering speed into account, the GPU wavelet filter is the most efficient method to remove baseline wander present in long-term ECGs, with which computational burden can be strongly reduced.

  10. The optimal parameter design for a welding unit of manufacturing industry by Taguchi method and computer simulation

    Directory of Open Access Journals (Sweden)

    Seyed Mojib Zahraee

    2016-05-01

    Full Text Available Purpose: Manufacturing systems include a complicated combination of resources, such as materials, labors, and machines. Hence, when the manufacturing systems are faced with a problem related to the availability of resources it is difficult to identify the root of the problem accurately and effectively. Managers and engineers in companies are trying to achieve a robust production line based on the maximum productivity. The main goal of this paper is to design a robust production line, taking productivity into account in the selected manufacturing industry. Design/methodology/approach: This paper presents the application of Taguchi method along with computer simulation for finding an optimum factor setting for three controllable factors, which are a number of welding machines, hydraulic machines, and cutting machines by analyzing the effect of noise factors in a selected manufacturing industry. Findings and Originality/value: Based on the final results, the optimal design parameter of welding unit of in the selected manufacturing industry will be obtained when factor A is located at level 2 and B and C are located at level 1. Therefore, maximum productive desirability is achieved when the number of welding machines, hydraulic machines, and cutting machines is equal to 17, 2, and 1, respectively. This paper has a significant role in designing a robust production line by considering the lowest cost and timely manner based on the Taguchi method.

  11. Improved PI-PD control design using predictive functional optimization for temperature model of a fluidized catalytic cracking unit.

    Science.gov (United States)

    Zou, Hongbo; Li, Haisheng

    2017-03-01

    Proportional-integral-derivative (PID) control is widely used in industry because of its simple structure and convenient implementation. However, PID control is suitable for small time delay systems; while if too large delay is encountered, PID control may not obtain the desired performance. Proportional-integral-proportional-derivative (PI-PD) control is a modified of PID control and can get improved control performance; however, due to the complex controller parameter tuning, the PI-PD control is used in a limited scope. Inspired by the advantage of predictive functional control (PFC), a new PI-PD control design using PFC optimization is proposed in this paper. The proposed method not only inherits the advantage of PFC, which does well in coping with the time delay, but also has the same structure as the PI-PD controller. The proposed method is tested on the preheated temperature control of crude oil in a fluidized catalytic cracking unit. The results show that the proposed controller improves control performance compared with typical PID control and PI-PD control. Copyright © 2016 ISA. Published by Elsevier Ltd. All rights reserved.

  12. The optimal parameter design for a welding unit of manufacturing industry by Taguchi method and computer simulation

    Energy Technology Data Exchange (ETDEWEB)

    Zahraee, S.M.; Chegeni, A.; Toghtamish, A.

    2016-07-01

    Manufacturing systems include a complicated combination of resources, such as materials, labors, and machines. Hence, when the manufacturing systems are faced with a problem related to the availability of resources it is difficult to identify the root of the problem accurately and effectively. Managers and engineers in companies are trying to achieve a robust production line based on the maximum productivity. The main goal of this paper is to design a robust production line, taking productivity into account in the selected manufacturing industry. This paper presents the application of Taguchi method along with computer simulation for finding an optimum factor setting for three controllable factors, which are a number of welding machines, hydraulic machines, and cutting machines by analyzing the effect of noise factors in a selected manufacturing industry. Based on the final results, the optimal design parameter of welding unit of in the selected manufacturing industry will be obtained when factor A is located at level 2 and B and C are located at level 1. Therefore, maximum productive desirability is achieved when the number of welding machines, hydraulic machines, and cutting machines is equal to 17, 2, and 1, respectively. This paper has a significant role in designing a robust production line by considering the lowest cost and timely manner based on the Taguchi method. (Author)

  13. Exergy analysis and optimization of a biomass gasification, solid oxide fuel cell and micro gas turbine hybrid system

    DEFF Research Database (Denmark)

    Bang-Møller, Christian; Rokni, Masoud; Elmegaard, Brian

    2011-01-01

    A hybrid plant producing combined heat and power (CHP) from biomass by use of a two-stage gasification concept, solid oxide fuel cells (SOFC) and a micro gas turbine was considered for optimization. The hybrid plant represents a sustainable and efficient alternative to conventional decentralized...

  14. Techno-economic analysis of CHP system supplied by waste forest biomass.

    Science.gov (United States)

    Borsukiewicz-Gozdur, A; Klonowicz, P; Król, D; Wiśniewski, S; Zwarycz-Makles, K

    2015-08-01

    Poland, as for Europe, is a country with an average forest cover of approximately 30%. In these forests, more than 37M m3 of wood, mostly coniferous (over 80%), is harvested per year. In 2012, 4.2M m3 of sawn timber was produced (sawn timber without factory lumber). At the same time, in Poland there are over 8000 sawmills, whereas only about 700 of them saw over 90% of the harvested timber. So much fragmentation is a major cause of low sawmills innovation, particularly of those small ones. However, in recent years, a trend of development in this sector is noticeable, and it is through rationalisation of material and energy economy. One of the methods to increase the technical and economic effectiveness of enterprises involved in woodworking is to build in the combined heat and power system (CHP) plant with the ORC system into the existing infrastructure, which will be matched to the needs of the company. This article presents an analysis of the profitability of the investment based on the example of a medium-sized company sawing approximately 50,000 m3 of timber per year, and the economic analysis was performed for prices and costs valid in Poland. The analysis made for the 1650 kW(el) organic Rankine cycle (ORC) system, has resulted in a profitability index PI = 1.3, on the assumptions that the ORC system operates for 6000 h y(-1), will be purchased at the price of 4500 € kW(el)(-1) and at the price of electricity sales of 130 € MWh(-1). © The Author(s) 2015.

  15. Operational Strategies for a Portfolio of Wind Farms and CHP Plants in a Two-Price Balancing Market

    DEFF Research Database (Denmark)

    Hellmers, Anna; Zugno, Marco; Skajaa, Anders

    2015-01-01

    In this paper we explore the portfolio effect of a system consisting of a Combined Heat and Power (CHP) plant and a wind farm. The goal is to increase the overall profit of the portfolio by reducing imbalances, and consequently their implicit penalty in a two-price balancing market for electricity......-horizon fashion, so that forecasts for heat demand, wind power production and market prices are updated at each iteration. We conclude that the portfolio strategy is the most profitable due to the two-price structure of the balancing market. This encourages producers to handle their imbalances outside the market....

  16. Performance of working-fluid mixtures in an ORC-CHP system for different heat demand segments

    OpenAIRE

    Oyewunmi, OA; Kirmse, CJW; Pantaleo, AM; Markides, C.

    2016-01-01

    Organic Rankine cycle (ORC) power systems are being increasingly deployed for waste heat recovery and conversion to power in several industrial settings. In the present paper, we investigate the use of working-fluid mixtures in ORC systems operating in combined heat and power mode (ORC-CHP) with shaft power provided by the expander/turbine and heating provided by the cooling-water exiting the condenser. The waste-heat source is a flue gas stream from a refinery boiler with a mass flow rate of...

  17. Experimental study and modelling of degradation phenomena in HTPEM fuel cell stacks for use in CHP systems

    DEFF Research Database (Denmark)

    Andreasen, Søren Juhl

    2009-01-01

    Degradation phenomena in HTPEM fuel cells for use in CHP systems were investigated experimentally and by modelling. It was found that the two main degradation mechanisms in HTPEM fuel cells are carbon corrosion and Pt agglomeration. On basis of this conclusion a mechanistic model, describing...... single cell experiment and a long term stack experiment (around 800 hours so far). In the stack experiment two 1 kW stacks were operated at temperatures of 150oC and 170oC. Individual cell voltages were monitored during the experiment, along with stack voltage and temperature. The experiment support...

  18. ANALYSIS AND PARAMETRIC OPTIMIZATION OF ENERGY-AND-TECHNOLOGY UNITS ON THE BASIS OF THE POWER EQUIPMENT OF COMPRESSOR PLANTS OF MAIN GAS PIPELINES

    Directory of Open Access Journals (Sweden)

    V. A. Sednin

    2017-01-01

    Full Text Available On the basis of the gas compressor units of compressor plants of a main gas pipeline mathematical models of the macro-level were generated for analysis and parametric optimization of combined energy-and-technology units. In continuation of the study these models was applied to obtain the regression dependencies. For this purpose, a numerical experiment was used which had been designed with the use of regression analysis mathematical tool, which assumes that the test results should represent independent, normally distributed, random variables with approximately equal variance. Herewith we study the dependence of the optimization criterion on the value of control parameters (factors. Planning, conducting and processing of results of the experiment was conducted in the following sequence: choice of the optimization criteria, selection of control parameters (factors, encoding factors, the matrix of experiment compiling, assessing significance of regression coefficients, testing the adequacy of the model and reproducibility of the experiments. As the optimization criteria the electricity capacity and efficiency of combined energy-technology units were adopted. As control parameters for the installation with a gas-expansion-and-generator machine the temperature of the fuel gas before the expander, the pressure of the fuel gas after the expander and the temperature of the air supplied to the compressor of the engine were adopted, while for the steam turbine the adopted optimization criteria were compression in the compressor of the engine, the steam consumption for the technology and the temperature of the air supplied to the compressor of the engine. The application of the outlined methodological approach makes it possible to obtain a simple polynomial dependence, which significantly simplify the procedures of analysis, parametric optimization and evaluation of efficiency in the feasibility studies of the options of construction of the energy

  19. Comprehensive Energy Assessment: EE and RE Project Optimization Modeling for United States Pacific Command (USPACOM) American Recovery and Reinvestment Act (ARRA) FEMP Technical Assistance

    Energy Technology Data Exchange (ETDEWEB)

    Brigantic, Robert T.; Papatyi, Anthony F.; Perkins, Casey J.

    2010-09-30

    This report summarizes a study and corresponding model development conducted in support of the United States Pacific Command (USPACOM) as part of the Federal Energy Management Program (FEMP) American Reinvestment and Recovery Act (ARRA). This research was aimed at developing a mathematical programming framework and accompanying optimization methodology in order to simultaneously evaluate energy efficiency (EE) and renewable energy (RE) opportunities. Once developed, this research then demonstrated this methodology at a USPACOM installation - Camp H.M. Smith, Hawaii. We believe this is the first time such an integrated, joint EE and RE optimization methodology has been constructed and demonstrated.

  20. A Comparative Study of Fuzzy Logic, Genetic Algorithm, and Gradient-Genetic Algorithm Optimization Methods for Solving the Unit Commitment Problem

    Directory of Open Access Journals (Sweden)

    Sahbi Marrouchi

    2014-01-01

    Full Text Available Due to the continuous increase of the population and the perpetual progress of industry, the energy management presents nowadays a relevant topic that concerns researchers in electrical engineering. Indeed, in order to establish a good exploitation of the electrical grid, it is necessary to solve technical and economic problems. This can only be done through the resolution of the Unit Commitment Problem. Unit Commitment Problem allows optimizing the combination of the production units’ states and determining their production planning, in order to satisfy the expected consumption with minimal cost during a specified period which varies usually from 24 hours to one week. However, each production unit has some constraints that make this problem complex, combinatorial, and nonlinear. This paper presents a comparative study between a strategy based on hybrid gradient-genetic algorithm method and two strategies based on metaheuristic methods, fuzzy logic, and genetic algorithm, in order to predict the combinations and the unit commitment scheduling of each production unit in one side and to minimize the total production cost in the other side. To test the performance of the optimization proposed strategies, strategies have been applied to the IEEE electrical network 14 busses and the obtained results are very promising.

  1. Designing and optimization of a micro CHP system based on Solid Oxide Fuel Cell with different fuel processing technologies

    DEFF Research Database (Denmark)

    Liso, Vincenzo; Nielsen, Mads Pagh; Kær, Søren Knudsen

    2009-01-01

    The development of fuel cell technologies offers the opportunity to achieve significant improvements in energy conversion efficiencies at many scales. The high operating temperature (700-1000 Celsius) of Solid Oxide Fuel Cells (SOFC) has a number of consequences, the most important of which...... will be evaluated in terms of their energetic performance and suitability for meeting residential thermal and electric demand....

  2. Field Demonstration, Optimization, and Rigorous Validation of Peroxygen-Based ISCO for the Remediation of Contaminated Groundwater - CHP Stabilization Protocol

    Science.gov (United States)

    2014-05-01

    sorbed material and to disrupt and destroy the NAPL globules and ganglia. Superoxide is generated through heterogeneous catalysis of hydrogen peroxide...12% (0.6–3.6 M) range are typically used for ISCO applications, and the common practice in the field has been to increase the concentration of...hydrogen peroxide when treatment has been unsuccessful. This practice often enhances treatment effectiveness, in part because the high hydrogen peroxide

  3. Modeling and optimization of a heat-pump-assisted high temperature proton exchange membrane fuel cell micro-combined-heat-and-power system for residential applications

    DEFF Research Database (Denmark)

    Arsalis, Alexandros; Kær, Søren Knudsen; Nielsen, Mads Pagh

    2015-01-01

    In this study a micro-combined-heat-and-power (micro-CHP) system is coupled to a vapor-compression heat pump to fulfill the residential needs for heating (space heating and water heating) and electricity in detached single-family households in Denmark. Such a combination is assumed to be attractive...... for application, since both fuel cell technology and electric heat pumps are found to be two of the most efficient technologies for generation/conversion of useful energy. The micro-CHP system is fueled with natural gas and includes a fuel cell stack, a fuel processor and other auxiliary components. The micro....... The variational loads are considered from full to quarter load, and the micro-CHP system is optimized in terms of operating thermophysical parameters for every different load. The results clearly indicate the capability of the proposed system to perform efficiently throughout all necessary load changes to fulfill...

  4. Use of Methanation for Optimization of a Hybrid Plant Combining Two-Stage Biomass Gasification, SOFCs and a Micro Gas Turbine

    DEFF Research Database (Denmark)

    Bang-Møller, Christian; Rokni, Masoud; Elmegaard, Brian

    2011-01-01

    A hybrid plant producing combined heat and power (CHP) from biomass by use of the two-stage gasification concept, solid oxide fuel cells (SOFCs) and a micro gas turbine (MGT) was considered for optimization. The hybrid plant is a sustainable and efficient alternative to conventional decentralized...

  5. 4E analysis and multi objective optimization of a micro gas turbine and solid oxide fuel cell hybrid combined heat and power system

    Science.gov (United States)

    Sanaye, Sepehr; Katebi, Arash

    2014-02-01

    Energy, exergy, economic and environmental (4E) analysis and optimization of a hybrid solid oxide fuel cell and micro gas turbine (SOFC-MGT) system for use as combined generation of heat and power (CHP) is investigated in this paper. The hybrid system is modeled and performance related results are validated using available data in literature. Then a multi-objective optimization approach based on genetic algorithm is incorporated. Eight system design parameters are selected for the optimization procedure. System exergy efficiency and total cost rate (including capital or investment cost, operational cost and penalty cost of environmental emissions) are the two objectives. The effects of fuel unit cost, capital investment and system power output on optimum design parameters are also investigated. It is observed that the most sensitive and important design parameter in the hybrid system is fuel cell current density which has a significant effect on the balance between system cost and efficiency. The selected design point from the Pareto distribution of optimization results indicates a total system exergy efficiency of 60.7%, with estimated electrical energy cost 0.057 kW-1 h-1, and payback period of about 6.3 years for the investment.

  6. Analysis of the impact of Heat-to-Power Ratio for a SOFC-based mCHP system for residential application under different climate regions in Europe

    DEFF Research Database (Denmark)

    Liso, Vincenzo; Zhao, Yingru; Brandon, Nigel

    2011-01-01

    -family households in different European countries are evaluated. The range of Heat-to-Power Ratio for the SOFC based mCHP System of 0.5 to 1.5 shows good agreement with the hot water, space heating and electricity demand during the warm seasons across Europe. This suggests that the fuel cell system should be sized...

  7. Marketing opportunities for CHP electricity in a virtual power plant. Direct and indirect marketing of flexibility; Vermarktungschancen fuer KWK-Strom im virtuellen Kraftwerk. Direkte und indirekte Flexibilitaetsvermarktung

    Energy Technology Data Exchange (ETDEWEB)

    Otto, Achim; Baumgart, Bastian [Trianel GmbH, Aachen (Germany). Abt. Virtuelle Kraftwerke

    2013-07-15

    The increasingly fluctuating feed-in of electricity by means of a rapid expansion of renewable energies results in an increasing demand for flexible performance for the regulation of production and consumption. An important part of the necessary flexibility could be provided by CHP plants. Their potential of flexibility is not always fully exploited.

  8. Flexible 75 kWel Stirling CHP-plant for bio-fuels with low emissions and a high fuel utilization. Final technical report

    Energy Technology Data Exchange (ETDEWEB)

    2011-07-01

    The objective of the project ''Flexible 75 kWel Stirling CHP-plant for bio-fuels with low emissions and a high fuel utilization'' was to combine the Danish experiences with the Stirling engine and updraft gasification with the application of the FLOX gas burner technology for developing and demonstrating a flexible biomass-based small scale CHP plant with 75 kW electrical output, high power efficiency and low emissions. Further, the project has aimed at increasing the technology's reliability and decreasing the need for service. Also, the project has included the development of a control and communication system for unmanned start-up and operation of the plant. During the project the objective was altered and so the development of a new Stirling engine design was done on the 4-cylindred 35 kWe Stirling engine instead of the 8-cylindred 75 kWe Stirling engine. Focus has been on designing a more durable engine designed for easy and fast service. Cold test of the engine has been successful and now full-scale hot tests are to be performed. In the project Stirling DK has also in cooperation with project partner Danish gas Technology Centre developed the Stirling Engine with Diluted Oxidation (SEDIOX) concept which is a combustion technology based on the diluted oxidation principle. A trademark is obtained and also a patent application is filed and pending regarding the SEDIOX combustion chamber concept. All components for the Stirling gasification plant were produced and installed at Svanholm Estate. The plant consisted of one conventional combustion chamber and one SD3E-type Stirling engine. The plant was commissioned in June 2009 and 1,472 hours of operation and 43 MWh of electricity production was achieved before the plant was de-commissioned in February 2010 due to divergences between Svanholm Estate and Stirling DK. During operation the control system including remote access was tested thoroughly and with great success. The new overall

  9. [Optimization of blood gas analysis in intensive care units : Reduction of preanalytical errors and improvement of workflow].

    Science.gov (United States)

    Kieninger, M; Zech, N; Mulzer, Y; Bele, S; Seemann, M; Künzig, H; Schneiker, A; Gruber, M

    2015-05-01

    Point of care testing with blood gas analysis (BGA) is an important factor for intensive care medicine. Continuous efforts to optimize workflow, improve safety for the staff and avoid preanalytical mistakes are important and should reflect quality management standards. In a prospective observational study it was investigated whether the implementation of a new system for BGA using labeled syringes and automated processing of the specimens leads to improvements compared to the previously used procedure. In a 4-week test period the time until receiving the final results of the BGA with the standard method used in the clinical routine (control group) was compared to the results in a second 4-week test period using the new labeled syringes and automated processing of the specimens (intervention group). In addition, preanalytical mistakes with both systems were checked during routine daily use. Finally, it was investigated whether a delay of 10 min between taking and analyzing the blood samples alters the results of the BGA. Preanalytical errors were frequently observed in the control group where non-deaerated samples were recorded in 87.3 % but in the intervention group almost all samples (98.9 %) were correctly deaerated. Insufficient homogenization due to omission of manual pivoting was seen in 83.2 % in the control group and in 89.9 % in the intervention group; however, in the intervention group the samples were homogenized automatically during the further analytical process. Although a survey among the staff revealed a high acceptance of the new system and a subjective improvement of workflow, a measurable gain in time after conversion to the new procedure could not be seen. The mean time needed for a complete analysis process until receiving the final results was 244 s in the intervention group and 201 s in the control group. A 10-min delay between taking and analyzing the blood samples led to a significant and clinically relevant elevation of the values for

  10. Providing Optimal Palliative Care for Persons Living with Dementia: A Comparison of Physician Perceptions in the Netherlands and the United Kingdom.

    Science.gov (United States)

    Brazil, Kevin; Galway, Karen; Carter, Gillian; van der Steen, Jenny T

    2017-05-01

    The European Association for Palliative Care (EAPC) recently issued a framework that defines optimal palliative care in dementia. However, implementation of the guidelines may pose challenges for physicians working with dementia patients in practice. To measure and compare the perceptions of physicians in two European regions regarding the importance and challenges of implementing recommendations for optimal palliative care in dementia patients. Cross-sectional observational study. The Netherlands and the United Kingdom. Physicians (n = 317) providing palliative care to patients with dementia. Postal survey. Physicians in the Netherlands and Northern Ireland (NI), United Kingdom, prioritized the same domains of optimal palliative care for dementia and these match the priorities in the EAPC-endorsed guidelines. Respondents in both countries rated lack of education of professional teams and lack of awareness of the general public among the most important barriers to providing palliative care in dementia. NI respondents also identified access to specialist support as a barrier. The results indicate that there is a strong consensus among experts, elderly care physicians, and general practitioners across a variety of settings in Europe that person-centered care involving optimal communication and shared decision making is the top priority for delivering optimal palliative care in dementia. The current findings both support and enhance the new recommendations ratified by the EAPC. To take forward the implementation of EAPC guidelines for palliative care for dementia, it will be necessary to assess the challenges more thoroughly at a country-specific level and to design and test interventions that may include systemic changes to help physicians overcome such challenges.

  11. Optimal and economic selection of turn ratio for unit transformer using generator capability curves of synchronous generators

    Directory of Open Access Journals (Sweden)

    Seyed M.H. NABAVI

    2015-05-01

    Full Text Available One of the most important subjects in power systems is an optimal and economic design of power transformers. In this paper, determination of turn ratios for power transformers that are directly connected to generators is evaluated considering reactive power generation and its impact on the optimal turn ratio selection. A generator capability curve has been used to explain all details. Three different methods have been examined and the simulation results have been compared in a real test system, on Rudbar-Lorestan, Karkheh, Karoon 3, Masjed Solayman, and Gotvand hydro power plants. The obtained results illustrate that without considering limits of reactive power the achieved turn ratios can be much higher than the optimal values.

  12. The Heat Transfer of Microencapsulated Phase Change Material Slurry and Its Thermal Energy Storage Performance of Combined Heat and Power Generating Units

    Directory of Open Access Journals (Sweden)

    Yonghong Guo

    2017-10-01

    Full Text Available The application of thermal energy storage (TES is an effective way of improving the power load regulation capability of combined heat and power (CHP generating units. In this paper, a theoretical investigation on the thermal energy storage system of a CHP unit that employs the microencapsulated phase change material slurry (MPCMS as the working fluid is carried out. The results indicate that the microcapsule particle internal melting rate is progressively small; 90% latent heat can be absorbed in 63% total melting time. The melting time of particles in micron is very short, and the diameter is an important factor for microcapsule melting. For the MPCMS flow in a circular tube, the temperature distribution between laminar flows and turbulent flows is different. In a turbulent flow, there is an approximate isothermal section along the tube, which cannot be found in a laminar flow. Additionally, a thermal storage system with MPCMS as heat transfer fluid for a CHP unit is proposed. A case study for a 300 MW CHP unit found that the use of an MPSMS thermal energy storage system increases the power peak shaving capacity by 81.4%. This indicates that the thermal storage system increases the peak shaving capacity of cogeneration units.

  13. Long-Term Monitoring Network Optimization Evaluation for Operable Unit 2, Bunker Hill Mining and Metallurgical Complex Superfund Site, Idaho

    Science.gov (United States)

    This report presents a description and evaluation of the ground water and surface water monitoring program associated with the Bunker Hill Mining and Metallurgical Complex Superfund Site (Bunker Hill) Operable Unit (OU) 2.

  14. Modelling of a solid oxide fuel cell CHP system coupled with a hot water storage tank for a single household

    DEFF Research Database (Denmark)

    Liso, Vincenzo; Zhao, Yingru; Yang, Wenyuan

    2015-01-01

    In this paper a solid oxide fuel cell (SOFC) system for cogeneration of heat and power integrated with a stratified heat storage tank is studied. The use of a storage tank with thermal stratification allows one to increase the annual operating hours of CHP: heat can be produced when the request...... that in the case of syngas, due to larger system heat output, a larger tank volume was required in order to accumulate unused heat over the night. The detailed description of the tank model will be useful to energy system modelers when sizing hot water tanks. Problem formulation is reported also using a Matlab...... is low (for instance during the night), taking advantage of thermal stratification to increases the heat recovery performance. A model of the SOFC system is presented to estimate the energy required to meet the average electric energy demand of the residence. Two fuels are considered, namely syngas...

  15. Design and analysis of permanent magnet moving coil type generator used in a micro-CHP generation system

    Science.gov (United States)

    Oros Pop, Susana Teodora; Berinde, Ioan; Vadan, Ioan

    2015-12-01

    This paper presents the design and analysis of a permanent magnet moving coil type generator driven by a free piston Stirling engine. This assemble free piston Stirling engine - permanent magnet moving coil type generator will be used in a combined heat and power (CHP) system for producing heat and power in residential area. The design procedure for moving coil type linear generator starts from the rated power imposed and finally uses the Faraday law of induction. The magneto-static magnetic field generated by permanent magnets is analyzed by means of Reluctance method and Finite Element Method in order to evaluate the magnetic flux density in the air gap, which is a design data imposed in the design stage, and the results are compared.

  16. In-situ corrosion investigation at Masnedø CHP plant - a straw-fired power plant

    DEFF Research Database (Denmark)

    Montgomery, Melanie; Karlsson, Asger

    1999-01-01

    Various austenitic and ferritic steels were exposed on a water-cooled probe in the superheater area of a straw-fired CHP plant. The temperature of the probe ranged from 450-600°C and the period of exposure was 1400 hours. The rate of corrosion was assessed based on unattacked metal remaining....... The corrosion products and course of corrosion for the various steel types were investigated using light optical and scanning electron microscopy. The ferritic steels suffered from corrosion mainly via material loss. The austenitic steels suffered from predominantly selective corrosion which resulted...... in depletion of chromium from the alloy. A clear trend was observed that selective corrosion increased with respect to the chromium content of the alloy....

  17. Optimization of Turkish Air Force SAR Units Forward Deployment Points for a Central Based SAR Force Structure

    Science.gov (United States)

    2015-03-26

    Applications ( VBA ) & LINGO Optimization Software interface that allows changing each exogenous variable of the models in a flexible way. The...Median Model ................................................................ 44 3.7 Generating VBA & Lingo Combination as a Useful Tool...46 3.7.2 Logic of VBA & LINGO Interface .............................................................................. 46 3.8 Summary

  18. Optimization of the power transmission towards the tractive unit by adjusting the power factor; Optimierung der Energieuebertragung zum Triebfahrzeug ueber den Leistungsfaktor

    Energy Technology Data Exchange (ETDEWEB)

    Mahn, U. [Technische Univ. Darmstadt (Germany). Inst. fuer Elektrische Energieversorgung

    1997-12-31

    The operation of modern power converters in tractive units offers the possibility to influence the power factor and, as a consequence, the reactive power distribution of the catenary line. In the following, some criteria for optimizing the power transmission are presented and evaluated for a 50 Hz high-speed line. (orig.) [Deutsch] Durch den Einsatz von Vierquadrantenstellern ist es heute moeglich, den Leistungsfaktor von Wechselstromtriebfahrzeugen und damit auch den Blindleistungshaushalt der Fahrleitung zu beeinflussen. Hierfuer werden Optimierungskriterien beschrieben und am Beispiel einer 50-Hz-Hochgeschwindigkeitsstrecke bewertet. (orig.)

  19. Multi-criteria optimization of on-site heating, cooling and power generation with solid oxide fuel cell-gas turbine combined cycle units

    Energy Technology Data Exchange (ETDEWEB)

    K. Tanaka; M. Burer; D. Favrat; K. Yamada [UMIST, Manchester (United Kingdom). Tyndall Centre for Climate Change Research

    2003-07-01

    The implementation of integrated energy systems within urban areas is a promising CO{sub 2} emissions abatement measure. In this paper on-site heating, cooling and power generation based on a solid oxide fuel cell and gas turbine (SOFC-GT) combined cycle unit associated with a compression chiller and additional boilers has been considered from the viewpoints of cost and CO{sub 2} emissions. Physical and costing modelling of such a unit has been integrated within a new multi-criteria evolutionary algorithm for an assessment of the economic and environmental performances associated with optimal design and operation, for typical requirements of large office buildings in Tokyo. 9 refs., 8 figs., 2 tabs.

  20. Decision Support Tools for Electricity Retailers, Wind Power and CHP Plants Using Probabilistic Forecasts

    Directory of Open Access Journals (Sweden)

    Marco Zugno

    2015-06-01

    Full Text Available This paper reviews a number of applications of optimization under uncertainty in energy markets resulting from the research project ENSYMORA. A general mathematical formulation applicable to problems of optimization under uncertainty in energy markets is presented. This formulation can be effortlessly adapted to describe different approaches: the deterministic one (usable within a rolling horizon scheme, stochastic programming and robust optimization. The different features of this mathematical formulation are duly interpreted with a view to the energy applications reviewed in this paper: trading for a price-maker wind power producer, management of heat and power systems, operation for retailers in a dynamic-price market. A selection of results shows the viability and appropriateness of the presented stochastic optimization approaches for managing energy systems under uncertainty.

  1. Influence of biomass cofiring on the optimal coefficient of the cogeneration share in a district heating system

    Science.gov (United States)

    Ziębik, Andrzej; Gładysz, Paweł

    2014-03-01

    The paper presents a modified algorithm for choosing the optimal coefficient of the share of cogeneration in district heating systems taking into account additional benefits concerning the promotion of highefficiency cogeneration and biomass cofiring. The optimal coefficient of the share of cogeneration depends first of all on the share of the heat required for preparing the hot tap water. The final result of investigations is an empirical equation describing the influence of the ratio of the heat flux for the production of hot tap water to the maximum flux for space heating and ventilation, as well as the share of chemical energy of biomass in the fuel mixture on the optimal value of the share of cogeneration in district heating systems. The approach presented in the paper may be applied both in back-pressure combined heat and power (CHP) plants and in extraction-condensing CHP plants.

  2. Optimizing Surveillance for South American Origin Influenza A Viruses Along the United States Gulf Coast Through Genomic Characterization of Isolates from Blue-winged Teal (Anas discors).

    Science.gov (United States)

    Ramey, A M; Walther, P; Link, P; Poulson, R L; Wilcox, B R; Newsome, G; Spackman, E; Brown, J D; Stallknecht, D E

    2016-04-01

    Relative to research focused on inter-continental viral exchange between Eurasia and North America, less attention has been directed towards understanding the redistribution of influenza A viruses (IAVs) by wild birds between North America and South America. In this study, we genomically characterized 45 viruses isolated from blue-winged teal (Anas discors) along the Texas and Louisiana Gulf Coast during March of 2012 and 2013, coincident with northward migration of this species from Neotropical wintering areas to breeding grounds in the United States and Canada. No evidence of South American lineage genes was detected in IAVs isolated from blue-winged teal supporting restricted viral gene flow between the United States and southern South America. However, it is plausible that blue-winged teal redistribute IAVs between North American breeding grounds and wintering areas throughout the Neotropics, including northern South America, and that viral gene flow is limited by geographical barriers further south (e.g., the Amazon Basin). Surveillance for the introduction of IAVs from Central America and northern South America into the United States may be further optimized through genomic characterization of viruses resulting from coordinated, concurrent sampling efforts targeting blue-winged teal and sympatric species throughout the Neotropics and along the United States Gulf Coast. © Published 2014. This article is a US Government work and is in the public domain in the USA.

  3. The optimal delivery of palliative care: a national comparison of the outcomes of consultation teams vs inpatient units.

    Science.gov (United States)

    Casarett, David; Johnson, Megan; Smith, Dawn; Richardson, Diane

    2011-04-11

    Growing attention to end-of-life care has led to intensive efforts to provide better palliative care. However, it is not known whether palliative care is best provided by consultative teams or in dedicated units. This nationwide telephone survey was conducted in 77 Veterans Affairs medical centers that offer palliative care consultation services and dedicated palliative care units. One family member per patient who died at a participating Veterans Affairs medical center between July 1, 2008, and December 31, 2009, was invited to participate. The telephone survey included 1 global rating item and 9 core items describing the patient's care in the last month of life. Interviews were completed with family members for 5901 of 9546 patients. Of these, 1873 received usual care, 1549 received a palliative care consultation, and 2479 received care in a palliative care unit. After nonresponse weighting and propensity score adjustment, families of patients who received a palliative care consultation were more likely than those who received usual care to report that the patient's care in the last month of life had been "excellent" (adjusted proportions: 51% vs 46%; odds ratio [OR], 1.25; 95% confidence interval [CI], 1.02-1.55; P = .04). However, families of patients who received care in a palliative care unit were even more likely to report excellent care (adjusted proportions: 63% vs 53%; OR, 1.52; 95% CI, 1.25-1.85; P < .001). Care received in palliative care units may offer more improvements in care than those achieved with palliative care consultations.

  4. Parameter optimization, sensitivity, and uncertainty analysis of an ecosystem model at a forest flux tower site in the United States

    Science.gov (United States)

    Wu, Yiping; Liu, Shuguang; Huang, Zhihong; Yan, Wende

    2014-01-01

    Ecosystem models are useful tools for understanding ecological processes and for sustainable management of resources. In biogeochemical field, numerical models have been widely used for investigating carbon dynamics under global changes from site to regional and global scales. However, it is still challenging to optimize parameters and estimate parameterization uncertainty for complex process-based models such as the Erosion Deposition Carbon Model (EDCM), a modified version of CENTURY, that consider carbon, water, and nutrient cycles of ecosystems. This study was designed to conduct the parameter identifiability, optimization, sensitivity, and uncertainty analysis of EDCM using our developed EDCM-Auto, which incorporated a comprehensive R package—Flexible Modeling Framework (FME) and the Shuffled Complex Evolution (SCE) algorithm. Using a forest flux tower site as a case study, we implemented a comprehensive modeling analysis involving nine parameters and four target variables (carbon and water fluxes) with their corresponding measurements based on the eddy covariance technique. The local sensitivity analysis shows that the plant production-related parameters (e.g., PPDF1 and PRDX) are most sensitive to the model cost function. Both SCE and FME are comparable and performed well in deriving the optimal parameter set with satisfactory simulations of target variables. Global sensitivity and uncertainty analysis indicate that the parameter uncertainty and the resulting output uncertainty can be quantified, and that the magnitude of parameter-uncertainty effects depends on variables and seasons. This study also demonstrates that using the cutting-edge R functions such as FME can be feasible and attractive for conducting comprehensive parameter analysis for ecosystem modeling.

  5. Parameter optimization, sensitivity, and uncertainty analysis of an ecosystem model at a forest flux tower site in the United States

    Science.gov (United States)

    Wu, Yiping; Liu, Shuguang; Huang, Zhihong; Yan, Wende

    2014-06-01

    Ecosystem models are useful tools for understanding ecological processes and for sustainable management of resources. In biogeochemical field, numerical models have been widely used for investigating carbon dynamics under global changes from site to regional and global scales. However, it is still challenging to optimize parameters and estimate parameterization uncertainty for complex process-based models such as the Erosion Deposition Carbon Model (EDCM), a modified version of CENTURY, that consider carbon, water, and nutrient cycles of ecosystems. This study was designed to conduct the parameter identifiability, optimization, sensitivity, and uncertainty analysis of EDCM using our developed EDCM-Auto, which incorporated a comprehensive R package—Flexible Modeling Framework (FME) and the Shuffled Complex Evolution (SCE) algorithm. Using a forest flux tower site as a case study, we implemented a comprehensive modeling analysis involving nine parameters and four target variables (carbon and water fluxes) with their corresponding measurements based on the eddy covariance technique. The local sensitivity analysis shows that the plant production-related parameters (e.g., PPDF1 and PRDX) are most sensitive to the model cost function. Both SCE and FME are comparable and performed well in deriving the optimal parameter set with satisfactory simulations of target variables. Global sensitivity and uncertainty analysis indicate that the parameter uncertainty and the resulting output uncertainty can be quantified, and that the magnitude of parameter-uncertainty effects depends on variables and seasons. This study also demonstrates that using the cutting-edge R functions such as FME can be feasible and attractive for conducting comprehensive parameter analysis for ecosystem modeling.

  6. Optimization and economic evaluation of industrial gas production and combined heat and power generation from gasification of corn stover and distillers grains.

    Science.gov (United States)

    Kumar, Ajay; Demirel, Yasar; Jones, David D; Hanna, Milford A

    2010-05-01

    Thermochemical gasification is one of the most promising technologies for converting biomass into power, fuels and chemicals. The objectives of this study were to maximize the net energy efficiency for biomass gasification, and to estimate the cost of producing industrial gas and combined heat and power (CHP) at a feedrate of 2000kg/h. Aspen Plus-based model for gasification was combined with a CHP generation model, and optimized using corn stover and dried distillers grains with solubles (DDGS) as the biomass feedstocks. The cold gas efficiencies for gas production were 57% and 52%, respectively, for corn stover and DDGS. The selling price of gas was estimated to be $11.49 and $13.08/GJ, respectively, for corn stover and DDGS. For CHP generation, the electrical and net efficiencies were as high as 37% and 88%, respectively, for corn stover and 34% and 78%, respectively, for DDGS. The selling price of electricity was estimated to be $0.1351 and $0.1287/kWh for corn stover and DDGS, respectively. Overall, high net energy efficiencies for gas and CHP production from biomass gasification can be achieved with optimized processing conditions. However, the economical feasibility of these conversion processes will depend on the relative local prices of fossil fuels. Copyright 2009 Elsevier Ltd. All rights reserved.

  7. Increasing the flexibility of operational scheduling for a large-scale CHP plant used for generating district heat and electricity in order to meet the varying market demands; Steigerung der Einsatzflexibilitaet einer grossen KWK-Anlage zur Fernwaerme- und Stromerzeugung gemaess aktueller Marktanforderungen

    Energy Technology Data Exchange (ETDEWEB)

    Meierer, Matthias; Krupp, Roland; Stork, Rolf [Grosskraftwerk Mannheim AG, Mannheim (Germany)

    2015-07-01

    The substantial changes in the structure of German power supply plants pose high demands on the flexibility of the operational scheduling of conventional thermal power plants. Grosskraftwerk Mannheim AG is a power plant company that is operating a plant for combined power and district heat generation. The paper describes some measures which have been taken to improve the plant's operational flexibility. In addition, the associated technical systems and their functions, as well as the state of ongoing projects are outlined. Special focus is placed on topics related to issues such as ''district-heat storage unit of the new unit 9, flexibility of operational scheduling, and efficient CHP plant operation''.

  8. Researching of the possibility of using absorption heat exchangers for creating the low return temperature heat supply systems based on CHP generation

    Science.gov (United States)

    Yavorovsky, Y. V.; Malenkov, A. S.; Zhigulina, Y. V.; Romanov, D. O.; Kurzanov, S. Y.

    2017-11-01

    This paper deals with the variant of modernization of the heat point within urban heat supply network in order to create the system of heat and cold supply on its basis, providing the suppliers with heat in cold months and with heat and cold in warm months. However, in cold months in the course of heating system operation, the reverse delivery water temperature is maintained below 40 °C. The analysis of heat and power indicators of the heat and cold supply system under different operating conditions throughout the year was conducted. The possibility to use the existing heat networks for the cold supply needs was estimated. The advantages of the system over the traditional heat supply systems that use Combined Heat and Power (CHP) plant as a heat source as exemplified by heat supply system from CHP with ST-80 turbine were demonstrated.

  9. Micro-CHP ready to go. Energy saving and a simple alternative; Micro-wkk is klaar voor de start. Energiebesparend en eenvoudig toe te passen alternatief

    Energy Technology Data Exchange (ETDEWEB)

    De Jong, A. [Cogen Nederland, Driebergen (Netherlands)

    2011-05-15

    Heating installations in existing buildings offer great opportunities for increasing sustainability. Given the large replacement market of 400,000 boilers every year there is ample opportunity for making quick progress in implementing efficient and sustainable technologies. Micro-CHP, also called the High efficiency CHP boiler, is one of the energy saving and easy-to-deploy alternatives for the high efficiency boiler in existing buildings. [Dutch] Verwarmingsinstallaties in de bestaande bouw bieden grote kansen voor verduurzaming. Gegeven de grote vervangingsmarkt van vierhonderdduizend cv-ketels per jaar kan er snel voortgang worden gemaakt met de implementatie van efficiente en duurzame technieken. Micro-wkk - ook wel hre-ketel genoemd - is een van de energiebesparende en eenvoudig toe te passen alternatieven voor de hr-ketel in de bestaande bouw.

  10. Small-scale CHP Plant based on a 35 kWel Hermetic Four Cylinder Stirling Engine for Biomass Fuels- Development, Technology and Operating Experiences

    DEFF Research Database (Denmark)

    Obernberger, I.; Carlsen, Henrik; Biedermann, F.

    2003-01-01

    ) process and the Stirling engine process. The ORC process represents an economically interesting technology for small-scale biomass-fired combined heat and power plants in a power range between 400 and 1,500 kWel. A newly developed ORC technology with a nominal electric capacity of 1,000 kW was implemented...... in the biomass CHP plant Lienz (A) in the framework of an EU demonstration project. This plant was put in operation in February 2002. Stirling engines are a promising solution for installations with nominal electric capacities between 10 and 150 kW. A biomass CHP pilot plant based on a 35 kWel-Stirling engine...

  11. Self-adaptive Differential Evolution Based Optimal Power Flow for Units with Non-smooth Fuel Cost Functions

    Directory of Open Access Journals (Sweden)

    C. Thitithamrongchai

    2007-06-01

    Full Text Available This paper presents a self-adaptive differential evolution with augmented Lagrange multiplier method (SADE_ALM for solving optimal power flow (OPF problems with non-smooth generator fuel cost curves. The SADE_ALM is a modified version of conventional differential evolution (DE by integrating mutation factor (F and crossover constant (CR as additional control variables.An augmented Lagrange multiplier method (ALM is applied to handle inequality constraints instead of traditional penalty function method, whereas the sum of the violated constraint (SVC index is employed to ensure that the final result is the feasible global or quasi-global optimum.The proposed algorithm has been tested with the IEEE 30-bus system with different fuel cost characteristics, i.e. 1 quadratic cost curve model, and 2 quadratic cost curve with rectified sine component model (valve-point effects. Numerical results show that the SADE_ALM provides very impressive results compared with the previous reports.

  12. Decision Support Tools for Electricity Retailers, Wind Power and CHP Plants Using Probabilistic Forecasts

    DEFF Research Database (Denmark)

    Zugno, Marco; Morales González, Juan Miguel; Madsen, Henrik

    2015-01-01

    : trading for a price-maker wind power producer, management of heat and power systems, operation for retailers in a dynamic-price market. A selection of results shows the viability and appropriateness of the presented stochastic optimization approaches for managing energy systems under uncertainty....

  13. Optimization of Cycle and Expander Design of an Organic Rankine Cycle Unit using Multi-Component Working Fluids

    DEFF Research Database (Denmark)

    Meroni, Andrea; Andreasen, Jesper Graa; Pierobon, Leonardo

    2016-01-01

    for an organic Rankine cycle unit utilizing waste heat from low temperature heat sources. The study addresses a case where the minimum temperature of the heat source is constrained and a case where no constraint is imposed. The former case is the wasteheat recovery from jacket cooling water of a marine diesel...... engine onboard a large ship, and the latter is representative of a low-temperature geothermal, solar or waste heat recovery application. Multi-component working fluids are investigated, as they allow improving the match between the temperature pro-files in the heat exchangers and, consequently, reducing...... the irreversibility in the ORC system. This work considers mixtures of R245fa/pentane and propane/isobutane. The use of multi-component working fluids typically results in increased heat transfer areas and different expander designs compared to purefluids. In order to properly account for turbine performance...

  14. Development of a portable, modular unit for the optimization of ultrasound-assisted oxidative desulfurization of diesel

    Science.gov (United States)

    Wan, Meng-Wei

    Due to the stringent rules requiring ultra-low sulfur content in diesel fuels, it is necessary to develop alternative methods of desulfurization of fossil fuel derived oil, such as diesel. Current technology is not sufficient to solve this problem. Ultrasound applied to oxidative desulfurization which combined three complementary techniques: ultrasonication, phase transfer catalysis (PTC) and transition metal catalyzed oxidation, has accomplished high sulfur removal in a short contact time at ambient temperature and atmospheric pressure. This research has successfully demonstrated that the higher oxidation efficiency of BT to BTO and free of any by-products by using tetraoctylammonium fluoride as phase transfer agent. The oxidation rate of BT to BTO increased with increasing the carbon chain length of QAS cations. Under the same length of carbon chain, the oxidation rate of BT to BTO increased with decreasing the molecular size of QAS anions. Moreover, for diesel fuels containing various levels of sulfur content, UAOD process followed by solvent extraction has demonstrated that the sulfur reduction can reach above 95 % removal efficiency or final sulfur content below 15 ppm in mild condition. For large-scale commercial production, this research has successfully developed and operated a continuous desulfurization unit, which consists of a sonoractor, an RF amplifier, a function generator, a pretreatment tank, and a pipeline system. A single unit only needed 2' x 4' x 1' space for installation. The results indicated that the remarkable 92% removal efficiency for the sulfur in marine logistic diesel, even at a treatment rate as high as 25 lb/hour which is approximately 2 barrels per day. Therefore, this sonoreactor demonstrated the feasibility of large-scale operation even in a relatively small installation with low capital investment and maintenance cost. It also ensures the safety considerations by operating with diluted hydrogen peroxide under ambient temperature

  15. Uniting geology and craftsmanship to find the optimal soapstone for restoration of the Nidaros soapstone Cathedral in Norway

    Science.gov (United States)

    Aslaksen Aasly, Kari; Meyer, Gurli Birgitte; Kløve Keiding, Jakob; Langås, Rune; Lund, Vegard

    2017-04-01

    The Nidaros Cathedral situated in Trondheim, Norway is a restored cathedral resting on the remnants of an original medieval church sanctified St Olav. The cathedral became one of the most important sanctuary for pilgrimage during the Middle Ages and still is today. In a European context the cathedral, along with a certain group of other churches and monasteries in Norway, is unique by being build from soapstone (steatite). This talc and chlorite dominated metamorphic rock is relatively soft, heat resistant and dense making the material ideal for cooking pots, stoves and all kinds of utensils. Soapstone has therefore been appreciated, used and quarried since the Stone Age in Norway. At the onset of Christianity the choice of soapstone from harder rock types was not difficult for the building owners combining the vision of stone churches in Norway with the skills of wood carving traditions of local handicraftsmen. The best example is the Nidaros Cathedral built in the 11th to 14th century. In 1869, the Nidaros Cathedral Restoration Workshop (NDR) was founded with the purpose of restoring the cathedral using original craftsman's techniques and authentic materials. The restoration was originally completed in 1969, but is still ongoing due to weathering of certain used soapstone types. A major challenge remains to find soapstone resources of the right quality. Core issues relate to avoid rocks with cracks and cleavage, a demand for homogeneity, maintaining esthetic authenticity, resistance to weathering (disintegration) and last but not least the ultimatum of workability. Thus locating new soapstone resources depends strongly on geological understanding, quarry experience and stone carver's knowledge. The present work is based on close cooperation between stone carvers and geologists in a common goal of uniting knowledge and experience in defining qualities of soapstone for various purposes of restoration. Cooperate observations of geology and carving properties in the

  16. Unit operation optimization for the manufacturing of botanical injections using a design space approach: a case study of water precipitation.

    Science.gov (United States)

    Gong, Xingchu; Chen, Huali; Chen, Teng; Qu, Haibin

    2014-01-01

    Quality by design (QbD) concept is a paradigm for the improvement of botanical injection quality control. In this work, water precipitation process for the manufacturing of Xueshuantong injection, a botanical injection made from Notoginseng Radix et Rhizoma, was optimized using a design space approach as a sample. Saponin recovery and total saponin purity (TSP) in supernatant were identified as the critical quality attributes (CQAs) of water precipitation using a risk assessment for all the processes of Xueshuantong injection. An Ishikawa diagram and experiments of fractional factorial design were applied to determine critical process parameters (CPPs). Dry matter content of concentrated extract (DMCC), amount of water added (AWA), and stirring speed (SS) were identified as CPPs. Box-Behnken designed experiments were carried out to develop models between CPPs and process CQAs. Determination coefficients were higher than 0.86 for all the models. High TSP in supernatant can be obtained when DMCC is low and SS is high. Saponin recoveries decreased as DMCC increased. Incomplete collection of supernatant was the main reason for the loss of saponins. Design space was calculated using a Monte-Carlo simulation method with acceptable probability of 0.90. Recommended normal operation region are located in DMCC of 0.38-0.41 g/g, AWA of 3.7-4.9 g/g, and SS of 280-350 rpm, with a probability more than 0.919 to attain CQA criteria. Verification experiment results showed that operating DMCC, SS, and AWA within design space can attain CQA criteria with high probability.

  17. Unit operation optimization for the manufacturing of botanical injections using a design space approach: a case study of water precipitation.

    Directory of Open Access Journals (Sweden)

    Xingchu Gong

    Full Text Available Quality by design (QbD concept is a paradigm for the improvement of botanical injection quality control. In this work, water precipitation process for the manufacturing of Xueshuantong injection, a botanical injection made from Notoginseng Radix et Rhizoma, was optimized using a design space approach as a sample. Saponin recovery and total saponin purity (TSP in supernatant were identified as the critical quality attributes (CQAs of water precipitation using a risk assessment for all the processes of Xueshuantong injection. An Ishikawa diagram and experiments of fractional factorial design were applied to determine critical process parameters (CPPs. Dry matter content of concentrated extract (DMCC, amount of water added (AWA, and stirring speed (SS were identified as CPPs. Box-Behnken designed experiments were carried out to develop models between CPPs and process CQAs. Determination coefficients were higher than 0.86 for all the models. High TSP in supernatant can be obtained when DMCC is low and SS is high. Saponin recoveries decreased as DMCC increased. Incomplete collection of supernatant was the main reason for the loss of saponins. Design space was calculated using a Monte-Carlo simulation method with acceptable probability of 0.90. Recommended normal operation region are located in DMCC of 0.38-0.41 g/g, AWA of 3.7-4.9 g/g, and SS of 280-350 rpm, with a probability more than 0.919 to attain CQA criteria. Verification experiment results showed that operating DMCC, SS, and AWA within design space can attain CQA criteria with high probability.

  18. Unit Risk Quotient (RQ) and Relative Significance of Radionuclide on Flora and Fauna to the EU-APR Optimization

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Keunsung [KHNP-CRI, Daejeon (Korea, Republic of); Kim, Sukhoon [FNC Technology Co., Ltd., Yongin (Korea, Republic of); Lee, Chonghui [KEPCO E and C, Yongin (Korea, Republic of)

    2015-05-15

    As part of the project for acquiring the certification from EUR organization, in accordance with Articles 4.8 and 5.5 specified in Section 2.20 of EUR Volume 2, the effects of ionizing radiation from the standard design of EU-APR on biota and ecosystems during operation and decommissioning phases shall be assessed. This assessment must be carried out according to the ERICA (i.e. Environmental Risk from Ionizing Contaminants: Assessment and management) integrated approach. This paper describes the evaluation results for unit risk quotient and relative significance by radionuclide derived from performing Tier 1 assessment on flora and fauna for the EU-APR design using ERICA Tool. As specified previously, Pa-231 and Th-228 are the most significant for the terrestrial and for the marine/freshwater ecosystems, respectively. And, in terms of environmental risk, those radionuclides having the most impact on flora and fauna are relatively more significant than isotope having the least impact by about 7 to 10 orders of magnitude.

  19. Modelling the primary drying step for the determination of the optimal dynamic heating pad temperature in a continuous pharmaceutical freeze-drying process for unit doses.

    Science.gov (United States)

    De Meyer, Laurens; Lammens, Joris; Mortier, Séverine Thérèse F C; Vanbillemont, Brecht; Van Bockstal, Pieter Jan; Corver, Jos; Nopens, Ingmar; Vervaet, Chris; De Beer, Thomas

    2017-10-30

    In the pharmaceutical industry, traditional freeze-drying of unit doses is a batch-wise process associated with many disadvantages. To overcome these disadvantages and to guarantee a uniform product quality and high process efficiency, a continuous freeze-drying process is developed and evaluated. The main differences between the proposed continuous freeze-drying process and traditional freeze-drying can be found firstly in the freezing step during which the vials are rotated around their longitudinal axis (spin freezing), and secondly in the drying step during which the energy for sublimation and desorption is provided through the vial wall by conduction via an electrical heating pad. To obtain a more efficient drying process, the energy transfer has to be optimised without exceeding the product and process limits (e.g. cake collapse, choked flow). Therefore, a mechanistic model describing primary drying during continuous lyophilisation of unit doses based on conduction via heating pads was developed allowing the prediction of the optimal dynamic power input and temperature output of the electric heating pads. The model was verified by experimentally testing the optimal dynamic primary drying conditions calculated for a model formulation. The primary drying endpoint of the model formulation was determined via in-line NIR spectroscopy. This endpoint was then compared with the predicted model based endpoint. The mean ratio between the experimental and model based predicted drying time for six verification runs was 1.05±0.07, indicating a good accordance between the model and the experimental data. Copyright © 2017 Elsevier B.V. All rights reserved.

  20. The concept of system for chips production need to work demo CHP plant in company 'AGROSAVA' from Šimanovci

    Directory of Open Access Journals (Sweden)

    Dedić Aleksandar Đ.

    2014-01-01

    Full Text Available In this paper according to the calculation of chips productivity needs for gasification in the demo CHP plant for co-generation: electricity and heat, chippers were analyzed due to: the type of mobility, running for chipping and the method of delivering chips to temporary yard. The plant was planned to generate electricity power up to 200kWelec. First, in consideration were taken the chippers with medium capacity, which mainly served for chipping brushwood and leaves that remain after harvest plantations on mostly flat terrain and parks. Later, the comparative characteristics of the world's three largest manufacturers of machinery for the production of wood chips significantly larger amounts (up to 30m3/h were given. These chippers were particularly suitable for the higher density of crops and stationed yard, in which brushwood would be brought and chip. At the end, the types of convective dryers were analyzed that could be successfully used for drying wood chips (drum and pneumatic dryer and based on the calculation proposed the types of dryers that were available in the local market.

  1. Increased Industrial District Heating use in a CHP System-Economic Consequences and Impacts on Global CO2 Emissions

    Energy Technology Data Exchange (ETDEWEB)

    Difs, Kristina; Trygg, Louise [Linkoping University - Division of Energy Systems (Sweden)

    2009-07-01

    The use of district heating (DH) in industrial processes is relatively limited compared to other fuels and electricity. Hence, the industrial sector has great potential to convert from electricity and fossil fuels to DH. In addition, DH is mainly used for space heating and hot tap water, which makes the DH demand strongly seasonally dependent. By converting industrial processes like cooling, drying and industrial heating to DH, the heat load curve will be more evenly distributed throughout the year, thus utilizing the DH production resources better. This paper analyses how conversions from electricity or other fuels to district heating (DH) in industrial processes will affect an energy system. The effect of a more evenly distributed heat load profile is analysed with different policy instruments, fuel prices and electricity prices. In this study, three CHP plants acting as base load plants, which utilize different fuels (biofuel, waste and natural gas), are analysed. The result shows that when the use of district heating in industrial processes is increased it will lead to reduced system cost in both the biofueled and waste-incinerated combined heat and power system. Furthermore, when considering European electricity production in coal condensing and natural gas power plants, conversion to DH will also lead to possible reduced global CO2 emissions. Keywords: Combined heat and power, district heating, industrial heat load, heat load duration, energy efficiency audits.

  2. Testing and model-aided analysis of a 2 kW el PEMFC CHP-system

    Science.gov (United States)

    König, P.; Weber, A.; Lewald, N.; Aicher, T.; Jörissen, L.; Ivers-Tiffée, E.; Szolak, R.; Brendel, M.; Kaczerowski, J.

    A prototype PEMFC CHP-system (combined heat and power) for decentralised energy supply in domestic applications has been installed in the Fuel Cell Testing Laboratory at the Institut für Werkstoffe der Elektrotechnik (IWE), Universität Karlsruhe (TH). The system, which was developed at the Zentrum für Sonnenenergie- und Wasserstoff-Forschung ZSW, Ulm (FC-stack) and the Fraunhofer-Institut für Solare Energiesysteme ISE, Freiburg (reformer) is operated and tested in close cooperation with the Stadtwerke Karlsruhe. The tests are carried out as part of the strategic project EDISon, which is supported by the German Federal Ministry of Economics and Technology (BMWA). The performance of the system is evaluated for different operating conditions. The tests include steady state measurements under different electrical and thermal loads as well as an analysis of the dynamic behaviour of the system during load changes. First results of these steady state and dynamic operation characteristics will be presented in this paper.

  3. Optimal unit sizing of a hybrid renewable energy system for isolated applications; Optimalite des elements d'un systeme decentralise de production d'energie electrique

    Energy Technology Data Exchange (ETDEWEB)

    Morales, D

    2006-07-15

    In general, the methods used to conceive a renewable energy production system overestimate the size of the generating units. These methods increase the investment cost and the production cost of energy. The work presented in this thesis proposes a methodology to optimally size a renewable energy system.- This study shows that the classic approach based only on a long term analysis of system's behaviour is not sufficient and a complementary methodology based on a short term analysis is proposed. A numerical simulation was developed in which the mathematical models of the solar panel, the wind turbines and battery are integrated. The daily average solar energy per m2 is decomposed into a series of hourly I energy values using the Collares-Pereira equations. The time series analysis of the wind speed is made using the Monte Carlo Simulation Method. The second part of this thesis makes a detailed analysis of an isolated wind energy production system. The average energy produced by the system depends on the generator's rated power, the total swept area of the wind turbine, the gearbox's transformation ratio, the battery voltage and the wind speed probability function. The study proposes a methodology to determine the optimal matching between the rated power of the permanent magnet synchronous machine and the wind turbine's rotor size. This is made taking into account the average electrical energy produced over a period of time. (author)

  4. Optimization of the level and range of working temperature of the PCM in the gypsum-microencapsulated PCM thermal energy storage unit for summer conditions in Central Poland

    Science.gov (United States)

    Łapka, P.; Jaworski, M.

    2017-10-01

    In this paper thermal energy storage (TES) unit in a form of a ceiling panel made of gypsum-microencapsulated PCM composite with internal U-shaped channels was considered and optimal characteristics of the microencapsulated PCM were determined. This panel may be easily incorporated into, e.g., an office or residential ventilation system in order to reduce daily variations of air temperature during the summer without additional costs related to the consumption of energy for preparing air parameters to the desired level. For the purpose of the analysis of heat transfer in the panel, a novel numerical simulator was developed. The numerical model consists of two coupled parts, i.e., the 1D which deals with the air flowing through the U-shaped channel and the 3D which deals with heat transfer in the body of the panel. The computational tool was validated based on the experimental study performed on the special set-up. Using this tool an optimization of parameters of the gypsum-microencapsulated PCM composite was performed in order to determine its most appropriate properties for the application under study. The analyses were performed for averaged local summer conditions in Warsaw, Poland.

  5. The Surgical Optimal Mobility Score predicts mortality and length of stay in an Italian population of medical, surgical, and neurologic intensive care unit patients.

    Science.gov (United States)

    Piva, Simone; Dora, Giancarlo; Minelli, Cosetta; Michelini, Mariachiara; Turla, Fabio; Mazza, Stefania; D'Ottavi, Patrizia; Moreno-Duarte, Ingrid; Sottini, Caterina; Eikermann, Matthias; Latronico, Nicola

    2015-12-01

    We validated the Italian version of Surgical Optimal Mobility Score (SOMS) and evaluated its ability to predict intensive care unit (ICU) and hospital length of stay (LOS), and hospital mortality in a mixed population of ICU patients. We applied the Italian version of SOMS in a consecutive series of prospectively enrolled, adult ICU patients. Surgical Optimal Mobility Score level was assessed twice a day by ICU nurses and twice a week by an expert mobility team. Zero-truncated Poisson regression was used to identify predictors for ICU and hospital LOS, and logistic regression for hospital mortality. All models were adjusted for potential confounders. Of 98 patients recruited, 19 (19.4%) died in hospital, of whom 17 without and 2 with improved mobility level achieved during the ICU stay. SOMS improvement was independently associated with lower hospital mortality (odds ratio, 0.07; 95% confidence interval [CI], 0.01-0.42) but increased hospital LOS (odds ratio, 1.21; 95% CI: 1.10-1.33). A higher first-morning SOMS on ICU admission, indicating better mobility, was associated with lower ICU and hospital LOS (rate ratios, 0.89 [95% CI, 0.80-0.99] and 0.84 [95% CI, 0.79-0.89], respectively). The first-morning SOMS on ICU admission predicted ICU and hospital LOS in a mixed population of ICU patients. SOMS improvement was associated with reduced hospital mortality but increased hospital LOS, suggesting the need of optimizing hospital trajectories after ICU discharge. Copyright © 2015 Elsevier Inc. All rights reserved.

  6. SECARB Commercial Scale CO2 Injection and Optimization of Storage Capacity in the Southeastern United States

    Energy Technology Data Exchange (ETDEWEB)

    Koperna, George J. [Advanced Resources International, Inc., Arlington, VA (United States); Pashin, Jack [Oklahoma State Univ., Stillwater, OK (United States); Walsh, Peter [Univ. of Alabama, Birmingham, AL (United States)

    2017-10-30

    for the region and provide modern day analogues. Stability of the caprock over several test parameters was conducted by UAB to yield comprehensive measurements on long term stability of caprocks. The detailed geologic model of the full earth volume from surface thru the Donovan oil reservoir is incorporated into a state-of-the-art reservoir simulation conducted by the University of Alabama at Birmingham (UAB) to explore optimization of CO2 injection and storage under different characterizations of reservoir flow properties. The application of a scaled up geologic modeling and reservoir simulation provides a proof of concept for the large scale volumetric modeling of CO2 injection and storage the subsurface.

  7. Dose-dependent effects of NY-ESO-1 protein vaccine complexed with cholesteryl pullulan (CHP-NY-ESO-1) on immune responses and survival benefits of esophageal cancer patients.

    Science.gov (United States)

    Kageyama, Shinichi; Wada, Hisashi; Muro, Kei; Niwa, Yasumasa; Ueda, Shugo; Miyata, Hiroshi; Takiguchi, Shuji; Sugino, Sahoko H; Miyahara, Yoshihiro; Ikeda, Hiroaki; Imai, Naoko; Sato, Eiichi; Yamada, Tomomi; Osako, Masaharu; Ohnishi, Mami; Harada, Naozumi; Hishida, Tadashi; Doki, Yuichiro; Shiku, Hiroshi

    2013-10-05

    Cholesteryl pullulan (CHP) is a novel antigen delivery system for cancer vaccines. This study evaluated the safety, immune responses and clinical outcomes of patients who received the CHP-NY-ESO-1 complex vaccine, Drug code: IMF-001. Patients with advanced/metastatic esophageal cancer were enrolled and subcutaneously vaccinated with either 100 μg or 200 μg of NY-ESO-1 protein complexed with CHP. The primary endpoints were safety and humoral immune responses, and the secondary endpoint was clinical efficacy. A total of 25 patients were enrolled. Thirteen and twelve patients were repeatedly vaccinated with 100 μg or 200 μg of CHP-NY-ESO-1 with a median of 8 or 9.5 doses, respectively. No serious adverse events related to the vaccine were observed. Three out of 13 patients in the 100-μg cohort and 7 out of 12 patients in the 200-μg cohort were positive for anti-NY-ESO-1 antibodies at baseline. In the 100-μg cohort, an antibody response was observed in 5 out of 10 pre-antibody-negatives patients, and the antibody levels were augmented in 2 pre-antibody-positive patients after vaccination. In the 200-μg cohort, all 5 pre-antibody-negative patients became seropositive, and the antibody level was amplified in all 7 pre-antibody-positive patients. No tumor shrinkage was observed. The patients who received 200 μg of CHP-NY-ESO-1 survived longer than patients receiving 100 μg of CHP-NY-ESO-1, even those who exhibited unresponsiveness to previous therapies or had higher tumor burdens. The safety and immunogenicity of CHP-NY-ESO-1 vaccine were confirmed. The 200 μg dose more efficiently induced immune responses and suggested better survival benefits. (Clinical trial registration number NCT01003808).

  8. Economic optimization of waste treatment and energy production in Denmark

    DEFF Research Database (Denmark)

    Münster, Marie; Ravn, Hans; Hedegaard, Karsten

    2013-01-01

    This article presents an optimization model that incorporates LCA methodology and captures important characteristics of waste management systems. The most attractive waste management options are in the model identified as part the optimization. The model renders it possible to apply different...... optimization objectives such as minimizing costs or greenhouse gas emissions or to prioritise several objectives given different weights. An illustrative case is analyzed, covering alternative treatments of 1 tonne residual household waste: incineration of the full amount or sorting out organic waste...... for biogas production for either CHP generation or as fuel in vehicles. The case study illustrates, that what is the optimal solution depends on the objective and assumptions regarding the background system – here illustrated with different assumptions regarding displaced electricity production. The article...

  9. Dynamic Nucleotide-dependent Interactions of Cysteine- and Histidine-rich Domain (CHORD)-containing Hsp90 Cochaperones Chp-1 and Melusin with Cochaperones PP5 and Sgt1*

    Science.gov (United States)

    Hong, Tae-Joon; Kim, Sangkyu; Wi, Ah Ram; Lee, Peter; Kang, Miae; Jeong, Jae-Hoon; Hahn, Ji-Sook

    2013-01-01

    Mammals have two cysteine- and histidine-rich domain (CHORD)-containing Hsp90 cochaperones, Chp-1 and melusin, which are homologs of plant Rar1. It has been shown previously that Rar1 CHORD directly interacts with ADP bound to the nucleotide pocket of Hsp90. Here, we report that ADP and ATP can bind to Hsp90 cochaperones Chp-1 and PP5, inducing their conformational changes. Furthermore, we demonstrate that Chp-1 and melusin can interact with cochaperones PP5 and Sgt1 and with each other in an ATP-dependent manner. Based on the known structure of the Rar1-Hsp90 complex, His-186 has been identified as an important residue of Chp-1 for ADP/ATP binding. His-186 is necessary for the nucleotide-dependent interaction of Chp-1 not only with Hsp90 but also with Sgt1. In addition, Ca2+, which is known to bind to melusin, enhances the interactions of melusin with Hsp90 and Sgt1. Furthermore, melusin acquires the ADP preference for Hsp90 binding in the presence of Ca2+. Our newly discovered nucleotide-dependent interactions between cochaperones might provide additional complexity to the dynamics of the Hsp90 chaperone system, also suggesting potential Hsp90-independent roles for these cochaperones. PMID:23184943

  10. Technical-Economic Evaluation of a Cogeneration Unit Considering Carbon Emission Savings

    Directory of Open Access Journals (Sweden)

    Ana Christina Ferreira

    2014-06-01

    Full Text Available The support of combined heat and power production systems has gained policy attention, because these are often considered to be less polluting and more efficient than conventional energy conversion systems. As a consequence, the potential market for these energy systems that contribute to reduce greenhouse gas emissions and to enhance energy security on a national level, is shifting from large-scale existing units to small and micro-size emerging technologies. This paper presents a numerical model based on a cost-benefit analysis used to design an optimal cogeneration system for a small-scale building application, considering the Portuguese context and the comparison with the harmonized efficiency reference values for the separate production of electricity and useful heat. The model includes the identification of the objective function terms (i.e., the elements involved in the financial analysis across the system lifetime and the economic evaluation of costs and benefits of the combined heat and power production system. The economic viability of cogeneration systems significantly depends on system technology, client energy requirements and support schemes implemented in the respective countries. A strategic approach is necessary to adequately embed the new technology as a feasible solution in terms of investment and operational costs. Only by matching the energy supply to the needs and expectations of the energy users, it will be possible to improve the market competitiveness of these alternative power production plants. The optimal solution disclosed a positive annual worth, which is higher if the carbon emission savings are monetized. In addition, the optimal system represents a more efficient way to produce useful heat and electricity (i.e. a positive primary energy saving and to reduce gas emissions. A cost-benefit analysis can be applied for the techno-economic evaluation of a CHP system by assessing the monetary socio-environmental costs

  11. The optimal size for biogas plants

    Energy Technology Data Exchange (ETDEWEB)

    Walla, C.; Schneeberger, W. [Department of Economics and Social Sciences, Institute of Agricultural and Forestry Economics, University of Natural Resources and Applied Life Sciences Vienna, Gregor-Mendel-Strasse 33, 1180 Vienna (Austria)

    2008-06-15

    The costs of biogas and electricity production from maize silage in relation to plant size are investigated in this paper. A survey of manufacturers' engineering data was conducted to derive a reliable relationship between the capacity of a combined heat and power (CHP) unit and its electrical efficiency. Then a model was developed to derive cost curves for the unit costs of biogas and electricity production and for the transport costs for maize silage and biogas slurry. The least-cost plant capacity depends to a great extent on the local availability of silage maize, and ranges in the model calculations from 575 to 1150 kW{sub el}. Finally, the paper deals with the optimum operating plant size due to the investment support available and the graduated tariff for green electricity in Austria. (author)

  12. Woking Park PAFC CHP monitoring. Phase 1: Planning, installation and commissioning

    Energy Technology Data Exchange (ETDEWEB)

    Goulding, P.S.; Fry, M.R.

    2003-07-01

    This report covers the planning, installation and commissioning of the first commercially operated fuel cell cogeneration system in the UK. The involvement of Woking Borough Council, its approach to energy efficiency, and the Woking Park site are discussed, and details are given of the PC25/C 200kW fuel cell which is manufactured in the US by UTC Fuel Cells. A description of the Woking Park fuel cell combined heat and power application is presented, and the project economics, specification and tendering are examined. The route taken to planning approval is traced, and installation procedures are outlined. The testing of the phosphoric type PC25 fuel cell cogeneration unit is described, and expected cost and project timescales are noted.

  13. Optimal Resources Planning of Residential Complex Energy System in a Day-ahead Market Based on Invasive Weed Optimization Algorithm

    Directory of Open Access Journals (Sweden)

    P. Αhmadi

    2017-10-01

    Full Text Available This paper deals with optimal resources planning in a residential complex energy system, including FC (fuel cell, PV (Photovoltaic panels and the battery. A day-ahead energy management system (EMS based on invasive weed optimization (IWO algorithm is defined for managing different resources to determine an optimal operation schedule for the energy resources at each time interval to minimize the operation cost of a smart residential complex energy system. Moreover, in this paper the impacts of the sell to grid and purchase from grid are also considered. All practical constraints of the each energy resources and utility policies are taken into account. Moreover, sensitivity analysis are conducted on electricity prices and sell to grid factor (SGF, in order to improve understanding the impact of key parameters on residential CHP systems economy. It is shown that proposed system can meet all electrical and thermal demands with economic point of view. Also enhancement of electricity price leads to substantial growth in utilization of proposed CHP system.

  14. Potential of ORC Systems to Retrofit CHP Plants in Wastewater Treatment Stations

    Directory of Open Access Journals (Sweden)

    Ricardo Chacartegui

    2013-12-01

    Full Text Available Wastewater treatment stations take advantage of the biogas produced from sludge in anaerobic digesters to generate electricity (reciprocating gas engines and heat (cooling water and engine exhaust gases. A fraction of this electricity is used to operate the plant while the remaining is sold to the grid. Heat is almost entirely used to support the endothermic anaerobic digestion and a minimum fraction of it is rejected to the environment at a set of fan coolers. This generic description is applicable to on-design conditions. Nevertheless, the operating conditions of the plant present a large seasonal variation so it is commonly found that the fraction of heat rejected to the atmosphere increases significantly at certain times of the year. Moreover, the heat available in the exhaust gases of the reciprocating engine is at a very high temperature (around 650 oC, which is far from the temperature at which heat is needed for the digestion of sludge (around 40 oC in the digesters. This temperature difference offers an opportunity to introduce an intermediate system between the engines and the digesters that makes use of a fraction of the available heat to convert it into electricity. An Organic Rankine Cycle (ORC with an appropriate working fluid is an adequate candidate for these hot/cold temperature sources. In this paper, the techno-economic effect of adding an Organic Rankine Cycle as the intermediate system of an existing wastewater treatment station is analysed. On this purpose, different working fluids and system layouts have been studied for a reference wastewater treatment station giving rise to optimal systems configurations. The proposed systems yield very promising results with regard to global efficiency and electricity production (thermodynamically and economically.

  15. Biomass gasification in cost-optimized district heating systems-A regional modelling analysis

    Energy Technology Data Exchange (ETDEWEB)

    Boerjesson, Martin, E-mail: martin.borjesson@chalmers.s [Energy Systems Technology, Division of Energy Technology, Department of Energy and Environment, Chalmers University of Technology, SE-412 96 Goeteborg (Sweden); Ahlgren, Erik O. [Energy Systems Technology, Division of Energy Technology, Department of Energy and Environment, Chalmers University of Technology, SE-412 96 Goeteborg (Sweden)

    2010-01-15

    Biomass integrated gasification combined cycle (BIGCC) plants could, in combined heat and power (CHP) generation, increase the power-to-heat ratio compared to conventional biomass steam turbine plants. Furthermore, biomass gasification could also be used for the efficient production of biofuels for transport. In this study, different applications of biomass gasification in connection to district heating (DH) are analysed and contrasted to conventional technology options. An application of the cost-optimizing energy system model MARKAL with a detailed description of the DH sector in a southwestern region of Sweden was developed within the study and used in the analysis. Policy measures for CO{sub 2} reduction and for promotion of 'green' electricity are assumed, and required subsidy levels for large-scale production of transport biofuels are calculated. The model also operates with different supplies of biomass: a local supply at a lower cost and an international supply of refined biomass at a slightly higher cost. The study shows that investments in BIGCC CHP are often cost-efficient in cases with low ambitions regarding transport biofuels. However, due to limitations in heat demand and in local, lower cost, supply of biomass, investment in biofuel production means less investment in BIGCC CHP and, thereby, a smaller electricity production.

  16. Biomass gasification in cost-optimized district heating systems. A regional modelling analysis

    Energy Technology Data Exchange (ETDEWEB)

    Boerjesson, Martin; Ahlgren, Erik O. [Energy Systems Technology, Division of Energy Technology, Department of Energy and Environment, Chalmers University of Technology, SE-412 96 Goeteborg (Sweden)

    2010-01-15

    Biomass integrated gasification combined cycle (BIGCC) plants could, in combined heat and power (CHP) generation, increase the power-to-heat ratio compared to conventional biomass steam turbine plants. Furthermore, biomass gasification could also be used for the efficient production of biofuels for transport. In this study, different applications of biomass gasification in connection to district heating (DH) are analysed and contrasted to conventional technology options. An application of the cost-optimizing energy system model MARKAL with a detailed description of the DH sector in a southwestern region of Sweden was developed within the study and used in the analysis. Policy measures for CO{sub 2} reduction and for promotion of 'green' electricity are assumed, and required subsidy levels for large-scale production of transport biofuels are calculated. The model also operates with different supplies of biomass: a local supply at a lower cost and an international supply of refined biomass at a slightly higher cost. The study shows that investments in BIGCC CHP are often cost-efficient in cases with low ambitions regarding transport biofuels. However, due to limitations in heat demand and in local, lower cost, supply of biomass, investment in biofuel production means less investment in BIGCC CHP and, thereby, a smaller electricity production. (author)

  17. Economic potentials of CHP connected to district heat systems in Germany. Implementation of the EU Efficiency Directive; Wirtschaftliche Potenziale der waermeleitungsgebundenen Siedlungs-KWK in Deutschland. Umsetzung der EU-Energieeffizienzrichtlinie

    Energy Technology Data Exchange (ETDEWEB)

    Eikmeier, Bernd [Fraunhofer-Institut fuer Fertigungstechnik und Angewandte Materialforschung IFAM, Bremen (Germany). Organisationseinheit Systemanalyse; Bremen Univ. (Germany)

    2015-07-01

    The EU Efficiency Directive (2012/27/EU) is requiring all member states to carry out an evaluation of the potential for highly efficient CHP and the efficient use of district heating and cooling by December 2015. The German Federal Ministry of Economic Affairs and Energy appointed this task to the Fraunhofer Institute for Manufacturing and Advanced Materials, division for Energy Systems Analysis (formerly Bremer Energie Institut) in conjunction with other partners. The results for the sector district- and communal heating with CHP, sub-sectors private households, trade and services industry, are presented in this article.

  18. Quadruple or quintuple conversion of hlb, sak, sea (or sep), scn, and chp genes by bacteriophages in non-beta-hemolysin-producing bovine isolates of Staphylococcus aureus.

    Science.gov (United States)

    Kumagai, Rina; Nakatani, Kazue; Ikeya, Nanami; Kito, Yukiko; Kaidoh, Toshio; Takeuchi, Shotaro

    2007-05-16

    In 13 of 43 non-beta-hemolysin-producing bovine isolates of Staphylococcus aureus, two truncated beta-hemolysin (hlb) genes were demonstrated by PCR and sequencing, and one truncated hlb gene was located beside the integrase (int) gene of phage origin. The staphylokinase (sak) gene was detected in all 13 isolates in which the truncated hlb genes were detected by PCR. Enterotoxin A (sea) and enterotoxin P (sep) genes were also detected in 5 and 2 of the 13 isolates, respectively. Moreover, the scn and chp genes encoding staphylococcal complement inhibitor (SCIN) and chemotaxis inhibitory protein of S. aureus (CHIPS) were detected in 13 and 4 of the 13 isolates, respectively. The bacteriophage induced by mitomycin C treatment was able to lysogenize one beta-hemolysin-producing isolate of S. aureus, and the sak and scn genes were detected from the lysogenized isolate. These results suggest quadruple or quintuple conversion of hlb, sak, sea (or sep), scn, and chp genes by bacteriophages among non-beta-hemolysin-producing bovine isolates of S. aureus.

  19. Operating Experiences with a Small-scale CHP Pilot Plant based on a 35 kWel Hermetic Four Cylinder Stirling Engine for Biomass Fuels

    DEFF Research Database (Denmark)

    Biedermann, F.; Carlsen, Henrik; Schoech, M.

    2003-01-01

    Within the scope of the RD&D project presented a small-scale CHP plant with a hermetic four cylinder Stirling engine for biomass fuels was developed and optimised in cooperation with the Technical University of Denmark, MAWERA Holzfeuerungsanlagen GesmbH, an Austrian biomass furnace and boiler ma...... exchanger of the Stirling engine, of the air preheater and of the entire combustion system. Furthermore, the optimisation of the pneumatic cleaning system to reduce ash deposition in the hot heat exchanger is of great relevance.......Within the scope of the RD&D project presented a small-scale CHP plant with a hermetic four cylinder Stirling engine for biomass fuels was developed and optimised in cooperation with the Technical University of Denmark, MAWERA Holzfeuerungsanlagen GesmbH, an Austrian biomass furnace and boiler...... manufacturer, and BIOS BIOENERGIESYSTEME GmbH, an Austrian development and engineering company. Based on the technology developed, a pilot plant was designed and erected in Austria. The nominal electric power output of the plant is 35 kWel and the nominal thermal output amounts to approx. 220 kWth. The plant...

  20. Evaluation of the cost effectiveness of exenatide versus insulin glargine in patients with sub-optimally controlled Type 2 diabetes in the United Kingdom

    Directory of Open Access Journals (Sweden)

    Tetlow Anthony P

    2008-08-01

    Full Text Available Abstract Objective Exenatide belongs to a new therapeutic class in the treatment of diabetes (incretin mimetics, allowing glucose-dependent glycaemic control in Type 2 diabetes. Randomised controlled trial data suggest that exenatide is as effective as insulin glargine at reducing HbA1c in combination therapy with metformin and sulphonylureas; with reduced weight but higher incidence of adverse gastrointestinal events. The objective of this study is to evaluate the cost effectiveness of exenatide versus insulin glargine using RCT data and a previously published model of Type 2 diabetes disease progression that is based on the United Kingdom Prospective Diabetes Study; the perspective of the health-payer of the United Kingdom National Health Service. Methods The study used a discrete event simulation model designed to forecast the costs and health outcome of a cohort of 1,000 subjects aged over 40 years with sub-optimally-controlled Type 2 diabetes, following initiation of either exenatide, or insulin glargine, in addition to oral hypoglycaemic agents. Sensitivity analysis for a higher treatment discontinuation rate in exenatide patients was applied to the cohort in three different scenarios; (1 either ignored or (2 exenatide-failures excluded or (3 exenatide-failures switched to insulin glargine. Analyses were undertaken to evaluate the price sensitivity of exenatide in terms of relative cost effectiveness. Baseline cohort profiles and effectiveness data were taken from a published randomised controlled trial. Results The relative cost-effectiveness of exenatide and insulin glargine was tested under a variety of conditions, in which insulin glargine was dominant in all cases. Using the most conservative of assumptions, the cost-effectiveness ratio of exenatide vs. insulin glargine at the current UK NHS price was -£29,149/QALY (insulin glargine dominant and thus exenatide is not cost-effective when compared with insulin glargine, at the current

  1. Determining optimal threshold for glucose control in organ donors after neurologic determination of death: a United Network for Organ Sharing Region 5 Donor Management Goals Workgroup prospective analysis.

    Science.gov (United States)

    Sally, Mitchell B; Ewing, Tyler; Crutchfield, Megan; Patel, Madhukar S; Raza, Shariq; De La Cruz, Salvador; Zatarain, John; Malinoski, Darren Jay

    2014-01-01

    The appropriate level of glucose control in organ donors after neurologic determination of death (DNDD) remains uncertain. We hypothesized that a glucose target of 180 mg/dL would be appropriate for optimizing organ transplantation rates and outcomes. Demographic, critical care, organ transplantation, and graft outcome data were prospectively collected on all DNDDs in United Network for Organ Sharing (UNOS) Region 5 from 2010 to 2012. Glucose levels were assessed at four time points in the organ donation process. The primary outcome measure was having four or more organs transplanted per donor (OTPD). Univariate analyses were conducted to determine the relationship between glucose levels and OTPD, organ transplantation rates, and graft function. Multivariate analyses were performed to determine independent predictors of four or more OTPDs. Glucose levels were analyzed at the following cutoff points: 150 or less, 180, and 200 mg/dL. Results with a p Glucose levels of 150 mg/dL or less were not associated with differences in organ use. Levels of 180 mg/dL or less were associated with more OTPDs (3.5 vs. 3.2), a higher rate of four or more OTPDs (42% vs. 34%), and more heart (34% vs. 28%), pancreas (18% vs. 11%), and kidney (85% vs. 81%) use. Levels of 200 mg/dL or less revealed similar results. However, only a level of 180 mg/dL or less was an independent predictor of four or more OTPDs (odds ratio, 1.4). All three levels were associated with higher kidney graft survival after a mean (SD) of 10 (6.0) months of follow-up (97% vs. 95%). Hyperglycemia is common in DNDDs and is associated with lower organ transplantation rates and worse graft outcomes. Targeting a glucose level of 180 mg/dL or less seems to preserve outcomes and is consistent with general critical care guidelines. Therapeutic study, level II.

  2. Techno-economic optimization of flexible biogas concepts in the context of EEG; Technisch-oekonomische Optimierung von flexiblen Biogaskonzepten im Kontext des EEG

    Energy Technology Data Exchange (ETDEWEB)

    Barchmann, Tino; Lauer, Markus [DBFZ Deutsches Biomasseforschungszentrum gemeinnuetzige GmbH, Leipzig (Germany)

    2014-08-01

    Due to the introduction of direct marketing and flexibility premium of renewable energy by the Renewable Energy Act 2012 (EEG 2012), incentives were created to favour a more demand-oriented power supply from biogas plants (BGA). The decision for such an operational mode depends on on-site conversion units on the economic outcome of the plants throughout the whole operating time. To install new plants or transfer existing plants into a flexible mode of operation, investments in additional and more efficient combined heat and power plants (CHP), in additional gas and/or heat storage and other technical components are necessary. The analyses show that the flexibility premium, as an extra of the market premium model, creates the greatest incentive for a more flexible generation of electricity from biogas. In addition, an intelligent management optimization can generate additional revenues on EPEX SPOT SE and balancing energy market. The additional revenues of more demand-oriented power supply from biogas plants are highly dependent on plant-specific conditions. From an economic perspective, a duplication of the installed electrical capacity seems to be the most beneficial option for a transition to a demand-driven operation mode of an average biogas model plant under the current legal framework (EEG 2012).

  3. Optimal Energy Management of Multi-Microgrids with Sequentially Coordinated Operations

    Directory of Open Access Journals (Sweden)

    Nah-Oak Song

    2015-08-01

    Full Text Available We propose an optimal electric energy management of a cooperative multi-microgrid community with sequentially coordinated operations. The sequentially coordinated operations are suggested to distribute computational burden and yet to make the optimal 24 energy management of multi-microgrids possible. The sequential operations are mathematically modeled to find the optimal operation conditions and illustrated with physical interpretation of how to achieve optimal energy management in the cooperative multi-microgrid community. This global electric energy optimization of the cooperative community is realized by the ancillary internal trading between the microgrids in the cooperative community which reduces the extra cost from unnecessary external trading by adjusting the electric energy production amounts of combined heat and power (CHP generators and amounts of both internal and external electric energy trading of the cooperative community. A simulation study is also conducted to validate the proposed mathematical energy management models.

  4. Optimal operation control of a virtual power plant based on gas-powered micro-cogeneration units; Optimale Betriebsfuehrung eines virtuellen Kraftwerks auf Basis von gasbetriebenen Mikro-Blockheizkraftwerken

    Energy Technology Data Exchange (ETDEWEB)

    Mueller, Christian; Rehkopf, Andreas [Technische Univ. Bergakademie Freiberg (Germany). Inst. fuer Automatisierungstechnik

    2011-07-01

    In this paper the optimal operation control of a virtual power plant is studied. Therefor the control problem of the micro-cogeneration units is reduced to a mathematical bilevel problem. The target functions and constraints for that Stackelberg Game are identified. Finally the coupling of both levels is realized by the solution set of the lower level. A simple example of the real application (use) is shown. (orig.)

  5. Developing Virtual Power Plant for Optimized Distributed Energy Resources Operation and Integration

    DEFF Research Database (Denmark)

    You, Shi

    , these sources are usually deployed in way of “fit and forget” which to a great extent confines their value and presents challenges in relation to:  Optimized DER operation related to time varying onsite demand requirements, ambient conditions and electricity prices, etc.  Coordinated control of many small...... scheme is still challenged by many uncertainties which reside in the nature of price signal control such as jumpy response. To demonstrate the feasibility of the VPP, a prototyped VPP with two Dachs μCHP systems is set up in the laboratory as a proof of concept. It has shown that, on the premise...

  6. Optimization and Optimal Control

    CERN Document Server

    Chinchuluun, Altannar; Enkhbat, Rentsen; Tseveendorj, Ider

    2010-01-01

    During the last four decades there has been a remarkable development in optimization and optimal control. Due to its wide variety of applications, many scientists and researchers have paid attention to fields of optimization and optimal control. A huge number of new theoretical, algorithmic, and computational results have been observed in the last few years. This book gives the latest advances, and due to the rapid development of these fields, there are no other recent publications on the same topics. Key features: Provides a collection of selected contributions giving a state-of-the-art accou

  7. Novel web-based real-time dashboard to optimize recycling and use of red cell units at a large multi-site transfusion service

    Science.gov (United States)

    Sharpe, Christopher; Quinn, Jason G; Watson, Stephanie; Doiron, Donald; Crocker, Bryan; Cheng, Calvino

    2014-01-01

    Background: Effective blood inventory management reduces outdates of blood products. Multiple strategies have been employed to reduce the rate of red blood cell (RBC) unit outdate. We designed an automated real-time web-based dashboard interfaced with our laboratory information system to effectively recycle red cell units. The objective of our approach is to decrease RBC outdate rates within our transfusion service. Methods: The dashboard was deployed in August 2011 and is accessed by a shortcut that was placed on the desktops of all blood transfusion services computers in the Capital District Health Authority region. It was designed to refresh automatically every 10 min. The dashboard provides all vital information on RBC units, and implemented a color coding scheme to indicate an RBC unit's proximity to expiration. Results: The overall RBC unit outdate rate in the 7 months period following implementation of the dashboard (September 2011-March 2012) was 1.24% (123 units outdated/9763 units received), compared to similar periods in 2010-2011 and 2009-2010: 2.03% (188/9395) and 2.81% (261/9220), respectively. The odds ratio of a RBC unit outdate postdashboard (2011-2012) compared with 2010-2011 was 0.625 (95% confidence interval: 0.497-0.786; P < 0.0001). Conclusion: Our dashboard system is an inexpensive and novel blood inventory management system which was associated with a significant reduction in RBC unit outdate rates at our institution over a period of 7 months. This system, or components of it, could be a useful addition to existing RBC management systems at other institutions. PMID:25337432

  8. Network design optimization of fuel cell systems and distributed energy devices.

    Energy Technology Data Exchange (ETDEWEB)

    Colella, Whitney G.

    2010-07-01

    This research explores the thermodynamics, economics, and environmental impacts of innovative, stationary, polygenerative fuel cell systems (FCSs). Each main report section is split into four subsections. The first subsection, 'Potential Greenhouse Gas (GHG) Impact of Stationary FCSs,' quantifies the degree to which GHG emissions can be reduced at a U.S. regional level with the implementation of different FCS designs. The second subsection, 'Optimizing the Design of Combined Heat and Power (CHP) FCSs,' discusses energy network optimization models that evaluate novel strategies for operating CHP FCSs so as to minimize (1) electricity and heating costs for building owners and (2) emissions of the primary GHG - carbon dioxide (CO{sub 2}). The third subsection, 'Optimizing the Design of Combined Cooling, Heating, and Electric Power (CCHP) FCSs,' is similar to the second subsection but is expanded to include capturing FCS heat with absorptive cooling cycles to produce cooling energy. The fourth subsection, - Thermodynamic and Chemical Engineering Models of CCHP FCSs,' discusses the physics and thermodynamic limits of CCHP FCSs.

  9. Robust Management of Combined Heat and Power Systems via Linear Decision Rules

    DEFF Research Database (Denmark)

    Zugno, Marco; Morales González, Juan Miguel; Madsen, Henrik

    2014-01-01

    The heat and power outputs of Combined Heat and Power (CHP) units are jointly constrained. Hence, the optimal management of systems including CHP units is a multicommodity optimization problem. Problems of this type are stochastic, owing to the uncertainty inherent both in the demand for heat and...... linear decision rules to guarantee both tractability and a correct representation of the dynamic aspects of the problem. Numerical results from an illustrative example confirm the value of the proposed approach....

  10. Novel web-based real-time dashboard to optimize recycling and use of red cell units at a large multi-site transfusion service

    Directory of Open Access Journals (Sweden)

    Christopher Sharpe

    2014-01-01

    Full Text Available Background: Effective blood inventory management reduces outdates of blood products. Multiple strategies have been employed to reduce the rate of red blood cell (RBC unit outdate. We designed an automated real-time web-based dashboard interfaced with our laboratory information system to effectively recycle red cell units. The objective of our approach is to decrease RBC outdate rates within our transfusion service. Methods: The dashboard was deployed in August 2011 and is accessed by a shortcut that was placed on the desktops of all blood transfusion services computers in the Capital District Health Authority region. It was designed to refresh automatically every 10 min. The dashboard provides all vital information on RBC units, and implemented a color coding scheme to indicate an RBC unit′s proximity to expiration. Results: The overall RBC unit outdate rate in the 7 months period following implementation of the dashboard (September 2011-March 2012 was 1.24% (123 units outdated/9763 units received, compared to similar periods in 2010-2011 and 2009-2010: 2.03% (188/9395 and 2.81% (261/9220, respectively. The odds ratio of a RBC unit outdate postdashboard (2011-2012 compared with 2010-2011 was 0.625 (95% confidence interval: 0.497-0.786; P < 0.0001. Conclusion: Our dashboard system is an inexpensive and novel blood inventory management system which was associated with a significant reduction in RBC unit outdate rates at our institution over a period of 7 months. This system, or components of it, could be a useful addition to existing RBC management systems at other institutions.

  11. Testing of a low NOx wire-mesh duct burner for micro-cogeneration unit

    Energy Technology Data Exchange (ETDEWEB)

    Ramadan, O.B.; Gauthier, J.E.D. [Carleton Univ., Ottawa, ON (Canada). Dept. of Mechanical and Aerospace Engineering; Hughes, P.M.; Brandon, R. [Natural Resources Canada, Ottawa, ON (Canada). CANMET Energy Technology Centre

    2007-07-01

    Combined heat and power (CHP) or cogeneration involves the generation of electricity in addition to the productive use of waste heat from the combustion process using the same primary fuel. An alternative to combined electrical power and heat generation is a micro-cogeneration unit which uses a micro-turbine as a prime mover. This type of unit is expected to result in a shift from large and centralized plants to smaller, more economical on-site generation plants. This paper presented a new low nitrogen oxide (NOx) wire-mesh duct burner (WMDB) for the development of a more efficient micro-cogeneration unit. In order to increase its thermal output, the low NOx WMDB was designed, built and integrated for evaluation with the Ingersol-Rand 70 kw micro-cogeneration unit. The wire-mesh burner had a conical shape and was manufactured by ACOTECH. The paper also discussed the advantages of micro-CHP units which are more attractive to building owners, retail establishments, commercial and light industrial facilities. Advantages include quality of the power supply; more economical, cleaner power; and the addition of new capacity without new transmission lines. It was concluded that low levels of emission were achieved with the development of a low NOx wire-mesh duct burner for a micro-cogeneration plant. 2 refs., 5 figs.

  12. Providing Optimal Palliative Care for Persons Living with Dementia: A Comparison of Physician Perceptions in the Netherlands and the United Kingdom

    NARCIS (Netherlands)

    Brazil, K.; Galway, K.; Carter, G.; Steen, J.T. van der

    2017-01-01

    BACKGROUND: The European Association for Palliative Care (EAPC) recently issued a framework that defines optimal palliative care in dementia. However, implementation of the guidelines may pose challenges for physicians working with dementia patients in practice. OBJECTIVE: To measure and compare the

  13. Development and design of experiments optimization of a high temperature proton exchange membrane fuel cell auxiliary power unit with onboard fuel processor

    Science.gov (United States)

    Karstedt, Jörg; Ogrzewalla, Jürgen; Severin, Christopher; Pischinger, Stefan

    In this work, the concept development, system layout, component simulation and the overall DOE system optimization of a HT-PEM fuel cell APU with a net electric power output of 4.5 kW and an onboard methane fuel processor are presented. A highly integrated system layout has been developed that enables fast startup within 7.5 min, a closed system water balance and high fuel processor efficiencies of up to 85% due to the recuperation of the anode offgas burner heat. The integration of the system battery into the load management enhances the transient electric performance and the maximum electric power output of the APU system. Simulation models of the carbon monoxide influence on HT-PEM cell voltage, the concentration and temperature profiles within the autothermal reformer (ATR) and the CO conversion rates within the watergas shift stages (WGSs) have been developed. They enable the optimization of the CO concentration in the anode gas of the fuel cell in order to achieve maximum system efficiencies and an optimized dimensioning of the ATR and WGS reactors. Furthermore a DOE optimization of the global system parameters cathode stoichiometry, anode stoichiometry, air/fuel ratio and steam/carbon ratio of the fuel processing system has been performed in order to achieve maximum system efficiencies for all system operating points under given boundary conditions.

  14. Resource-efficient drying methods applied to the biomass fired CHP plant. System Study; Resurseffektiva torkmetoder applicerade paa biobraensleeldade kraftvaermeverk. Systemstudie

    Energy Technology Data Exchange (ETDEWEB)

    Joensson, Mikael; Nystroem, Olle; Hermann, Fredrik (Grontmij AB (Sweden))

    2010-12-15

    The study shows that the existing heat-load for the CHP plant can be increased by drying the wet fuel by using the district heating (hot-flow) as heat source, which increases the operating time for the plant and allow for higher electricity production. A drying method which is appropriate is based on the bed drying technique that can be adapted to the temperatures used in district heating systems or which is available in various waste heat sources. The degree of maturity of the bed drying technology for drying of wet fuel consisting of different size fractions is somewhat uncertain. Technical difficulties have been identified and it seems difficult to dry slash. Application of a drying process with the purpose to increase the heat load can be justified for various reasons related to the products to be produced in the plant and combine. In this study, attention is drawn to the drying of fuel for the use in the boiler of the CHP plant and for the production of pellets for sale. Two different plant sizes of CHP plants have been studied. One of 20 MW and one of 50 MW electrical power. For each plant size different combinations of drying, to varying moisture content, and with different amount of pellets production has been examined in different plant cases. The drying means that the electricity production can be increased with maintained or reduced electricity production cost. The majority of the increase in generated electricity is created by the drying of wet fuel for the CHP's own needs, i.e. drying of the pellet production is less significant. In this study logging slash (branches and tops from felling) has been used as fuel both for operating the boiler of the CHP and as raw material for pellet production. Since pelleted logging slash is not a fully established product, it has been difficult to determine its value. It is likely that the price will be below what is established for sawdust pellet, in part because of the slash-pellet contains more impurities and

  15. Optimal Siting and Sizing of Multiple DG Units for the Enhancement of Voltage Profile and Loss Minimization in Transmission Systems Using Nature Inspired Algorithms.

    Science.gov (United States)

    Ramamoorthy, Ambika; Ramachandran, Rajeswari

    2016-01-01

    Power grid becomes smarter nowadays along with technological development. The benefits of smart grid can be enhanced through the integration of renewable energy sources. In this paper, several studies have been made to reconfigure a conventional network into a smart grid. Amongst all the renewable sources, solar power takes the prominent position due to its availability in abundance. Proposed methodology presented in this paper is aimed at minimizing network power losses and at improving the voltage stability within the frame work of system operation and security constraints in a transmission system. Locations and capacities of DGs have a significant impact on the system losses in a transmission system. In this paper, combined nature inspired algorithms are presented for optimal location and sizing of DGs. This paper proposes a two-step optimization technique in order to integrate DG. In a first step, the best size of DG is determined through PSO metaheuristics and the results obtained through PSO is tested for reverse power flow by negative load approach to find possible bus locations. Then, optimal location is found by Loss Sensitivity Factor (LSF) and weak (WK) bus methods and the results are compared. In a second step, optimal sizing of DGs is determined by PSO, GSA, and hybrid PSOGSA algorithms. Apart from optimal sizing and siting of DGs, different scenarios with number of DGs (3, 4, and 5) and PQ capacities of DGs (P alone, Q alone, and P and Q both) are also analyzed and the results are analyzed in this paper. A detailed performance analysis is carried out on IEEE 30-bus system to demonstrate the effectiveness of the proposed methodology.

  16. Optimal Siting and Sizing of Multiple DG Units for the Enhancement of Voltage Profile and Loss Minimization in Transmission Systems Using Nature Inspired Algorithms

    Directory of Open Access Journals (Sweden)

    Ambika Ramamoorthy

    2016-01-01

    Full Text Available Power grid becomes smarter nowadays along with technological development. The benefits of smart grid can be enhanced through the integration of renewable energy sources. In this paper, several studies have been made to reconfigure a conventional network into a smart grid. Amongst all the renewable sources, solar power takes the prominent position due to its availability in abundance. Proposed methodology presented in this paper is aimed at minimizing network power losses and at improving the voltage stability within the frame work of system operation and security constraints in a transmission system. Locations and capacities of DGs have a significant impact on the system losses in a transmission system. In this paper, combined nature inspired algorithms are presented for optimal location and sizing of DGs. This paper proposes a two-step optimization technique in order to integrate DG. In a first step, the best size of DG is determined through PSO metaheuristics and the results obtained through PSO is tested for reverse power flow by negative load approach to find possible bus locations. Then, optimal location is found by Loss Sensitivity Factor (LSF and weak (WK bus methods and the results are compared. In a second step, optimal sizing of DGs is determined by PSO, GSA, and hybrid PSOGSA algorithms. Apart from optimal sizing and siting of DGs, different scenarios with number of DGs (3, 4, and 5 and PQ capacities of DGs (P alone, Q alone, and  P and Q both are also analyzed and the results are analyzed in this paper. A detailed performance analysis is carried out on IEEE 30-bus system to demonstrate the effectiveness of the proposed methodology.

  17. Optimization of production in the oil field through the study of the problem of location of wells and production units; Otimizacao da producao em campo de petroleo pelo estudo do problema de localizacao de pocos e unidades de producao

    Energy Technology Data Exchange (ETDEWEB)

    Santana, Roberta G.S. [Universidade Federal do Rio de Janeiro (UFRJ), RJ (Brazil); Rosa, Vinicius R. [Petroleo Brasileiro S.A. (PETROBRAS), Rio de Janeiro, RJ (Brazil)

    2012-07-01

    This project provides a process for determining the best location of well and production units in an oil field in order to optimize the reservoir performance and the volume of recovered oil, maximizing the profitability. The process uses various statistical analyses presented in the reservoir simulation results, under considerations and parameters. Sensibility analysis and response surface methodology is also applied to a better understanding of how each well influence the total production and the location of the platform and/or manifold can be changed to optimize the production. The method is shown being applied on a field scale with synthetic data. It aims to be a new way of guiding decision-making on a project to develop a field production. (author)

  18. CO{sub 2} reduction: potential of heat pumps when used together with combined heat and power units; Potentiel energetique des pompes a chaleur combinees au couplage chaleur-force. Pour une reduction maximale des emissions de CO{sub 2} et pour une production de courant fossile avec reduction des emissions de CO{sub 2} en Suisse - Rapport final

    Energy Technology Data Exchange (ETDEWEB)

    Rognon, F.

    2005-07-01

    This final report for the Swiss Federal Office of Energy (SFOE) presents the results of a project that examined the potential of using heat pumps in combination with Combined Heat and Power (CHP) units as a replacement for fossil-fuel fired heating units in Switzerland. The electrical power produced by the CHP units can be used to provide power for the drives of heat pump systems. The author states that the fossil fuel consumption and the resulting emissions of carbon dioxide can be halved using this combination. Also, even more efficient systems using power produced in larger combined-cycle power generation are discussed. Further examples of how fossil-fired power generation in combination with heat pumps can not only replace fossil-fuelled heating systems but also provide additional electricity too are given. This overview includes figures on the potential of such combined systems.

  19. Development and Testing of the Advanced CHP System Utilizing the Off-Gas from the Innovative Green Coke Calcining Process in Fluidized Bed

    Energy Technology Data Exchange (ETDEWEB)

    Chudnovsky, Yaroslav; Kozlov, Aleksandr

    2013-08-15

    Green petroleum coke (GPC) is an oil refining byproduct that can be used directly as a solid fuel or as a feedstock for the production of calcined petroleum coke. GPC contains a high amount of volatiles and sulfur. During the calcination process, the GPC is heated to remove the volatiles and sulfur to produce purified calcined coke, which is used in the production of graphite, electrodes, metal carburizers, and other carbon products. Currently, more than 80% of calcined coke is produced in rotary kilns or rotary hearth furnaces. These technologies provide partial heat utilization of the calcined coke to increase efficiency of the calcination process, but they also share some operating disadvantages. However, coke calcination in an electrothermal fluidized bed (EFB) opens up a number of potential benefits for the production enhancement, while reducing the capital and operating costs. The increased usage of heavy crude oil in recent years has resulted in higher sulfur content in green coke produced by oil refinery process, which requires a significant increase in the calcinations temperature and in residence time. The calorific value of the process off-gas is quite substantial and can be effectively utilized as an “opportunity fuel” for combined heat and power (CHP) production to complement the energy demand. Heat recovered from the product cooling can also contribute to the overall economics of the calcination process. Preliminary estimates indicated the decrease in energy consumption by 35-50% as well as a proportional decrease in greenhouse gas emissions. As such, the efficiency improvement of the coke calcinations systems is attracting close attention of the researchers and engineers throughout the world. The developed technology is intended to accomplish the following objectives: - Reduce the energy and carbon intensity of the calcined coke production process. - Increase utilization of opportunity fuels such as industrial waste off-gas from the novel

  20. Optimized manufacturable porous materials

    DEFF Research Database (Denmark)

    Andreassen, Erik; Andreasen, Casper Schousboe; Jensen, Jakob Søndergaard

    to include manufacturing constraints in the optimization. This work focuses on incorporating the manufacturability into the optimization procedure, allowing the resulting material structure to be manufactured directly using rapid manufacturing techniques, such as selective laser melting/sintering (SLM....../S). The available manufacturing methods are best suited for porous materials (one constituent and void), but the optimization procedure can easily include more constituents. The elasticity tensor is found from one unit cell using the homogenization method together with a standard finite element (FE) discretization....... The distribution of the material in the unit cell is optimized according to a given objective (e.g. maximum bulk modulus or minimum Poisson’s ratio) and some given constraints (e.g. isotropy) using topology optimization. The manufacturability is achieved using various filtering techniques together...

  1. Impact of Process Optimization and Quality Improvement Measures on Neonatal Feeding Outcomes at an All-Referral Neonatal Intensive Care Unit.

    Science.gov (United States)

    Jadcherla, Sudarshan R; Dail, James; Malkar, Manish B; McClead, Richard; Kelleher, Kelly; Nelin, Leif

    2016-07-01

    We hypothesized that the implementation of a feeding quality improvement (QI) program among premature neonates accelerates feeding milestones, safely lowering hospital length of stay (LOS) compared with the baseline period. Baseline data were collected for 15 months (N = 92) prior to initiating the program, which involved development and implementation of a standardized feeding strategy in eligible premature neonates. Process optimization, implementation of feeding strategy, monitoring compliance, multidisciplinary feeding rounds, and continuous education strategies were employed. The main outcomes included the ability and duration to reach enteral feeds-120 (mL/kg/d), oral feeds-120 (mL/kg/d), and ad lib oral feeding. Balancing measures included growth velocities, comorbidities, and LOS. Comparing baseline versus feeding program (N = 92) groups, respectively, the feeding program improved the number of infants receiving trophic feeds (34% vs 80%, P Process optimization and the implementation of a standardized feeding strategy minimize practice variability, accelerating the attainment of enteral and oral feeding milestones and decreasing LOS without increasing adverse morbidities. © 2015 American Society for Parenteral and Enteral Nutrition.

  2. OPTIMIZATION OF OPTIMIZATION OF DESIGN FORMULA DESIGN ...

    African Journals Online (AJOL)

    User

    control in productions both at the fac the site. Thus, optimum desig approached from a global appl starting initially from the optim individual units or criterion. The method [12, 13, 14, 15] is used herein the ultimate limit-state of bending reinforced concrete slab. presented herein have been develop mathematical programming.

  3. Prototype of a new tip developed to be coupled to dental light-curing units for optimizing bonding of orthodontic brackets and accessories

    Directory of Open Access Journals (Sweden)

    Sergio Luiz Mota Júnior

    2013-12-01

    Full Text Available OBJECTIVE: development of a new device to be coupled to light-curing units for bonding orthodontic brackets and accessories, and test its efficacy in an in vitro mechanical trial. The inner surface of the device is mirrored and is based on physical concepts of light refraction and reflection. The main advantage of such device is the reduced clinical time needed for bonding and the low possibility of contamination during the process. METHODS: One hundred and twenty specimens were used for testing the shear bond strength of brackets bonded with the device. The Adhesive Remnant Index (ARI was also determined. The sample was divided into 2 groups. In group 1 a halogen light-curing unit was used while in group 2 a led light-curing unit was used. Each group was then subdivided. In subgroups H1 and L1, a conventional light guide rod was used while in subgroups H2 and L2 bonding was performed with the mirrored device coupled to the tip of the guide light rod. RESULTS: The values obtained for the shear bond strength and the ARI in the subgroups were compared. Results showed that there was no statistically significant difference for the shear strength (p > 0.05 and the ARI (p > 0.05 between the subgroups. CONCLUSION: The tests of mechanical trials and the ARI analysis showed that the new device fulfilled the requirements for bonding orthodontic accessories, and that the time for bonding was reduced to half, being necessary only one light exposure.

  4. Establishing the soundness of administrative spatial units for operationalising the active living potential of residential environments: an exemplar for designing optimal zones

    Directory of Open Access Journals (Sweden)

    Riva Mylène

    2008-07-01

    Full Text Available Abstract Background In health and place research, definitions of areas, area characteristics, and health outcomes should ideally be coherent with one another. Yet current approaches for delimiting areas mostly rely on spatial units "of convenience" such as census tracts. These areas may be homogeneous along socioeconomic conditions but heterogeneous along other environmental characteristics. This heterogeneity can lead to biased measurement of environment characteristics and misestimation of area effects on health. The objective of this study was to assess the soundness of census tracts as units of analysis for measuring the active living potential of environments, hypothesised to be associated with walking. Results Starting with data at the smallest census area level available, zones homogeneous along three indicators of active living potential, i.e. population density, land use mix, and accessibility to services were designed. Delimitation of zones ensued from statistical clustering of the smallest areas into seven clusters or "types of environment". Mapping of clusters into a GIS led to the delineation of 898 zones characterised by one of seven types of environment, corresponding to different levels of active living potential. Homogeneity of census tracts along indicators of active living potential varied. A greater proportion (83% of variation in accessibility to services was attributable to differences between census tracts suggesting within-tract homogeneity along this variable. However, census tracts were heterogeneous with respect to population density and land use mix where a greater proportion of the variation was attributable to within-tract differences. About 55% of tracts were characterised by a combination of three or more "types of environment" suggesting substantial within-tract heterogeneity in the active living potential of environments. Conclusion Soundness of census tracts for measuring active living potential may be limited

  5. Application unit for the administration of contrast gases for pulmonary magnetic resonance imaging: optimization of ventilation distribution for (3) He-MRI.

    Science.gov (United States)

    Güldner, M; Becker, St; Wolf, U; Düber, C; Friesenecker, A; Gast, K K; Heil, W; Hoffmann, C; Karpuk, S; Otten, E W; Rivoire, J; Salhi, Z; Scholz, A; Schreiber, L M; Terekhov, M

    2015-09-01

    MRI of lung airspaces using gases with MR-active nuclei ((3) He, (129) Xe, and (19) F) is an important area of research in pulmonary imaging. The volume-controlled administration of gas mixtures is important for obtaining quantitative information from MR images. State-of-the-art gas administration using plastic bags (PBs) does not allow for a precise determination of both the volume and timing of a (3) He bolus. A novel application unit (AU) was built according to the requirements of the German medical devices law. Integrated spirometers enable the monitoring of the inhaled gas flow. The device is particularly suited for hyperpolarized (HP) gases (e.g., storage and administration with minimal HP losses). The setup was tested in a clinical trial (n = 10 healthy volunteers) according to the German medicinal products law using static and dynamic ventilation HP-(3) He MRI. The required specifications for the AU were successfully realized. Compared to PB-administration, better reproducibility of gas intrapulmonary distribution was observed when using the AU for both static and dynamic ventilation imaging. The new AU meets the special requirements for HP gases, which are storage and administration with minimal losses. Our data suggest that gas AU-administration is superior to manual modes for determining the key parameters of dynamic ventilation measurements. © 2014 Wiley Periodicals, Inc.

  6. High performance liquid chromatographic separation of thirteen drugs collected in Chinese Pharmacopoeia 2010(Ch.P2010 on cellulose ramification chiral stationary phase

    Directory of Open Access Journals (Sweden)

    Ying Zhou

    2012-02-01

    Full Text Available The enantiomers separation of thirteen drugs collected in Ch.P2010 was performed on chiral stationary phase of cellulose ramification (chiralpak OD and chiralpak OJ by high performance liquid chromatographic (HPLC methods, which included ibuprofen (C1, ketoprofen (C2, nitrendipine (C3, nimodipine (C4, felodipine (C5, omeprazole (C6, praziquantel (C7, propranolol hydrochloride (C8, atenolol (C9, sulpiride (C10, clenbuterol hydrochloride (C11, verapamil hydrochloride (C12, and chlorphenamine maleate (C13. The mobile phase consisted of isopropanol and n-hexane. The detection wavelength was set at 254 nm and the flow rate was 0.7 mL/min. The enantiomers separation of these thirteen racemates on chiralpak OD column and chiralpak OJ column was studied, while the effects of proportion of organic additives, alcohol displacer and temperature on the separation were studied. And the mechanism of some of racemates was discussed. The results indicated that thirteen chiral drugs could be separated on chiral stationary phase of cellulose ramification in normal phase chromatographic system. The chromatographic retention and resolution of enantiomers could be adjusted by factors including column temperature and the concentration of alcohol displacer and organic alkaline modifier in mobile phase. It was shown that the resolution was improved with reducing concentration of alcohol displacer. When concentration of organic alkaline modifier was 0.2% (v/v, the resolution and the peak shape were fairly good. Most racemates mentioned above had better resolution at column temperature of 25 °C. When racemates were separated, the temperature should be kept so as to obtain stable separation results. Keywords: HPLC, Chiral stationary phase, Optical enantiomers, Cellulose ramification

  7. Optimization for Limitation and Condition for operation (LCO) of Rod Drop Accidents in Hanul Nuclear Power Plants Units 1 and 2

    Energy Technology Data Exchange (ETDEWEB)

    Yoon, Duk-Joo; Lee, Seung-Chan; Sung, Je-Joong; Lee, Hye-min; Hong, Sun-Kwan; Ha, Sang-Jun [KHNP CRI, Daejeon (Korea, Republic of)

    2015-10-15

    This paper is to evaluate a reactor safety when the plant is eliminated the manual trip by quadrant power tilt ratio (QPTR) of technical specification value, 1.09 during the dropped rod assembly event for Hanul 1 and 2 units. Dropped rod assembly does not cause reactor trip per the current design methodology by elimination of NFRT but manually trip in 2 hours by technical specification and eventually it reduces the plant power availability. The plant availability can improve and prevent unnecessary plant transient by eliminating the manual reactor trip in 2 hours by QPTR after rod drop. A fuel safety in case that the plant eliminates the manual reactor trip by QPTR can be achieved through the operating data analysis of related event experiences using LCO of the improved technical specification. In order to keep the hot channel factors within limits compatible with the design criteria, reactor operation in the event of quadrant power tilt should be reduced to certain limit of reactor power. The power reduction in the event of quadrant power tilt have been determined under the principle that the limit value of quadrant power tilt ratio increases as reactor power decreases. Time limits for various operational circumstances with a radial power tilt are incorporated in order to prevent the core from a non uniform depletion. The 50% power reduction if the power tilt ratio exceeds 1.02 is a consequence of this methodology. We confirm that fuel damage will be prevented and fuel safety will be assured if the plants reduce reactor power to 50% during dropped rod assembly events.

  8. Frequency and impact of intensive care unit complications on moderate-severe traumatic brain injury: early results of the Outcome Prognostication in Traumatic Brain Injury (OPTIMISM) Study.

    Science.gov (United States)

    Muehlschlegel, Susanne; Carandang, Raphael; Ouillette, Cynthia; Hall, Wiley; Anderson, Fred; Goldberg, Robert

    2013-06-01

    Known predictors of adverse outcomes in patients with moderate-severe TBI (msTBI) explain only a relatively small proportion of patient-related outcomes. The frequency and impact of intensive care unit complications (ICU-COMPL) on msTBI-associated outcomes are poorly understood. In 213 consecutive msTBI patients admitted to a Level I Trauma Center neuro trauma ICU, twenty-eight ICU-COMPL (21 medical and 7 neurological) were prospectively collected and adjudicated by group consensus, using pre-defined criteria. We determined frequencies, and explored associations of ICU-COMPL and hospital discharge outcomes using multivariable logistic regression. The average age of the study sample was 53 years, and the median presenting Glasgow Coma Scale and Injury Severity Scores were 5 and 27, respectively. Hyperglycemia (79%), fever (62%), systemic inflammatory response syndrome (60%), and hypotension requiring vasopressors (42%) were the four most common medical ICU-COMPL. Herniation (39%), intracranial rebleed (39%), and brain edema requiring osmotherapy (37%) were the three most common neurological ICU-COMPL. After adjusting for admission variables, duration of ventilation, and ICU length-of-stay, patients with brain edema (OR 5.8; 95% CI 2, 16.7) had a significantly increased odds for dying during hospitalization whereas patients with hospital-acquired urinary tract infection (UTI) had a decreased odds (OR 0.05; 95% CI 0.005, 0.6). Sensitivity analysis revealed that UTI occurred later, suggesting a non-causal association with survival. Brain herniation (OR 15.7; 95% CI 2.6, 95.4) was associated with an unfavorable functional status (GOS 1-3). ICU-COMPL are very common after msTBI, have a considerable impact on short-term outcomes, and should be considered in the prognostication of these high risk patients. Survival associations of time-dependent complications warrant cautious interpretation.

  9. A novel quasi-oppositional harmony search algorithm for AGC optimization of three-area multi-unit power system after deregulation

    Directory of Open Access Journals (Sweden)

    Chandan Kumar Shiva

    2016-03-01

    Full Text Available The present work addresses a decentralized, well tested three-area multi-unit power system for its automatic generation control (AGC after deregulation which is characterized by price-based market operation. To match with the actual deregulated environment, as prevailing in the real one, the market structure is kept generic enough enabling to capture all possibilities occurring in real-time day-to-day power environment. In accordance to the modifications, as done in the investigated three-area power system model, the concerned objective is to intensify the deregulated AGC operation followed by load disturbances. At the present platform, three different classes of case study results are postulated for the studied test system. The first two illustrate the behavior of unilateral and bilateral based power contract transactions while the third one considers the contract violation case as it exists in present time. The contractual agreement, instituted by DISCO participation matrix, is initialized to address the power transaction contracts. In this work, a novel quasi-oppositional harmony search (QOHS algorithm is explored and presented its significances in deregulated AGC operation. In the second phase of investigation, fast acting Sugeno fuzzy logic technique is explored for on-line, off-nominal operating conditions. For analysis purpose, both the qualitative and the quantitative aspects of the proposed QOHS are presented in reference to genetic algorithm (GA. Additionally, the sensitivity analysis is also performed to evaluate the performance of the proposed QOHS based controller. Simulation work reveals that the proposed QOHS may be, effectively, worked out to order to improve the deregulated AGC performance. It is also being observed that the proposed QOHS outperforms the GA in sense of deregulated AGC operation of power system.

  10. FIELD TEST INSTRUCTION 100-NR-2 OPERABLE UNIT DESIGN OPTIMIZATION STUDY FOR SEQUESTRATION OF SR-90 SATURATED ZONE APATITE PERMEABLE REACTIVE BARRIER EXTENSION

    Energy Technology Data Exchange (ETDEWEB)

    BOWLES NA

    2010-10-06

    The objective of this field test instruction is to provide technical guidance for aqueous injection emplacement of an extension apatite permeable reactive barrier (PRE) for the sequestration of strontium-90 (Sr-90) using a high concentration amendment formulation. These field activities will be conducted according to the guidelines established in DOE/RL-2010-29, 100-NR-2 Design Optimization Study, hereafter referred to as the DOS. The DOS supports the Federal Facility Agreement Consent Order (EPA et al., 1989), Milestone M-16-06-01, and 'Complete Construction of a Permeable Reactive Barrier at 100-N.' Injections of apatite precursor chemicals will occur at an equal distance intervals on each end of the existing PRE to extend the PRB from the existing 91 m (300 ft) to at least 274 m (900 ft). Field testing at the 100-N Area Apatite Treatability Test Site, as depicted on Figure 1, shows that the barrier is categorized by two general hydrologic conceptual models based on overall well capacity and contrast between the Hanford and Ringold hydraulic conductivities. The upstream portion of the original barrier, shown on Figure 1, is characterized by relatively low overall well specific capacity. This is estimated from well development data and a lower contrast in hydraulic conductivity between the Hanford formation and Ringold Formations. Comparison of test results from these two locations indicate that permeability contrast between the Hanford formation and Ringold Formation is significantly less over the upstream one-third of the barrier. The estimated hydraulic conductivity for the Hanford formation and Ringold Formation over the upstream portion of the barrier based on observations during emplacement of the existing 91 m (300 ft) PRB is approximately 12 and 10 m/day (39 and 32 ft/day), respectively (PNNL-17429). However, these estimates should be used as a rough guideline only, as significant variability in hydraulic conductivity is likely to be observed in

  11. Optimal Energy Management of Combined Cooling, Heat and Power in Different Demand Type Buildings Considering Seasonal Demand Variations

    Directory of Open Access Journals (Sweden)

    Akhtar Hussain

    2017-06-01

    Full Text Available In this paper, an optimal energy management strategy for a cooperative multi-microgrid system with combined cooling, heat and power (CCHP is proposed and has been verified for a test case of building microgrids (BMGs. Three different demand types of buildings are considered and the BMGs are assumed to be equipped with their own combined heat and power (CHP generators. In addition, the BMGs are also connected to an external energy network (EEN, which contains a large CHP, an adsorption chiller (ADC, a thermal storage tank, and an electric heat pump (EHP. By trading the excess electricity and heat energy with the utility grid and EEN, each BMG can fulfill its energy demands. Seasonal energy demand variations have been evaluated by selecting a representative day for the two extreme seasons (summer and winter of the year, among the real profiles of year-round data on electricity, heating, and cooling usage of all the three selected buildings. Especially, the thermal energy management aspect is emphasized where, bi-lateral heat trading between the energy supplier and the consumers, so-called energy prosumer concept, has been realized. An optimization model based on mixed integer linear programming has been developed for minimizing the daily operation cost of the EEN while fulfilling the energy demands of the BMGs. Simulation results have demonstrated the effectiveness of the proposed strategy.

  12. Adaptive Bacterial Foraging Optimization

    Directory of Open Access Journals (Sweden)

    Hanning Chen

    2011-01-01

    Full Text Available Bacterial Foraging Optimization (BFO is a recently developed nature-inspired optimization algorithm, which is based on the foraging behavior of E. coli bacteria. Up to now, BFO has been applied successfully to some engineering problems due to its simplicity and ease of implementation. However, BFO possesses a poor convergence behavior over complex optimization problems as compared to other nature-inspired optimization techniques. This paper first analyzes how the run-length unit parameter of BFO controls the exploration of the whole search space and the exploitation of the promising areas. Then it presents a variation on the original BFO, called the adaptive bacterial foraging optimization (ABFO, employing the adaptive foraging strategies to improve the performance of the original BFO. This improvement is achieved by enabling the bacterial foraging algorithm to adjust the run-length unit parameter dynamically during algorithm execution in order to balance the exploration/exploitation tradeoff. The experiments compare the performance of two versions of ABFO with the original BFO, the standard particle swarm optimization (PSO and a real-coded genetic algorithm (GA on four widely-used benchmark functions. The proposed ABFO shows a marked improvement in performance over the original BFO and appears to be comparable with the PSO and GA.

  13. Three novel NY-ESO-1 epitopes bound to DRB1*0803, DQB1*0401 and DRB1*0901 recognized by CD4 T cells from CHP-NY-ESO-1-vaccinated patients.

    Science.gov (United States)

    Mizote, Yu; Taniguchi, Taku; Tanaka, Kei; Isobe, Midori; Wada, Hisashi; Saika, Takashi; Kita, Shoichi; Koide, Yukari; Uenaka, Akiko; Nakayama, Eiichi

    2010-07-19

    Three novel NY-ESO-1 CD4 T cell epitopes were identified using PBMC obtained from patients who were vaccinated with a complex of cholesterol-bearing hydrophobized pullulan (CHP) and NY-ESO-1 protein (CHP-NY-ESO-1). The restriction molecules were determined by antibody blocking and using various EBV-B cells with different HLA alleles as APC to present peptides to CD4 T cells. The minimal epitope peptides were determined using various N- and C-termini truncated peptides deduced from 18-mer overlapping peptides originally identified for recognition. Those epitopes were DRB1*0901-restricted NY-ESO-1 87-100, DQB1*0401-restricted NY-ESO-1 95-107 and DRB1*0803-restricted NY-ESO-1 124-134. CD4 T cells used to determine those epitope peptides recognized EBV-B cells or DC that were treated with recombinant NY-ESO-1 protein or NY-ESO-1-expressing tumor cell lysate, suggesting that the epitope peptides are naturally processed. These CD4 T cells showed a cytokine profile with Th1 characteristics. Furthermore, NY-ESO-1 87-100 peptide/HLA-DRB1*0901 tetramer staining was observed. Multiple Th1-type CD4 T cell responses are beneficial for inducing effective anti-tumor responses after NY-ESO-1 protein vaccination. (c) 2010 Elsevier Ltd. All rights reserved.

  14. Design of an Optimal Biorefinery

    DEFF Research Database (Denmark)

    Nawaz, Muhammad; Zondervan, Edwin; Woodley, John

    2011-01-01

    In this paper we propose a biorefinery optimization model that can be used to find the optimal processing route for the production of ethanol, butanol, succinic acid and blends of these chemicals with fossil fuel based gasoline. The approach unites transshipment models with a superstructure...

  15. Design of an Optimal Biorefinery

    DEFF Research Database (Denmark)

    Nawaz, Muhammad; Zondervan, Edwin; Woodley, John

    In this paper we propose a biorefinery optimization model that can be used to find the optimal processing route for the production of ethanol, butanol, succinic acid and blends of these chemicals with fossil fuel based gasoline. The approach unites transshipment models with a superstructure...

  16. Technical feasibility study of Voltage Optimization Unit

    DEFF Research Database (Denmark)

    Hu, Junjie; Marinelli, Mattia; Coppo, Massimiliano

    is performed using the soft-wares DigSilent PowerFactory and Matlab. In this simulation study, a real low voltage network from Dong Eldistribution is modeled in Powerfactory. The measured data of the real low voltage network is analyzed and the resulting loading profiles including active and reactive power...... are used as load basics for the analysis. In term of PV genera-tion profiles, a realistic PV output power is assumed. Four relevant indicies such as phase neutral voltage, netural potential voltage, unbalanced factor (VUF), and power losses are evaluated in the present study. The simulation tests include...

  17. Website Optimization

    CERN Document Server

    King, Andrew

    2008-01-01

    Remember when an optimized website was one that merely didn't take all day to appear? Times have changed. Today, website optimization can spell the difference between enterprise success and failure, and it takes a lot more know-how to achieve success. This book is a comprehensive guide to the tips, techniques, secrets, standards, and methods of website optimization. From increasing site traffic to maximizing leads, from revving up responsiveness to increasing navigability, from prospect retention to closing more sales, the world of 21st century website optimization is explored, exemplified a

  18. Biomass combustion gas turbine CHP

    Energy Technology Data Exchange (ETDEWEB)

    Pritchard, D.

    2002-07-01

    This report summarises the results of a project to develop a small scale biomass combustor generating system using a biomass combustor and a micro-gas turbine indirectly fired via a high temperature heat exchanger. Details are given of the specification of commercially available micro-turbines, the manufacture of a biomass converter, the development of a mathematical model to predict the compatibility of the combustor and the heat exchanger with various compressors and turbines, and the utilisation of waste heat for the turbine exhaust.

  19. Modeling and off-design performance of a 1 kWe HT-PEMFC (high temperature-proton exchange membrane fuel cell)-based residential micro-CHP (combined-heat-and-power) system for Danish single-family households

    DEFF Research Database (Denmark)

    Arsalis, Alexandros; Nielsen, Mads Pagh; Kær, Søren Knudsen

    2011-01-01

    A novel proposal for the modeling and operation of a micro-CHP (combined-heat-and-power) residential system based on HT-PEMFC (High Temperature-Proton Exchange Membrane Fuel Cell) technology is described and analyzed to investigate its commercialization prospects. An HT-PEMFC operates at elevated...

  20. Projected configuration of a coal-fired district heating source on the basis of comparative technical-economical optimization analysis

    Science.gov (United States)

    Tańczuk, Mariusz; Radziewicz, Wojciech; Olszewski, Eligiusz; Skorek, Janusz

    2017-10-01

    District heating technologies should be efficient, effective and environmentally friendly. The majority of the communal heating systems in Poland produce district hot water in coal-fired boilers. A large number of them are considerably worn out, low-efficient in the summer time and will not comply with forthcoming regulations. One of the possible solution for such plants is repowering with new CHP systems or new boilers fuelled with fuels alternative to coal. Optimisation analysis of the target configuration of municipal heat generating plant is analysed in the paper. The work concerns repowering the existing conventional heat generating plant according to eight different scenarios of the plant configuration meeting technical and environmental requirements forecasted for the year of 2035. The maximum demand for heat of the system supplied by the plant is 185 MW. Taking into account different technical configurations on one side, and different energy and fuel prices on the other side, the comparative cost-benefits analysis of the assumed scenarios has been made. The basic economical index NPV (net present value) has been derived for each analysed scenario and the results have been compared and discussed. It was also claimed that the scenario with CHP based on ICE engines is optimal.

  1. Projected configuration of a coal-fired district heating source on the basis of comparative technical-economical optimization analysis

    Directory of Open Access Journals (Sweden)

    Tańczuk Mariusz

    2017-01-01

    Full Text Available District heating technologies should be efficient, effective and environmentally friendly. The majority of the communal heating systems in Poland produce district hot water in coal-fired boilers. A large number of them are considerably worn out, low-efficient in the summer time and will not comply with forthcoming regulations. One of the possible solution for such plants is repowering with new CHP systems or new boilers fuelled with fuels alternative to coal. Optimisation analysis of the target configuration of municipal heat generating plant is analysed in the paper. The work concerns repowering the existing conventional heat generating plant according to eight different scenarios of the plant configuration meeting technical and environmental requirements forecasted for the year of 2035. The maximum demand for heat of the system supplied by the plant is 185 MW. Taking into account different technical configurations on one side, and different energy and fuel prices on the other side, the comparative cost-benefits analysis of the assumed scenarios has been made. The basic economical index NPV (net present value has been derived for each analysed scenario and the results have been compared and discussed. It was also claimed that the scenario with CHP based on ICE engines is optimal.

  2. Optimal PMU Placement By Improved Particle Swarm Optimization

    DEFF Research Database (Denmark)

    Rather, Zakir Hussain; Liu, Leo; Chen, Zhe

    2013-01-01

    This paper presents an improved method of binary particle swarm optimization (IBPSO) technique for optimal phasor measurement unit (PMU) placement in a power network for complete system observability. Various effective improvements have been proposed to enhance the efficiency and convergence rate...... of conventional particle swarm optimization method. The proposed method of IBPSO ensures optimal PMU placement with and without consideration of zero injection measurements. The proposed method has been applied to standard test systems like 17 bus, IEEE 24-bus, IEEE 30-bus, New England 39-bus, IEEE 57-bus system...

  3. Optimality Conditions in Vector Optimization

    CERN Document Server

    Jiménez, Manuel Arana; Lizana, Antonio Rufián

    2011-01-01

    Vector optimization is continuously needed in several science fields, particularly in economy, business, engineering, physics and mathematics. The evolution of these fields depends, in part, on the improvements in vector optimization in mathematical programming. The aim of this Ebook is to present the latest developments in vector optimization. The contributions have been written by some of the most eminent researchers in this field of mathematical programming. The Ebook is considered essential for researchers and students in this field.

  4. Energy and Exergy Analysis and Optimization of Combined Heat and Power Systems. Comparison of Various Systems

    Directory of Open Access Journals (Sweden)

    Monica Costea

    2012-09-01

    Full Text Available The paper presents a comparison of various CHP system configurations, such as Vapour Turbine, Gas Turbine, Internal Combustion Engine, External Combustion Engine (Stirling, Ericsson, when different thermodynamic criteria are considered, namely the first law efficiency and exergy efficiency. Thermodynamic optimization of these systems is performed intending to maximize the exergy, when various practical related constraints (imposed mechanical useful energy, imposed heat demand, imposed heat to power ratio or main physical limitations (limited heat availability, maximum system temperature allowed, thermo-mechanical constraints are taken into account. A sensitivity analysis to model parameters is given. The results have shown that the various added constraints were useful for the design allowing to precise the influence of the model main parameters on the system design. Future perspective of the work and recommendations are stated.

  5. Structural optimization

    CERN Document Server

    MacBain, Keith M

    2009-01-01

    Intends to supplement the engineer's box of analysis and design tools making optimization as commonplace as the finite element method in the engineering workplace. This title introduces structural optimization and the methods of nonlinear programming such as Lagrange multipliers, Kuhn-Tucker conditions, and calculus of variations.

  6. Optimal Flow.

    Science.gov (United States)

    Norman, Donald A.

    1996-01-01

    Discusses the educational applications of experimental psychologist Mihaly Csikszentmihalyi's theory of peak experience, or optimal flow. Optimal flow refers to the receptive state people achieve when they are engaged in interesting and challenging activity. Includes an insightful critique of multimedia instruction from this perspective. (MJP)

  7. Use of methanation for optimization of a hybrid plant combining two-stage biomass gasification, SOFCs and a micro gas turbine

    Energy Technology Data Exchange (ETDEWEB)

    Bang-Moeller, C.; Rokni, M.; Elmegaard, B.

    2011-05-15

    A hybrid plant producing combined heat and power (CHP) from biomass by use of the two-stage gasification concept, solid oxide fuel cells (SOFCs) and a micro gas turbine (MGT) was considered for optimization. The hybrid plant is a sustainable and efficient alternative to conventional decentralized CHP plants. The demonstrated two-stage gasifier produces a clean product gas, thus ensuring the need for only simple gas conditioning prior to the SOFCs. Focus in this optimization study was on SOFC cooling and the investigation was conducted by system-level modelling combining zero-dimensional component models in the simulation tool DNA. By introducing an adiabatic methanation reactor prior to the SOFCs, the excess air flow for SOFC cooling could be reduced due to additional endothermic reforming reactions internally in the SOFCs, thus lowering the air compressor work. Installing an adiabatic methanator reduced the mass flow of cathode air by 27% and increased the turbine inlet temperature by 17% resulting in an electrical efficiency gain from 48.6 to 50.4% based on lower heating value (LHV). Furthermore, the size of several components could be reduced due to the lower air flow. The study also showed that combining alternative product gas preheating and adiabatic methanation made the traditional anode in/out heat exchanger redundant and an electrical efficiency of 52.5% (LHV) was achieved. (Author)

  8. Directional Convexity and Finite Optimality Conditions.

    Science.gov (United States)

    1984-03-01

    system, Necessary Conditions for optimality. Work Unit Number 5 (Optimization and Large Scale Systems) *Istituto di Matematica Applicata, Universita...that R(T) is convex would then imply x(u,T) e int R(T). Cletituto di Matematica Applicata, Universita di Padova, 35100 ITALY. Sponsored by the United

  9. Stochastic Optimization of Complex Systems

    Energy Technology Data Exchange (ETDEWEB)

    Birge, John R. [University of Chicago

    2014-03-20

    This project focused on methodologies for the solution of stochastic optimization problems based on relaxation and penalty methods, Monte Carlo simulation, parallel processing, and inverse optimization. The main results of the project were the development of a convergent method for the solution of models that include expectation constraints as in equilibrium models, improvement of Monte Carlo convergence through the use of a new method of sample batch optimization, the development of new parallel processing methods for stochastic unit commitment models, and the development of improved methods in combination with parallel processing for incorporating automatic differentiation methods into optimization.

  10. A case study of aerosol data assimilation with the Community Multi-scale Air Quality Model over the contiguous United States using 3D-Var and optimal interpolation methods

    Science.gov (United States)

    Tang, Youhua; Pagowski, Mariusz; Chai, Tianfeng; Pan, Li; Lee, Pius; Baker, Barry; Kumar, Rajesh; Delle Monache, Luca; Tong, Daniel; Kim, Hyun-Cheol

    2017-12-01

    This study applies the Gridpoint Statistical Interpolation (GSI) 3D-Var assimilation tool originally developed by the National Centers for Environmental Prediction (NCEP), to improve surface PM2.5 predictions over the contiguous United States (CONUS) by assimilating aerosol optical depth (AOD) and surface PM2.5 in version 5.1 of the Community Multi-scale Air Quality (CMAQ) modeling system. An optimal interpolation (OI) method implemented earlier (Tang et al., 2015) for the CMAQ modeling system is also tested for the same period (July 2011) over the same CONUS. Both GSI and OI methods assimilate surface PM2.5 observations at 00:00, 06:00, 12:00 and 18:00 UTC, and MODIS AOD at 18:00 UTC. The assimilations of observations using both GSI and OI generally help reduce the prediction biases and improve correlation between model predictions and observations. In the GSI experiments, assimilation of surface PM2.5 (particle matter with diameter assimilation at the 550 nm wavelength. In contrast, we find a stronger OI impact of the MODIS AOD on surface aerosols at 18:00 UTC compared to the surface PM2.5 OI method. GSI produces smoother result and yields overall better correlation coefficient and root mean squared error (RMSE). It should be noted that the 3D-Var and OI methods used here have several big differences besides the data assimilation schemes. For instance, the OI uses relatively big model uncertainties, which helps yield smaller mean biases, but sometimes causes the RMSE to increase. We also examine and discuss the sensitivity of the assimilation experiments' results to the AOD forward operators.

  11. Chasing the peak: optimal statistics for weak shear analyses

    Science.gov (United States)

    Smit, Merijn; Kuijken, Konrad

    2018-01-01

    Context. Weak gravitational lensing analyses are fundamentally limited by the intrinsic distribution of galaxy shapes. It is well known that this distribution of galaxy ellipticity is non-Gaussian, and the traditional estimation methods, explicitly or implicitly assuming Gaussianity, are not necessarily optimal. Aims: We aim to explore alternative statistics for samples of ellipticity measurements. An optimal estimator needs to be asymptotically unbiased, efficient, and robust in retaining these properties for various possible sample distributions. We take the non-linear mapping of gravitational shear and the effect of noise into account. We then discuss how the distribution of individual galaxy shapes in the observed field of view can be modeled by fitting Fourier modes to the shear pattern directly. This allows scientific analyses using statistical information of the whole field of view, instead of locally sparse and poorly constrained estimates. Methods: We simulated samples of galaxy ellipticities, using both theoretical distributions and data for ellipticities and noise. We determined the possible bias Δe, the efficiency η and the robustness of the least absolute deviations, the biweight, and the convex hull peeling (CHP) estimators, compared to the canonical weighted mean. Using these statistics for regression, we have shown the applicability of direct Fourier mode fitting. Results: We find an improved performance of all estimators, when iteratively reducing the residuals after de-shearing the ellipticity samples by the estimated shear, which removes the asymmetry in the ellipticity distributions. We show that these estimators are then unbiased in the absence of noise, and decrease noise bias by more than 30%. Our results show that the CHP estimator distribution is skewed, but still centered around the underlying shear, and its bias least affected by noise. We find the least absolute deviations estimator to be the most efficient estimator in almost all

  12. Contribution to a Danish action plan for development and demonstration of CHP from solid biomass; Oplaeg til en national handlingsplan for udvikling og demonstration indenfor kraftvarme fra fast biomasse

    Energy Technology Data Exchange (ETDEWEB)

    Hansen, Morten Tony

    2011-01-15

    The report is the contribution from the industry to an action plan for development and demonstration of CHP technology for solid biomass. The report aims to serve as inspiration and basis for administrators and applicants of Danish funding schemes for development and demonstration in future tenders. Although Danish-based cogeneration technologies for solid biofuels are advanced compared to the competitors in many areas there is a large need to continuously improve the technology by sustained development and demonstration activities. The aim is to overcome the technological barriers that this project has identified and thus maintain competitiveness. The industry currently has very strong focus on market deployment of especially technologies for cogeneration in small scale (up to 15 MW thermal power) and on the overall economy of these plants. Reference installations that displays many operational hours with a reasonable economy, are crucial for investors. Currently, no companies market commercial plants that have sufficiently low costs to operate under Danish conditions and few do for the conditions found internationally. Thus, from the industry perspective there is still a need for development and demonstration of CHP technology below 15 MW thermal. The analysis does not exclude any technology tracks, but the development and demonstration efforts should lead to improvements in conditions such as availability, efficiencies and operating and maintenance costs. Also technologies for large plants and systems need to be improved with respect to availability and efficiency and reduced operating and maintenance costs. For all technologies, there is a need to develop the use of special solid biofuels that on the one hand may have troublesome characteristics but on the other may help lower operating costs. The Danish-based companies have good opportunities to find support for the development and demonstration effort. A number of support programs and pools are in place and

  13. Portfolio Optimization

    OpenAIRE

    Frajtova-Michalikova, Katarina; Spuchľakova, Erika; Misankova, Maria

    2015-01-01

    In this paper Portfolio Optimization techniques were used to determine the most favorable investment portfolio. In particular, stock indices of three companies, namely Microsoft Corporation, Christian Dior Fashion House and Shevron Corporation were evaluated. Using this data the amounts invested in each asset when a portfolio is chosen on the efficient frontier were calculated. In addition, the Portfolio with minimum variance, tangency portfolio and optimal Markowitz portfolio are presented.

  14. Optimal Electric and Heat Energy Management of Multi-Microgrids with Sequentially-Coordinated Operations

    Directory of Open Access Journals (Sweden)

    Nah-Oak Song

    2016-06-01

    Full Text Available We propose an optimal electric and heat energy management for a cooperative multi-microgrid community. The sequentially-coordinated operation for heat energy is proposed in order to distribute the computational burden as an extension of “Optimal Energy Management of Multi-Microgrids with Sequentially Coordinated Operations” and is following the sequentially-coordinated operations for electric energy in it. This sequentially-coordinated operation for heat energy is mathematically modeled and how to obtain the global heat energy optimization solution in the cooperative multi-microgrid community is presented. The global heat energy optimization is achieved for the cooperative community by adjusting the combined electric and heat energy production amounts of combined heat and power (CHP generators and the heat energy production amount of heat only boilers (HOBs which satisfy all heat loads, as well as optimize the external electric energy trading in order to minimize the unnecessary cost from the external electric trading, and/or maximize the profit from the external electric trading. To validate the proposed mathematical energy management models, a simulation study is also conducted.

  15. Optimal GENCO bidding strategy

    Science.gov (United States)

    Gao, Feng

    Electricity industries worldwide are undergoing a period of profound upheaval. The conventional vertically integrated mechanism is being replaced by a competitive market environment. Generation companies have incentives to apply novel technologies to lower production costs, for example: Combined Cycle units. Economic dispatch with Combined Cycle units becomes a non-convex optimization problem, which is difficult if not impossible to solve by conventional methods. Several techniques are proposed here: Mixed Integer Linear Programming, a hybrid method, as well as Evolutionary Algorithms. Evolutionary Algorithms share a common mechanism, stochastic searching per generation. The stochastic property makes evolutionary algorithms robust and adaptive enough to solve a non-convex optimization problem. This research implements GA, EP, and PS algorithms for economic dispatch with Combined Cycle units, and makes a comparison with classical Mixed Integer Linear Programming. The electricity market equilibrium model not only helps Independent System Operator/Regulator analyze market performance and market power, but also provides Market Participants the ability to build optimal bidding strategies based on Microeconomics analysis. Supply Function Equilibrium (SFE) is attractive compared to traditional models. This research identifies a proper SFE model, which can be applied to a multiple period situation. The equilibrium condition using discrete time optimal control is then developed for fuel resource constraints. Finally, the research discusses the issues of multiple equilibria and mixed strategies, which are caused by the transmission network. Additionally, an advantage of the proposed model for merchant transmission planning is discussed. A market simulator is a valuable training and evaluation tool to assist sellers, buyers, and regulators to understand market performance and make better decisions. A traditional optimization model may not be enough to consider the distributed

  16. Automated beam model optimization.

    Science.gov (United States)

    Létourneau, Daniel; Sharpe, Michael B; Owrangi, Amir; Jaffray, David A

    2010-05-01

    The beam model in a three dimensional treatment planning system (TPS) defines virtually the mechanical and dosimetric characteristics of a treatment unit. The manual optimization of a beam model during commissioning can be a time consuming task due to its iterative nature. Furthermore, the quality of the beam model commissioning depends on the user's ability to manage multiple parameters and assess their impact on the agreement between measured and calculated dose. The objective of this work is to develop and validate the performance of an automated beam model optimization system (ABMOS) based on intensity modulated radiotherapy (IMRT) beam measurements to improve beam model accuracy while streamlining the commissioning process. The ABMOS was developed to adjust selected TPS beam model parameters iteratively to maximize the agreement between measured and calculated 2D dose maps obtained for an IMRT beam pattern. A 2D diode array with high spatial resolution detectors was used to sample the entire IMRT beam pattern in a single dose measurement. The use of an IMRT beam pattern with large number of monitor units was selected to highlight the difference between planned and delivered dose and improve the signal to noise ratio in the low dose regions. ABMOS was applied to the optimization of a beam model for an Elekta Synergy S treatment unit. The optimized beam model was validated for two anatomical sites (25 paraspinal and 25 prostate cases) using two independent patient-specific IMRT quality control (QC) methods based on ion chamber and 2D diode array measurements, respectively. The conventional approach of comparing calculated and measured beam profiles and percent-depth dose curves was also used to assess improvement in beam model after ABMOS optimization. Elements of statistical process control were applied to the process of patient-specific QC performed with the ion chamber and the 2D array to complement the model comparison. After beam model optimization with

  17. Methodologies Used for Scaling-up From a Single Energy Production Unit to State Energy Sector

    Science.gov (United States)

    Cimdina, Ginta; Timma, Lelde; Veidenbergs, Ivars; Blumberga, Dagnija

    2015-12-01

    In a well-functioning and sustainable national energy sector, each of its elements should function with maximum efficiency. To ensure maximum efficiency and study possible improvement of the sector, a scaling-up framework is presented in this work. The scaling-up framework means that the starting point is a CHP unit and its operation, the next step of aggregation is in a district heating network, followed by a municipal energy plan and finally leading to a low carbon strategy. In this framework the authors argue, that the successful, innovative practices developed and tested at the lower level of aggregation can be then transferred to the upper levels of aggregation, thus leading to a scaling-up effect of innovative practices. The work summarizes 12 methodologies used in the energy sector, by dividing these methodologies among the levels of aggregation in a scaling-up framework.

  18. Topology optimization

    DEFF Research Database (Denmark)

    Bendsøe, Martin P.; Sigmund, Ole

    2007-01-01

    Taking as a starting point a design case for a compliant mechanism (a force inverter), the fundamental elements of topology optimization are described. The basis for the developments is a FEM format for this design problem and emphasis is given to the parameterization of design as a raster image...

  19. Optimal transport

    CERN Document Server

    Eckmann, B

    2008-01-01

    At the close of the 1980s, the independent contributions of Yann Brenier, Mike Cullen and John Mather launched a revolution in the venerable field of optimal transport founded by G Monge in the 18th century, which has made breathtaking forays into various other domains of mathematics ever since. The author presents a broad overview of this area.

  20. On optimization of power production

    Energy Technology Data Exchange (ETDEWEB)

    Feltenmark, S.

    1997-01-01

    Short-term optimization of power production is treated. It concerns the problem of determining a production schedule for a power system, which minimizes the total cost of production, while satisfying various constraints. The thesis consists of an introductory chapter, four chapters that each concerns a specific problem area (economic dispatch, unit commitment, hydro power planning and cogeneration optimization), plus a chapter with relevant theory. The emphasis of the thesis is on the mathematical structures that arise in problems in this field, and how to exploit them algorithmically. A recurring theme is convexification, either implicit, by dualization, or explicit, as in our approach to hydro power optimization. 134 refs

  1. JOINT ECONOMIC AND ENVIRONMENTAL OPTIMIZATION OF HYBRID POWER SUPPLY FOR LARGE SCALE RO-DESALINATION PLANT: WITH AND WITHOUT CO2 SEQUESTRATION

    Directory of Open Access Journals (Sweden)

    EMAN A. TORA

    2016-07-01

    Full Text Available In this paper, a multi- objective optimization approach is introduced to define a hybrid power supply system for a large scale RO- desalination plant. The target is to integrate a number of locally available energy resources to generate the electricity demand of the RO- desalination plant with minimizing both the electricity generation cost and the greenhouse gas emissions whereby carbon dioxide sequestration may be an option. The considered energy resources and technologies are wind turbines, solar PV, combined cycles with natural gas turbines, combined cycles with coal gasification, pulverized coal with flue gas desulfurization, and biomass combined heat and power CHP. These variable energy resources are investigated under different constraints on the renewable energy contribution. Likewise, the effect of carbon dioxide sequestration is included. Accordingly, five scenarios have been analyzed. Trade- offs between the minimum electricity generation cost and the minimum greenhouse gas emissions have been determined and represented in Pareto curves using the constraint method (. The results highlight that among the studied fossil fuel technologies, the integrated combined cycle natural gas turbines can provide considerable fraction of the needed power supply. Likewise, wind turbines are the most effective technology among renewable energy options. When CO2 sequestration applied, the costs increase and significant changes in the optimum combination of renewable energy resources have been monitored. In that case, solar PV starts to appreciably compete. The optimum mix of energy resources extends to include biomass CHP as well.

  2. Optimization of fermentation conditions for red pigment production ...

    African Journals Online (AJOL)

    An extracellular pigment-producing ascomycetous filamentous fungi belonging to the genera Penicillium was obtained from soil and its optimal culture conditions investigated. The optimal culture conditions for pigment production were as follows; soluble starch 2% (670 units), peptone (880 units), pH 9.0 (900 units); ...

  3. Optimization of power system operation

    CERN Document Server

    Zhu, Jizhong

    2015-01-01

    This book applies the latest applications of new technologies topower system operation and analysis, including new and importantareas that are not covered in the previous edition. Optimization of Power System Operation covers both traditional andmodern technologies, including power flow analysis, steady-statesecurity region analysis, security constrained economic dispatch,multi-area system economic dispatch, unit commitment, optimal powerflow, smart grid operation, optimal load shed, optimalreconfiguration of distribution network, power system uncertaintyanalysis, power system sensitivity analysis, analytic hierarchicalprocess, neural network, fuzzy theory, genetic algorithm,evolutionary programming, and particle swarm optimization, amongothers. New topics such as the wheeling model, multi-areawheeling, the total transfer capability computation in multipleareas, are also addressed. The new edition of this book continues to provide engineers andac demics with a complete picture of the optimization of techn...

  4. Design process and instrumentation of a low NOx wire-mesh duct burner for micro-cogeneration unit

    Energy Technology Data Exchange (ETDEWEB)

    Ramadan, O.B.; Gauthier, J.E.D. [Carleton Univ., Ottawa, ON (Canada). Dept. of Mechanical and Aerospace Engineering; Hughes, P.M.; Brandon, R. [Natural Resources Canada, Ottawa, ON (Canada). CANMET Energy Technology Centre

    2007-07-01

    Air pollution and global climate change have become a serious environmental problem leading to increasingly stringent government regulations worldwide. New designs and methods for improving combustion systems to minimize the production of toxic emissions, like nitrogen oxides (NOx) are therefore needed. In order to control smog, acid rain, ozone depletion, and greenhouse-effect warming, a reduction of nitrogen oxide is necessary. One alternative for combined electrical power and heat generation (CHP) are micro-cogeneration units which use a micro-turbine as a prime mover. However, to increase the efficiencies of these units, micro-cogeneration technology still needs to be developed further. This paper described the design process, building, and testing of a new low NOx wire-mesh duct burner (WMDB) for the development of a more efficient micro-cogeneration unit. The primary goal of the study was to develop a practical and simple WMDB, which produces low emissions by using lean-premixed surface combustion concept and its objectives were separated into four phases which were described in this paper. Phase I involved the design and construction of the burner. Phase II involved a qualitative flow visualization study for the duct burner premixer to assist the new design of the burner by introducing an efficient premixer that could be used in this new application. Phase III of this research program involved non-reacting flow modeling on the burner premixer flow field using a commercial computational fluid dynamic model. In phase IV, the reacting flow experimental investigation was performed. It was concluded that the burner successfully increased the quantity and the quality of the heat released from the micro-CHP unit and carbon monoxide emissions of less than 9 ppm were reached. 3 refs., 3 figs.

  5. Optimal control

    CERN Document Server

    Aschepkov, Leonid T; Kim, Taekyun; Agarwal, Ravi P

    2016-01-01

    This book is based on lectures from a one-year course at the Far Eastern Federal University (Vladivostok, Russia) as well as on workshops on optimal control offered to students at various mathematical departments at the university level. The main themes of the theory of linear and nonlinear systems are considered, including the basic problem of establishing the necessary and sufficient conditions of optimal processes. In the first part of the course, the theory of linear control systems is constructed on the basis of the separation theorem and the concept of a reachability set. The authors prove the closure of a reachability set in the class of piecewise continuous controls, and the problems of controllability, observability, identification, performance and terminal control are also considered. The second part of the course is devoted to nonlinear control systems. Using the method of variations and the Lagrange multipliers rule of nonlinear problems, the authors prove the Pontryagin maximum principle for prob...

  6. Optimization Problems

    Directory of Open Access Journals (Sweden)

    Yaping Hu

    2015-01-01

    the nonsmooth convex optimization problem. First, by using Moreau-Yosida regularization, we convert the original objective function to a continuously differentiable function; then we use approximate function and gradient values of the Moreau-Yosida regularization to substitute the corresponding exact values in the algorithm. The global convergence is proved under suitable assumptions. Numerical experiments are presented to show the effectiveness of this algorithm.

  7. Numerical Optimization

    Science.gov (United States)

    1992-12-01

    optimization (as opposed to the so-called "pivotal" methods, such as the simplex method for linear pro- gramming), with special consideration for the...to be of the same order of one step of Karmarkar’s algorithm. While one step of the classical simplex algorithm [13] for linear pro- gramming is much...memoria d; Carlo Cartaneo, maestro ed amkco RIASSUNTO - Si considera un nuovo metodo per la risoluzione numeraca eta di sistern. di eqiuazioni non lineari

  8. Optimal Diversification

    OpenAIRE

    Gomes, Joao F; Livdan, Dmitry

    2002-01-01

    In this Paper we show that the main empirical findings about firm diversification and performance are actually consistent with the optimal behavior of a firm that maximizes shareholder value. In our model, diversification allows a firm to explore better productive opportunities while taking advantage of economies of scale. The dynamic structure of our model allows us to examine several aspects of the relationship between firm diversification and performance in a very general setting.

  9. Conference on Large Scale Optimization

    CERN Document Server

    Hearn, D; Pardalos, P

    1994-01-01

    On February 15-17, 1993, a conference on Large Scale Optimization, hosted by the Center for Applied Optimization, was held at the University of Florida. The con­ ference was supported by the National Science Foundation, the U. S. Army Research Office, and the University of Florida, with endorsements from SIAM, MPS, ORSA and IMACS. Forty one invited speakers presented papers on mathematical program­ ming and optimal control topics with an emphasis on algorithm development, real world applications and numerical results. Participants from Canada, Japan, Sweden, The Netherlands, Germany, Belgium, Greece, and Denmark gave the meeting an important international component. At­ tendees also included representatives from IBM, American Airlines, US Air, United Parcel Serice, AT & T Bell Labs, Thinking Machines, Army High Performance Com­ puting Research Center, and Argonne National Laboratory. In addition, the NSF sponsored attendance of thirteen graduate students from universities in the United States and abro...

  10. Optimal Control Strategies for Constrained Relative Orbits

    National Research Council Canada - National Science Library

    Irvin , Jr, David J

    2007-01-01

    .... This research finds optimal trajectories, produced with discrete-thrusts, that minimize fuel spent per unit time and stay within the user-defened volume, thus providing a practical hover capability...

  11. Numerical Optimization.

    Science.gov (United States)

    1988-01-01

    TASK AREA & WORK UNIT NUMBERS Dipartimento di Matematica -G.--iattelnuoz .’ Universita di Roma "La Sapienze" rlnlRr% Pnmaq (Tt-al’g) I$. CONTROLLING...guaranteed. 3. Adminisrtrative actions The following investigators are working on the contract: (i) Francesco Zirilli Dipartimento di Matematica "G...Castelnuovo" Universiti di Roma "La Sapienza" 00185 Romna (Italy) (ii) Filippo Aluffi-Pentini Dipartimento di Matematica Universiti di Barn 80125 Bari (Italy

  12. Discrete optimization

    CERN Document Server

    Parker, R Gary

    1988-01-01

    This book treats the fundamental issues and algorithmic strategies emerging as the core of the discipline of discrete optimization in a comprehensive and rigorous fashion. Following an introductory chapter on computational complexity, the basic algorithmic results for the two major models of polynomial algorithms are introduced--models using matroids and linear programming. Further chapters treat the major non-polynomial algorithms: branch-and-bound and cutting planes. The text concludes with a chapter on heuristic algorithms.Several appendixes are included which review the fundamental ideas o

  13. Unconstrained Optimization

    DEFF Research Database (Denmark)

    Frandsen, P. E.; Jonasson, K.; Nielsen, Hans Bruun

    1999-01-01

    an introduction to algorithms for unconstrained optimization. We present Conjugate Gradient, Damped Newton and Quasi Newton methods together with the relevant theoretical background. The reader is assumed to be familiar with algorithms for solving linear and nonlinear system of equations, at a level corresponding...... to an introductory course in numerical analysis. The algorithms presented in the note appear in any good program library, and implementations can be found via GAMS (Guide to Available Mathematical Software) at the Internet address http://gams.nist.gov The examples in the note were computed in Matlab. The programs...

  14. Finding Multiple Optimal Solutions to Optimal Load Distribution Problem in Hydropower Plant

    Directory of Open Access Journals (Sweden)

    Xinhao Jiang

    2012-05-01

    Full Text Available Optimal load distribution (OLD among generator units of a hydropower plant is a vital task for hydropower generation scheduling and management. Traditional optimization methods for solving this problem focus on finding a single optimal solution. However, many practical constraints on hydropower plant operation are very difficult, if not impossible, to be modeled, and the optimal solution found by those models might be of limited practical uses. This motivates us to find multiple optimal solutions to the OLD problem, which can provide more flexible choices for decision-making. Based on a special dynamic programming model, we use a modified shortest path algorithm to produce multiple solutions to the problem. It is shown that multiple optimal solutions exist for the case study of China’s Geheyan hydropower plant, and they are valuable for assessing the stability of generator units, showing the potential of reducing occurrence times of units across vibration areas.

  15. Aircraft Trajectory Optimization Using Parametric Optimization Theory

    OpenAIRE

    Valenzuela Romero, Alfonso

    2012-01-01

    In this thesis, a study of the optimization of aircraft trajectories using parametric optimization theory is presented. To that end, an approach based on the use of predefined trajectory patterns and parametric optimization is proposed. The trajectory pat

  16. Generating Units

    Data.gov (United States)

    Department of Homeland Security — Generating Units are any combination of physically connected generators, reactors, boilers, combustion turbines, and other prime movers operated together to produce...

  17. Harsh criticism of legislation on promotion of CHP systems - Small and medium-sized businesses fear predatory competition; Massive Kritik an der KWK-Regelung - Brutale Verdraengung des Mittelstandes

    Energy Technology Data Exchange (ETDEWEB)

    Anon.

    2001-05-01

    The article explains the reasons that induced representatives of the small and medium-sized sector of Germany's mineral oil industry, in particular those in the fuel oil trading business, to write a letter to the Federal Chancellor in order to warn him of predatory competition in the fuel oil market segment. They perceive the Government's legislation in support of the cogeneration technology and combined power and heat systems (CHP) as something very close to governmental intervention in the heat market, which is not in compliance with the rules of competition in the Internal Market. (orig./CB) [German] In einem Schreiben an Bundeskanzler Gerhard Schroeder wird die anstehende Regelung fuer die kuenftige Nutzung der Kraft-Waerme-Kopplung (KWK) kritisiert. Nach Auffassung des Mineraloelmittelstandes muss im Rahmen der KWK-Diskussion beruecksichtigt werden, dass jede staatliche Subventionierung dieser Anlagen einen Eingriff in den Waermemarkt bedeutet. Geschieht dies dauerhaft und einseitig nur zugunsten eines Wettbwerbers auf diesem Markt - hier Fern-/Nahwaerme aus kommunalen KWK-Anlagen - werden Mittelstaendler verdraengt. (orig./CB)

  18. Solving unit commitment and economic load dispatch problems ...

    African Journals Online (AJOL)

    Economic Load Dispatch (ELD) and Unit Commitment (UC) are very important applications to predict the optimized cost of load in a power system. UC determines working states for existing generating units under some operational constraints and then optimizing the operation cost for all running units w.r.t. load demand ...

  19. Optimal produktion

    Directory of Open Access Journals (Sweden)

    Öje Danell

    1999-04-01

    Full Text Available Optimal Production in Reindeer Husbandry.There are three ways to optimize the reindeer herd: 1 Adjusting the reindeer number to pasture resources. 2 Keeping as many productive animals in the herd as possible through slaughter. 3 Increasing the herd quality through selection.Renhjorden bör optimeras så att den fungerar som en "skördeapparat" for bete och lämnar största möjliga bidrag till försörjningen för dem som lever av renskötsel. Det finns minst tre sätt att optimera renhjorden, nämligen (1 anpassning av djurantalet till betesresurserna så att djurens kondition och därmed produktiviteten kan bibehållas på hög nivå, (2 utforma renhjordens struktur med hjalp av slaktuttaget så att den innehåller så stor andel produktiva djur som möjligt, och (3 förbättra djurmaterialets produktionsmässiga kvalitet genom urval baserat på registrerad produktion. Betesanpassningen är den mest grundläggande åtgärden och ger den snabbaste effekten. Även hjordstrukturering är en åtgärd som ger relativt snabb effekt och som dessutom kan beslutas och utforas av den enskilde djuraägaren utan att störa den kollektiva renskötseln. Urval är en åtgärd som ger effekt först på längre sikt och därför kräver en konsekvent insats under en längre tid.

  20. Optimization of material, design, and operational parameters associated with full-scale 400,000-acfm fabic filter baghouse on the City of Colorado Springs' Martin Drake Generating Unit No. 6

    Energy Technology Data Exchange (ETDEWEB)

    Ostop, R.L. (Department of Public Utilities, Colorado Springs, CO); Thaxton, L.A.

    1978-01-01

    A program for determining the optimum design, construction, and operation of a fabric filter baghouse for control flyash emissions from a Colorado power plant fueled with low-sulfur coal is described. The primary purposes of this program were to show that fabric filter system can be designed on scientific principles rather than rule-of-thumb methods and that the operation of such a system can be optimized for greatest cost effectiveness. (LCL)