WorldWideScience

Sample records for chp technologies opportunities

  1. Modeling and simulation of a residential micro-CHP system based on HT-PEMFC technology

    DEFF Research Database (Denmark)

    Arsalis, Alexandros; Nielsen, Mads Pagh; Kær, Søren Knudsen

    2009-01-01

    Combined-heat-and-power (CHP) technology is a well known and proved method to produce simultaneously power and heat at high efficiencies. This can be further improved by the introduction of a novel micro-CHP residential system based on High Temperature-Proton Exchange Membrane Fuel Cell (HT-PEMFC...... is simulated in LabVIEW environment to provide the ability of Data Acquisition of actual components and thereby more realistic design in the future....

  2. Investment appraisal for small CHP technology in biomass-fuel power plant

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1999-07-01

    The paper is essentially an investment appraisal for small CHP (combined heat and power) technology in biomass-fuel power plant and discusses and presents data on the combustion/steam cycle technologies to demonstrate the economic viability of CHP projects using established market costs for technology and employing energy crops as biomass fuel. The data is based on the UK, where electricity prices are low, but the overseas market (where prices are higher and there is potential for UK exports) is also discussed. The report aims to synthesise up-to-date technical and economic information on biomass-fuel CHP projects of small scale and focuses on technical and financial information on equipment, capital, construction and operating costs, and revenue streams.

  3. Biomass gasification with CHP production: A review of state of the art technology and near future perspectives

    Directory of Open Access Journals (Sweden)

    Jankes Goran G.

    2012-01-01

    Full Text Available This paper is a review of the state of the art of biomass gasification and the future of using biomass in Serbia and it presents researches within the project “The Development of a CHP Plant with Biomass Gasification”. The concept of downdraft demonstration unit coupled with gas engine is adopted. Downdraft fixed-bed gasification is generally favored for CHP, owing to the simple and reliable gasifiers and low content of tar and dust in produced gas. The composition and quantity of gas and the amount of air are defined by modeling biomass residues gasification process. The gas (290-400m3/h for 0.5- 0.7MW biomass input obtained by gasification at 800oC with air at atmospheric pressure contains 14% H2, 27% CO, 9% CO2, 2% CH4, and 48% N2, and its net heating value is 4.8-6 MJ/Nm3. The expected gasifier efficiency is up to 80%. The review of the work on biomass gasification has shown that the development of technology has reached the mature stage. There are CHP plants with biomass gasification operating as demonstration plants and several gasification demonstration units are successfully oriented to biofuel production. No attempt has been made here to address the economic feasibility of the system. Economics will be the part of a later work as firmer data are acquired.

  4. Wind Technologies & Evolving Opportunities (Presentation)

    Energy Technology Data Exchange (ETDEWEB)

    Robichaud, R.

    2014-07-01

    This presentation covers opportunities for wind technology; wind energy market trends; an overview of the National Wind Technology Center near Boulder, Colorado; wind energy price and cost trends; wind turbine technology improvements; and wind resource characterization improvements.

  5. Biomass CHP based on a Stirling engine

    Energy Technology Data Exchange (ETDEWEB)

    Cowburn, D.A.; Dando, R.L.

    1997-12-31

    Combined heat and power (CHP) schemes offer a means of converting fuel to useful energy with much higher efficiencies (up to 80 percent) compared to electricity generating stations (efficiencies <36 percent). This has led to many EEC member states, including the UK, and other industrial countries encouraging the use of CHP. At the smaller scale (<500 kWe) steam based systems have generally proven too costly to provide solid fuel with an opportunity to exploit this potentially attractive CHP market sector. The Stirling engine offers a technology which can produce mechanical power from solid fuels without the need to raise steam. This project has been directed towards producing a Stirling engine design capable of producing an output of 150 kW{sub e} from solid fuel. The participants in the projects, CRE Group Ltd., Basys Marine Ltd. (formerly Cray Marine) and Gamos Ltd., brought together a wide range of experience in the areas of gasification, combustion, heat transfer, Stirling engine technology and high precision engineering. A novel form of low pressure nitrogen charged Stirling engine has been designed specifically for stationary applications. This avoided the drawbacks of high pressures with H{sub e} or H used as the working fluids and consequent requirement for exotic sealing arrangements, which have been associated with previous Stirling engine`s aimed primarily at the automotive market. (author)

  6. Micro-CHP Systems for Residential Applications

    Energy Technology Data Exchange (ETDEWEB)

    Timothy DeValve; Benoit Olsommer

    2007-09-30

    Integrated micro-CHP (Cooling, Heating and Power) system solutions represent an opportunity to address all of the following requirements at once: conservation of scarce energy resources, moderation of pollutant release into our environment, and assured comfort for home-owners. The objective of this effort was to establish strategies for development, demonstration, and sustainable commercialization of cost-effective integrated CHP systems for residential applications. A unified approach to market and opportunity identification, technology assessment, specific system designs, adaptation to modular product platform component conceptual designs was employed. UTRC's recommendation to U.S. Department of Energy is to go ahead with the execution of the proposed product development and commercialization strategy plan under Phase II of this effort. Recent indicators show the emergence of micro-CHP. More than 12,000 micro-CHP systems have been sold worldwide so far, around 7,500 in 2004. Market projections predict a world-wide market growth over 35% per year. In 2004 the installations were mainly in Europe (73.5%) and in Japan (26.4%). The market in North-America is almost non-existent (0.1%). High energy consumption, high energy expenditure, large spark-spread (i.e., difference between electricity and fuel costs), big square footage, and high income are the key conditions for market acceptance. Today, these conditions are best found in the states of New York, Pennsylvania, New Jersey, Wisconsin, Illinois, Indiana, Michigan, Ohio, New England states. A multiple stage development plan is proposed to address risk mitigation. These stages include concept development and supplier engagement, component development, system integration, system demonstration, and field trials. A two stage commercialization strategy is suggested based on two product versions. The first version--a heat and power system named Micro-Cogen, provides the heat and essential electrical power to the

  7. Initial Market Assessment for Small-Scale Biomass-Based CHP

    Energy Technology Data Exchange (ETDEWEB)

    Brown, E.; Mann, M.

    2008-01-01

    The purpose of this report is to reexamine the energy generation market opportunities for biomass CHP applications smaller than 20 MW. This paper provides an overview of the benefits of and challenges for biomass CHP in terms of policy, including a discussion of the drivers behind, and constraints on, the biomass CHP market. The report provides a summary discussion of the available biomass supply types and technologies that could be used to feed the market. Two primary markets are outlined--rural/agricultural and urban--for small-scale biomass CHP, and illustrate the primary intersections of supply and demand for those markets. The paper concludes by summarizing the potential markets and suggests next steps for identifying and utilizing small-scale biomass.

  8. Small-scale CHP Plant based on a 35 kWel Hermetic Four Cylinder Stirling Engine for Biomass Fuels- Development, Technology and Operating Experiences

    DEFF Research Database (Denmark)

    Obernberger, I.; Carlsen, Henrik; Biedermann, F.

    2003-01-01

    ) process and the Stirling engine process. The ORC process represents an economically interesting technology for small-scale biomass-fired combined heat and power plants in a power range between 400 and 1,500 kWel. A newly developed ORC technology with a nominal electric capacity of 1,000 kW was implemented...... in the biomass CHP plant Lienz (A) in the framework of an EU demonstration project. This plant was put in operation in February 2002. Stirling engines are a promising solution for installations with nominal electric capacities between 10 and 150 kW. A biomass CHP pilot plant based on a 35 kWel-Stirling engine...

  9. Micro-CHP Systems for Residential Applications

    Energy Technology Data Exchange (ETDEWEB)

    Timothy DeValve; Benoit Olsommer

    2007-09-30

    Integrated micro-CHP (Cooling, Heating and Power) system solutions represent an opportunity to address all of the following requirements at once: conservation of scarce energy resources, moderation of pollutant release into our environment, and assured comfort for home-owners. The objective of this effort was to establish strategies for development, demonstration, and sustainable commercialization of cost-effective integrated CHP systems for residential applications. A unified approach to market and opportunity identification, technology assessment, specific system designs, adaptation to modular product platform component conceptual designs was employed. UTRC's recommendation to U.S. Department of Energy is to go ahead with the execution of the proposed product development and commercialization strategy plan under Phase II of this effort. Recent indicators show the emergence of micro-CHP. More than 12,000 micro-CHP systems have been sold worldwide so far, around 7,500 in 2004. Market projections predict a world-wide market growth over 35% per year. In 2004 the installations were mainly in Europe (73.5%) and in Japan (26.4%). The market in North-America is almost non-existent (0.1%). High energy consumption, high energy expenditure, large spark-spread (i.e., difference between electricity and fuel costs), big square footage, and high income are the key conditions for market acceptance. Today, these conditions are best found in the states of New York, Pennsylvania, New Jersey, Wisconsin, Illinois, Indiana, Michigan, Ohio, New England states. A multiple stage development plan is proposed to address risk mitigation. These stages include concept development and supplier engagement, component development, system integration, system demonstration, and field trials. A two stage commercialization strategy is suggested based on two product versions. The first version--a heat and power system named Micro-Cogen, provides the heat and essential electrical power to the

  10. Screening of CHP Potential at Federal Sites in Select Regions of the U.S.

    Energy Technology Data Exchange (ETDEWEB)

    Energy Nexus Group, . .

    2002-02-25

    Combined Cooling Heat and Power (CHP) is a master term for onsite power generation technologies that sequentially produce electrical or mechanical energy and useful thermal energy. Some form of CHP has existed for more than 100 years and it is now achieving a greater level of acceptance due to an increasing need for reliable power service and energy cost management. Capturing and using the heat produced as a byproduct of generating electricity from fuel sources increases the usable energy that can be obtained from the original fuel source. CHP technologies have the potential to reduce energy consumption through increased efficiency--decreasing energy bills as well as pollution. The EPA recognizes CHP as a potent climate change mitigation measure. The U.S. Department of Energy (D.O.E.) Federal Energy Management Program (FEMP) is assisting Federal agencies to realize their energy efficiency goals. CHP is an efficiency measure that is receiving growing attention because of its sizable potential to provide efficiency, environmental, and reliability benefits. CHP therefore benefits the host facility, the electric infrastructure, and the U.S. society as a whole. This report and study seeks to make a preliminary inquiry into near term CHP opportunities for federal facilities in selected U.S. regions. It offers to help focus the attention of policy makers and energy facility managers on good candidate facilities for CHP. First, a ranked list of high potential individual sites is identified. Then, several classes of federal facilities are identified for the multiple opportunities they offer as a class. Recommendations are then offered for appropriate next steps for the evaluation and cost effective implementation of CHP. This study was designed to ultimately rank federal facilities in terms of their potential to take advantage of CHP economic and external savings in the near term. In order to best serve the purposes of this study, projections have been expressed in terms of

  11. Demonstration of Next-Generation PEM CHP Systems for Global Markets Using PBI Membrane Technology

    Energy Technology Data Exchange (ETDEWEB)

    Vogel, John [Plug Power Inc., Latham, NY (United States); Fritz Intwala, Katrina [Plug Power Inc., Latham, NY (United States)

    2009-08-01

    Plug Power and BASF have conducted eight years of development work prior to this project, demonstrating the potential of PBI membranes to exceed many DOE technical targets. This project consisted of; 1.The development of a worldwide system architecture; 2.Stack and balance of plant module development; 3.Development of an improved, lower cost MEA electrode; 4.Receipt of an improved MEA from the EU consortium; 5.Integration of modules into a system; and 6.Delivery of system to EU consortium for additional integration of technologies and testing.

  12. Marketing opportunities for CHP electricity in a virtual power plant. Direct and indirect marketing of flexibility; Vermarktungschancen fuer KWK-Strom im virtuellen Kraftwerk. Direkte und indirekte Flexibilitaetsvermarktung

    Energy Technology Data Exchange (ETDEWEB)

    Otto, Achim; Baumgart, Bastian [Trianel GmbH, Aachen (Germany). Abt. Virtuelle Kraftwerke

    2013-07-15

    The increasingly fluctuating feed-in of electricity by means of a rapid expansion of renewable energies results in an increasing demand for flexible performance for the regulation of production and consumption. An important part of the necessary flexibility could be provided by CHP plants. Their potential of flexibility is not always fully exploited.

  13. 75 FR 10464 - Broadband Technology Opportunities Program

    Science.gov (United States)

    2010-03-08

    ... National Telecommunications and Information Administration RIN 0660-ZA28 Broadband Technology Opportunities... Technology Opportunities Program (BTOP) is extended until 5:00 p.m. Eastern Daylight Time (EDT) on March 26... Sustainable Broadband Adoption (SBA) projects. DATES: All applications for funding CCI projects must...

  14. Flight Opportunities: Space Technology Mission Directorate

    Science.gov (United States)

    Van Dijk, Alexander

    2016-01-01

    Flight Opportunities enables maturation of new space technologies by funding access to commercially available space-relevant test environments. The program also supports capability development in the commercial suborbital and orbital small satellite launcher markets.

  15. Water Technology Innovation: Ten Market Opportunities

    Science.gov (United States)

    The Water Technology Innovation Blueprint offers an overview of market opportunities that include conserving and recovering energy, recovering nutrients, improving water infrastructure, reducing costs for water monitoring, and improving water quality.

  16. Technological opportunities and paths of development

    DEFF Research Database (Denmark)

    Plichta, Kirsten

    1993-01-01

    rational they tend to choose opportunities for incremental improvements in their products and production techniques rather than developing radical new products and techniques. 4) Persistent differences between firms in an industry with regard to their products and process technologies are an outcome......Executive summary: 1) The technological development of firms in an industry is influenced by the opportunities for improving product and process, their ability to identify such opportunities and their ability to appropriate the benefit of the development effort. 2) Firms' historically developed...... technological knowledge, their production, development and other routines as well prior investments in products and production equipment play an important role with regard to the technological opportunities that firms' identify and select for development. 3) Because history matters and because firms are bounded...

  17. Telecommunications: Opportunities in the emerging technologies

    Energy Technology Data Exchange (ETDEWEB)

    Schultheis, R.W. [Mission Telecommunications Group, Charlottesville, VA (United States)

    1994-12-31

    A series of slides present opportunities for Utility Telecommunications. The following aspects are covered: (1) Technology in a period of revolution; (2) Technology Management by the Energy Utility, (3) Contemporary Telecommunication Network Architectures, (4) Opportunity Management, (5) Strategic Planning for Profits and Growth, (6) Energy Industry in a period of challenge. Management topics and applications are presented in a matrix for generation, transmission, distribution, customer service and new business revenue growth subjects.

  18. Designing and optimization of a micro CHP system based on Solid Oxide Fuel Cell with different fuel processing technologies

    DEFF Research Database (Denmark)

    Liso, Vincenzo; Nielsen, Mads Pagh; Kær, Søren Knudsen

    2009-01-01

    (SMR) and partial oxidation (CPO) will be investigated for each configuration. The internal reforming will be also considered for its ability to reduce the stack temperature and decrease the need of cooling air. Finally, optimization criteria for SOFC systems applied to single-family detached dwellings...... are the possibility to partially reform hydrocarbon in the fuel cell anode compartment and the possibility to use high quality heat for cogeneration. In this work, different configurations of solid oxide fuel cell system for decentralized electricity production are examined. The Balance of Plant (BoP) components...... of the Micro Combined Heat and Power plant (mCHP) will be identified including fuel and air supply, fuel management anode re-circulation, exhaust gas heat management, power conditioning and control system. Using mass and energy balance, different types of fuel reforming including steam reforming...

  19. CHP and Energy Conservation

    OpenAIRE

    McGovern, Jim

    1995-01-01

    The principles of the use of 'combined heat and power' (CHP) for the achievement of fuel energy conservation, minimisation of environmental impact and economic advantage are explained. A distinction is made between the two types of outputs: heat and work. It is argued that an efficiency value that is defined as the sum of the heat and work outputs divided by the energy of the fuel used is not very meaningful. An alternative, rational, efficiency is explained. It is concluded that CHP is an op...

  20. CHP and District Cooling: An Assessment of Market and Policy Potential in India

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2008-07-01

    This report contains an assessment of India's CHP/DC status and recommendations for addressing barriers to allow India to meet its energy efficiency targets. Such barriers include a lack of governmental emphasis on CHP, the absence of a clear methodology for calculating CO2 emission reductions from CHP/DHC, and a tax and duty structure for CHP capital equipment that is not as attractive as for other renewable energy technologies.

  1. Combined Heat & Power Using the Infinia Concentrated Solar - CHP PowerDish System

    Science.gov (United States)

    2013-08-01

    installed cost as the PowerDish CHP system). The solar thermal system selected and installed will be a low or medium-temperature collector system...implementing the PowerDish CHP. ...................................... 29 Table 8. Important costs for implementing the PowerDish CHP versus PV- solar thermal ...capabilities of the Infinia PowerDish CHP technology to generate clean solar electricity as well as thermal energy for domestic hot water and space

  2. Critical technologies research: Opportunities for DOE

    Energy Technology Data Exchange (ETDEWEB)

    1992-12-01

    Recent studies have identified a number of critical technologies that are essential to the nation`s defense, economic competitiveness, energy independence, and betterment of public health. The National Critical Technologies Panel (NCTP) has identified the following critical technology areas: Aeronautics and Surface Transportation; Biotechnology and Life Sciences; Energy and Environment; Information and Communications; Manufacturing; and Materials. Sponsored by the Department of Energy`s Office of Energy Research (OER), the Critical Technologies Research Workshop was held in May 1992. Approximately 100 scientists, engineers, and managers from the national laboratories, industry, academia, and govemment participated. The objective of the Berkeley Workshop was to advance the role of the DOE multiprogram energy laboratories in critical technologies research by describing, defining, and illustrating research areas, opportunities, resources, and key decisions necessary to achieve national research goals. An agenda was developed that looked at DOE`s capabilities and options for research in critical technologies and provided a forum for industry, academia, govemment, and the national laboratories to address: Critical technology research needs; existing research activities and resources; capabilities of the national laboratories; and opportunities for national laboratories, industries, and universities. The Workshop included plenary sessions in which presentations by technology and policy leaders set the context for further inquiry into critical technology issues and research opportunities. Separate sessions then focused on each of the following major areas of technology: Advanced materials; biotechnology and life sciences; energy and environment; information and communication; and manufacturing and transportation.

  3. Critical technologies research: Opportunities for DOE

    Energy Technology Data Exchange (ETDEWEB)

    1992-12-01

    Recent studies have identified a number of critical technologies that are essential to the nation's defense, economic competitiveness, energy independence, and betterment of public health. The National Critical Technologies Panel (NCTP) has identified the following critical technology areas: Aeronautics and Surface Transportation; Biotechnology and Life Sciences; Energy and Environment; Information and Communications; Manufacturing; and Materials. Sponsored by the Department of Energy's Office of Energy Research (OER), the Critical Technologies Research Workshop was held in May 1992. Approximately 100 scientists, engineers, and managers from the national laboratories, industry, academia, and govemment participated. The objective of the Berkeley Workshop was to advance the role of the DOE multiprogram energy laboratories in critical technologies research by describing, defining, and illustrating research areas, opportunities, resources, and key decisions necessary to achieve national research goals. An agenda was developed that looked at DOE's capabilities and options for research in critical technologies and provided a forum for industry, academia, govemment, and the national laboratories to address: Critical technology research needs; existing research activities and resources; capabilities of the national laboratories; and opportunities for national laboratories, industries, and universities. The Workshop included plenary sessions in which presentations by technology and policy leaders set the context for further inquiry into critical technology issues and research opportunities. Separate sessions then focused on each of the following major areas of technology: Advanced materials; biotechnology and life sciences; energy and environment; information and communication; and manufacturing and transportation.

  4. Technological Opportunities and New Firm Creation

    OpenAIRE

    Scott Shane

    2001-01-01

    Research on the creation of new high-technology companies has typically focused either on industry-level factors such as market structure and technology regime or on individual-level factors such as the work experience of entrepreneurs. This study complements these approaches by examining the effect of technological opportunities on firm formation. In particular, the study shows that the probability that an invention will be commercialized through firm formation is influenced by its importanc...

  5. Deployment of FlexCHP System

    Energy Technology Data Exchange (ETDEWEB)

    Cygan, David [Gas Technology Inst., Des Plaines, IL (United States)

    2015-11-01

    The Gas Technology Institute (GTI), along with its partner Integrated CHP Systems Corporation, has developed and demonstrated an Ultra-Low-Nitrogen Oxide (ULN) Flexible Combined Heat and Power (FlexCHP) system that packages a state-of-the-art Capstone C65 gas microturbine and Johnston PFXX100 boiler with an innovative natural gas-fired supplemental burner. Supplemental burners add heat as needed in response to facility demand, which increases energy efficiency, but typically raises exhaust NOx levels, degrading local air quality unless a costly and complicated catalytic treatment system is added. The FlexCHP system increases energy efficiency and achieves the 2007 California Air Resource Board (CARB) distributed generation emissions standards for Nitrogen oxides (NOx), Carbon Monoxide (CO), and Total Hydrocarbons (THC) without catalytic exhaust gas treatment. The key to this breakthrough performance is a simple and reliable burner design which utilizes staged combustion with engineered internal recirculation. This ULN burner system successfully uses turbine exhaust as an oxidizer, while achieving high efficiencies and low emissions. In tests at its laboratory facilities in Des Plaines, Illinois, GTI validated the ability of the system to achieve emissions of NOx, CO, and THC below the CARB criteria of 0.07, 0.10, and 0.02 lb/MW-h respectively. The FlexCHP system was installed at the field demonstration site, Inland Empire Foods, in Riverside, California to verify performance of the technology in an applied environment. The resulting Combined Heat and Power (CHP) package promises to make CHP implementation more attractive, mitigate greenhouse gas emissions, and improve the reliability of electricity supply.

  6. Technology in Parkinson's disease: Challenges and opportunities.

    Science.gov (United States)

    Espay, Alberto J; Bonato, Paolo; Nahab, Fatta B; Maetzler, Walter; Dean, John M; Klucken, Jochen; Eskofier, Bjoern M; Merola, Aristide; Horak, Fay; Lang, Anthony E; Reilmann, Ralf; Giuffrida, Joe; Nieuwboer, Alice; Horne, Malcolm; Little, Max A; Litvan, Irene; Simuni, Tanya; Dorsey, E Ray; Burack, Michelle A; Kubota, Ken; Kamondi, Anita; Godinho, Catarina; Daneault, Jean-Francois; Mitsi, Georgia; Krinke, Lothar; Hausdorff, Jeffery M; Bloem, Bastiaan R; Papapetropoulos, Spyros

    2016-09-01

    The miniaturization, sophistication, proliferation, and accessibility of technologies are enabling the capture of more and previously inaccessible phenomena in Parkinson's disease (PD). However, more information has not translated into a greater understanding of disease complexity to satisfy diagnostic and therapeutic needs. Challenges include noncompatible technology platforms, the need for wide-scale and long-term deployment of sensor technology (among vulnerable elderly patients in particular), and the gap between the "big data" acquired with sensitive measurement technologies and their limited clinical application. Major opportunities could be realized if new technologies are developed as part of open-source and/or open-hardware platforms that enable multichannel data capture sensitive to the broad range of motor and nonmotor problems that characterize PD and are adaptable into self-adjusting, individualized treatment delivery systems. The International Parkinson and Movement Disorders Society Task Force on Technology is entrusted to convene engineers, clinicians, researchers, and patients to promote the development of integrated measurement and closed-loop therapeutic systems with high patient adherence that also serve to (1) encourage the adoption of clinico-pathophysiologic phenotyping and early detection of critical disease milestones, (2) enhance the tailoring of symptomatic therapy, (3) improve subgroup targeting of patients for future testing of disease-modifying treatments, and (4) identify objective biomarkers to improve the longitudinal tracking of impairments in clinical care and research. This article summarizes the work carried out by the task force toward identifying challenges and opportunities in the development of technologies with potential for improving the clinical management and the quality of life of individuals with PD. © 2016 International Parkinson and Movement Disorder Society.

  7. Hybrid Solid Oxide Fuel Cell and Thermoelectric Generator for Maximum Power Output in Micro-CHP Systems

    Science.gov (United States)

    Rosendahl, L. A.; Mortensen, Paw V.; Enkeshafi, Ali A.

    2011-05-01

    One of the most obvious early market applications for thermoelectric generators (TEG) is decentralized micro combined heat and power (CHP) installations of 0.5 kWe to 5 kWe based on fuel cell technology. Through the use of TEG technology for waste heat recovery it is possible to increase the electricity production in micro-CHP systems by more than 15%, corresponding to system electrical efficiency increases of some 4 to 5 percentage points. This will make fuel cell-based micro-CHP systems very competitive and profitable and will also open opportunities in a number of other potential business and market segments which are not yet quantified. This paper quantifies a micro-CHP system based on a solid oxide fuel cell (SOFC) and a high-performance TE generator. Based on a 3 kW fuel input, the hybrid SOFC implementation boosts electrical output from 945 W to 1085 W, with 1794 W available for heating purposes.

  8. Hybrid Solid Oxide Fuel Cell and Thermoelectric Generator for Maximum Power Output in Micro-CHP Systems

    DEFF Research Database (Denmark)

    Rosendahl, Lasse; Mortensen, Paw Vestergård; Enkeshafi, Ali A.

    2011-01-01

    and market segments which are not yet quantified. This paper quantifies a micro-CHP system based on a solid oxide fuel cell (SOFC) and a high-performance TE generator. Based on a 3 kW fuel input, the hybrid SOFC implementation boosts electrical output from 945 W to 1085 W, with 1794 W available for heating......One of the most obvious early market applications for thermoelectric generators (TEG) is decentralized micro combined heat and power (CHP) installations of 0.5 kWe to 5 kWe based on fuel cell technology. Through the use of TEG technology for waste heat recovery it is possible to increase...... the electricity production in micro-CHP systems by more than 15%, corresponding to system electrical efficiency increases of some 4 to 5 percentage points. This will make fuel cell-based micro-CHP systems very competitive and profitable and will also open opportunities in a number of other potential business...

  9. MICRO-CHP System for Residential Applications

    Energy Technology Data Exchange (ETDEWEB)

    Joseph Gerstmann

    2009-01-31

    This is the final report of progress under Phase I of a project to develop and commercialize a micro-CHP system for residential applications that provides electrical power, heating, and cooling for the home. This is the first phase of a three-phase effort in which the residential micro-CHP system will be designed (Phase I), developed and tested in the laboratory (Phase II); and further developed and field tested (Phase III). The project team consists of Advanced Mechanical Technology, Inc. (AMTI), responsible for system design and integration; Marathon Engine Systems, Inc. (MES), responsible for design of the engine-generator subsystem; AO Smith, responsible for design of the thermal storage and water heating subsystems; Trane, a business of American Standard Companies, responsible for design of the HVAC subsystem; and AirXchange, Inc., responsible for design of the mechanical ventilation and dehumidification subsystem.

  10. Dicty_cDB: CHP638 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP638 (Link to dictyBase) - - - - CHP638P (Link to Original site) CHP638F 529 CHP63...8Z 720 CHP638P 1229 - - Show CHP638 Library CH (Link to library) Clone ID CHP638 (Link...sukuba.ac.jp/CSM/CH/CHP6-B/CHP638Q.Seq.d/ Representative seq. ID CHP638P (Link to... Original site) Representative DNA sequence >CHP638 (CHP638Q) /CSM/CH/CHP6-B/CHP638Q.Seq.d/ CTGTTGGCCTACTGGG...ng significant alignments: (bits) Value CHP638 (CHP638Q) /CSM/CH/CHP6-B/CHP638Q.S

  11. Dicty_cDB: CHP160 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP160 (Link to dictyBase) - - - Contig-U16475-1 CHP160P (Link to Original site) CHP16...0F 469 CHP160Z 728 CHP160P 1177 - - Show CHP160 Library CH (Link to library) Clone ID CHP16...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CH/CHP1-C/CHP160Q.Seq.d/ Representative seq. ID CHP16...0P (Link to Original site) Representative DNA sequence >CHP160 (CHP160Q) /CSM/CH/CHP1-C/CHP16... Sequences producing significant alignments: (bits) Value CHP160 (CHP160Q) /CSM/CH/CHP1-C/CHP160Q.Seq.d/ 201

  12. Dicty_cDB: CHP531 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP531 (Link to dictyBase) - G20193 DDB0235388 Contig-U14452-1... - (Link to Original site) CHP531F 577 - - - - - - Show CHP531 Library CH (Link to library) Clone ID CHP531 ...l site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CH/CHP5-B/CHP531Q.Seq.d/ Repres...entative seq. ID - (Link to Original site) Representative DNA sequence >CHP531 (CHP531Q) /CSM/CH/CHP5-B/CHP53...liasfdmgq fitgpfgs--- Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value CHP531 (CHP53

  13. Dicty_cDB: CHP630 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP630 (Link to dictyBase) - - - Contig-U16260-1 - (Link to Original site) - - CHP63...0Z 515 - - - - Show CHP630 Library CH (Link to library) Clone ID CHP630 (Link to dicty...iol.tsukuba.ac.jp/CSM/CH/CHP6-B/CHP630Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >CHP630 (CHP630Q) /CSM/CH/CHP6-B/CHP630Q.Seq.d/ XXXXXXXXXXTCGTCAA...liyvptlpvklshnvxsiiglqlvlstkirkp Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value CHP630 (CHP63

  14. Dicty_cDB: CHP631 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP631 (Link to dictyBase) - - - Contig-U16308-1 CHP631P (Link to Original site) CHP63...1F 576 CHP631Z 628 CHP631P 1184 - - Show CHP631 Library CH (Link to library) Clone ID CHP63...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CH/CHP6-B/CHP631Q.Seq.d/ Representative seq. ID CHP63...1P (Link to Original site) Representative DNA sequence >CHP631 (CHP631Q) /CSM/CH/CHP6-B/CHP63....0 %: endoplasmic reticulum >> prediction for CHP631 is exc 5' end seq. ID CHP631F 5' end seq. >CHP631F.Seq

  15. Dicty_cDB: CHP536 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP536 (Link to dictyBase) - - - Contig-U16458-1 CHP536P (Link to Original site) CHP53...6F 597 CHP536Z 660 CHP536P 1237 - - Show CHP536 Library CH (Link to library) Clone ID CHP53...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CH/CHP5-B/CHP536Q.Seq.d/ Representative seq. ID CHP53...6P (Link to Original site) Representative DNA sequence >CHP536 (CHP536Q) /CSM/CH/CHP5-B/CHP53...XPK Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value CHP536 (CHP53

  16. Dicty_cDB: CHP639 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP639 (Link to dictyBase) - - - Contig-U15897-1 CHP639P (Link to Original site) CHP63...9F 700 CHP639Z 643 CHP639P 1323 - - Show CHP639 Library CH (Link to library) Clone ID CHP63...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CH/CHP6-B/CHP639Q.Seq.d/ Representative seq. ID CHP63...9P (Link to Original site) Representative DNA sequence >CHP639 (CHP639Q) /CSM/CH/CHP6-B/CHP63...nkkkn*knk*ins*kkil Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value CHP639 (CHP63

  17. Big Data: Survey, Technologies, Opportunities, and Challenges

    Directory of Open Access Journals (Sweden)

    Nawsher Khan

    2014-01-01

    Full Text Available Big Data has gained much attention from the academia and the IT industry. In the digital and computing world, information is generated and collected at a rate that rapidly exceeds the boundary range. Currently, over 2 billion people worldwide are connected to the Internet, and over 5 billion individuals own mobile phones. By 2020, 50 billion devices are expected to be connected to the Internet. At this point, predicted data production will be 44 times greater than that in 2009. As information is transferred and shared at light speed on optic fiber and wireless networks, the volume of data and the speed of market growth increase. However, the fast growth rate of such large data generates numerous challenges, such as the rapid growth of data, transfer speed, diverse data, and security. Nonetheless, Big Data is still in its infancy stage, and the domain has not been reviewed in general. Hence, this study comprehensively surveys and classifies the various attributes of Big Data, including its nature, definitions, rapid growth rate, volume, management, analysis, and security. This study also proposes a data life cycle that uses the technologies and terminologies of Big Data. Future research directions in this field are determined based on opportunities and several open issues in Big Data domination. These research directions facilitate the exploration of the domain and the development of optimal techniques to address Big Data.

  18. Decentralised CHP in a competitive market

    DEFF Research Database (Denmark)

    Lund, Henrik

    2004-01-01

    The article agues that decentralised CHP plants is an important part of energy supply in Denmark.......The article agues that decentralised CHP plants is an important part of energy supply in Denmark....

  19. Dicty_cDB: CHP538 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP538 (Link to dictyBase) - - - Contig-U11908-1 CHP538P (Link to Original site) CHP53...8F 639 CHP538Z 714 CHP538P 1333 - - Show CHP538 Library CH (Link to library) Clone ID CHP53...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CH/CHP5-B/CHP538Q.Seq.d/ Representative seq. ID CHP53...8P (Link to Original site) Representative DNA sequence >CHP538 (CHP538Q) /CSM/CH/CHP5-B/CHP53...NIFDVEDLVPKNSXSFIKKKL*iin*nfk*inxkklcktk Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value CHP53

  20. Innovative forming and fabrication technologies : new opportunities.

    Energy Technology Data Exchange (ETDEWEB)

    Davis, B.; Hryn, J.; Energy Systems; Kingston Process Metallurgy, Inc.

    2008-01-31

    The advent of light metal alloys and advanced materials (polymer, composites, etc.) have brought the possibility of achieving important energy reductions into the full life cycle of these materials, especially in transportation applications. 1 These materials have gained acceptance in the aerospace industry but use of light metal alloys needs to gain wider acceptance in other commercial transportation areas. Among the main reasons for the relatively low use of these materials are the lack of manufacturability, insufficient mechanical properties, and increased material costs due to processing inefficiencies. Considering the enormous potential energy savings associated with the use of light metal alloys and advanced materials in transportation, there is a need to identify R&D opportunities in the fields of materials fabrication and forming aimed at developing materials with high specific mechanical properties combined with energy efficient processes and good manufacturability. This report presents a literature review of the most recent developments in the areas of fabrication and metal forming focusing principally on aluminum alloys. In the first section of the document, the different sheet manufacturing technologies including direct chill (DC) casting and rolling, spray forming, spray rolling, thin slab, and strip casting are reviewed. The second section of the document presents recent research on advanced forming processes. The various forming processes reviewed are: superplastic forming, electromagnetic forming, age forming, warm forming, hydroforming, and incremental forming. Optimization of conventional forming processes is also discussed. Potentially interesting light metal alloys for high structural efficiency including aluminum-scandium, aluminum-lithium, magnesium, titanium, and amorphous metal alloys are also reviewed. This section concludes with a discussion on alloy development for manufacturability. The third section of the document reviews the latest

  1. Cost targets for domestic fuel cell CHP

    Science.gov (United States)

    Staffell, I.; Green, R.; Kendall, K.

    Fuel cells have the potential to reduce domestic energy bills by providing both heat and power at the point of use, generating high value electricity from a low cost fuel. However, the cost of installing the fuel cell must be sufficiently low to be recovered by the savings made over its lifetime. A computer simulation is used to estimate the savings and cost targets for fuel cell CHP systems. Two pitfalls of this kind of simulation are addressed: the selection of representative performance figures for fuel cells, and the range of houses from which energy demand data was taken. A meta-study of the current state of the art is presented, and used with 102 house-years of demand to simulate the range of economic performance expected from four fuel cell technologies within the UK domestic CHP market. Annual savings relative to a condensing boiler are estimated at €170-300 for a 1 kWe fuel cell, giving a target cost of €350-625 kW -1 for any fuel cell technology that can demonstrate a 2.5-year lifetime. Increasing lifetime and reducing fuel cell capacity are identified as routes to accelerated market entry. The importance of energy demand is seen to outweigh both economic and technical performance assumptions, while manufacture cost and system lifetime are highlighted as the only significant differences between the technologies considered. SOFC are considered to have the greatest potential, but uncertainty in the assumptions used precludes any clear-cut judgement.

  2. Dicty_cDB: CHP530 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP530 (Link to dictyBase) - - - - - (Link to Original site) CHP53...0F 182 - - - - - - Show CHP530 Library CH (Link to library) Clone ID CHP530 (Link to dictyBase) Atlas ID... - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CH/CHP5-B/CHP53...0Q.Seq.d/ Representative seq. ID - (Link to Original site) Representative DNA sequence >CHP53...0 (CHP530Q) /CSM/CH/CHP5-B/CHP530Q.Seq.d/ ACTGTTGGCCTACTGGGCAAATTAAAATCATTAAAAATAAAAAAA

  3. Technology platforms: opportunities and development perspectives

    Science.gov (United States)

    Belyakov, G. P.; Avramchikova, N. T.; Belyakova, G. Y.; Chuvashova, M. N.

    2016-11-01

    The term “technology platform” is used to define thematic scopes in terms of which technological priorities are formed concerning state, business, science and education cooperation that are aimed to solve the problem of state technological independence. The authors have examined the implementation of this tool so that to concentrate essential resources in priority-driven vectors of science and technological advancement of a guiding cluster of innovative technologies in the field of space applications.

  4. Dicty_cDB: CHP532 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP532 (Link to dictyBase) - - - Contig-U16255-1 - (Link to Original site) - - CHP53...2Z 245 - - - - Show CHP532 Library CH (Link to library) Clone ID CHP532 (Link to dicty...iol.tsukuba.ac.jp/CSM/CH/CHP5-B/CHP532Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >CHP532 (CHP532Q) /CSM/CH/CHP5-B/CHP532Q.Seq.d/ XXXXXXXXXXGGTNTNT...s CSM-cDNA Score E Sequences producing significant alignments: (bits) Value CHP532 (CHP532Q) /CSM/CH/CHP5-B/CHP532Q.Seq.d/ 335 2e-91 SS

  5. Dicty_cDB: CHP537 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP537 (Link to dictyBase) - - - Contig-U12147-1 | Contig-U15540-1 CHP53...7P (Link to Original site) CHP537F 116 CHP537Z 256 CHP537P 352 - - Show CHP537 Library CH (Link to library) Clone ID CHP53...47-1 | Contig-U15540-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CH/CHP5-B/CHP53...7Q.Seq.d/ Representative seq. ID CHP537P (Link to Original site) Representative DNA sequence >CHP537 (CHP53...7Q) /CSM/CH/CHP5-B/CHP537Q.Seq.d/ ACTGTTGGCCTACTGGGGTAAACTAATTAACACACAAAAATAAAAATAAAAAAAAAAAAA

  6. Dicty_cDB: CHP535 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP535 (Link to dictyBase) - - - Contig-U16475-1 | Contig-U16524-1 CHP53...5P (Link to Original site) CHP535F 213 CHP535Z 459 CHP535P 652 - - Show CHP535 Library CH (Link to library) Clone ID CHP53...75-1 | Contig-U16524-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CH/CHP5-B/CHP53...5Q.Seq.d/ Representative seq. ID CHP535P (Link to Original site) Representative DNA sequence >CHP535 (CHP53...5Q) /CSM/CH/CHP5-B/CHP535Q.Seq.d/ ACTGTTGGCCTACTGGNATGATTATTATAATTCAAATTAAAAATATATTATATAAATATA

  7. Dicty_cDB: CHP533 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP533 (Link to dictyBase) - - - Contig-U13117-1 | Contig-U15928-1 CHP53...3P (Link to Original site) CHP533F 113 CHP533Z 753 CHP533P 846 - - Show CHP533 Library CH (Link to library) Clone ID CHP53...17-1 | Contig-U15928-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CH/CHP5-B/CHP53...3Q.Seq.d/ Representative seq. ID CHP533P (Link to Original site) Representative DNA sequence >CHP533 (CHP53...3Q) /CSM/CH/CHP5-B/CHP533Q.Seq.d/ TTANTTAAAAAGATNGATANTAAATCAAAGGGGAAANCAGTTNTNGAANGTAATNCNTTA

  8. Dicty_cDB: CHP633 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP633 (Link to dictyBase) - - - Contig-U16496-1 - (Link to Original site) CHP63...3F 647 - - - - - - Show CHP633 Library CH (Link to library) Clone ID CHP633 (Link to dicty...iol.tsukuba.ac.jp/CSM/CH/CHP6-B/CHP633Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >CHP633 (CHP633Q) /CSM/CH/CHP6-B/CHP633Q.Seq.d/ CTGTTGGCCTATTGGNA...nt alignments: (bits) Value CHP633 (CHP633Q) /CSM/CH/CHP6-B/CHP633Q.Seq.d/ 749 0.0 AFA385 (AFA385Q) /CSM/AF/

  9. Dicty_cDB: CHP636 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP636 (Link to dictyBase) - - - Contig-U15337-1 - (Link to Original site) - - CHP63...6Z 448 - - - - Show CHP636 Library CH (Link to library) Clone ID CHP636 (Link to dicty...iol.tsukuba.ac.jp/CSM/CH/CHP6-B/CHP636Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >CHP636 (CHP636Q) /CSM/CH/CHP6-B/CHP636Q.Seq.d/ XXXXXXXXXXGCCNCCC...cDNA Score E Sequences producing significant alignments: (bits) Value CHP636 (CHP636Q) /CSM/CH/CHP6-B/CHP636

  10. Dicty_cDB: CHP634 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP634 (Link to dictyBase) - - - Contig-U11045-1 - (Link to Original site) - - CHP63...4Z 693 - - - - Show CHP634 Library CH (Link to library) Clone ID CHP634 (Link to dicty...iol.tsukuba.ac.jp/CSM/CH/CHP6-B/CHP634Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >CHP634 (CHP634Q) /CSM/CH/CHP6-B/CHP634Q.Seq.d/ XXXXXXXXXXTAAATTT...ant alignments: (bits) Value CHP634 (CHP634Q) /CSM/CH/CHP6-B/CHP634Q.Seq.d/ 551 e

  11. Dicty_cDB: CHP632 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP632 (Link to dictyBase) - - - Contig-U16510-1 | Contig-U16524-1 CHP63...2P (Link to Original site) CHP632F 204 CHP632Z 220 CHP632P 404 - - Show CHP632 Library CH (Link to library) Clone ID CHP63...10-1 | Contig-U16524-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CH/CHP6-B/CHP63...2Q.Seq.d/ Representative seq. ID CHP632P (Link to Original site) Representative DNA sequence >CHP632 (CHP63...2Q) /CSM/CH/CHP6-B/CHP632Q.Seq.d/ CTGTTGGCCTACTGGNAAAAAAATATTCAACTCAGTAATAATAATAATAAAAATAATAAC

  12. Mississippi State University Cooling, Heating, and Power (Micro-CHP) and Bio-Fuel Center

    Energy Technology Data Exchange (ETDEWEB)

    Mago, Pedro [Mississippi State Univ., Mississippi State, MS (United States); Newell, LeLe [Mississippi State Univ., Mississippi State, MS (United States)

    2014-01-31

    Between 2008 and 2014, the U.S. Department of Energy funded the MSU Micro-CHP and Bio-Fuel Center located at Mississippi State University. The overall objective of this project was to enable micro-CHP (micro-combined heat and power) utilization, to facilitate and promote the use of CHP systems and to educate architects, engineers, and agricultural producers and scientists on the benefits of CHP systems. Therefore, the work of the Center focused on the three areas: CHP system modeling and optimization, outreach, and research. In general, the results obtained from this project demonstrated that CHP systems are attractive because they can provide energy, environmental, and economic benefits. Some of these benefits include the potential to reduce operational cost, carbon dioxide emissions, primary energy consumption, and power reliability during electric grid disruptions. The knowledge disseminated in numerous journal and conference papers from the outcomes of this project is beneficial to engineers, architects, agricultural producers, scientists and the public in general who are interested in CHP technology and applications. In addition, more than 48 graduate students and 23 undergraduate students, benefited from the training and research performed in the MSU Micro-CHP and Bio-Fuel Center.

  13. CHP Integrated with Burners for Packaged Boilers

    Energy Technology Data Exchange (ETDEWEB)

    Castaldini, Carlo; Darby, Eric

    2013-09-30

    The objective of this project was to engineer, design, fabricate, and field demonstrate a Boiler Burner Energy System Technology (BBEST) that integrates a low-cost, clean burning, gas-fired simple-cycle (unrecuperated) 100 kWe (net) microturbine (SCMT) with a new ultra low-NOx gas-fired burner (ULNB) into one compact Combined Heat and Power (CHP) product that can be retrofit on new and existing industrial and commercial boilers in place of conventional burners. The Scope of Work for this project was segmented into two principal phases: (Phase I) Hardware development, assembly and pre-test and (Phase II) Field installation and demonstration testing. Phase I was divided into five technical tasks (Task 2 to 6). These tasks covered the engineering, design, fabrication, testing and optimization of each key component of the CHP system principally, ULNB, SCMT, assembly BBEST CHP package, and integrated controls. Phase I work culminated with the laboratory testing of the completed BBEST assembly prior to shipment for field installation and demonstration. Phase II consisted of two remaining technical tasks (Task 7 and 8), which focused on the installation, startup, and field verification tests at a pre-selected industrial plant to document performance and attainment of all project objectives. Technical direction and administration was under the management of CMCE, Inc. Altex Technologies Corporation lead the design, assembly and testing of the system. Field demonstration was supported by Leva Energy, the commercialization firm founded by executives at CMCE and Altex. Leva Energy has applied for patent protection on the BBEST process under the trade name of Power Burner and holds the license for the burner currently used in the product. The commercial term Power Burner is used throughout this report to refer to the BBEST technology proposed for this project. The project was co-funded by the California Energy Commission and the Southern California Gas Company (SCG), a

  14. Exploring Challenges and Opportunities for Eco-Feedback Technology

    DEFF Research Database (Denmark)

    Verdezoto, Nervo

    This position paper explores challenges and opportunities for eco-feedback technology. Drawing on two design cases, I discuss the importance of supporting active participation as well as the articulation of work in everyday practices to facilitate reduction of consumption.......This position paper explores challenges and opportunities for eco-feedback technology. Drawing on two design cases, I discuss the importance of supporting active participation as well as the articulation of work in everyday practices to facilitate reduction of consumption....

  15. Technology seduction: lost opportunities in child health?

    Science.gov (United States)

    Stanley, F J; Kurinczuk, J J

    1995-08-01

    This report examines the extent to which illness-based individual care and expensive, often unevaluated, technologies in paediatrics have seduced practitioners away from more cost-effective, population-based child health activities and examples of new and unevaluated technologies in perinatology and paediatrics are given. The way in which these technologies are introduced and taken up, by 'creeping incrementalism', is described and a plea is made to implement only those aspects of paediatric care that have been demonstrated to be effective. This would result in only appropriate technologies being used, avoid harm being done to children and ensure that money is available for other effective population-based activities that improve child health.

  16. Licensing Opportunities for NIH, CDC & FDA Technologies

    Data.gov (United States)

    U.S. Department of Health & Human Services — This dataset represents all technologies available for licensing from the National Institutes of Health (NIH), the Food and Drug Administration (FDA), and the Center...

  17. The Next Wave of Technologies Opportunities from Chaos

    CERN Document Server

    Simon, Phil

    2010-01-01

    Your all-inclusive guide to all the latest technologies. Providing you with a better understanding of the latest technologies, including Cloud Computing, Software as a Service, Service-Oriented Architecture (SOA), Open Source, Mobile Computing, Social Networking, and Business Intelligence, The Next Wave of Technologies: Opportunities from Chaos helps you know which questions to ask when considering if a specific technology is right for your organization.: Demystifies powerful but largely misunderstood technologies; Explains how each technology works; Provides key guidance on determining if a p

  18. Changing Technologies Offer New Opportunities in the Plant Sciences

    Directory of Open Access Journals (Sweden)

    Theresa M. Culley

    2013-01-01

    Full Text Available The plant sciences are now facing an unprecedented time in our history in which technology is advancing at a rapid pace, creating a wide variety of novel opportunities for our field. Applications in Plant Sciences is a new source for sharing exciting and innovative applications of new technologies that have the potential to propel plant research forward into the future.

  19. Technology opportunities in a restructured electric industry

    Energy Technology Data Exchange (ETDEWEB)

    Gehl, S.

    1995-12-31

    This paper describes the Strategic Research & Development (SR&D) program of the Electric Power Research Institute (EPRI). The intent of the program is to anticipate and shape the scientific and technological future of the electricity enterprise. SR&D serves those industry R&D needs that are more exploratory, precompetitive, and longer-term. To this end, SR&D seeks to anticipate technological change and, where possible, shape that change to the advantage of the electric utility enterprise and its customers. SR&D`s response to this challenge is research and development program that addresses the most probable future of the industry, but at the same time is robust against alternative futures. The EPRI SR&D program is organized into several vectors, each with a mission that relates directly to one or more EPRI industry goals, which are summarized in the paper. 1 fig., 2 tabs.

  20. Emerging technologies in bioremediation: constraints and opportunities.

    Science.gov (United States)

    Rayu, Smriti; Karpouzas, Dimitrios G; Singh, Brajesh K

    2012-11-01

    Intensive industrialisation, inadequate disposal, large-scale manufacturing activities and leaks of organic compounds have resulted in long-term persistent sources of contamination of soil and groundwater. This is a major environmental, policy and health issue because of adverse effects of contaminants on humans and ecosystems. Current technologies for remediation of contaminated sites include chemical and physical remediation, incineration and bioremediation. With recent advancements, bioremediation offers an environmentally friendly, economically viable and socially acceptable option to remove contaminants from the environment. Three main approaches of bioremediation include use of microbes, plants and enzymatic remediation. All three approaches have been used with some success but are limited by various confounding factors. In this paper, we provide a brief overview on the approaches, their limitations and highlights emerging technologies that have potential to revolutionise the enzymatic and plant-based bioremediation approaches.

  1. Challenges and opportunities of torrefaction technology

    Science.gov (United States)

    Kosov, V. F.; Kuzmina, J. S.; Sytchev, G. A.; Zaichenko, V. M.

    2016-11-01

    Since the active exploitation and usage of classical non-renewable energy resources the most promising direction is the development of technologies of heat and electricity production from renewable sources—biomass. This is important in terms of reducing the harmful man-made influence of fuel-and-energy sector on the ecological balance. One of the most important aims when using biomass is its pre-treatment. The paper describes the fuel preliminary preparation for combustion with such technological process as torrefaction. Torrefaction allows bringing the biomass fuel as close as it possible to fossil coals for the main thermotechnical parameters. During torrefaction moisture is removed from initial material and the partial thermal decomposition of its components appears. The final torrefied product can be recommended for utilization in existing coal-fired boilers without their major reconstruction. Thus torrefaction technology enables the partial or complete replacement of fossil coal. At JIHT RAS, a torrefaction pilot plant is developed. As heat transfer medium the gas-piston engine exhaust gases were used. Results of researching and proposals for further development are showed in this paper.

  2. Dicty_cDB: CHP637 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP637 (Link to dictyBase) - - - Contig-U10836-1 - (Link to Original site) CHP63...7F 590 - - - - - - Show CHP637 Library CH (Link to library) Clone ID CHP637 (Link to dicty...iol.tsukuba.ac.jp/CSM/CH/CHP6-B/CHP637Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >CHP637 (CHP637Q) /CSM/CH/CHP6-B/CHP637Q.Seq.d/ ACTGTTGGCCTACTGGN... %: vacuolar 4.0 %: mitochondrial 4.0 %: nuclear 4.0 %: endoplasmic reticulum >> prediction for CHP637 is exc 5' end seq. ID CHP63

  3. Putney Basketville Site Biomass CHP Analysis

    Energy Technology Data Exchange (ETDEWEB)

    Hunsberger, Randolph [National Renewable Energy Lab. (NREL), Golden, CO (United States); Mosey, Gail [National Renewable Energy Lab. (NREL), Golden, CO (United States)

    2013-10-01

    The U.S. Environmental Protection Agency (EPA) Office of Solid Waste and Emergency Response Center for Program Analysis developed the RE-Powering America's Land initiative to reuse contaminated sites for renewable energy generation when aligned with the community's vision for the site. The Putney, Vermont, Basketville site, formerly the location of a basket-making facility and a paper mill andwoolen mill, was selected for a feasibility study under the program. Biomass was chosen as the renewable energy resource based on abundant woody-biomass resources available in the area. Biomass combined heat and power (CHP) was selected as the technology due to nearby loads, including Putney Paper and Landmark College.

  4. Complex plasmas scientific challenges and technological opportunities

    CERN Document Server

    Lopez, Jose; Becker, Kurt; Thomsen, Hauke

    2014-01-01

    This book provides the reader with an introduction to the physics of complex plasmas, a discussion of the specific scientific and technical challenges they present, and an overview of their potential technological applications. Complex plasmas differ from conventional high-temperature plasmas in several ways: they may contain additional species, including nanometer- to micrometer-sized particles, negative ions, molecules and radicals, and they may exhibit strong correlations or quantum effects. This book introduces the classical and quantum mechanical approaches used to describe and simulate complex plasmas. It also covers some key experimental techniques used in the analysis of these plasmas, including calorimetric probe methods, IR absorption techniques and X-ray absorption spectroscopy. The final part of the book reviews the emerging applications of microcavity and microchannel plasmas, the synthesis and assembly of nanomaterials through plasma electrochemistry, the large-scale generation of ozone using mi...

  5. [New technologies: support opportunities for network research].

    Science.gov (United States)

    Rodríguez-Martín, A; Novalbos Ruiz, J P; Jiménez-Rodríguez, R; Jiménez-Rodríguez, A

    2012-11-01

    The consolidation of a support area for network research, which promotes collaborative research, training and the dissemination of knowledge through the use of ICTs, requires the organization of a work methodology to share and exchange resources in a specific network that is already running. The establishment of communication mechanisms between researchers from different groups will be necessary along with the introduction of the ICTs in the teaching and advanced environments of research training, different inventories of the research resources that are available for exchanges and shared use between groups and laboratories, and finally, a shared scientific documentation system with the appropriate maintenance of the previously listed tools. Large administrative structures and detailed plans are not needed to comply with all of the above functions. The availability of effective tools, however, to combine efforts and search for resources in all of these areas is needed, with the agility and flexibility that allow us to currently use new communication and information technologies. The results of this research support area should lead to an increase in the efficacy and quality of the network by increasing the flow of information and the inter-group collaboration in teaching, research and professional development, along with the transfer and dissemination of research results.

  6. Dicty_cDB: CHP167 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP167 (Link to dictyBase) - - - Contig-U16471-1 - (Link to Original site) - - CHP16...7Z 703 - - - - Show CHP167 Library CH (Link to library) Clone ID CHP167 (Link to dicty...iol.tsukuba.ac.jp/CSM/CH/CHP1-C/CHP167Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >CHP167 (CHP167Q) /CSM/CH/CHP1-C/CHP167Q.Seq.d/ XXXXXXXXXXGAAATTG...chondrial 4.0 %: cytoskeletal >> prediction for CHP167 is nuc 5' end seq. ID - 5' end seq. - Length of 5' en

  7. Mobile Technologies Enhance the E-Learning Opportunity

    Science.gov (United States)

    Chuang, Keh-Wen

    2009-01-01

    The objective of this paper is to identify the mobile technologies that enhance the E-Learning opportunity, examine the educational benefits and implementation issues in mobile learning, discuss the guidelines for implementing effective mobile learning, identify the current application and operation of mobile learning, and discuss the future of…

  8. Entry and Technological Performance in New Technology Domains : Technological Opportunities, Technology Competition and Technological Relatedness

    NARCIS (Netherlands)

    Leten, B.; Belderbos, R.; Van Looy, B.

    2016-01-01

    Entry and success in new technology domains (NTDs) is essential for firms' long-term performance. We argue that firms' choices to enter NTDs and their subsequent performance in these domains are not only governed by firm-level factors but also by environmental characteristics. Entry is encouraged by

  9. Dicty_cDB: CHP159 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP159 (Link to dictyBase) - - - Contig-U15743-1 CHP159P (Link... to Original site) CHP159F 653 CHP159Z 743 CHP159P 1376 - - Show CHP159 Library CH (Link to library) Clone ID CHP159 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15743-1 Original site URL http://dict...TSTKXLSLDQVSLIVSIVFHHHVESSKRLQNQXKVNQAGSLVKKENLLALIKILH FDQSINRQQLNSILVQICTFSDNREELLCYILQILTGYQSIVSQQPQRKTAE...HHHVESSKRLQNQXKVNQAGSLVKKENLLALIKILH FDQSINRQQLNSILVQICTFSDNREELLCYILQILTGYQSIVSQ

  10. Mobile display technologies: Past developments, present technologies, and future opportunities

    Science.gov (United States)

    Ohshima, Hiroyuki

    2014-01-01

    It has been thirty years since the first active matrix (AM) flat panel display (FPD) was industrialized for portable televisions (TVs) in 1984. The AM FPD has become a dominant electronic display technology widely used from mobile displays to large TVs. The development of AM FPDs for mobile displays has significantly changed our lives by enabling new applications, such as notebook personal computers (PCs), smartphones and tablet PCs. In the future, the role of mobile displays will become even more important, since mobile displays are the live interface for the world of mobile communications in the era of ubiquitous networks. Various developments are being conducted to improve visual performance, reduce power consumption and add new functionality. At the same time, innovative display concepts and novel manufacturing technologies are being investigated to create new values.

  11. CHP Fuel Cell Durability Demonstration - Final Report

    Energy Technology Data Exchange (ETDEWEB)

    Petrecky, James; Ashley, Christopher J

    2014-07-21

    Plug Power has managed a demonstration project that has tested multiple units of its high-temperature, PEM fuel cell system in micro-combined heat and power (μ-CHP) applications in California. The specific objective of the demonstration project was to substantiate the durability of GenSys Blue, and, thereby, verify its technology and commercial readiness for the marketplace. In the demonstration project, Plug Power, in partnership with the National Fuel Cell Research Center (NFCRC) at the University of California, Irvine (UCI), and Sempra, will execute two major tasks: • Task 1: Internal durability/reliability fleet testing. Six GenSys Blue units will be built and will undergo an internal test regimen to estimate failure rates. This task was modified to include 3 GenSys Blue units installed in a lab at UCI. • Task 2: External customer testing. Combined heat and power units will be installed and tested in real-world residential and/or light commercial end user locations in California.

  12. Opportunities for Combined Heat and Power in Data Centers

    Energy Technology Data Exchange (ETDEWEB)

    Darrow, Ken [ICF International; Hedman, Bruce [ICF International

    2009-03-01

    Data centers represent a rapidly growing and very energy intensive activity in commercial, educational, and government facilities. In the last five years the growth of this sector was the electric power equivalent to seven new coal-fired power plants. Data centers consume 1.5% of the total power in the U.S. Growth over the next five to ten years is expected to require a similar increase in power generation. This energy consumption is concentrated in buildings that are 10-40 times more energy intensive than a typical office building. The sheer size of the market, the concentrated energy consumption per facility, and the tendency of facilities to cluster in 'high-tech' centers all contribute to a potential power infrastructure crisis for the industry. Meeting the energy needs of data centers is a moving target. Computing power is advancing rapidly, which reduces the energy requirements for data centers. A lot of work is going into improving the computing power of servers and other processing equipment. However, this increase in computing power is increasing the power densities of this equipment. While fewer pieces of equipment may be needed to meet a given data processing load, the energy density of a facility designed to house this higher efficiency equipment will be as high as or higher than it is today. In other words, while the data center of the future may have the IT power of ten data centers of today, it is also going to have higher power requirements and higher power densities. This report analyzes the opportunities for CHP technologies to assist primary power in making the data center more cost-effective and energy efficient. Broader application of CHP will lower the demand for electricity from central stations and reduce the pressure on electric transmission and distribution infrastructure. This report is organized into the following sections: (1) Data Center Market Segmentation--the description of the overall size of the market, the size and

  13. Emerging Issues and Opportunities in Health Information Technology.

    Science.gov (United States)

    Nardi, Elizabeth A; Lentz, Lisa Korin; Winckworth-Prejsnar, Katherine; Abernethy, Amy P; Carlson, Robert W

    2016-10-01

    When used effectively, health information technology (HIT) can transform clinical care and contribute to new research discoveries. Despite advances in HIT and increased electronic health record adoption, many challenges to optimal use, interoperability, and data sharing exist. Data standardization across systems is limited, and scanned medical note documents result in unstructured data that make reporting on quality measures for reimbursement burdensome. Different policies and initiatives, including the Health Information Technology for Economic and Clinical Health Act, the Medicare Access and CHIP Reauthorization Act, and the National Cancer Moonshot initiative, among others, all recognize the impact that HIT can have on cancer care. Given the growing role HIT plays in health care, it is vital to have effective and efficient HIT systems that can exchange information, collect credible data that is analyzable at the point of care, and improves the patient-provider relationship. In June 2016, NCCN hosted the Emerging Issues and Opportunities in Health Information Technology Policy Summit. The summit addressed challenges, issues, and opportunities in HIT as they relate to cancer care. Keynote presentations and panelists discussed moving beyond Meaningful Use, HIT readiness to support and report on quality care, the role of HIT in precision medicine, the role of HIT in the National Cancer Moonshot initiative, and leveraging HIT to improve quality of clinical care.

  14. Procuring Stationary Fuel Cells For CHP: A Guide for Federal Facility Decision Makers

    Energy Technology Data Exchange (ETDEWEB)

    Stinton, David P [ORNL; McGervey, Joseph [SRA International, Inc.; Curran, Scott [ORNL

    2011-11-01

    Federal agency leaders are expressing growing interest in using innovative fuel cell combined heat and power (CHP) technology at their sites, motivated by both executive branch sustainability targets and a desire to lead by example in the transition to a clean energy economy. Fuel cell CHP can deliver reliable electricity and heat with 70% to 85% efficiency. Implementing this technology can be a high efficiency, clean energy solution for agencies striving to meet ambitious sustainability requirements with limited budgets. Fuel cell CHP systems can use natural gas or renewable fuels, such as biogas. Procuring Stationary Fuel Cells for CHP: A Guide for Federal Facility Decision Makers presents an overview of the process for planning and implementing a fuel cell CHP project in a concise, step-by-step format. This guide is designed to help agency leaders turn their interest in fuel cell technology into successful installations. This guide concentrates on larger (100 kW and greater) fuel cell CHP systems and does not consider other fuel cell applications such as cars, forklifts, backup power supplies or small generators (<100 kW). Because fuel cell technologies are rapidly evolving and have high up front costs, their deployment poses unique challenges. The electrical and thermal output of the CHP system must be integrated with the building s energy systems. Innovative financing mechanisms allow agencies to make a make versus buy decision to maximize savings. This guide outlines methods that federal agencies may use to procure fuel cell CHP systems with little or no capital investment. Each agency and division, however, has its own set of procurement procedures. This guide was written as a starting point, and it defers to the reader s set of rules if differences exist. The fuel cell industry is maturing, and project developers are gaining experience in working with federal agencies. Technology improvements, cost reductions, and experienced project developers are making

  15. Modeling of non-linear CHP efficiency curves in distributed energy systems

    DEFF Research Database (Denmark)

    Milan, Christian; Stadler, Michael; Cardoso, Gonçalo

    2015-01-01

    Distributed energy resources gain an increased importance in commercial and industrial building design. Combined heat and power (CHP) units are considered as one of the key technologies for cost and emission reduction in buildings. In order to make optimal decisions on investment and operation...... approaches are formulated using binary and Special-Ordered-Set (SOS) variables. Both suggestions have been implemented into the optimization model DER–CAM to simulate investment decisions of CHP micro-turbines and CHP fuel cells with variable efficiencies. The approaches have further been applied...... successfully in a case study with four different commercial buildings. Comparison of the results between the standard version and the new approaches indicate that total annual system costs remain almost unchanged. System performance is subject to change and storage technologies become more important. Part load...

  16. Push Technology on the Net: Threat or Opportunity for the Online Searcher?

    Science.gov (United States)

    Helfer, Joe

    1997-01-01

    Analyzes whether push technology is a threat or opportunity for online searchers. Outlines key functions of push technology products and defines key technology terms. Illustrates how the role of the online searcher changes with push technology. (AEF)

  17. Sustainable ground transportation – review of technologies, challenges and opportunities

    Energy Technology Data Exchange (ETDEWEB)

    Agarwal, Ramesh K. [Department of Mechanical Engineering and Materials Science, Washington University, St. Louis, MO 63130 (United States)

    2013-07-01

    Currently there are nearly 750 million ground vehicles in service worldwide. They are responsible for 50% of petroleum (oil) consumption and 60% of all greenhouse gas (GHG) emissions worldwide. The number of vehicles is forecasted to double by 2050. Therefore the environmental issues such as noise, emissions and fuel burn have become important for energy and environmental sustainability. This paper provides an overview of specific energy and environmental issues related to ground transportation. The technologies related to reduction in energy requirements such as reducing the vehicle mass by using the high strength low weight materials and reducing the viscous drag by active flow control and smoothing the operational profile, and reducing the contact friction by special tire materials are discussed along with the portable energy sources for reducing the GHG emissions such as low carbon fuels (biofuels), Lithium-ion batteries with high energy density and stability, and fuel cells. The technological challenges and opportunities for innovations are discussed.

  18. Sustainable ground transportation – review of technologies, challenges and opportunities

    Directory of Open Access Journals (Sweden)

    Ramesh K. Agarwal

    2013-01-01

    Full Text Available Currently there are nearly 750 million ground vehicles in service worldwide. They are responsible for 50% of petroleum (oil consumption and 60% of all greenhouse gas (GHG emissions worldwide. The number of vehicles is forecasted to double by 2050. Therefore the environmental issues such as noise, emissions and fuel burn have become important for energy and environmental sustainability. This paper provides an overview of specific energy and environmental issues related to ground transportation. The technologies related to reduction in energy requirements such as reducing the vehicle mass by using the high strength low weight materials and reducing the viscous drag by active flow control and smoothing the operational profile, and reducing the contact friction by special tire materials are discussed along with the portable energy sources for reducing the GHG emissions such as low carbon fuels (biofuels, Lithium-ion batteries with high energy density and stability, and fuel cells. The technological challenges and opportunities for innovations are discussed.

  19. 330 kWe Packaged CHP System with Reduced Emissions

    Energy Technology Data Exchange (ETDEWEB)

    Plahn, Paul [Cummins Power Generation, Minneapolis, MN (United States); Keene, Kevin [Cummins Power Generation, Minneapolis, MN (United States); Pendray, John [Cummins Power Generation, Minneapolis, MN (United States)

    2015-03-31

    The objective of this project was to develop a flexible, 330 kWe packaged Combined Heat and Power (CHP) system that can be deployed to commercial and light industrial applications at a lower total cost of ownership than current CHP solutions. The project resulted in a CHP system that is easy to use and inexpensive to install, offering world class customer support, while providing a low-emissions, higher-efficiency internal combustion engine for a CHP system of this size.

  20. CHP REGIONAL APPLICATION CENTERS: A PRELIMINARY INVENTORY OF ACTIVITIES AND SELECTED RESULTS

    Energy Technology Data Exchange (ETDEWEB)

    Schweitzer, Martin [ORNL

    2009-10-01

    Eight Regional CHP Application Centers (RACs) are funded by the U.S. Department of Energy (DOE) to facilitate the development and deployment of Combined Heat and Power (CHP) technologies in all 50 states. The RACs build end-user awareness by providing CHP-related information to targeted markets through education and outreach; they work with the states and regulators to encourage the creation and adoption of favorable public policies; and they provide CHP users and prospective users with technical assistance and support on specific projects. The RACs were started by DOE as a pilot program in 2001 to support the National CHP Roadmap developed by industry to accelerate deployment of energy efficient CHP technologies (U.S. Combined Heat and Power Association 2001). The intent was to foster a regional presence to build market awareness, address policy issues, and facilitate project development. Oak Ridge National Laboratory (ORNL) has supported DOE with the RAC program since its inception. In 2007, ORNL led a cooperative effort involving DOE and some CHP industry stakeholders to establish quantitative metrics for measuring the RACs accomplishments. This effort incorporated the use of logic models to define and describe key RAC activities, outputs, and outcomes. Based on this detailed examination of RAC operations, potential metrics were identified associated with the various key sectors addressed by the RACs: policy makers; regulatory agencies; investor owned utilities; municipal and cooperative utilities; financiers; developers; and end users. The final product was reviewed by a panel of representatives from DOE, ORNL, RACs, and the private sector. The metrics developed through this effort focus on major RAC activities as well as on CHP installations and related outcomes. All eight RACs were contacted in August 2008 and asked to provide data for every year of Center operations for those metrics on which they kept records. In addition, data on CHP installations and

  1. Combined Heat and Power (CHP) as a Compliance Option under the Clean Power Plan: A Template and Policy Options for State Regulators

    Energy Technology Data Exchange (ETDEWEB)

    None

    2015-07-30

    Combined Heat and Power (CHP) is an important option for states to consider in developing strategies to meet their emission targets under the US Environmental Protection Agency's Clean Power Plan. This Template is designed to highlight key issues that states should consider when evaluating whether CHP could be a meaningful component of their compliance plans. It demonstrates that CHP can be a valuable approach for reducing emissions and helping states achieve their targets. While the report does not endorse any particular approach for any state, and actual plans will vary dependent upon state-specific factors and determinations, it provides tools and resources that states can use to begin the process, and underscores the opportunity CHP represents for many states. . By producing both heat and electricity from a single fuel source, CHP offers significant energy savings and carbon emissions benefits over the separate generation of heat and power, with a typical unit producing electricity with half the emissions of conventional generation. These efficiency gains translate to economic savings and enhanced competitiveness for CHP hosts, and emissions reductions for the state, along with helping to lower electric bills; and creating jobs in the design, construction, installation and maintenance of equipment. In 2015, CHP represents 8 percent of electric capacity in the United States and provides 12 percent of total power generation. Projects already exist in all 50 states, but significant technical and economic potential remains. CHP offers a tested way for states to achieve their emission limits while advancing a host of ancillary benefits.

  2. Wearable Training Monitoring Technology: Applications, Challenges and Opportunities.

    Science.gov (United States)

    Cardinale, Marco; Varley, Matthew C

    2016-11-11

    The need to quantify aspects of training in order to improve training prescription has been the holy grail of sport scientists and coaches for many years. Recently, there has been an increase in scientific interest, possibly due to technological advancements and better equipment to quantify training activities. Over the last few years there has been an increase in the number of studies assessing training load in various athletic cohorts with a bias towards subjective reports and/or quantifications of external load. It is evident the lack of extensive longitudinal studies employing objective internal load measurements possibly due to the cost/effectiveness and the invasiveness of measures necessary to quantify objective internal loads. Advances in technology might help in developing better wearable tools able to ease the difficulties and costs associated with conducting longitudinal observational studies in athletic cohorts and possibly provide better information on the biological implications of specific external load patterns. Considering the recent technological developments for monitoring training load and the extensive use of various tools for research and applied work, the aim of this work was to review applications, challenges and opportunities of various wearable technologies.

  3. Modeling work of a small scale gasifier/SOFC CHP system

    Energy Technology Data Exchange (ETDEWEB)

    Liu, M.; Aravind, P.V.; Qu, Z.; Woudstra, N.; Verkooijen, A.H.M. [Delft University of Technology (Netherlands). Dept. of Mechanical Engineering], Emails: ming.liu@tudelft.nl, p.v.aravind@tudelft.nl, z.qu@tudelft.nl, n.woudstra@tudelft.nl, a. h. m. verkooijen@tudelft.nl; Cobas, V.R.M. [Federal University of Itajuba (UNIFEI), Pinheirinhos, MG (Brazil). Dept. of Mechanical Engineering], E-mail: vlad@unifei.edu.br

    2009-07-01

    For a highly efficient biomass gasification/Solid Oxide Fuel Cell (SOFC) Combined Heat and Power (CHP) generation system, the gasifier, the accompanying gas cleaning technologies and the CHP unit must be carefully designed as an integrated unit. This paper describes such a system involving a two-stage fixed-bed down draft gasifier, a SOFC CHP unit and a gas cleaning system. A gas cleaning system with both low temperature and high temperature sections is proposed for coupling the gasifier and the SOFC. Thermodynamic modeling was carried out for the gasifier/SOFC system with the proposed gas cleaning system. The net AC electrical efficiency of this system is around 30% and the overall system efficiency is around 60%. This paper also describes various exergy losses in the system and the future plans for integrated gasifier-GCU-SOFC experiments from which the results will be used to validate the modeling results of this system. (author)

  4. Ecological assessment of new CHP systems and their combination; Oekologische Bewertung neuer WKK-Systeme und Systemkombinationen - Schlussbericht

    Energy Technology Data Exchange (ETDEWEB)

    Primas, A.

    2007-07-01

    This final report for the Swiss Federal Office of Energy (SFOE) reports on new developments in the Combined Heat and Power (CHP) generation area. The objective of this study is an ecological and technical evaluation of various CHP systems and system combinations. These also include suitable combinations with other technologies. Systems for five different temperature levels are quantified according to their environmental impact. Various possible applications are compared with a highly efficient reference system using separate heat and power generation - a combined-cycle plant and a heat pump. For chilled water production a combination of the CHP system with an absorption chiller is investigated. The results of the investigations are presented and commented on. Also, advantageous applications of CHP systems are noted.

  5. Technology solutions for a global business. Opportunities and challenges

    Energy Technology Data Exchange (ETDEWEB)

    Warren, Tim

    2000-07-01

    Shell's relationship with Norway goes back a long way and is very important to our future as well, as is evident from this presentation, which describes some of the pressures on a global energy business like Shell. It also deals with the fundamental importance of technology in the way we respond to those pressures. The power of innovation, and of partnerships, in keeping us at the front of the wave and, using our experiences, it is described how we at Shell deal with these issues. It also gives some examples of the benefits that have come out of our partnerships here in Norway, and the challenges and opportunities confronting those partnerships in the future.

  6. Integrated Advanced Reciprocating Internal Combustion Engine System for Increased Utilization of Gaseous Opportunity Fuels

    Energy Technology Data Exchange (ETDEWEB)

    Pratapas, John; Zelepouga, Serguei; Gnatenko, Vitaliy; Saveliev, Alexei; Jangale, Vilas; Li, Hailin; Getz, Timothy; Mather, Daniel

    2013-08-31

    The project is addressing barriers to or opportunities for increasing distributed generation (DG)/combined heat and power (CHP) use in industrial applications using renewable/opportunity fuels. This project brings together novel gas quality sensor (GQS) technology with engine management for opportunity fuels such as landfill gas, digester gas and coal bed methane. By providing the capability for near real-time monitoring of the composition of these opportunity fuels, the GQS output can be used to improve the performance, increase efficiency, raise system reliability, and provide improved project economics and reduced emissions for engines used in distributed generation and combined heat and power.

  7. Opportunities & Challenges for Green Technology in 21st Century

    OpenAIRE

    Aithal, Sreeramana; Aithal, Shubhrajyotsna

    2016-01-01

    Technology has affected the society and its surroundings in many ways and helped to develop more advanced economies including today's global economy. Science has contributed many technologies to the society which include Aircraft technology, Automobile technology, Biotechnology, Computer technology, Telecommunication technology, Internet technology, Renewable energy technology, Atomic & Nuclear technology, Nanotechnology, Space technology etc. have changed the lifestyle of the people ...

  8. Challenges and opportunities in polymer technology applied to veterinary medicine.

    Science.gov (United States)

    Bermudez, J M; Cid, A G; Ramírez-Rigo, M V; Quinteros, D; Simonazzi, A; Sánchez Bruni, S; Palma, S

    2014-04-01

    An important frontier in the administration of therapeutic drugs to veterinary species is the use of different polymers as drug delivery platforms. The usefulness of polymers as platforms for the administration of pharmaceutical and agricultural agents has been clearly recognized in the recent decades. The chemical versatility of polymers and the wide range of developed controlled-release strategies enhance the possibilities for the formulation of active molecules. In particular, the veterinary area offers opportunities for the development of novel controlled-release drug delivery technologies adapted to livestock or companion animal health needs. In some cases, it also allows to improve profitability in meat production or to meet the safety criteria related to drug residues. A number of factors affect the selection of polymers and subsequent properties of the controlled-release drug delivery system. However, their selection also dictates the release kinetics of the drug from the delivery system. Such choices are therefore crucial as they affect the success and potential of the delivery system for achieving the therapeutic goals of the veterinarian. It is the intention of this review to give an overview of the most relevant polymers, which are used or have been tested as drug delivery release rate modifiers in the veterinary field. The article highlights some recent developments focusing on their advantages and applications and analyzes the future direction of the scientific and technological advancements in this area.

  9. Conceptual framework for the continuing circulation of small CHP-plants. IZES-Study: Further measures necessary; Rahmenbedingungen fuer die weitere Verbreitung von Klein-KWK-Anlagen. IZES-Studie: Weitere Massnahmen notwendig

    Energy Technology Data Exchange (ETDEWEB)

    Leprich, U.; Thiele, A. [Institut fuer ZukunftsEnergieSysteme (IZES), Saarbruecken (Germany)

    2004-07-01

    The incentives, created by the CHP law of March the 19th of 2002, are short- and medium term not sufficient to broadly introduce small CHP-plants in general - and future technologies like the fuel cell or a Stirling-motor in particular - on the market or at least to develop those to a state of market maturity. A further development or rather a flanking of the existing CHP law is urgently recommended. (orig.)

  10. Digital Technology and Mental Health Interventions: Opportunities and Challenges

    Directory of Open Access Journals (Sweden)

    Aguilera, Adrian

    2015-02-01

    Full Text Available The growth of the Internet, mobile phones, social media and other digital technologies has changed our world in many ways. It has provided individuals with information that was previously only available to a select few. An example of the reach of technology is data that as of October 2012, there are over 6 billion phones worldwide (BBC, 2012. The availability of data in real time has presented hopes of intervening more efficiently and managing health problems by leveraging limited human resources. It also has an impact in changing the roles of providers and patients and in legal and ethical issues including privacy in digital health interactions. This paper will discuss why digital technology has received recent attention in the area of mental health, present some applications of technology for mental health to date, explore the challenges to full implementation in clinical settings, and present future opportunities for digital technologies.El crecimiento del Internet, los teléfonos móviles, las redes sociales y otras tecnologías digitales ha cambiado nuestro mundo de muchas maneras. Ha proporcionado a las personas con la información que antes sólo estaba disponible para un grupo selecto, por ejemplo a partir de octubre de 2012. Un ejemplo del alcance de la tecnología son los datos que dicen que hay más de 6 millones de teléfonos en todo el mundo (BBC, 2012. La disponibilidad de los datos en tiempo real a presentado la esperanza de intervenir de manera más eficiente y manejar los problemas de salud los recursos humanos limitados. También tiene un impacto en el cambio de los roles de los proveedores y los pacientes y en aspectos legales y éticos, incluyendo la privacidad en las interacciones de salud digital. Este artículo discutirá unas razones por cual la tecnología digital ha recibido atención recientemente en el área de salud mental, presentará algunas aplicaciones de la tecnología para mejorar la salud mental hasta la fecha

  11. CHP plant reduces grain whisky costs

    Energy Technology Data Exchange (ETDEWEB)

    Forrester, R.

    1989-04-01

    Scottish Grain Distillers Limited operate one of the largest grain whisky spirit production units in Scotland at Port Dundas Distillery, Glasgow. In 1972, a treatment plant for the distillery residues was installed. This was a major user of steam and fuelled by oil. In 1983, prompted by spiralling oil price rises, changes in the plant were initiated resulting in a significant move away from steam to electricity as the main source of energy and replacing oil by gas as the boiler fuel. To further improve the economics, an on-site gas turbine combined heat and power (CHP) system has been installed, any excess power being exported to the national grid. Estimated savings achieved by the CHP system point to a payback of 5.2 years on the gross investment capital. (U.K.).

  12. Designing and control of a SOFC micro-CHP system

    DEFF Research Database (Denmark)

    Liso, Vincenzo

    component for steady-state operation were developed. System concepts and key performance parameters were identified. The models were used to evaluate optimal cell-stack power output, the impact of cell operating and design parameters, thermal energy recovery, system process design, and operating strategy...... results. Also, predominant modes of catalytic reforming were identified and modeled. System design evaluations reveal that methane-fueled SOFC systems demonstrate the highest electrical efficiency when coupled with a steam reformer process. The use of recycled cell exhaust gases in process design is found......-to-power ratio demonstrated in this study makes the SOFC-based micro-CHP systems a promising technology for energy conversion when compared to other well established technologies such as internal combustion engines or sterling engines. In particular, the range of heat-to-power ratio for the SOFC-based micro...

  13. CHP plant Legionowo Poland - Final report

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2004-12-01

    In 1997, a new Energy Law was passed in Poland. An important element of the law is that local energy planning is made obligatory. The law describes obligatory tasks and procedures for Polish municipalities related to planning and organisation of the energy sector. With the objective of supporting the Polish municipalities in their obligations according to the energy law of 1997, the project 'Energy Planning in Poland at Municipal Level - Support to Decision Makers' was launched. As part of the project, Municipal Guideline Reports have been elaborated for three model municipalities. These guidelines present the basis for the Energy Supply Plans in these municipalities. For the city of Legionowo, the following was recommended: 1. The planning processes initiated during the project should be continues/followed up, 2. Master Plan for the district heating system should be prepared, 3. The possibilities of establishment of a major natural gas-fired CHP plant of the Combined Cycle type should be investigated. The present report is the final Master Plan based on the following reports: Master Plan for Legionowo - Status Report; Master Plan for Legionowo - Hydraulic Analysis; CHP Plant Legionowo Poland - CHP Feasibility Analysis. The final Master Plan describes the status in the DH Company in Legionowo, possible improvements and an investment plan for the selected scenario. (BA)

  14. Innovative Technologies for Human Exploration: Opportunities for Partnerships and Leveraging Novel Technologies External to NASA

    Science.gov (United States)

    Hay, Jason; Mullins, Carie; Graham, Rachael; Williams-Byrd, Julie; Reeves, John D.

    2011-01-01

    Human spaceflight organizations have ambitious goals for expanding human presence throughout the solar system. To meet these goals, spaceflight organizations have to overcome complex technical challenges for human missions to Mars, Near Earth Asteroids, and other distant celestial bodies. Resolving these challenges requires considerable resources and technological innovations, such as advancements in human health and countermeasures for space environments; self-sustaining habitats; advanced power and propulsion systems; and information technologies. Today, government space agencies seek cooperative endeavors to reduce cost burdens, improve human exploration capabilities, and foster knowledge sharing among human spaceflight organizations. This paper looks at potential opportunities for partnerships and spin-ins from economic sectors outside the space industry. It highlights innovative technologies and breakthrough concepts that could have significant impacts on space exploration and identifies organizations throughout the broader economy that specialize in these technologies.

  15. New business opportunity: Green field project with new technology

    Directory of Open Access Journals (Sweden)

    Lee Seung Jae

    2014-06-01

    Full Text Available Since 2009 of global financial crisis, shipbuilding industry has undergone hard times seriously. After such a long depression, the latest global shipping market index shows that the economic recovery of global shipbuilding market is underway. Especially, nations with enormous resources are going to increase their productivity or expanding their shipyards to accommodate a large amount of orders expected in the near future. However, few commercial projects have been carried out for the practical shipyard layout designs even though those can be good commercial opportunities for shipbuilding engineers. Shipbuilding starts with a shipyard construction with a large scale investment initially. Shipyard design and the equipment layout problem, which is directly linked to the productivity of ship production, is an important issue in the production planning of mass production of ships. In many cases, shipbuilding yard design has relied on the experience of the internal engineer, resulting in sporadic and poorly organized processes. Consequently, economic losses and the trial and error involved in such a design process are inevitable problems. The starting point of shipyard construction is to design a shipyard layout. Four kinds of engineering parts required for the shipyard layout design and construction. Those are civil engineering, building engineering, utility engineering and production layout engineering. Among these parts, production layout engineering is most important because its result is used as a foundation of the other engineering parts, and also, determines the shipyard capacity in the shipyard lifecycle. In this paper, the background of shipbuilding industry is explained in terms of engineering works for the recognition of the macro trend. Nextly, preliminary design methods and related case study is introduced briefly by referencing the previous research. Lastly, the designed work of layout design is validated using the computer simulation

  16. New business opportunity: Green field project with new technology

    Science.gov (United States)

    Lee, Seung Jae; Woo, Jong Hun; Shin, Jong Gye

    2014-06-01

    Since 2009 of global financial crisis, shipbuilding industry has undergone hard times seriously. After such a long depression, the latest global shipping market index shows that the economic recovery of global shipbuilding market is underway. Especially, nations with enormous resources are going to increase their productivity or expanding their shipyards to accommodate a large amount of orders expected in the near future. However, few commercial projects have been carried out for the practical shipyard layout designs even though those can be good commercial opportunities for shipbuilding engineers. Shipbuilding starts with a shipyard construction with a large scale investment initially. Shipyard design and the equipment layout problem, which is directly linked to the productivity of ship production, is an important issue in the production planning of mass production of ships. In many cases, shipbuilding yard design has relied on the experience of the internal engineer, resulting in sporadic and poorly organized processes. Consequently, economic losses and the trial and error involved in such a design process are inevitable problems. The starting point of shipyard construction is to design a shipyard layout. Four kinds of engineering parts required for the shipyard layout design and construction. Those are civil engineering, building engineering, utility engineering and production layout engineering. Among these parts, production layout engineering is most important because its result is used as a foundation of the other engineering parts, and also, determines the shipyard capacity in the shipyard lifecycle. In this paper, the background of shipbuilding industry is explained in terms of engineering works for the recognition of the macro trend. Nextly, preliminary design methods and related case study is introduced briefly by referencing the previous research. Lastly, the designed work of layout design is validated using the computer simulation technology.

  17. Dicty_cDB: CHP195 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP195 (Link to dictyBase) - - - Contig-U11819-1 - (Link to Or...iginal site) CHP195F 138 - - - - - - Show CHP195 Library CH (Link to library) Clone ID CHP195 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11819-1 Original site URL http://dictycdb.b...qilkvstnk**IKNYYVNRVYEIIIIINICTYKKK--- Translated Amino Acid sequence (All Frames) Frame A: tvgllvfsnt*gink*...iin*kllck*sl*nnnynkymyi*kk--- Frame B: llaywffqilkvstnk**IKNYYVNRVYEIIIIINICTYKKK--- Frame C: cwptgffkylryqq

  18. Using Cost-Effectiveness Tests to Design CHP Incentive Programs

    Energy Technology Data Exchange (ETDEWEB)

    Tidball, Rick [ICF International, Fairfax, VA (United States)

    2014-11-01

    This paper examines the structure of cost-effectiveness tests to illustrate how they can accurately reflect the costs and benefits of CHP systems. This paper begins with a general background discussion on cost-effectiveness analysis of DER and then describes how cost-effectiveness tests can be applied to CHP. Cost-effectiveness results are then calculated and analyzed for CHP projects in five states: Arkansas, Colorado, Iowa, Maryland, and North Carolina. Based on the results obtained for these five states, this paper offers four considerations to inform regulators in the application of cost-effectiveness tests in developing CHP programs.

  19. Calorimetric studies and lessons on fires and explosions of a chemical plant producing CHP and DCPO

    Energy Technology Data Exchange (ETDEWEB)

    Hsu, Jing-Ming; Su, Mao-Sheng; Huang, Chiao-Ying [Department of Occupational Safety and Health, Chia Nan University of Pharmacy and Science, Tainan, Taiwan, ROC (China); Duh, Yih-Shing, E-mail: yihshingduh@yahoo.com.tw [Department of Safety, Health and Environmental Engineering, National United University, No. 1 Lien-Da, Miaoli, Taiwan, ROC (China)

    2012-05-30

    Highlights: Black-Right-Pointing-Pointer We analyzed fire and explosion incidents in a plant producing CHP and DCPO. Black-Right-Pointing-Pointer Data from calorimeters reveal causes and phenomena associated with the incidents. Black-Right-Pointing-Pointer The credible worst scenario was thermal explosion. Black-Right-Pointing-Pointer Incidents may be avoided by implementing DIERS methodology. - Abstract: Cumene hydroperoxide (CHP) has been used in producing phenol, dicumyl peroxide (DCPO) and as an initiator for synthesizing acrylonitrile-butadiene-styrene (ABS) resin by copolymerization in Taiwan. Four incidents of fire and explosion induced by thermal runaway reactions were occurred in a same plant producing CHP, DCPO and bis-(tert-butylperoxy isopropyl) benzene peroxide (BIBP). The fourth fire and explosion occurred in the CHP reactor that resulted in a catastrophic damage in reaction region and even spread throughout storage area. Descriptions on the occurrences of these incidents were assessed by the features of processes, reaction schemes and unexpected side reactions. Calorimetric data on thermokinetics and pressure were used for explaining the practical consequences or which the worst cases encountered in this kind of plant. Acceptable risk associated with emergency relief system design is vital for a plant producing organic peroxide. These basic data for designing an inherently safer plant can be conducted from adiabatic calorimetry. An encouraging deduction has been drawn here, these incidents may be avoided by the implementation of API RP 520, API RP 521, DIERS technology, OSHA 1910.119 and AIChE's CCPS recommended PSM elements.

  20. Evaluation of Combined Heat and Power (CHP Systems Using Fuzzy Shannon Entropy and Fuzzy TOPSIS

    Directory of Open Access Journals (Sweden)

    Fausto Cavallaro

    2016-06-01

    Full Text Available Combined heat and power (CHP or cogeneration can play a strategic role in addressing environmental issues and climate change. CHP systems require less fuel than separate heat and power systems in order to produce the same amount of energy saving primary energy, improving the security of the supply. Because less fuel is combusted, greenhouse gas emissions and other air pollutants are reduced. If we are to consider the CHP system as “sustainable”, we must include in its assessment not only energetic performance but also environmental and economic aspects, presenting a multicriteria issue. The purpose of the paper is to apply a fuzzy multicriteria methodology to the assessment of five CHP commercial technologies. Specifically, the combination of the fuzzy Shannon’s entropy and the fuzzy Technique for Order of Preference by Similarity to Ideal Solution (TOPSIS approach will be tested for this purpose. Shannon’s entropy concept, using interval data such as the α-cut, is a particularly suitable technique for assigning weights to criteria—it does not require a decision-making (DM to assign a weight to the criteria. To rank the proposed alternatives, a fuzzy TOPSIS method has been applied. It is based on the principle that the chosen alternative should be as close as possible to the positive ideal solution and be as far as possible from the negative ideal solution. The proposed approach provides a useful technical–scientific decision-making tool that can effectively support, in a consistent and transparent way, the assessment of various CHP technologies from a sustainable point of view.

  1. Modeling and parametric study of a 1 kWe HT-PEMFC-based residential micro-CHP system

    DEFF Research Database (Denmark)

    Arsalis, Alexandros; Nielsen, Mads Pagh; Kær, Søren Knudsen

    2011-01-01

    A detailed thermodynamic, kinetic and geometric model of a micro-CHP (Combined-Heatand-Power) residential system based on High Temperature-Proton Exchange Membrane Fuel Cell (HT-PEMFC) technology is developed, implemented and validated. HT-PEMFC technology is investigated as a possible candidate...... for fuel cell-based residential micro-CHP systems, since it can operate at higher temperature than Nafion-based fuel cells, and therefore can reach higher cogeneration efficiencies. The proposed system can provide electric power, hot water, and space heating for a typical Danish single-family household...

  2. Opportunities for the Use of Business Data Analysis Technologies

    OpenAIRE

    Bāliņa, S; Žuka, R; Krasts, J

    2016-01-01

    The paper analyses the business data analysis technologies, provides their classification and considers relevant terminology. The feasibility of business data analysis technologies handling big data sources is overviewed. The paper shows the results of examination of the online big data source analytics technologies, data mining and predictive modelling technologies and their trends.

  3. CHP expansion strategy in North Rhine-Westphalia. A blueprint for other regions; KWK-Ausbaustrategie in NRW. Eine Blaupause fuer andere Regionen

    Energy Technology Data Exchange (ETDEWEB)

    Holzapfel, Dominik [EnergieAgentur.NRW, Duesseldorf (Germany); Schneider, Sabine [EnergieAgentur.NRW, Wuppertal (Germany)

    2015-10-01

    The North Rhine-Westphalian state government intends to increase the share of combined heat and power (CHP) generation to at least 25 % by 2020. Since 2013, the campaign ''CHP.NRW - Power Meets Heat'' (''KWK.NRW - Strom trifft Waerme'') of the EnergyAgency.NRW, is has been running on behalf of the NRW Climate Protection Ministry, to publicise this technology and to promote its expansion. The campaign accompanies the State Government's CHP Stimulus Programme. The EnergyAgency.NRW has organised companies and research institutions, associations and interest groups under the umbrella of ''CHP.NRW - Power Meets Heat'', aiming at co-ordinated and intensified activities in the field of combined heat and power generation. The target of the initial-project ''roadmap/CHP.NRW'' of the ''Virtual Institute / CHP.NRW'' is to develop a guideline for the application and optimisation of CHP-systems.

  4. Nano-enabled environmental products and technologies - opportunities and drawbacks

    DEFF Research Database (Denmark)

    Møller Christensen, Frans; Brinch, Anna; Kjølholt, Jesper

    on the (Danish) market, as well as products and technologies, which are still in R&D and it will provide a qualitative overview of health and environmental pros and cons of these technologies. The project has focused on technologies applied in: 1) purification of water and wastewater, 2) remediation of soil......The project aims to investigate the benefits for health and environment that the use of nanomaterials in products and technologies may have. More specifically, the project provides an overview of the most relevant nano-enabled environmental technologies, different types of products and technologies...

  5. Local CHP Plants between the Natural Gas and Electricity Systems

    DEFF Research Database (Denmark)

    Bregnbæk, Lars; Schaumburg-Müller, Camilla

    2005-01-01

    that are expected to be in force in Denmark during 2005, where a large part of the local CHP plants will change from being paid for electricity production according to a feed-in tariff, to a situation where the electricity is to be sold on market conditions. The results will highlight the CHP plant as the link...

  6. Research, Development and Demonstration of Micro-CHP System for Residential Applications

    Energy Technology Data Exchange (ETDEWEB)

    Karl Mayer

    2010-03-31

    ECR International and its joint venture company, Climate Energy, are at the forefront of the effort to deliver residential-scale combined heat and power (Micro-CHP) products to the USA market. Part of this substantial program is focused on the development of a new class of steam expanders that offers the potential for significantly lower costs for small-scale power generation technology. The heart of this technology is the scroll expander, a machine that has revolutionized the HVAC refrigerant compressor industry in the last 15 years. The liquid injected cogeneration (LIC) technology is at the core of the efforts described in this report, and remains an excellent option for low cost Micro-CHP systems. ECR has demonstrated in several prototype appliances that the concept for LIC can be made into a practical product. The continuing challenge is to identify economical scroll machine designs that will meet the performance and endurance requirements needed for a long life appliance application. This report describes the numerous advances made in this endeavor by ECR International. Several important advances are described in this report. Section 4 describes a marketing and economics study that integrates the technical performance of the LIC system with real-world climatic data and economic analysis to assess the practical impact that different factors have on the economic application of Micro-CHP in residential applications. Advances in the development of a working scroll steam expander are discussed in Section 5. A rigorous analytical assessment of the performance of scroll expanders, including the difficult to characterize impact of pocket to pocket flank leakage, is presented in Section 5.1. This is followed with an FEA study of the thermal and pressure induced deflections that would result from the normal operation of an advanced scroll expander. Section 6 describes the different scroll expanders and test fixtures developed during this effort. Another key technical

  7. Global climate change: Mitigation opportunities high efficiency large chiller technology

    Energy Technology Data Exchange (ETDEWEB)

    Stanga, M.V.

    1997-12-31

    This paper, comprised of presentation viewgraphs, examines the impact of high efficiency large chiller technology on world electricity consumption and carbon dioxide emissions. Background data are summarized, and sample calculations are presented. Calculations show that presently available high energy efficiency chiller technology has the ability to substantially reduce energy consumption from large chillers. If this technology is widely implemented on a global basis, it could reduce carbon dioxide emissions by 65 million tons by 2010.

  8. Technology Opportunities to Reduce U.S. Greenhouse Gas Emissions

    Energy Technology Data Exchange (ETDEWEB)

    1997-10-01

    This report serves as the technology basis of a needed national climate change technology strategy, with the confidence that a strong technology R&D program will deliver a portfolio of technologies with the potential to provide very substantial greenhouse gas emission reductions along with continued economic growth. Much more is needed to define such a strategy, including identification of complementary deployment policies and analysis to support the seeping and prioritization of R&D programs. A national strategy must be based upon governmental, industrial, and academic partnerships.

  9. Fuel Cell Technology Status Analysis Project: Partnership Opportunities

    Energy Technology Data Exchange (ETDEWEB)

    2017-03-13

    Fact sheet describing the National Renewable Energy Laboratory's (NREL's) Fuel Cell Technology Status Analysis Project. NREL is seeking fuel cell industry partners from the United States and abroad to participate in an objective and credible analysis of commercially available fuel cell products to benchmark the current state of the technology and support industry growth.

  10. Challenges and Opportunities Facing Technology Education in Taiwan

    Science.gov (United States)

    Lee, Lung-Sheng Steven

    2009-01-01

    The technology education in Taiwan is prescribed in the national curriculum and provided to all students in grades 1-12. However, it faces the following challenges: (1) Lack of worthy image, (2) Inadequate teachers in elementary schools, (3) Deficient teaching vitality in secondary schools, and (4) Diluted technology teacher education programs. In…

  11. Energy efficiency analysis and impact evaluation of the application of thermoelectric power cycle to today's CHP systems

    DEFF Research Database (Denmark)

    Chen, Min; Lund, Henrik; Rosendahl, Lasse;

    2010-01-01

    High efficiency thermoelectric generators (TEG) can recover waste heat from both industrial and private sectors. Thus, the development and deployment of TEG may represent one of the main drives for technological change and fuel substitution. This paper will present an analysis of system efficiency...... configurations for combustion systems. The feasible deployment of TEG in various CHP plants will be examined in terms of heat source temperature range, influences on CHP power specification and thermal environment, as well as potential benefits. The overall conversion efficiency improvements and economic...

  12. Assessment of the implementation issues for fuel cells in domestic and small scale stationary power generation and CHP applications

    Energy Technology Data Exchange (ETDEWEB)

    Graham, G.; Cruden, A.; Hart, J.

    2002-07-01

    This report discusses implementation issues associated with the use of fuel cells in <10 kW domestic, small-scale power generation and combined heat and power (CHP) operations in the UK. The report examines the key issues (fuel cell system standards and certification, fuel infrastructure, commercial issues and competing CHP technologies), before discussing non-technical issues including finance, ownership, import and export configuration, pricing structure, customer acceptability, installation, operation and training of servicing and commissioning personnel. The report goes on to discuss market and technical drivers, grid connection issues and solutions, operations and maintenance. Recommendations for the future are made.

  13. Elimination of restraints on the propagation of combined heat and power (CHP) generation systems in Switzerland; Beseitigung von Hemmnissen bei der Verbreitung von Waermekraftkopplung (WKK) in der Schweiz

    Energy Technology Data Exchange (ETDEWEB)

    Rieder, S.; Landis, F. [Interface Politikstudien Forschung Beratung, Luzern (Switzerland); Lienhard, A.; Marti Locher, F. [Universitaet Bern, Kompetenzzentrum fuer Public Management (KPM), Bern (Switzerland); Krummenacher, S. [Enerprice Partners AG, Technopark Luzern, Root Laengenbold (Switzerland)

    2009-04-15

    This report for the Swiss Federal Office of Energy (SFOE) discusses the results of study initiated by the SFOE that was to investigate the reasons for the low level of proliferation of CHP technology in Switzerland. The two main questions asked - which factors inhibit the use of CHP in particular application areas and which energy-policy measures can remove such obstacles - are discussed. The use of CHP in various areas of application from waste incineration plants through to units used in residential buildings is analysed and commented on. Recommendations on measures that can be taken to enhance the use of CHP are discussed. Three strategy variants available to the public services area are presented and discussed. It is noted that a consensus between players in the technical and political areas is necessary

  14. Optimal Design and Operation of A Syngas-fuelled SOFC Micro-CHP System for Residential Applications in Different Climate Zones in China

    DEFF Research Database (Denmark)

    Yang, Wenyuan; Liso, Vincenzo; Zhao, Yingru

    2013-01-01

    demand. Numerical simulations are conducted in Matlab environment. System design trade-offs are discussed to determine the optimal match between the energy demand of the household for different climates across China and the energy supply of the micro-CHP during the whole year. Moreover, criteria......Energy consumption in residential sector can be considerably reduced by enhancing the efficiency of energy supply. Fuel cell-based residential micro-CHP systems are expected to be one of the most promising technologies because of their high efficiency and low environmental impact. Since the design...... heat-to-power load ratio. Therefore, the aim of this study is to investigate the optimal design and operation of a syngas-fuelled SOFC micro-CHP system for small households located in five different climate zones in China. The ability of the micro-CHP to cover the heat and electricity demand of a 70m2...

  15. Digital Technology and Mental Health Interventions: Opportunities and Challenges

    OpenAIRE

    Aguilera, Adrian

    2015-01-01

    The growth of the Internet, mobile phones, social media and other digital technologies has changed our world in many ways. It has provided individuals with information that was previously only available to a select few. An example of the reach of technology is data that as of October 2012, there are over 6 billion phones worldwide (BBC, 2012). The availability of data in real time has presented hopes of intervening more efficiently and managing health problems by leveraging limited human reso...

  16. Modelling Danish local CHP on market conditions

    DEFF Research Database (Denmark)

    Ravn, Hans V.; Riisom, Jannik; Schaumburg-Müller, Camilla;

    2004-01-01

    the local heat demand as well as technical factors such as heat storage facilities and production unit characteristics. Based on an adaptive prognosis for electricity spot prices, bids for the spot market are made in accordance with the rules of the Nord Pool 24-hour cycle. The paper will discuss...... in the Western Danish system. As both the power produced by the local CHPs and the wind power are prioritised, the production of these types of power is occasionally sufficient to meet the total demand in the system, causing the market price to drop dramatically, sometimes even to zero-level. In line...... with the liberalisation process of the energy sectors of the EU countries, it is however anticipated that Danish local CHP are to begin operating on market conditions within the year 2005. This means that the income that the local CHPs previously gained from selling electricity at the feed-in tariff is replaced in part...

  17. Technology Opportunities to Reduce U.S. Greenhouse Gas Emissions

    Energy Technology Data Exchange (ETDEWEB)

    National Lab Directors, . .

    2001-04-05

    The rise in greenhouse gas emissions from fossil fuel combustion and industrial and agricultural activities has aroused international concern about the possible impacts of these emissions on climate. Greenhouse gases--mostly carbon dioxide, some methane, nitrous oxide and other trace gases--are emitted to the atmosphere, enhancing an effect in which heat reflected from the earth's surface is kept from escaping into space, as in a greenhouse. Thus, there is concern that the earth's surface temperature may rise enough to cause global climate change. Approximately 90% of U.S. greenhouse gas emissions from anthropogenic sources come from energy production and use, most of which are a byproduct of the combustion of fossil fuels. On a per capita basis, the United States is one of the world's largest sources of greenhouse gas emissions, comprising 4% of the world's population, yet emitting 23% of the world's greenhouse gases. Emissions in the United States are increasing at around 1.2% annually, and the Energy Information Administration forecasts that emissions levels will continue to increase at this rate in the years ahead if we proceed down the business-as-usual path. President Clinton has presented a two-part challenge for the United States: reduce greenhouse gas emissions and grow the economy. Meeting the challenge will mean that in doing tomorrow's work, we must use energy more efficiently and emit less carbon for the energy expended than we do today. To accomplish these goals, President Clinton proposed on June 26, 1997, that the United States ''invest more in the technologies of the future''. In this report to Secretary of Energy Pena, 47 technology pathways are described that have significant potential to reduce carbon dioxide emissions. The present study was completed before the December 1997 United Nations Framework Convention on Climate Change and is intended to provide a basis to evaluate technology

  18. Identifying and Researching Market Opportunities for New High Technology Products.

    Science.gov (United States)

    Dunstan, Peter

    Using a product called the synchro-pulse welder as a case study example, this paper discusses the activities of CSIRO (Commonwealth Scientific and Industrial Research Organisation) in identifying and marketing new high-technology products. A general discussion of CSIRO's market research plans includes two goals to be attained within the next 5…

  19. Opportunities for the transfer of astronomical technology to medicine.

    Science.gov (United States)

    Hughes, S

    2007-12-01

    There are many examples of technology transfer from astronomy to medicine, for example algorithms for reconstructing X-ray CT images were first developed for processing radio astronomy images. In more recent times, X-ray detectors developed for the Hubble Space Telescope have been used in a fine-needle breast biopsy system. Software originally developed to mosaic planetary images has been incorporated into a system for detecting breast cancer. Australia has expertise in the development of instrumentation for producing radio images from an array of radio telescopes and in multi-object fibre systems for capturing the spectra of hundreds of stellar objects simultaneously. Two possible applications of these Australian technologies are suggested that may merit further exploration. A meeting between interested parties is suggested to discuss future directions and funding.

  20. Renewable Energy Technologies in Ghana: Opportunities and Threats

    Directory of Open Access Journals (Sweden)

    C.K. Amuzuvi

    2013-06-01

    Full Text Available In most developing countries, there is a monopoly of electricity generation, transmission and distribution by some governmental agencies, resulting in little or no access to electricity in rural communities where a larger proportion of the population resides. A study of Renewable Energy Technologies (RET in Ghana is presented in this study. The renewable energy technology discussed is based on solar Photovoltaics (PV. This study addresses some of the vital factors that have prevented the growth of a viable market for RETs using solar PV as a typical example. Adverse policy environment and lack of financing are cited as the main barriers to be surmounted. Recommendations are made for government and all stakeholders to engage the private sector to give the RET industries a boost. The injection of an electrification fund is proposed to support grid extension to areas of proven economic potential using RET.

  1. Industrial Waste Heat Recovery - Potential Applications, Available Technologies and Crosscutting R&D Opportunities

    Energy Technology Data Exchange (ETDEWEB)

    Thekdi, Arvind [E3M Inc, North Potomac, MD (United States); Nimbalkar, Sachin U. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

    2015-01-01

    The purpose of this report was to explore key areas and characteristics of industrial waste heat and its generation, barriers to waste heat recovery and use, and potential research and development (R&D) opportunities. The report also provides an overview of technologies and systems currently available for waste heat recovery and discusses the issues or barriers for each. Also included is information on emerging technologies under development or at various stages of demonstrations, and R&D opportunities cross-walked by various temperature ranges, technology areas, and energy-intensive process industries.

  2. Information Technology Service Management and Opportunities for Information Systems Curricula

    OpenAIRE

    Sue Conger

    2009-01-01

    Historically, information systems (IS) programs have taught two of the three areas of information technology (IT) management: strategy and management, and applications development. Academic programs have ignored the third area, IT operations. IT operations management is becoming increasingly important as it is recognized as consuming as much as 90% of the IT budget and as acquisition of software becomes more prevalent than development of custom applications. Along with the shift of management...

  3. Microscale technology and biocatalytic processes: Opportunities and challenges for synthesis

    DEFF Research Database (Denmark)

    Wohlgemuth, Roland; Plazl, Igor; Žnidaršič-Plazl, Polona

    2015-01-01

    Despite the expanding presence of microscale technology in chemical synthesis and energy production as well as in biomedical devices and analytical and diagnostic tools, its potential in biocatalytic processes for pharmaceutical and fine chemicals, as well as related industries, has not yet been ......, and the future outlook for the implementation of these key green engineering methods and the role of supporting tools such as mathematical models to establish sustainable production processes are discussed....

  4. EPA and the Federal Technology Transfer Act: Opportunity knocks

    Energy Technology Data Exchange (ETDEWEB)

    Gatchett, A.M.; Fradkin, L.; Moore, M.; Gorman, T.; Ehrlich, A. [Environmental Protection Agency, Washington, DC (United States)

    1990-12-31

    In 1986, the Federal Technology Transfer Act (FTTA) was established to promote a closer, collaborative relationship between federal government agencies and the private sector. With the increasing need for new cost-effective technologies to prevent and control pollution, both the US Environmental Protection Agency (EPA) and private industry are encouraged to facilitate the transfer of knowledge and technology under this Act. The FTTA removed several of the legal and institutional barriers to cooperative research that existed before the Act`s passage. Through the FTTA, the government strives to promote the movement of its products, processes, skills, and knowledge into the private sector for further development and commercialization by encouraging the exchange of technical personnel and the sharing of facilities and other resources. Collaborative efforts between industry, federal agencies, and academia are made possible through cooperative research and development agreements (CRADAs). Forty-two CRADAs and five licensing agreements have been initiated with EPA under this program. This paper provides an overview of this new and innovative program within the EPA. 1 fig., 2 tabs.

  5. Space Science &Technology in Mauritius: Current Status and Future Opportunities

    Science.gov (United States)

    Rughooputh, S. D. D. V.; Beeharry, G. K.; Golap, K.; Issur, N. H.; Somanah, R.; Rughooputh, H. C. S.; Udayashankar, N.; Mueller, K.

    Space research (with either direct or indirect spin-offs) has been instrumental in leading to accomplishments that are meant to improve our quality of life in its broadest perspective. But are we all acquainted of the now proven-use of these findings and their capabilities? What do these mean to a remote small insular developing state like Mauritius? This paper explores the recent developments in this field in Mauritius and how we intend to optimize the use of the emerging technologies. Initiatives of the University of Mauritius are highlighted.

  6. Contribution to a Danish action plan for development and demonstration of CHP from solid biomass; Oplaeg til en national handlingsplan for udvikling og demonstration indenfor kraftvarme fra fast biomasse

    Energy Technology Data Exchange (ETDEWEB)

    Hansen, Morten Tony

    2011-01-15

    The report is the contribution from the industry to an action plan for development and demonstration of CHP technology for solid biomass. The report aims to serve as inspiration and basis for administrators and applicants of Danish funding schemes for development and demonstration in future tenders. Although Danish-based cogeneration technologies for solid biofuels are advanced compared to the competitors in many areas there is a large need to continuously improve the technology by sustained development and demonstration activities. The aim is to overcome the technological barriers that this project has identified and thus maintain competitiveness. The industry currently has very strong focus on market deployment of especially technologies for cogeneration in small scale (up to 15 MW thermal power) and on the overall economy of these plants. Reference installations that displays many operational hours with a reasonable economy, are crucial for investors. Currently, no companies market commercial plants that have sufficiently low costs to operate under Danish conditions and few do for the conditions found internationally. Thus, from the industry perspective there is still a need for development and demonstration of CHP technology below 15 MW thermal. The analysis does not exclude any technology tracks, but the development and demonstration efforts should lead to improvements in conditions such as availability, efficiencies and operating and maintenance costs. Also technologies for large plants and systems need to be improved with respect to availability and efficiency and reduced operating and maintenance costs. For all technologies, there is a need to develop the use of special solid biofuels that on the one hand may have troublesome characteristics but on the other may help lower operating costs. The Danish-based companies have good opportunities to find support for the development and demonstration effort. A number of support programs and pools are in place and

  7. Opportunities and Challenges of Using Technology in Mathematics Education of Creative Technical Studies

    DEFF Research Database (Denmark)

    Triantafyllou, Eva; Timcenko, Olga

    2014-01-01

    This paper explores the opportunities and challenges of integrating technology to support mathematics teaching and learning in creative engineer- ing disciplines. We base our discussion on data from our research in the Media Technology department of Aalborg University Copenhagen, Denmark. Our...... analysis proposes that unlike in other engineering disciplines, technology in these disciplines should be used for contextualizing mathematics rather than in- troducing and exploring mathematical concepts....

  8. Calorimetric studies and lessons on fires and explosions of a chemical plant producing CHP and DCPO.

    Science.gov (United States)

    Hsu, Jing-Ming; Su, Mao-Sheng; Huang, Chiao-Ying; Duh, Yih-Shing

    2012-05-30

    Cumene hydroperoxide (CHP) has been used in producing phenol, dicumyl peroxide (DCPO) and as an initiator for synthesizing acrylonitrile-butadiene-styrene (ABS) resin by copolymerization in Taiwan. Four incidents of fire and explosion induced by thermal runaway reactions were occurred in a same plant producing CHP, DCPO and bis-(tert-butylperoxy isopropyl) benzene peroxide (BIBP). The fourth fire and explosion occurred in the CHP reactor that resulted in a catastrophic damage in reaction region and even spread throughout storage area. Descriptions on the occurrences of these incidents were assessed by the features of processes, reaction schemes and unexpected side reactions. Calorimetric data on thermokinetics and pressure were used for explaining the practical consequences or which the worst cases encountered in this kind of plant. Acceptable risk associated with emergency relief system design is vital for a plant producing organic peroxide. These basic data for designing an inherently safer plant can be conducted from adiabatic calorimetry. An encouraging deduction has been drawn here, these incidents may be avoided by the implementation of API RP 520, API RP 521, DIERS technology, OSHA 1910.119 and AIChE's CCPS recommended PSM elements.

  9. Sleep Tracking, Wearable Technology, and Opportunities for Research and Clinical Care.

    Science.gov (United States)

    Shelgikar, Anita Valanju; Anderson, Patricia F; Stephens, Marc R

    2016-09-01

    Consumer-driven sleep-tracking technologies are becoming increasingly popular with patients with sleep disorders and the general population. As the list of sleep-tracking technologies continues to grow, clinicians and researchers are faced with new challenges and opportunities to incorporate these technologies into current practice. We review diagnostic tools used in sleep medicine clinical practice, discuss categories of consumer sleep-tracking technologies currently available, and explore the advantages and disadvantages of each. Potential uses of consumer sleep-tracking technologies to enhance sleep medicine patient care and research are also discussed.

  10. Implementation of renewable technologies - Opportunities and barriers. Zimbabwe country study

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2001-07-01

    Renewable Energy Technologies (RETS) have over the years become an integral part of the energy supply chain in most developed countries. Recent projections show that 13.5% of the world's primary energy supply comes from renewable and this figure has an aggregated annual growth rate of 16%. Wind has the highest annual growth rate of 22% while the least annual growth rate of 2% is for hydropower. The main push for renewable like wind in the OECD countries are environmental concerns and the business aspect in power generation. The situation is however completely different in Africa, where the thrust for RETs is developmental based. Although the continent has abundant renewable energy resources like solar, biomass, wind and hydro potential, they have remained largely unexploited. Several efforts have been made to help African countries like Zimbabwe to exploit such resources. The main objectives of this country study included review of Zimbabwe's development of past RETs, establish barriers related lessons learnt from such projects and currently running RETs projects, identify barriers experienced by other projects and then select a few barrier removal projects and then develop them with the help of all stake holders in the country. The methodology of this study involved a review of past RETs projects to establish barriers faced and barriers related lessons learnt. An examination of the policy instruments related to RETs was done to establish how they promote the dissemination of the technologies as well as their adequacy. A survey of all possible RETs projects in the country was carried out and in this survey the end-users were visited and interviewed by the research team. An initial workshop, which was attended by all stake holders, was held in November 1999. An Advisory committee on RETs in Zimbabwe was then set up comprising of various stake holders from government, the private sector, research institutions, interviewed end-users and the NGO community

  11. Energy policy responses to the climate change challenge: The consistency of European CHP, renewables and energy efficiency policies

    Energy Technology Data Exchange (ETDEWEB)

    Grohnheit, P.E.

    1999-09-01

    This report is Volume 14 of individual reports of the Shared Analysis Project prepared for the European Commission, Directorate General for Energy. The three major objectives of the project were: to design a common framework of energy analysis that aimed to involve all Member States and the experts of industrial research groups (the shared approach to energy analysis); To analyse generic EU-wide issues important for energy policy and for future energy demand and production, putting particular emphasis on world energy market trends, strategic energy policy responses to the Kyoto process, and evaluation of response strategies to increasing energy import dependence and to climate change activities; to carry out quantitative analyses of energy trends and scenarios as an input for discussion. The present volume considers three main issues concerning energy policy responses to the climate change challenge: the penetration of CHP and renewables according to official objectives, focusing on infrastructure and institutions rather than technology; the consistency of promotion of CHP, renewables and energy savings at the same time; consumers' choices and priorities in a liberalised market. The volume describes examples of policies in several Member States for these technologies with emphasis on CHP for both large-scale and small-scale district heating systems. The penetration of CHP technologies is analysed quantitatively using a traditional optimisation model approach for stylised regions with heat markets suitable for CHP and facing a competitive European market for electricity. The Joint Final Report of the project, titled 'Economic Foundations for Energy Policy' is published as a Special Issue of Energy in Europe, December 1999. All reports are available on the Internet, www.shared-analysis.fhg.de/ The project started in January 1998, involving about 100 months of scientific labour. The project consortium consisted of nine member institutes co-ordinated by

  12. Technology for site remediation: availability, needs and opportunities for R and D at SCK/CEN

    Energy Technology Data Exchange (ETDEWEB)

    Collard, G.

    1996-09-18

    Considerable experience has been gained over the past years in the use of control and treatment technologies, applied to contaminated sites and environments. Although available technologies are adequate in many cases, it is recognized that many technologies are too costly or inadequate to address the multitude of contaminant problems. This insight has led national and international organizations as well as private organizations and universities to sponsor environment technology programmes to address technology needs. The United States Department of Energy for example has initiated an aggressive environmental technology development programme and the Commission of the European Union is sponsoring environmental technology development. An overview is given of innovative and emerging technologies that may become important. Opportunities for SCK/CEN in research, development, and demonstration programmes are outlined.

  13. Emissions from decentralised CHP plants 2007 - Energinet.dk Environmental project no. 07/1882. Project report 5 - Emission factors and emission inventory for decentralised CHP production

    Energy Technology Data Exchange (ETDEWEB)

    Nielsen, Malene; Nielsen, Ole-Kenneth; Thomsen, M.

    2010-06-15

    Updated emission factors for decentralised combined heat and power (CHP) plants with a capacity < 25MWe have been estimated based on project emission measurements as well as emission measurements performed in recent years that were collected. The emission factors valid for 2006/2007 have been estimated for the plant technologies: Municipal solid waste (MSW) incineration plants, plants combusting straw or wood, natural gas fuelled reciprocating engines, biogas fuelled engines, natural gas fuelled gas turbines, gas oil fuelled reciprocating engines, gas oil fuelled gas turbines, steam turbines combusting residual oil and reciprocating engines combusting biomass producer gas based on wood. The emission factors for MSW incineration plants are much lower than the emission factors that were estimated for year 2000. The considerable reduction in the emission factors is a result of lower emission limit values in Danish legislation since 2006 that has lead to installation of new and improved flue gas cleaning systems in most MSW incineration plants. For CHP plants combusting wood or straw no major technical improvements have been implemented. The emission factors for natural gas fuelled reciprocating engines have been reduced since year 2000 as a result of technical improvements that have been carried out due to lower emission limit values in Danish legislation. The NO{sub x} emission factor for natural gas fuelled gas turbines has decreased 62 % since year 2000. This is a result of installation of low-NO{sub x} burners in almost all gas turbines that has been necessary to meet new emission limits in Danish legislation. The emission measurements programme included screening of the emissions of HCB, PCB, PCDD/-F and PBDD/-F. Compared to the Danish national emission decentralized CHP plants are major emission sources for CH{sub 4}, NO{sub x}, SO{sub 2}, heavy metals and HCB. (author)

  14. Development and Testing of the Advanced CHP System Utilizing the Off-Gas from the Innovative Green Coke Calcining Process in Fluidized Bed

    Energy Technology Data Exchange (ETDEWEB)

    Chudnovsky, Yaroslav; Kozlov, Aleksandr

    2013-08-15

    Green petroleum coke (GPC) is an oil refining byproduct that can be used directly as a solid fuel or as a feedstock for the production of calcined petroleum coke. GPC contains a high amount of volatiles and sulfur. During the calcination process, the GPC is heated to remove the volatiles and sulfur to produce purified calcined coke, which is used in the production of graphite, electrodes, metal carburizers, and other carbon products. Currently, more than 80% of calcined coke is produced in rotary kilns or rotary hearth furnaces. These technologies provide partial heat utilization of the calcined coke to increase efficiency of the calcination process, but they also share some operating disadvantages. However, coke calcination in an electrothermal fluidized bed (EFB) opens up a number of potential benefits for the production enhancement, while reducing the capital and operating costs. The increased usage of heavy crude oil in recent years has resulted in higher sulfur content in green coke produced by oil refinery process, which requires a significant increase in the calcinations temperature and in residence time. The calorific value of the process off-gas is quite substantial and can be effectively utilized as an “opportunity fuel” for combined heat and power (CHP) production to complement the energy demand. Heat recovered from the product cooling can also contribute to the overall economics of the calcination process. Preliminary estimates indicated the decrease in energy consumption by 35-50% as well as a proportional decrease in greenhouse gas emissions. As such, the efficiency improvement of the coke calcinations systems is attracting close attention of the researchers and engineers throughout the world. The developed technology is intended to accomplish the following objectives: - Reduce the energy and carbon intensity of the calcined coke production process. - Increase utilization of opportunity fuels such as industrial waste off-gas from the novel

  15. Technology and the delivery of the curriculum of the future: opportunities and challenges.

    Science.gov (United States)

    Sandars, John

    2012-01-01

    There is increasing availability of a wide range of technology that has the potential to support and enhance the curriculum of the future. Learners expect to use technology for their learning, but this requires the development of information and digital literacy skills to maximise the potential learning opportunities. Learning resources will be increasingly delivered by a variety of mobile devices and also through different immersive and virtual learning environments. Mobile devices and Web 2.0 technology provide opportunities for learners to create their own deep and personalised learning experiences that are relevant for future professional practice. Tutors have a crucial guidance and support role for the effective use of technology for learning. There is a little evidence base to support the impact on learning for many of the potential scenarios and further research is urgently required.

  16. Efficient identification of opportunities for Distributed Generation based on Smart Grid Technology

    DEFF Research Database (Denmark)

    Mutule, Anna; Obushevs, Artjoms; Lvov, Aleksandr

    2013-01-01

    The paper presents the main goals and achievements of the Smart Grids ERA-NET project named “Efficient identification of opportunities for Distributed Generation based on Smart Grid Technology (SmartGen)” during the second stage of project implementation. A description of Smart Grid Technology (SGT......) models developed within the framework of the project is given. The performed study cases where the SGT-models were implemented to analyze the impact of the electrical grid are discussed....

  17. An ANP application for identifying and prioritizing opportunities and threatens for technology transfer

    Directory of Open Access Journals (Sweden)

    Reza Attaran

    2014-01-01

    Full Text Available During the past few years, there have been different changes in global market due to fast development of science and technology. These changes have increased competition among all existing companies and it has made it difficult for new rivals to gain market share. This paper tries to identify the opportunities and threats of technology transfer in one of world’s fastest growing gas development regions called Pars Special Economic Energy Zone. The proposed model of this paper first identify important factors influencing both opportunities as well as threats and then uses analytical hierarchy process to rank all factors. The results show that the threats were more important than the existing opportunities and among the most important threats, embargo and sales of oil were the most important ones.

  18. The opportunities and challenges of persuasive technology in creating sustainable innovation and business model innovation

    DEFF Research Database (Denmark)

    Aagaard, Annabeth; Lindgren, Peter

    2015-01-01

    strength of NGO’s and the increasing sustainable agenda of global businesses. However, getting knowledge of the stakeholders and their behavior as well as the potentials in actively supporting more sustainable behaviors provides totally new and unique opportunities for radical and customer......The opportunities of persuasive technology in facilitating sustainable innovation and business model innovation have been witnessed continuously during the last decade. The unique ability of persuasive technology in interacting and mediating across users, customers, decisions makers and other...... stakeholders provides access to core knowledge about behavior and opportunities to influence and even change their behavior in a positive and more sustainable manner. Sustainable innovation and business model innovation is gaining more and more competitive leverage due to customer requirements, the growing...

  19. Berkeley Foundation for Opportunities in Information Technology: A Decade of Broadening Participation

    Science.gov (United States)

    Crutchfield, Orpheus S. L.; Harrison, Christopher D.; Haas, Guy; Garcia, Daniel D.; Humphreys, Sheila M.; Lewis, Colleen M.; Khooshabeh, Peter

    2011-01-01

    The Berkeley Foundation for Opportunities in Information Technology is a decade-old endeavor to expose pre-college young women and underrepresented racial and ethnic minorities to the fields of computer science and engineering, and prepare them for rigorous, university-level study. We have served more than 150 students, and graduated more than 65…

  20. Opportunities and barriers for OHS consultants in a technological change process at a client enterprise

    DEFF Research Database (Denmark)

    Broberg, Ole; Hermund, Ingelise

    2003-01-01

    In a case study of the design of inside finish and equipment of a new factory building the opportunities and barriers for OHS consultants in integrating work environment aspects are discussed. The work prac-tice of OHS consultants is studied in terms of theories from the sociology of technology...

  1. Understanding the Signature Pedagogy of the Design Studio and the Opportunities for Its Technological Enhancement

    Science.gov (United States)

    Crowther, Phillip

    2013-01-01

    This paper presents an analysis of the studio as the signature pedagogy of design education. A number of theoretical models of learning, pedagogy, and education are used to interrogate the studio for its advantages and shortcomings, and to identify opportunities for the integration of new technologies and to explore the affordances that they…

  2. The Dynamics of Opportunity and Threat Management in Turbulent Environments: The Role of Information Technologies

    Science.gov (United States)

    Park, Young Ki

    2011-01-01

    This study explains the role of information technologies in enabling organizations to successfully sense and manage opportunities and threats and achieve competitive advantage in turbulent environments. I use two approaches, a set-theoretic configurational theory approach and a variance theory approach, which are theoretically and methodologically…

  3. A Study of a Diesel Engine Based Micro-CHP System

    Energy Technology Data Exchange (ETDEWEB)

    Krishna, C.R.; Andrews, J.; Tutu, N.; Butcher, T.

    2010-08-31

    This project, funded by New York State Energy Research and Development Agency (NYSERDA), investigated the potential for an oil-fired combined heat and power system (micro-CHP system) for potential use in residences that use oil to heat their homes. Obviously, this requires the power source to be one that uses heating oil (diesel). The work consisted of an experimental study using a diesel engine and an analytical study that examined potential energy savings and benefits of micro-CHP systems for 'typical' locations in New York State. A search for a small diesel engine disclosed that no such engines were manufactured in the U.S. A single cylinder engine manufactured in Germany driving an electric generator was purchased for the experimental work. The engine was tested using on-road diesel fuel (15 ppm sulfur), and biodiesel blends. One of the main objectives was to demonstrate the possibility of operation in the so-called HCCI (Homogeneous Charge Compression Ignition) mode. The HCCI mode of operation of engines is being explored as a way to reduce the emission of smoke, and NOx significantly without exhaust treatment. This is being done primarily in the context of engines used in transportation applications. However, it is felt that in a micro-CHP application using a single cylinder engine, such an approach would confer those emission benefits and would be much easier to implement. This was demonstrated successfully by injecting the fuel into the engine air intake using a heated atomizer made by Econox Technologies LLC to promote significant vaporization before entering the cylinder. Efficiency and emission measurements were made under different electrical loads provided by two space heaters connected to the generator in normal and HCCI modes of operation. The goals of the analytical work were to characterize, from the published literature, the prime-movers for micro-CHP applications, quantify parametrically the expected energy savings of using micro-CHP

  4. Science in the Wild: Technology Needs and Opportunities in Scientific Fieldwork

    Science.gov (United States)

    Guice, Jon; Hoffower, Heidi; Norvig, Peter (Technical Monitor)

    1999-01-01

    Considering that much contemporary natural science involves field expeditions, fieldwork is an under-studied topic. There is also little information technology specifically designed to support scientific fieldwork, aside from portable scientific instruments. This article describes a variety of fieldwork practices in an interdisciplinary research area, proposes a framework linking types of fieldwork to types of needs in information technology, and identifies promising opportunities for technology development. Technologies that are designed to support the integration of field observations and samples with laboratory work are likely to aid nearly all research teams who conduct fieldwork. However, technologies that support highly detailed representations of field sites will likely trigger the deepest changes in work practice. By way of illustration, we present brief case studies of how fieldwork is done today and how it might be conducted with the introduction of new information technologies.

  5. Economic feasibility of CHP facilities fueled by biomass from unused agriculture land

    DEFF Research Database (Denmark)

    Pfeifer, Antun; Dominkovic, Dominik Franjo; Ćosić, Boris

    2016-01-01

    work and is now used to investigate the conditions in which such energy facilities could be feasible. The overall potential of biomass from short rotation coppice cultivated on unused agricultural land in the scenarios with 30% of the area is up to 10PJ/year. The added value of fruit trees pruning...... biomass represents an incentive for the development of fruit production on such agricultural land. Sensitivity analysis was conducted for several parameters: cost of biomass, investment costs in CHP systems and combined change in biomass and technology cost....

  6. Human Subjects Protection and Technology in Prevention Science: Selected Opportunities and Challenges.

    Science.gov (United States)

    Pisani, Anthony R; Wyman, Peter A; Mohr, David C; Perrino, Tatiana; Gallo, Carlos; Villamar, Juan; Kendziora, Kimberly; Howe, George W; Sloboda, Zili; Brown, C Hendricks

    2016-08-01

    Internet-connected devices are changing the way people live, work, and relate to one another. For prevention scientists, technological advances create opportunities to promote the welfare of human subjects and society. The challenge is to obtain the benefits while minimizing risks. In this article, we use the guiding principles for ethical human subjects research and proposed changes to the Common Rule regulations, as a basis for discussing selected opportunities and challenges that new technologies present for prevention science. The benefits of conducting research with new populations, and at new levels of integration into participants' daily lives, are presented along with five challenges along with technological and other solutions to strengthen the protections that we provide: (1) achieving adequate informed consent with procedures that are acceptable to participants in a digital age; (2) balancing opportunities for rapid development and broad reach, with gaining adequate understanding of population needs; (3) integrating data collection and intervention into participants' lives while minimizing intrusiveness and fatigue; (4) setting appropriate expectations for responding to safety and suicide concerns; and (5) safeguarding newly available streams of sensitive data. Our goal is to promote collaboration between prevention scientists, institutional review boards, and community members to safely and ethically harness advancing technologies to strengthen impact of prevention science.

  7. [AAL: Ambient Assisted Living Assistive technologies for healthy ageing and opportunities for medicine and caring].

    Science.gov (United States)

    Misoch, Sabina

    2015-09-01

    Ambient Assisted Living (AAL) summarizes various connected digital networked assisting technologies with the aim to support elderly and chronically ill people and to improve their quality of life. This paper defines the term AAL and shows different fields of application for AAL technologies. It illustrates the role of AAL against the background of the societal and demographic changes, of the expected growth of older people in need of care, and of the ongoing trend of singularisation of elderly. We describe medical application areas with new opportunities for the use of AAL technologies. The article highlights further the importance of the technical acceptance of these technologies by the end users, which we deem to be the most critical factor for the diffusion and use of AAL technologies in the forthcoming years.

  8. District Heating and CHP - Local Possibilities for Global Climate Change Mitigation

    Energy Technology Data Exchange (ETDEWEB)

    Difs, Kristina

    2010-07-01

    Global warming, in combination with increasing energy demand and higher energy prices, makes it necessary to change the energy use. To secure the energy supply and to develop sustainable societies, construction of energy-efficient systems is at the same time most vital. The aim of this thesis is therefore to identify how a local energy company, producing district heating (DH), district cooling (DC) and electricity in combined heat and power (CHP) plants, can contribute to resource-efficient energy systems and cost-effective reductions of global carbon dioxide (CO{sub 2}) emissions, along with its customers. Analyses have been performed on how a local energy company can optimise their DH and DC production and what supply-side and demand-side measures can lead to energy-efficient systems in combination with economic and climate change benefits. The energy company in focus is located in Linkoeping, Sweden. Optimisation models, such as MODEST and reMIND, have been used for analysing the energy systems. Scenario and sensitivity analyses have also been performed for evaluation of the robustness of the energy systems studied. For all analyses a European energy system perspective was applied, where a fully deregulated European electricity market with no bottlenecks or other system failures was assumed. In this thesis it is concluded that of the DH-supply technologies studied, the biomass gasification applications and the natural gas combined cycle (NGCC) CHP are the technologies with the largest global CO{sub 2} reduction potential, while the biomass-fuelled plant that only produces heat is the investment with the smallest global CO{sub 2} reduction and savings potential. However, the global CO{sub 2} reduction potential for the biomass integrated gasification combined cycle (BIGCC) CHP and NGCC CHP, the two technologies with highest electricity efficiencies, is highly dependent on the assumptions made about marginal European electricity production. Regarding the effect on

  9. Technology transfer of brain-computer interfaces as assistive technology: barriers and opportunities.

    Science.gov (United States)

    Nijboer, F

    2015-02-01

    This paper provides an analysis of perspectives from different stakeholders on the state-of-the-art of BCI. Three barriers for technology transfer of BCIs as access technologies are identified. First, BCIs are developed with a narrow focus on creating a reliable technology, while a broader focus on creating a usable technology is needed. Second, the potential target group, which could benefit from BCIs as access technologies is expected to be very small. Development costs are therefore high, while reimbursements are expected to be low, which challenges the commercial viability. Third, potential target users should be much more included in the design process of BCIs to ensure that the end-products meet technical, ethical, legal and social requirements. These three issues need to be urgently addressed so that target users may benefit from this promising technology.

  10. Optimal design and operation of a syngas-fuelled SOFC micro CHP system for residential applications in different climate zones in China

    OpenAIRE

    Yang, Wenyuan; Zhao, Yingru; Liso, Vincenzo; Brandon, Nigel

    2014-01-01

    Fuel cell based micro-CHP systems are expected to be one of the most promising technologies for implementation in the residential sector. Since the design and operation of such CHP systems are greatly dependent upon the seasonal atmospheric conditions, it is important to evaluate their performance under difference climate conditions to ensure that it is well matched with the local heat-to-power ratio. The aim of this study is to investigate the optimal design and operation of a syngas-fuelled...

  11. IVO`s CHP know-how: experience, inventions, patents

    Energy Technology Data Exchange (ETDEWEB)

    Aeijaelae, M.; Ohtonen, V. [ed.

    1997-11-01

    IVO can justly claim mastery in the co-generation of district heat and electricity - CHP. As well as looking at the issue from the viewpoint of planners, builders and operators, IVO`s engineers also view power plants through the eyes of the product developer and inventor. This approach has resulted in successful power plant configurations, inventions and patents and visions

  12. A Stochastic Unit Commitment Model for a Local CHP Plant

    DEFF Research Database (Denmark)

    Ravn, Hans V.; Riisom, Jannik; Schaumburg-Müller, Camilla

    2005-01-01

    Local CHP development in Denmark has during the 90’s been characterised by large growth primarily due to government subsidies in the form of feed-in tariffs. In line with the liberalisation process in the EU, Danish local CHPs of a certain size must operate on market terms from 2005. This paper...

  13. Reactive power control with CHP plants - A demonstration

    DEFF Research Database (Denmark)

    Nyeng, Preben; Østergaard, Jacob; Andersen, Claus A.;

    2010-01-01

    power rating of 7.3 MW on two synchronous generators. A closed-loop control is implemented, that remote controls the CHP plant to achieve a certain reactive power flow in a near-by substation. The solution communicates with the grid operator’s existing SCADA system to obtain measurements from...

  14. Coupling renewables via hydrogen into utilities: Temporal and spatial issues, and technology opportunities

    Energy Technology Data Exchange (ETDEWEB)

    Iannucci, J.J.; Horgan, S.A.; Eyer, J.M. [Distributed Utility Associates, San Ramon, CA (United States)] [and others

    1996-10-01

    This paper discusses the technical potential for hydrogen used as an energy storage medium to couple time-dependent renewable energy into time-dependent electric utility loads. This analysis will provide estimates of regional and national opportunities for hydrogen production, storage and conversion, based on current and near-term leading renewable energy and hydrogen production and storage technologies. Appropriate renewable technologies, wind, photovoltaics and solar thermal, are matched to their most viable regional resources. The renewables are assumed to produce electricity which will be instantaneously used by the local utility to meet its loads; any excess electricity will be used to produce hydrogen electrolytically and stored for later use. Results are derived based on a range of assumptions of renewable power plant capacity and fraction of regional electric load to be met (e.g., the amount of hydrogen storage required to meet the Northwest region`s top 10% of electric load). For each renewable technology national and regional totals will be developed for maximum hydrogen production per year and ranges of hydrogen storage capacity needed in each year (hydroelectric case excluded). The sensitivity of the answers to the fraction of peak load to be served and the land area dedicated for renewable resources are investigated. These analyses can serve as a starting point for projecting the market opportunity for hydrogen storage and distribution technologies. Sensitivities will be performed for hydrogen production, conversion. and storage efficiencies representing current and near-term hydrogen technologies.

  15. Full report: Assessment and opportunity identification of energy efficient pollution prevention technologies and processes

    Energy Technology Data Exchange (ETDEWEB)

    1994-11-01

    US industry produces about 12 billion tons of waste a year, or two-thirds of the waste generated in the US. The costs of handling and disposing of these wastes are significant, estimated to be between $25 and $43 billion in 1991, and represent an increase of 66% since 1986. US industry also uses about one-third of all energy consumed in the nation, which adds to the environmental burden. Industrial wastes affect the environmental well-being of the nation and, because of their growing costs, the competitive abilities of US industry. As part of a national effort to reduce industrial wastes, the US Congress passed the Energy Policy Act (EPAct, P.L. 102-486). Section 2108, subsections (b) and (c), of EPAct requires the Department of Energy (DOE) to identify opportunities to demonstrate energy efficient pollution prevention technologies and processes; to assess their availability and the energy, environmental, and cost effects of such technologies; and to report the results. Work for this report clearly pointed to two things, that there is insufficient data on wastes and that there is great breadth and diversity in the US industrial sector. This report identifies: information currently available on industrial sector waste streams, opportunities for demonstration of energy efficient pollution prevention technologies in two industries that produce significant amounts of waste--chemicals and petroleum, characteristics of waste reducing and energy saving technologies identifiable in the public literature, and potential barriers to adoption of waste reducing technologies by industry.

  16. DEVELOPMENT OF THE CHP-THERMAL SCHEMES IN CONTEXTS OF THE CONSOLIDATED ENERGY SYSTEM OF BELARUS

    Directory of Open Access Journals (Sweden)

    V. N. Romaniuk

    2015-01-01

    Full Text Available The paper deals with the structural specifics of the Belarus Consolidated Energy System capacities in view of their ongoing transfer to the combined-cycle technology, building the nuclear power plant and necessity for the generating capacity regulation in compliance with the load diagram. With the country’s economic complex energy utilization pattern being preserved, the generating capacities are subject to restructuring and the CHP characteristics undergo enhancement inter alia a well-known increase of the specific electricity production based on the heat consumption. Because of this the steam-turbine condensation units which are the traditional capacity regulators for the energy systems with heat power plants dominance are being pushed out of operation. In consequence of this complex of changes the issue of load diagram provision gains momentum which in evidence is relevant to the Consolidated Energy System of Belarus. One of the ways to alleviate acuteness of the problem could be the specific electric energy production cut on the CHP heat consumption with preserving the heat loads and without their handover to the heat generating capacities of direct combustion i.e. without fuel over-burning. The solution lies in integrating the absorption bromous-lithium heat pump units into the CHP thermal scheme. Through their agency low-temperature heat streams of the generator cooling, the lubrication and condensation heat-extraction of steam minimal passing to the condenser systems are utilized. As a case study the authors choose one of the CHPs in the conditions of which the corresponding employment of the said pumps leads to diminution of the fuel-equivalent specific flow-rate by 20−25 g for 1 kW⋅h production and conjoined electric energy generation capacity lowering. The latter will be handed over to other generating capacities, and the choice of them affects economic expediency of the absorption bromous-lithium heat pump-units installation

  17. U.S. DOE Roundtable and Workshop on Advanced Steel Technologies: Emerging Global Technologies and R&D Opportunities

    Energy Technology Data Exchange (ETDEWEB)

    Pellegrino, Joan [Energetics, Inc., Columbia, MD (United States); Jamison, Keith [Energetics, Inc., Columbia, MD (United States)

    2015-12-01

    This report is based on the proceedings of the U.S. DOE Roundtable and Workshop on Advanced Steel Technologies Workshop hosted by Oak Ridge National Laboratory (ORNL) in cooperation with the U.S. Department of Energy s (DOE s) Advanced Manufacturing Office (AMO) on held on June 23, 2015. Representatives from industry, government, and academia met at the offices of the National Renewable Energy Laboratory in Washington, DC, to share information on emerging steel technologies, issues impacting technology investment and deployment, gaps in research and development (R&D), and opportunities for greater energy efficiency. The results of the workshop are summarized in this report. They reflect a snapshot of the perspectives and ideas generated by the individuals who attended and not all-inclusive of the steel industry and stakeholder community.

  18. Identification and assessment of site treatment plan implementation opportunities for emerging technologies

    Energy Technology Data Exchange (ETDEWEB)

    Bernard, E.A. [Sandia National Labs., Germantown, MD (United States)

    1995-12-31

    The Department of Energy (DOE), in response to the 1992 Federal Facility Compliance Act, has prepared Site Treatment Plans (STP) for the approximately 2,000 waste streams identified within its mixed waste inventory Concurrently, emerging mixed waste treatment technologies are in final development. This paper defines a three-phase process to identify and assess implementation opportunities for these emerging technologies within the STP. It highlights the first phase, functional matching of expected treatment capabilities with proposed treatment requirements. Matches are based on treatment type, regulated contaminant and waste matrix type, for both capabilities and requirements. Results identify specific waste streams and volumes that could be treated by each emerging technology. A study for Plasma Hearth Process, Delphi DETOX{sup sm}, Supercritical Water Oxidation and Vitrification shows that about 200,000 ml of DOE`s mixed waste inventory can potentially be treated by one or more of these emerging technologies. Actual implementations are small fractions of the treatable inventory. Differences between potential and actual implementations must be minimized to accrue optimum benefit from implementation of emerging or alternative treatment technologies. Functional matching is the first phase in identifying and quantifying benefits, addressing technology system and treatment issues, and providing, in part, the basis for STP implementation decisions. DOE, through EM`s Office of Technology Development, has funded this work.

  19. Windows of opportunities and technological innovation in the Brazilian pharmaceutical industry.

    Science.gov (United States)

    Tigre, Paulo Bastos; Nascimento, Caio Victor Machado França do; Costa, Laís Silveira

    2016-11-03

    The Brazilian pharmaceutical industry is heavily dependent on external sources of inputs, capital, and technology. However, the emergence of technological opportunities and the development of biotechnology and the decline of the patent boom and resulting advances by generic drugs have opened windows of opportunities for the local industry. The article examines the Brazilian industry's innovative behavior vis-à-vis these opportunities, showing that although the industry as a whole invests little in innovation, a few large Brazilian companies have expanded their market share and stepped up their investments in research and development, supported by public policies for innovation. Resumo: A indústria farmacêutica brasileira caracteriza-se pela grande dependência de fontes externas de insumos, capital e tecnologia. O surgimento de oportunidades tecnológicas, associadas ao desenvolvimento da biotecnologia e ao fim do boom das patentes com o consequente avanço dos medicamentos genéricos, entretanto, vem abrindo janelas de oportunidades para a indústria local. Este artigo examina o comportamento inovador da indústria brasileira à luz dessas oportunidades, revelando que, embora o conjunto da indústria mantenha baixos níveis de investimentos em inovação, um pequeno grupo de grandes empresas nacionais vem ampliando sua participação no mercado e intensificando seus investimentos em pesquisa e desenvolvimento, apoiados por políticas públicas de inovação.

  20. Talking back to theory: the missed opportunities in learning technology research

    Directory of Open Access Journals (Sweden)

    Martin Oliver

    2011-12-01

    Full Text Available Research into learning technology has developed a reputation for being drivenby rhetoric about the revolutionary nature of new developments, for payingscant attention to theories that might be used to frame and inform research, andfor producing shallow analyses that do little to inform the practice of education.Although there is theoretically-informed research in learning technology, this isin the minority, and has been actively marginalised by calls for applied designwork. This limits opportunities to advance knowledge in the field. Using threeexamples, alternative ways to engage with theory are identified. The paper concludesby calling for greater engagement with theory, and the development of ascholarship of learning technology, in order to enrich practice within the fieldand demonstrate its relevance to other fields of work.

  1. Technologies for utilizing natural resources create new job opportunities in the geosciences in developing countries

    Science.gov (United States)

    Aswathanarayana, U.

    Water, soils, minerals, and biota constitute a community's most significant natural resources. Innovations in technology are generating new jobs in converting into a resource what was yesterday a non-resource; in developing process and control technologies to minimize wastes; and in waste recycling.“Resources are not, they become,” in the words of Zimmerman. In the case of the developing countries, the technologies of choice have not only to be ecologically sustainable and economically viable, but more importantly, employment generating. The new kinds of jobs—for example, in poverty alleviation projects via micro-enterprises based on value-added processing of natural resources—have a strong environmental relevance and tend to lie at the interface of several traditional scientific disciplines. Geoscience graduates in the developing countries are best placed to take advantage of these new job opportunities involving Earth materials, but only if they are exposed to broad-based geoscience instruction.

  2. Examining the Relationship Between Information Acquisition, Entrepreneurial Opportunity Recognition, and Innovation Performance in the High Technology Sector in Taiwan

    Science.gov (United States)

    Wang, Yu-Lin; Ellinger, Andrea D.

    2007-01-01

    The purpose of this study was to investigate the relationships between information acquisition, entrepreneurial opportunity recognition, and innovation performance in the high technology sector in Taiwan. The results suggest that both information acquisition and entrepreneurial opportunity recognition positively contribute to individual-level and…

  3. Ceramic Integration Technologies for Aerospace and Energy Systems: Technical Challenges and Opportunities

    Science.gov (United States)

    Singh, Mrityunjay

    2007-01-01

    Ceramic integration technology has been recognized as an enabling technology for the implementation of advanced ceramic systems in a number of high-temperature applications in aerospace, power generation, nuclear, chemical, and electronic industries. Various ceramic integration technologies (joining, brazing, attachments, repair, etc.) play a role in fabrication and manufacturing of large and complex shaped parts of various functionalities. However, the development of robust and reliable integrated systems with optimum performance requires the understanding of many thermochemical and thermomechanical factors, particularly for high temperature applications. In this presentation, various challenges and opportunities in design, fabrication, and testing of integrated similar (ceramic-ceramic) and dissimilar (ceramic-metal) material systems will be discussed. Experimental results for bonding and integration of SiC based LDI fuel injector, high conductivity C/C composite based heat rejection system, solid oxide fuel cells system, ultra high temperature ceramics for leading edges, and ceramic composites for thermostructural applications will be presented. Potential opportunities and need for the development of innovative design philosophies, approaches, and integrated system testing under simulated application conditions will also be discussed.

  4. Demand Response With Micro-CHP Systems

    NARCIS (Netherlands)

    Houwing, M.; Negenborn, R.R.; De Schutter, B.

    2011-01-01

    With the increasing application of distributed energy resources and novel information technologies in the electricity infrastructure, innovative possibilities to incorporate the demand side more actively in power system operation are enabled. A promising, controllable, residential distributed genera

  5. Advanced Authoring Technologies, Capabilities and Opportunities (Technologies avancees d’authoring, possibilites et opportunites)

    Science.gov (United States)

    2011-02-01

    AUTHORING 6 - 10 RTO-TR-HFM-129 others to update the “Ambush simulation game” used to train drivers in theatre . This update was also instantly...National Armaments Directorate Romanian National Distribution Royal Military Academy – Campus Renaissance 5th Department – Technological Centre...Royal Military Academy – Campus Renaissance H-1885 Budapest 9-11, Drumul Taberei Street Renaissancelaan 30 Sector 6, 061353, Bucharest 1000 Brussels

  6. Toxin-antitoxin loci as stress-response-elements: ChpAK/MazF and ChpBK cleave translated RNAs and are counteracted by tmRNA

    DEFF Research Database (Denmark)

    Christensen, S.K.; Pedersen, K.; Hansen, Flemming G.;

    2003-01-01

    . coli. We show that both proteins inhibit translation by inducing cleavage of translated mRNAs. Consistently, the inhibitory effect of the proteins was counteracted by tmRNA. Amino acid starvation induced strong transcription of chpA that depended on Lon protease but not on ppGpp. Simultaneously, Chp...

  7. Trends in plant virus epidemiology: opportunities from new or improved technologies.

    Science.gov (United States)

    Jones, R A C

    2014-06-24

    This review focuses on new or improved technologies currently being applied, or likely to be applied in the future, to worldwide research on plant virus epidemiology. Recent technological advances and innovations provide many opportunities to improve understanding of the way diverse types of plant virus epidemics develop and how to manage them. The review starts at the macro level by considering how recent innovations in remote sensing and precision agriculture can provide valuable information about (i) virus epidemics occurring at continental, regional or district scales (via satellites) and within individual crops (mostly via lightweight unmanned aerial vehicles), and (ii) exactly where to target control measures. It then considers recent improvements in information systems and innovations in modelling that improve (i) understanding of virus epidemics and ability to predict them, and (ii) delivery to end-users of critical advice on control measures, such as Internet-based Decision Support Systems. The review goes on to discuss how advances in analysis of spatiotemporal virus spread patterns within crops can help to enhance understanding of how virus epidemics develop and validate potentially useful virus control measures. At the micro level, the review then considers the many insights that advances in molecular epidemiology can provide about genetic variation within plant virus populations involved in epidemics, and how this variation drives what occurs at the macro level. Next, it describes how recent innovations in virus detection technologies are providing many opportunities to collect and analyse new types, and ever increasing amounts, of data about virus epidemics, and the genetic variability of the virus populations involved. Finally, the implications for plant virus epidemiology of technologies likely to be important in the future are considered. To address looming world food insecurity and threats to plant biodiversity resulting from climate change and

  8. Liquidity, Technological Opportunities, and the Stage Distribution of Venture Capital Investments.

    Science.gov (United States)

    Lahr, Henry; Mina, Andrea

    2014-06-01

    This paper explores the determinants of the stage distribution of European venture capital investments from 1990 to 2011. Consistent with liquidity risk theory, we find that the likelihood of investing in earlier stages increases relative to all private equity investments during liquidity crisis years. While liquidity is the main driver of acquisition investments and, to some extent, of expansion financings, technological opportunities are overall the main driver of early and late stage venture capital investments. In contrast to the dotcom crash, the recent financial crisis negatively affected the relative likelihood of expansion investments, but not of early and late stage investments.

  9. Combined Heat and Power Market Potential for Opportunity Fuels

    Energy Technology Data Exchange (ETDEWEB)

    Jones, David [Resource Dynamics Corporation, McLean, VA (United States); Lemar, Paul [Resource Dynamics Corporation, McLean, VA (United States

    2015-12-01

    This report estimates the potential for opportunity fuel combined heat and power (CHP) applications in the United States, and provides estimates for the technical and economic market potential compared to those included in an earlier report. An opportunity fuel is any type of fuel that is not widely used when compared to traditional fossil fuels. Opportunity fuels primarily consist of biomass fuels, industrial waste products and fossil fuel derivatives. These fuels have the potential to be an economically viable source of power generation in various CHP applications.

  10. Developing a Model for a CHP System with Storage

    Directory of Open Access Journals (Sweden)

    M. Abunku

    2016-04-01

    Full Text Available A model for a Combined Heat and Power (CHP system developed using Matlab is presented in this project. The model developed includes sub-models of Internal Combustion Engine (ICE and generator, electrical and thermal storage systems, and power converters (rectifier and inverter. The model developed is able to simulate the performance of a CHP system when supplying user load. The battery electrical storage system is modelled and used as the electrical storage for this project, and the water storage tank is modelled and used as thermal storage. The project presents the model developed, and the results of the analysis done on the model. The model considered only heat from engine cooling, which is used to heat water to supply the DHW (District Hot Water needs of the user. The results show that by the addition of storage to the CHP system, the overall system efficiency is increased by 32% indicating that the model developed is reliable, and the project is a feasible one

  11. Ceramic Integration Technologies for Advanced Energy Systems: Critical Needs, Technical Challenges, and Opportunities

    Science.gov (United States)

    Singh, Mrityunjay

    2010-01-01

    Advanced ceramic integration technologies dramatically impact the energy landscape due to wide scale application of ceramics in all aspects of alternative energy production, storage, distribution, conservation, and efficiency. Examples include fuel cells, thermoelectrics, photovoltaics, gas turbine propulsion systems, distribution and transmission systems based on superconductors, nuclear power generation and waste disposal. Ceramic integration technologies play a key role in fabrication and manufacturing of large and complex shaped parts with multifunctional properties. However, the development of robust and reliable integrated systems with optimum performance requires the understanding of many thermochemical and thermomechanical factors, particularly for high temperature applications. In this presentation, various needs, challenges, and opportunities in design, fabrication, and testing of integrated similar (ceramic ceramic) and dissimilar (ceramic metal) material www.nasa.gov 45 ceramic-ceramic-systems have been discussed. Experimental results for bonding and integration of SiC based Micro-Electro-Mechanical-Systems (MEMS) LDI fuel injector and advanced ceramics and composites for gas turbine applications are presented.

  12. Research, Development and Demonstration of Micro-CHP Systems for Residential Applications - Phase I

    Energy Technology Data Exchange (ETDEWEB)

    Robert A. Zogg

    2011-03-14

    The objective of the Micro-CHP Phase I effort was to develop a conceptual design for a Micro-CHP system including: Defining market potential; Assessing proposed technology; Developing a proof-of-principle design; and Developing a commercialization strategy. TIAX LLC assembled a team to develop a Micro-CHP system that will provide electricity and heating. TIAX, the contractor and major cost-share provider, provided proven expertise in project management, prime-mover design and development, appliance development and commercialization, analysis of residential energy loads, technology assessment, and market analysis. Kohler Company, the manufacturing partner, is a highly regarded manufacturer of standby power systems and other residential products. Kohler provides a compellingly strong brand, along with the capabilities in product development, design, manufacture, distribution, sales, support, service, and marketing that only a manufacturer of Kohler's status can provide. GAMA, an association of appliance and equipment manufacturers, provided a critical understanding of appliance commercialization issues, including regulatory requirements, large-scale market acceptance issues, and commercialization strategies. The Propane Education & Research Council, a cost-share partner, provided cost share and aided in ensuring the fuel flexibility of the conceptual design. Micro-CHP systems being commercialized in Europe and Japan are generally designed to follow the household thermal load, and generate electricity opportunistically. In many cases, any excess electricity can be sold back to the grid (net metering). These products, however, are unlikely to meet the demands of the U.S. market. First, these products generally cannot provide emergency power when grid power is lost--a critical feature to market success in the U.S. Even those that can may have insufficient electric generation capacities to meet emergency needs for many U.S. homes. Second, the extent to which net

  13. More performance by means of enhancement of the efficiency of CHP plants. CHP operation of an ORC plant; Mehr Leistung durch Effizienzsteigerung von KWK-Anlagen. KWK-Betrieb einer ORC-Anlage

    Energy Technology Data Exchange (ETDEWEB)

    Greschner, Timm; Fink, Jochen; Stadelmaier, Fabian [Duerr Cyplan Ltd., Bietigheim-Bissingen (Germany)

    2013-07-15

    In November 2012, the biogas plant of Stadtwerke Gross-Gerau-Versorgungs-GmbH (GGV) was supplemented with an energy-efficient organic Rankine cycle system (ORC) from Duerr Cyplan Ltd. (Bietigheim-Bissingen, Federal Republic of Germany). The ORC technology enables the utilization of the exhaust heat from the combustion of the gas for the power generation. Hereby, the efficiency in the power generation is increased by about 8 % in Gross-Gerau. Furthermore, the existing energy recovery concept is improved by the CHP operation of the ORC system. With the experience from Gross-Gerau new business segments can be accessed by means of the ORC technology.

  14. Value impact assessment: A preliminary assessment of improvement opportunities at the Quantico Central Heating Plant

    Energy Technology Data Exchange (ETDEWEB)

    Brambley, M.R.; Weakley, S.A.

    1990-09-01

    This report presents the results of a preliminary assessment of opportunities for improvement at the US Marine Corps (USMC) Quantico, Virginia, Central Heating Plant (CHP). This study is part of a program intended to provide the CHP staff with a computerized Artificial Intelligence (AI) decision support system that will assist in a more efficient, reliable, and safe operation of their plant. As part of the effort to provide the AI decision support system, a team of six scientists and engineers from the Pacific Northwest Laboratory (PNL) visited the plant to characterize the conditions and environment of the CHP. This assessment resulted in a list of potential performance improvement opportunities at the CHP. In this report, 12 of these opportunities are discussed and qualitatively analyzed. 70 refs., 7 figs., 6 tabs.

  15. Opportunities and Needs for Mobile-Computing Technology to Support U.S. Geological Survey Fieldwork

    Science.gov (United States)

    Wood, Nathan J.; Halsing, David L.

    2006-01-01

    To assess the opportunities and needs for mobile-computing technology at the U.S. Geological Survey (USGS), we conducted an internal, Internet-based survey of bureau scientists whose research includes fieldwork. In summer 2005, 144 survey participants answered 65 questions about fieldwork activities and conditions, technology to support field research, and postfieldwork data processing and analysis. Results suggest that some types of mobile-computing technology are already commonplace, such as digital cameras and Global Positioning System (GPS) receivers, whereas others are not, such as personal digital assistants (PDAs) and tablet-based personal computers (tablet PCs). The potential for PDA use in the USGS is high: 97 percent of respondents record field observations (primarily environmental conditions and water-quality data), and 87 percent take field samples (primarily water-quality data, water samples, and sediment/soil samples). The potential for tablet PC use in the USGS is also high: 59 percent of respondents map environmental features in the field, primarily by sketching in field notebooks, on aerial photographs, or on topographic-map sheets. Results also suggest that efficient mobile-computing-technology solutions could benefit many USGS scientists because most respondents spend at least 1 week per year in the field, conduct field sessions that are least 1 week in duration, have field crews of one to three people, and typically travel on foot about 1 mi from their field vehicles. By allowing researchers to enter data directly into digital databases while in the field, mobile-computing technology could also minimize postfieldwork data processing: 93 percent of respondents enter collected field data into their office computers, and more than 50 percent spend at least 1 week per year on postfieldwork data processing. Reducing postfieldwork data processing could free up additional time for researchers and result in cost savings for the bureau. Generally

  16. A study on electricity export capability of the μCHP system with spot price

    DEFF Research Database (Denmark)

    You, Shi; Træholt, Chresten; Poulsen, Bjarne

    2009-01-01

    When a number of muCHP systems are aggregated as a virtual power plant (VPP), they will be able to participate in the electricity wholesale market with no discrimination compared to conventional large power plants. Hence, this paper investigates the electricity export capability of the muCHP system...... when the electricity buyback price is given at a value equalizing the dynamic spot price. A muCHP system is modeled with optimized generation, and the marginal price of electricity export for such system is explained. A sensitivity analysis of several key factors, e.g. fuel price, heat to power ratio...... of the muCHP unit, which influence the export capability of muCHP system, is firstly carried out in the intraday case study, followed by the annual case study which explores the annual system performance. The results show that the electricity export capability of a muCHP system is closely related to its...

  17. Government policy and market penetration opportunities for US renewable energy technology in India and Pakistan

    Energy Technology Data Exchange (ETDEWEB)

    Sathaye, J.; Weingart, J.M.

    1988-01-01

    Some US renewable energy industries are now looking abroad, especially to the rapidly developing Asia-Pacific region, in order to increase sales and expand markets. The developing world appears in principle to be an important market for renewable energy technologies. These international markets have proven extremely difficult to penetrate, and the US competitive position is threatened by strong, well-organized, government-supported competition from Japan and Western Europe. For example, US photovoltaic manufacturers held 80% of the world PV market in 1980; today their market share is down to 35%. Less developed countries (LDCs) present a potentially significant but highly elusive market for renewable energy technologies. This market may develop for three major reasons; the shortage of electricity supply and the high cost of grid extension to rural areas, the high cost of oil imports and the scarcity of light oil products, and the gradual replacement of traditional fuels with modern ones. The focus of this report is on the policies and attitudes of national and regional governments in India and Pakistan towards renewable energy technology and how these policies and attitudes affect the potential for penetration of these markets by US industry. We have attempted to provide some useful insight into the actual market environment in India and Pakistan rather than just report on official laws, regulations, and policies. The report also examines the economics of technologies in comparison with more traditional sources of energy. It concentrates primarily on technologies, such as photovoltaics and wind electric systems, that would benefit from foreign participation, but also identifies potential market opportunities for advanced solar desalination and other renewable energy technologies. 31 refs.

  18. Regulatory impacts in relation to a renewable fuel CHP technology

    DEFF Research Database (Denmark)

    Groth, Tanja

    2014-01-01

    As part of the COLOSS GEI experiment, one apiary in Chalkidi, Greece was continuously monitored for various pests and pathogens including V. destructor mites, Nosema spp. spores, and quantitative titers of five viruses from late summer 2009 until March 2012. The apiary was established with 39 col...

  19. CHP from Updraft Gasifier and Stirling Engine

    DEFF Research Database (Denmark)

    Jensen, N.; Werling, J.; Carlsen, Henrik

    2002-01-01

    The combination of thermal gasification with a Stirling engine is an interesting concept for use in small combined heat and power plants based on biomass. By combining the two technologies a synergism can potentially be achieved. Technical problems, e.g. gas cleaning and fouling of the Stirling...... engine heat exchanger, can be eliminated and the overall electric efficiency of the system can be improved. At the Technical University of Denmark a Stirling engine fueled by gasification gas has been developed. In this engine the combustion system and the geometry of the hot heat exchanger...... of the Stirling engine has been adapted to the use of a gas with a low specific energy content and a high content of tar and particles. In the spring of 2001 a demonstration plant has been built in the western part of Denmark where this Stirling engine is combined with an updraft gasifier. A mathematical...

  20. Cubic Satellites, Vanguard Technology Integration, an Educational Opportunity of Modernization in Mexico

    Science.gov (United States)

    Moreno-Franco, Olmo A.; Muñoz-Ubando, L. A.; Moreno-Moreno, Prudenciano; Vargas-Méndez, Eduardo E.

    This paper provides a theoretical approach on the CubeSat standard making a cost-benefit analysis in the use of pico-satellites at the education and technology integration model for educational modernization. With the CubeSat format is planned to develop an orbit LEO pico-satellite as part of a multidisciplinary project led by the Robotics Institute of Yucatan (TRIY), assisted with previous experience in Mexico and Colombia, to build a satellite capable of stabilizing through a robotic device, which will be a training model for human resources in Mexico. The CubeSat initiative represents a technological development of more than 10 years who is still alive and growing, attracting new participants from different educational institutions and global business, which has proven to be a project that would be made and successful results with a significant low budget compared to other space missions, and finally is an opportunity to bring students and teachers to the aerospace industry, through a convergence of technology, and academic discipline.

  1. Addressing diverse learner preferences and intelligences with emerging technologies: Matching models to online opportunities

    Directory of Open Access Journals (Sweden)

    Ke Zhang

    2009-03-01

    Full Text Available This paper critically reviews various learning preferences and human intelligence theories and models with a particular focus on the implications for online learning. It highlights a few key models, Gardner’s multiple intelligences, Fleming and Mills’ VARK model, Honey and Mumford’s Learning Styles, and Kolb’s Experiential Learning Model, and attempts to link them to trends and opportunities in online learning with emerging technologies. By intersecting such models with online technologies, it offers instructors and instructional designers across educational sectors and situations new ways to think about addressing diverse learner needs, backgrounds, and expectations. Learning technologies are important for effective teaching, as are theories and models and theories of learning. We argue that more immense power can be derived from connections between the theories, models and learning technologies. Résumé : Cet article passe en revue de manière critique les divers modèles et théories sur les préférences d’apprentissage et l’intelligence humaine, avec un accent particulier sur les implications qui en découlent pour l’apprentissage en ligne. L’article présente quelques-uns des principaux modèles (les intelligences multiples de Gardner, le modèle VAK de Fleming et Mills, les styles d’apprentissage de Honey et Mumford et le modèle d’apprentissage expérientiel de Kolb et tente de les relier à des tendances et occasions d’apprentissage en ligne qui utilisent les nouvelles technologies. En croisant ces modèles avec les technologies Web, les instructeurs et concepteurs pédagogiques dans les secteurs de l’éducation ou en situation éducationnelle se voient offrir de nouvelles façons de tenir compte des divers besoins, horizons et attentes des apprenants. Les technologies d’apprentissage sont importantes pour un enseignement efficace, tout comme les théories et les modèles d’apprentissage. Nous sommes d

  2. Challenges and Development Opportunities for Catalytic Technologies in Petrochemical Industry in the 21st Century

    Institute of Scientific and Technical Information of China (English)

    CHEN Qing-ling

    2004-01-01

    The propellent drive and development opportunities for future catalytic technologies in petrochemical industry in the 21st century are reviewed in this paper. It focuses on the following five aspects:(1) The environmentally-friendly catalytic technologies, such as new technologies for the production of organic chemicals changing the raw material and synthetic process, the chemicals production replacing phosgene and hydrogen cyanide toxicant, and the conversion and utilization of organic wastes etc.(2) Utilization and development of cheaper light alkanes, for example, the chemical use of natural gas and the development technologies of methane chain, the production of acetic acid, ethylene and vinyl chloride from selective oxidation of ethane, as well as the manufacture of acrolein and acrylonitrile from the oxidation and ammoxidation of propane.(3) The new propylene-plus technologies of the low value higher olefins, such as catalytic cracking of C4,C5 olefins and metathesis of C4 olefin.(4) The technologies of high selective oxidation, e.g. production of propylene oxide with TS-1 molecular sieve, oxidation process by lattice oxygen and direct oxidation of benzene to phenol etc.(5) Development and application of novel catalytic materials, especially, mesopore molecular sieve materials for a larger molecule reaction, zeolite catalyst with MWW structure for alkylation of benzene and propylene, ionic liquid, and membrane reactor catalyst etc.Meanwhile,the challenging research subjects for future industrial catalysis and the several viewpoints for development strategy of new catalytic technologies are proposed. These viewpoints are as follows:(1) Catalysis discipline must be integrated with many other disciplines and should be multidisciplinary and transdisciplinary.(2) New preparation methods of catalytic materials must be originally developed.(3) The instrumentation having better time resolution and spatial resolution and applying under reaction conditions must be

  3. Integration Science and Technology of Silicon-Based Ceramics and Composites:Technical Challenges and Opportunities

    Science.gov (United States)

    Singh, M.

    2013-01-01

    Ceramic integration technologies enable hierarchical design and manufacturing of intricate ceramic and composite parts starting with geometrically simpler units that are subsequently joined to themselves and/or to metals to create components with progressively higher levels of complexity and functionality. However, for the development of robust and reliable integrated systems with optimum performance for high temperature applications, detailed understanding of various thermochemical and thermomechanical factors is critical. Different technical approaches are required for the integration of ceramic to ceramic and ceramic to metal systems. Active metal brazing, in particular, is a simple and cost-effective method to integrate ceramic to metallic components. Active braze alloys usually contain a reactive filler metal (e.g., Ti, Cr, V, Hf etc) that promotes wettability and spreading by inducing chemical reactions with the ceramics and composites. In this presentation, various examples of brazing of silicon nitride to themselves and to metallic systems are presented. Other examples of joining of ceramic composites (C/SiC and SiC/SiC) using ceramic interlayers and the resulting microstructures are also presented. Thermomechanical characterization of joints is presented for both types of systems. In addition, various challenges and opportunities in design, fabrication, and testing of integrated similar (ceramic-ceramic) and dissimilar (ceramic-metal) material systems will be discussed. Potential opportunities and need for the development of innovative design philosophies, approaches, and integrated system testing under simulated application conditions will also be presented.

  4. Emissions from decentralised CHP plants 2007 - Energinet.dk Environmental project no. 07/1882

    DEFF Research Database (Denmark)

    Nielsen, Malene; Nielsen, Ole-Kenneth; Thomsen, Marianne

    estimated for the plant technologies: Municipal solid waste (MSW) incineration plants, plants combusting straw or wood, natural gas fuelled reciprocating engines, biogas fuelled engines, natural gas fuelled gas turbines, gas oil fuelled reciprocating engines, gas oil fuelled gas turbines, steam turbines...... engines have been reduced since year 2000 as a result of technical improvements that have been carried out due to lower emission limit values in Danish legislation. The NOx emission factor for natural gas fuelled gas turbines has decreased 62 % since year 2000. This is a result of installation of low......-NOx burners in almost all gas turbines that has been necessary to meet new emission limits in Danish legislation. The emission measurements programme included screening of the emissions of HCB, PCB, PCDD/-F and PBDD/-F. Compared to the Danish national emission decentralized CHP plants are major emission...

  5. Characterization of ultrafine and fine particles from CHP Plants

    Energy Technology Data Exchange (ETDEWEB)

    2009-08-15

    Samples of particles collected at CHP plants in the project 'Survey of emissions from CHP Plants' have been analysed in this project to give information on the morphology and chemical composition of individual particle size classes. The objective of this project was to characterize ultrafine and fine particles emitted to the atmosphere from Danish CHP plants. Nine CHP plants were selected in the Emission Survey Project as being representative for the different types of CHP plants operating in Denmark: 1) Three Waste-to Energy (WTE) plants. 2) Three biomass fired (BM) plants (two straw fired, one wood/saw dust fired). 3) Two gas fired (GF) plants (one natural gas, one landfill gas fired). 4) One gasoil (GO) fired plant. At the WTE and BM plants, various types of emission control systems implemented. The results from these plants represent the composition and size distribution of combustion particles that are emitted from the plants emission control systems. The measured emissions of particles from the waste-to-energy plants WTE1-3 are generally very low. The number and mass concentrations of ultrafine particles (PM{sub 0.1}) were particularly low in the flue gas from WTE2 and WTE3, where bag filters are used for the reduction of particle emissions. The EDX analysis of particles from the WTE plants indicates that the PM{sub 0.1} that penetrates the ECS at WTE can contain high fractions of metals such as Fe, Mn and Cu. The SEM analysis of particles from WTE1-3 showed that the particles were generally porous and irregular in shape. The concentrations of particles in the flue gas from the biomass plants were generally higher than found for the WTE plants. The time series results showed that periodical, high concentration peaks of PM emissions occur from BM1 and BM2. The chemical composition of the particles emitted from the three biomass plants is generally dominated by C, O and S, and to some extend also Fe and Si. A high amount of Cu was found in selected

  6. The rv1184c locus encodes Chp2, an acyltransferase in Mycobacterium tuberculosis polyacyltrehalose lipid biosynthesis.

    Science.gov (United States)

    Touchette, Megan H; Holsclaw, Cynthia M; Previti, Mary L; Solomon, Viven C; Leary, Julie A; Bertozzi, Carolyn R; Seeliger, Jessica C

    2015-01-01

    Trehalose glycolipids are found in many bacteria in the suborder Corynebacterineae, but methyl-branched acyltrehaloses are exclusive to virulent species such as the human pathogen Mycobacterium tuberculosis. In M. tuberculosis, the acyltransferase PapA3 catalyzes the formation of diacyltrehalose (DAT), but the enzymes responsible for downstream reactions leading to the final product, polyacyltrehalose (PAT), have not been identified. The PAT biosynthetic gene locus is similar to that of another trehalose glycolipid, sulfolipid 1. Recently, Chp1 was characterized as the terminal acyltransferase in sulfolipid 1 biosynthesis. Here we provide evidence that the homologue Chp2 (Rv1184c) is essential for the final steps of PAT biosynthesis. Disruption of chp2 led to the loss of PAT and a novel tetraacyltrehalose species, TetraAT, as well as the accumulation of DAT, implicating Chp2 as an acyltransferase downstream of PapA3. Disruption of the putative lipid transporter MmpL10 resulted in a similar phenotype. Chp2 activity thus appears to be regulated by MmpL10 in a relationship similar to that between Chp1 and MmpL8 in sulfolipid 1 biosynthesis. Chp2 is localized to the cell envelope fraction, consistent with its role in DAT modification and possible regulatory interactions with MmpL10. Labeling of purified Chp2 by an activity-based probe was dependent on the presence of the predicted catalytic residue Ser141 and was inhibited by the lipase inhibitor tetrahydrolipstatin (THL). THL treatment of M. tuberculosis resulted in selective inhibition of Chp2 over PapA3, confirming Chp2 as a member of the serine hydrolase superfamily. Efforts to produce in vitro reconstitution of acyltransferase activity using straight-chain analogues were unsuccessful, suggesting that Chp2 has specificity for native methyl-branched substrates.

  7. The disappearing utility workforce : are aging personnel a human resources problem or a technology opportunity?

    Energy Technology Data Exchange (ETDEWEB)

    Kitterman, B.; Dugan, J. [LogicaCMG, Houston, TX (United States)

    2006-03-15

    The retirement of a large cohort of skilled workers in the electricity industry may provide an opportunity for utilities to improve their financial performance. Personnel related expenses have continued to squeeze profit margins at many utilities. In order to achieve annual earnings improvement targets of 10-15 per cent, many utilities have had no alternative but to reduce ongoing operational expenses. However, with nearly a third of the industry eligible to retire within the next 5 years, personnel cuts are no longer warranted. This article examined ways in which innovative technology can drive improvements in utilities to reduce future costs, make better use of reduced staffs and capture the knowledge base of skilled workers before their departure. The high performance utility of the future must commit to a program of continuous process improvement. The use of design templates for light or medium construction activities can accommodate as much as 80 per cent of the design engineering workload and reduce the number of engineers required. A single dispatching technology was recommended to reduce redundant job roles and incorporate the scheduling of field personnel. A plug and play wireless communications architecture was recommended to manage the flow of data between the office and the field, as well as to maximize the throughput of utility radio wire line and wireless networks, and to assign priorities to time sensitive data. It was suggested that a wireless enterprise strategy should accommodate the management of multiple field devices as well as supporting server and communications hardware. It was concluded that strategic technologies will help utilities to institutionalize the knowledge of seasoned employees and help to develop a set of sustainable best practices. In addition, a new technology platform will unite all segments of utility operations within a single set of business goals. 2 figs.

  8. A MATHEMATICAL MODEL OF CHP 2000 TYPE PROGRESSIVE GEAR

    Directory of Open Access Journals (Sweden)

    Paweł Lonkwic

    2016-12-01

    Full Text Available The project of CHP2000 type progressive gear has been presented in the article. The offered solution from its construction point of view differs from the existing solutions due to the application of Belleville springs packets supporting the braking roller cam and achieving a flexible range of the gear loading. The standard concept of the gear loading within a mathematical and a geometrical model has been presented in the article. The proposed solution can be used in the friction lifts with the loading capacity from 8500 up to 20000 N.

  9. Surveying Wearable Human Assistive Technology for Life and Safety Critical Applications: Standards, Challenges and Opportunities

    Directory of Open Access Journals (Sweden)

    Muhammad Mahtab Alam

    2014-05-01

    Full Text Available In this survey a new application paradigm life and safety for critical operations and missions using wearable Wireless Body Area Networks (WBANs technology is introduced. This paradigm has a vast scope of applications, including disaster management, worker safety in harsh environments such as roadside and building workers, mobile health monitoring, ambient assisted living and many more. It is often the case that during the critical operations and the target conditions, the existing infrastructure is either absent, damaged or overcrowded. In this context, it is envisioned that WBANs will enable the quick deployment of ad-hoc/on-the-fly communication networks to help save many lives and ensuring people’s safety. However, to understand the applications more deeply and their specific characteristics and requirements, this survey presents a comprehensive study on the applications scenarios, their context and specific requirements. It explores details of the key enabling standards, existing state-of-the-art research studies, and projects to understand their limitations before realizing aforementioned applications. Application-specific challenges and issues are discussed comprehensively from various perspectives and future research and development directions are highlighted as an inspiration for new innovative solutions. To conclude, this survey opens up a good opportunity for companies and research centers to investigate old but still new problems, in the realm of wearable technologies, which are increasingly evolving and getting more and more attention recently.

  10. Surveying wearable human assistive technology for life and safety critical applications: standards, challenges and opportunities.

    Science.gov (United States)

    Alam, Muhammad Mahtab; Ben Hamida, Elyes

    2014-05-23

    In this survey a new application paradigm life and safety for critical operations and missions using wearable Wireless Body Area Networks (WBANs) technology is introduced. This paradigm has a vast scope of applications, including disaster management, worker safety in harsh environments such as roadside and building workers, mobile health monitoring, ambient assisted living and many more. It is often the case that during the critical operations and the target conditions, the existing infrastructure is either absent, damaged or overcrowded. In this context, it is envisioned that WBANs will enable the quick deployment of ad-hoc/on-the-fly communication networks to help save many lives and ensuring people's safety. However, to understand the applications more deeply and their specific characteristics and requirements, this survey presents a comprehensive study on the applications scenarios, their context and specific requirements. It explores details of the key enabling standards, existing state-of-the-art research studies, and projects to understand their limitations before realizing aforementioned applications. Application-specific challenges and issues are discussed comprehensively from various perspectives and future research and development directions are highlighted as an inspiration for new innovative solutions. To conclude, this survey opens up a good opportunity for companies and research centers to investigate old but still new problems, in the realm of wearable technologies, which are increasingly evolving and getting more and more attention recently.

  11. Telerehabilitation Clinical and Vocational Applications for Assistive Technology: Research, Opportunities, and Challenges

    Directory of Open Access Journals (Sweden)

    Mark R. Schmeler

    2009-09-01

    Full Text Available Rehabilitation service providers in rural or underserved areas are often challenged in meeting the needs of their complex patients due to limited resources in their geographical area. Recruitment and retention of the rural clinical workforce are beset by the ongoing problems associated with limited continuing education opportunities, professional isolation, and the challenges inherent in coordinating rural community healthcare. People with disabilities who live in rural communities also face challenges accessing healthcare. Traveling long distances to a specialty clinic for necessary expertise may be troublesome due to inadequate or unavailable transportation, disability specific limitations, and financial limitations. Distance and lack of access are just two threats to quality of care that now being addressed by the use of videoconferencing, information exchange, and other telecommunication technologies that facilitate telerehabilitation. This white paper illustrates and summarizes clinical and vocational applications of telerehabilitation. We provide definitions related to the fields of telemedicine, telehealth, and telerehabilitation, and consider the impetus for telerehabilitation. We review the telerehabilitation literature for assistive technology applications; pressure ulcer prevention; virtual reality applications; speech-language pathology applications; seating and wheeled mobility applications; vocational rehabilitation applications; and cost effectiveness. We then discuss external telerehabilitation influencers, such as the positions of professional organizations. Finally, we summarize clinical and policy issues in a limited context appropriate to the scope of this paper. Keywords: Telerehabilitation, Telehealth, Telemedicine, Telepractice

  12. Implementation strategy for small CHP-plants in a competitive market

    DEFF Research Database (Denmark)

    Lund, Henrik; Šiupšinskas, G.; Martinaitis, V.

    2005-01-01

    The article analyses the conditions for the replacement of boilers in the existing district-heating supplies with combined heat-and-power production (CHP) in Lithuania.......The article analyses the conditions for the replacement of boilers in the existing district-heating supplies with combined heat-and-power production (CHP) in Lithuania....

  13. Opportunities for Regenerative Rehabilitation and Advanced Technologies in Physical Therapy: Perspective From Academia.

    Science.gov (United States)

    Norland, Ryan; Muchnick, Matthew; Harmon, Zachary; Chin, Tiffany; Kakar, Rumit Singh

    2016-04-01

    As rehabilitation specialists, physical therapists must continue to stay current with advances in technologies to provide appropriate rehabilitation protocols, improve patient outcomes, and be the preferred clinician of choice. To accomplish this vision, the physical therapy profession must begin to develop a culture of lifelong learning at the early stages of education and clinical training in order to embrace cutting-edge advancements such as stem cell therapies, tissue engineering, and robotics, to name a few. The purposes of this article are: (1) to provide a current perspective on faculty and graduate student awareness of regenerative rehabilitation concepts and (2) to advocate for increased integration of these emerging technologies within the doctor of physical therapy (DPT) curriculum. An online survey was designed to gauge awareness of principles in regenerative rehabilitation and to determine whether the topic was included and assessed in doctoral curricula. The survey yielded 1,006 responses from 82 DPT programs nationwide and indicated a disconnect in familiarity with the term "regenerative rehabilitation" and awareness of the inclusion of this material in the curriculum. To resolve this disconnect, the framework of the curriculum can be used to integrate new material via guest lecturers, interdisciplinary partnerships, and research opportunities. Successfully mentoring a generation of clinicians and rehabilitation scientists who incorporate new medical knowledge and technology into their own clinical and research practice depends greatly on sharing the responsibility among graduate students, professors, the American Physical Therapy Association (APTA), and DPT programs. Creating an interdisciplinary culture and integrating regenerative medicine and rehabilitation concepts into the curriculum will cultivate individuals who will be advocates for interprofessional behaviors and will ensure that the profession meets the goals stated in APTA Vision 2020.

  14. Mobile Technologies & Socio-Economic Opportunities for Disadvantaged Women: A Study of Information Behavior in a Developing Nation Context

    Science.gov (United States)

    Potnis, Devendra Dilip

    2010-01-01

    Information and communication technologies (ICTs) have been championed by the United Nations and others as one of the key media to open up socio-economic opportunities for disadvantaged populations. Studies lead us to believe that after being introduced to ICTs, users' information behavior changes, enabling them to benefit from socio-economic…

  15. Large-Scale Educational Telecommunications Systems for the U.S.: An Analysis of Educational Needs and Technological Opportunities.

    Science.gov (United States)

    Morgan, Robert P.; And Others

    Opportunities for utilizing large-scale educational telecommunications delivery systems to aid in meeting needs of U.S. education are extensively analyzed in a NASA-funded report. Status, trends, and issues in various educational subsectors are assessed, along with current use of telecommunications and technology and factors working for and…

  16. On the use of computation optimization opportunities in computer technologies for applied and computational mathematics problems with prescribed quality characteristics

    Science.gov (United States)

    Babich, M. D.; Zadiraka, V. K.; Lyudvichenko, V. A.; Sergienko, I. V.

    2010-12-01

    The use of various opportunities for computation optimization in computer technologies for applied and computational mathematics problems with prescribed quality characteristics is investigated. More precisely, the choice and determination of computational resources and methods of their efficient use for finding an approximate solution of problems up to prescribed accuracy in a limited amount of processor time are investigated.

  17. Power Saving Strategies and Technologies in Network Equipment Opportunities and Challenges, Risk and Rewards

    CERN Document Server

    Ceuppens, Luc; Kharitonov, Daniel

    2009-01-01

    Drawing from todays best-in-class solutions, we identify power-saving strategies that have succeeded in the past and look forward to new ideas and paradigms. We strongly believe that designing energy-efficient network equipment can be compared to building sports cars, task-oriented, focused and fast. However, unlike track-bound sports cars, ultra-fast and purpose-built silicon yields better energy efficiency when compared to more generic family sedan designs that mitigate go-to-market risks by being the masters of many tasks. Thus, we demonstrate that the best opportunities for power savings come via protocol simplification, best-of-breed technology, and silicon and software optimization, to achieve the least amount of processing necessary to move packets. We also look to the future of networking from a new angle, where energy efficiency and environmental concerns are viewed as fundamental design criteria and forces that need to be harnessed to continually create more powerful networking equipment.

  18. SOFC/TEG hybrid mCHP system. Final report

    Energy Technology Data Exchange (ETDEWEB)

    2012-03-15

    The starting point for this project have been the challenge has been to develop a cost effective solution with long term stability. This is where a focused effort in a strong consortium covering material research, module development and manufacture as well as device design and optimization can make a real difference. In March 2010 the SOFTEG phase II project was initiated and a cooperation organization was established to implement the project as a development and demonstration project involving the staff from all project partners. The project is now completed with excellent and documented outcome. The final results by Alpcon have been demonstration as a TEG-based mCHP system calls CHP Dual Engine Power System, which will be applicable as both a standalone TEG-CHP hybrid system, but also as an auxiliary power unit and power booster for the SOFC system. However the SOFC system cannot cover the household's heat demand alone so it is necessary to combine a SOFC system together with a water heater/boiler system to cover the peak heat demand of a residential house or a complex building. The SOFTEG project partners achieved significant results that mainly can be outlined as following: 1) University of Aarhus has improved the thermal stability of ZnSb by optimizing the concentration of Nano composite material. 2) The grain size and its influence on the sintering process by spark plasma method are investigated by Aarhus University, but further work seems to be necessary. 3) The TE material is going to commercialization by Aarhus University. 4) Aalborg University has prepared simulation tools for complex thermoelectric simulation in non-steady state condition. 5) The new type DCDC interleaved converter using the MPPT system for optimal power tracing is designed, build and tested by Aalborg University in cooperation with Alpcon. This task is included overall system design, control system implementation and power electronic control design. 6) Full scale practical

  19. Using Technology and Mentorship to Improve Teacher Pedagogy and Educational Opportunities in Rural Nicaragua

    Directory of Open Access Journals (Sweden)

    Anni Lindenberg

    2016-02-01

    Full Text Available This study used ethnographic methods to understand factors influencing the implementation of an educational intervention combining short math content videos with teacher trainings and mentorship in high-poverty primary schools in Nicaragua with implications for rural school reform. Educators in rural schools in Latin American face serious obstacles to improve classroom instruction and pedagogy, including lack of resources and overcrowding. Research suggests an over-reliance on input-output models in which inputs (e.g. teacher salaries, textbooks, technology, computer labs, numbers of classrooms, etc. are expected to produce particular outputs (student retention, lowering drop-out rates, increasing graduation rates, etc.; however, studies show that regardless of the resources, much depends on effective use of resources for successful teaching and learning (O'Sullivan, 2006; L. S. Shulman, 1987. While input/output models provide insights into an educational systems economic efficiency, they do not offer insight into what actually transpires inside of a classroom (O'Sullivan, 2006. Much depends on effective training and use of these very resources. Though systemic issues in the Nicaraguan educational system produced numerous obstacles for the eleven participating 3rd and 6th grade teachers, the educational intervention model supported teachers’ ability to be innovative and grow their practice in four ways: a increased pedagogical knowledge; b opportunities to collaborate and support one another as a community of teachers; c flexibility in adaptation of the intervention model to their specific classroom context; and d use of videos as supportive resources for content knowledge.

  20. Newly available technologies present expanding opportunities for scientific and technical information exchange

    Science.gov (United States)

    Tolzman, Jean M.

    1993-01-01

    The potential for expanded communication among researchers, scholars, and students is supported by growth in the capabilities for electronic communication as well as expanding access to various forms of electronic interchange and computing capabilities. Increased possibilities for information exchange, collegial dialogue, collaboration, and access to remote resources exist as high-speed networks, increasingly powerful workstations, and large, multi-user computational facilities are more frequently linked and more commonly available. Numerous writers speak of the telecommunications revolution and its impact on the development and dissemination of knowledge and learning. One author offers the phrase 'Scholarly skywriting' to represent a new form of scientific communication that he envisions using electronic networks. In the United States (U.S.), researchers associated with the National Science Foundation (NSF) are exploring 'nationwide collaboratories' and 'digital collaboration.' Research supported by the U.S. National Aeronautics and Space Administration (NASA) points to a future where workstations with built-in audio, video monitors, and screen sharing protocols are used to support collaborations with colleagues located throughout the world. Instruments and sensors located worldwide will produce data streams that will be brought together, analyzed, and distributed as new findings. Researchers will have access to machines that can supply domain-specific information in addition to locator and directory assistance. New forms of electronic journals will emerge and provide opportunities for researchers and scientists to exchange information electronically and interactively in a range of structures and formats. Ultimately, the wide-scale use of these technologies in the dissemination of research results and the stimulation of collegial dialogue will change the way we represent and express our knowledge of the world. A new paradigm will evolve--perhaps a truly worldwide

  1. Enabling Technologies for Entrepreneurial Opportunities in 3D printing of SmallSats

    Science.gov (United States)

    Kwas, Andrew; MacDonald, Eric; Muse, Dan; Wicker, Ryan; Kief, Craig; Aarestad, Jim; Zemba, Mike; Marshall, Bill; Tolbert, Carol; Connor, Brett

    2014-01-01

    A consortium of innovative experts in additive manufacturing (AM) comprising Northrup Grumman Technical Services, University of Texas at El Paso (UTEP), Configurable Space Microsystems Innovations & Applications Center (COSMIAC), NASA Glenn Research Center (GRC), and Youngstown State University, have made significant breakthroughs in the goal of creating the first complete 3D printed small satellite. Since AM machines are relatively inexpensive, this should lead to many entrepreneurial opportunities for the small satellite community. Our technology advancements are focused on the challenges of embedding key components within the structure of the article. We have demonstrated, using advanced fused deposition modeling techniques, complex geometric shapes which optimize the spacecraft design. The UTEP Keck Center has developed a method that interrupts the printing process to insert components into specific cavities, resulting in a spacecraft that has minimal internal space allocated for what traditionally were functional purposes. This allows us to increase experiment and instrument capability by provided added volume in a confined small satellite space. Leveraging initial progress made on a NASA contract, the team investigated the potential of new materials that exploit the AM process, producing candidate compositions that exceed the capabilities of traditional materials. These "new materials" being produced and tested include some that have improved radiation shielding, increased permeability, enhanced thermal properties, better conductive properties, and increased structural performance. The team also investigated materials that were previously not possible to be made. Our testing included standard mechanical tests such as vibration, tensile, thermal cycling, and impact resistance as well as radiation and electromagnetic tests. The initial results of these products and their performance will be presented and compared with standard properties. The new materials with

  2. Implementation of renewable energy technologies - Opportunities and barriers. Egypt country study

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2001-07-01

    The project used case studies of renewable energy implementation projects to analyse the reasons for success or failure of specific projects or technologies. In particular the study aimed to identify possibilities for 'removing' the main barriers and thus 'promoting' increased implementation of (RETs), and to 'generalise' the experiences from the case studies and produce results that can be disseminated and utilized further in a planned second phase. The specific objectives for Egypt Country Study were: 1) To determine, on the basis of analysis of the past experience, the barriers against implementation of RETs in Egypt, and to identify the favourable conditions and actions required for such implementation. 2) To apply the knowledge gained and results of the analysis of past projects for a detailed analysis of barriers to a chosen set of potential RETs implementation projects with view to success. 3) To identify specific RET projects for implementation including necessary actions to overcome identified barriers. The case study revealed that; for Domestic Solar Water Heating (DSWH) the main barriers are; the economic barriers followed by the awareness / information barriers, then the Technical and Institution barriers. For the PV rural electrification, the most important barriers are; the economic and financial barriers, the awareness and information barriers then the technical barriers. For the large-scale biogas systems, the main barriers are the institution and capacity, economic, policy and awareness / information respectively. According to the project results the main actions that could be taken to overcome the barriers and make use of the available opportunities are: Economic / Financial: 1) Creation of new financial schemes for the RETs applications components and systems. 2) Reducing the taxes and duties for the components and / or materials needed for Renewable Energy (RE) systems. 3) More government-supported market incentives

  3. Implementation of renewable energy technologies - Opportunities and barriers. Ghana country study

    Energy Technology Data Exchange (ETDEWEB)

    Edjekumhene, I.; Atakora, S.B.; Atta-Konadu, R.; Brew-Hammond, A. [Kumasi Inst. og Technology and Environment (Ghana)

    2001-07-01

    This report presents the experience of Ghana in the development, utilisation and promotion of Renewable Energy Technologies (RETs). The report gives a general overview of the state of RETs, describes past/existing institutional, regulatory and policy framework, identifies key barriers to and opportunities for RETs, and recommends directional changes needed to remove barriers and promote wide-scale adoption of RETs in Ghana. A total of eight RETs - biomass-fired dryers, sawdust stoves, sawdust briquette, biogas, solar crop dryer, solar water heater, solar water pump and small hydro power - are covered in the report. Analyses of barriers to the eight RETs are carried out using a framework approach that categorises barriers into socio-technical, economic and crosscutting barriers. Financial analyses, as opposed to economic analyses, have been carried out for all the selected RETs. The report also incorporates stake holders' perspectives and views on barriers and how they can be removed. Ghana is endowed with several renewable energy resources like solar radiation, small hydro, biomass, and wind. Exploitation of Ghana's renewable energy resources has been carried out under two main policy regimes - PND Law 62 (1983) and the Energy Sector Development Programme (ESDP). Several measures and instruments have been employed in the implementation of renewable energy policies. The main measures used are research and development, information and eduction, and some normative measures (like the passing of PNDC Law 62 and the Energy Commission Law). Some economic instruments, such as subsidies, taxes, pricing, financing and duty waiver/reduction, have been used as well but only to a limited extent. The effective development, implementation and dissemination of all the RETs studied are hampered by several barriers, which can be grouped into three main categories - Socio-technical barriers, economic barriers and crosscutting barriers. Socio-technical barriers refer to

  4. Implementation of renewable energy technologies - Opportunities and barriers. Ghana country study

    Energy Technology Data Exchange (ETDEWEB)

    Edjekumhene, I.; Atakora, S.B.; Atta-Konadu, R.; Brew-Hammond, A. [Kumasi Inst. og Technology and Environment (Ghana)

    2001-07-01

    This report presents the experience of Ghana in the development, utilisation and promotion of Renewable Energy Technologies (RETs). The report gives a general overview of the state of RETs, describes past/existing institutional, regulatory and policy framework, identifies key barriers to and opportunities for RETs, and recommends directional changes needed to remove barriers and promote wide-scale adoption of RETs in Ghana. A total of eight RETs - biomass-fired dryers, sawdust stoves, sawdust briquette, biogas, solar crop dryer, solar water heater, solar water pump and small hydro power - are covered in the report. Analyses of barriers to the eight RETs are carried out using a framework approach that categorises barriers into socio-technical, economic and crosscutting barriers. Financial analyses, as opposed to economic analyses, have been carried out for all the selected RETs. The report also incorporates stake holders' perspectives and views on barriers and how they can be removed. Ghana is endowed with several renewable energy resources like solar radiation, small hydro, biomass, and wind. Exploitation of Ghana's renewable energy resources has been carried out under two main policy regimes - PND Law 62 (1983) and the Energy Sector Development Programme (ESDP). Several measures and instruments have been employed in the implementation of renewable energy policies. The main measures used are research and development, information and eduction, and some normative measures (like the passing of PNDC Law 62 and the Energy Commission Law). Some economic instruments, such as subsidies, taxes, pricing, financing and duty waiver/reduction, have been used as well but only to a limited extent. The effective development, implementation and dissemination of all the RETs studied are hampered by several barriers, which can be grouped into three main categories - Socio-technical barriers, economic barriers and crosscutting barriers. Socio-technical barriers refer to

  5. R&D-needs and opportunities to broaden the data base on materials and technology for liquid metal spallation targets

    Energy Technology Data Exchange (ETDEWEB)

    Bauer, G.S.

    1996-06-01

    Liquid metals have so far only been used to a very limited extent as spallation targets, notably at the ISOLDE-facility at CERN (Pb and La) to produce radioactive isotopes. Virtually no systematic studies have been carried out so far. The available data base is by no means sufficient to answer conclusively very important questions such as predicting reliably the service time of medium-to-high power target systems or determining precisely what technological measures are required and appropriate to maintain an optimum coolant quality, to mitigate the effects of pressure waves in short pulse sources and others. During the workshop several areas have been identified, where there exists an urgent need for improved knowledge and reliable data, and opportunities have been presented to acquire such knowledge and to generate such data. Opportunities to do such research and pertinent know-how, although scarce, are spread over institutions in several countries, and efforts to use these opportunities often require substantial resources both in man power and money. The workshop participants therefore unanimously supported the view that a coordinated and internationally concerted effort should be undertaken to make the best possible use of existing opportunities and available resources in order to develop the knowledge and technology necessary for the deployment and safe operation of target systems suitable for pulsed spallation neutron sources in the multi-megawatt range of beam power.

  6. Comparison of Technological Options for Distributed Generation-Combined Heat and Power in Rajasthan State of India

    Directory of Open Access Journals (Sweden)

    Ram Kumar Agrawal

    2013-01-01

    Full Text Available Distributed generation (DG of electricity is expected to become more important in the future electricity generation system. This paper reviews the different technological options available for DG. DG offers a number of potential benefits. The ability to use the waste heat from fuel-operated DG, known as combined heat and power (CHP, offers both reduced costs and significant reductions of CO2 emissions. The overall efficiency of DG-CHP system can approach 90 percent, a significant improvement over the 30 to 35 percent electric grid efficiency and 50 to 90 percent industrial boiler efficiency when separate production is used. The costs of generation of electricity from six key DG-CHP technologies; gas engines, diesel engines, biodiesel CI engines, microturbines, gas turbines, and fuel cells, are calculated. The cost of generation is dependent on the load factor and the discount rate. It is found that annualized life cycle cost (ALCC of the DG-CHP technologies is approximately half that of the DG technologies without CHP. Considering the ALCC of different DG-CHP technologies, the gas I.C. engine CHP is the most effective for most of the cases but biodiesel CI engine CHP seems to be a promising DG-CHP technology in near future for Rajasthan state due to renewable nature of the fuel.

  7. Technological Support of Estimating Functional Opportunities of Higher Parts of Central Nervous System in the Individuals with Auditory Deprivation

    Directory of Open Access Journals (Sweden)

    Makarenko M.V.

    2016-10-01

    Full Text Available A new computerized technology of investigating and estimating the individual features of higher parts of the central nervous system in people with auditory deprivation is offered. The essence of the offered technology for investigating and estimating individual functional opportunities of higher parts of the nervous system of an individual with auditory deprivation consists in using the specific sequence of representing the load tests with corresponding criteria of estimating the processed information of different level of complexity, which are applied on hardware devices developed by us. We represented the scales for estimating the parameters of simple and complex sensorimotor reactions, speed qualitative and quantitative indicators of processing information based on the typological properties of the nervous system, such as the functional mobility, strength and balance of basic nervous processes. We suppose that the research using the same tests and criteria of estimating neuro-dynamic properties will increase the opportunity for the analysis of different experimental material and enhance its value

  8. Optimal designs of small CHP plants in a market with fluctuating electricity prices

    DEFF Research Database (Denmark)

    Lund, Henrik; Andersen, A.N.

    2005-01-01

    The paper presents the Danish experince with methodologies and software tools, which have been used to design investment and operation strategies for almost all small CHP plants in Denmark during the decade of the triple tariff.......The paper presents the Danish experince with methodologies and software tools, which have been used to design investment and operation strategies for almost all small CHP plants in Denmark during the decade of the triple tariff....

  9. Antibody responses against NY-ESO-1 and HER2 antigens in patients vaccinated with combinations of cholesteryl pullulan (CHP)-NY-ESO-1 and CHP-HER2 with OK-432.

    Science.gov (United States)

    Aoki, Masatoshi; Ueda, Shugo; Nishikawa, Hiroyoshi; Kitano, Shigehisa; Hirayama, Michiko; Ikeda, Hiroaki; Toyoda, Hideki; Tanaka, Kyosuke; Kanai, Michiyuki; Takabayashi, Arimichi; Imai, Hiroshi; Shiraishi, Taizo; Sato, Eiichi; Wada, Hisashi; Nakayama, Eiichi; Takei, Yoshiyuki; Katayama, Naoyuki; Shiku, Hiroshi; Kageyama, Shinichi

    2009-11-16

    Combination vaccines of the NY-ESO-1 protein complexed with cholesteryl pullulan (CHP), CHP-NY-ESO-1, and the truncated 146HER2 protein with CHP, CHP-HER2, were subcutaneously administered with the immuno-adjuvant OK-432 to eight esophageal cancer patients. Vaccination was well-tolerated. NY-ESO-1- and HER2-specific antibody responses were analyzed using the patients' sera and samples from previous single CHP-NY-ESO-1 or CHP-HER2 vaccine trial. The responses to NY-ESO-1 in the combination vaccine study were comparable to the single vaccine. For responses to HER2, there were fewer antibody responses in the combination vaccines. Although there were marked individual variations in the antibody responses to the NY-ESO-1 and HER2 antigens, the reaction patterns to these antigens were comparable within each patient. Antibodies to OK-432 were not augmented. Protein cancer vaccines targeting multiple antigens are feasible.

  10. Advanced Melting Technologies: Energy Saving Concepts and Opportunities for the Metal Casting Industry

    Energy Technology Data Exchange (ETDEWEB)

    none,

    2005-11-01

    The study examines current and emerging melting technologies and discusses their technical barriers to scale-up issues and research needed to advance these technologies, improving melting efficiency, lowering metal transfer heat loss, and reducing scrap.

  11. Opportunities of artistic and technological training in non-formal education

    Directory of Open Access Journals (Sweden)

    Natalya Ivkina

    2015-04-01

    Full Text Available The paper deals with questions concerning the organization of art and technological training in the situation of informal education; experience including application of information technologies and network services in the work of the Center work.

  12. Biomass gasification for CHP with dry gas cleaning and regenerative heat recovery

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2002-05-01

    Small scale CHP plants based on biomass gasification technologies are generally expensive and not very efficient due to gas quality problems which increase operation and maintenance cost as well as breakdown. To overcome this situation the team has developed, integrated and tested a complete biomass gasification combine heat and power prototype plant of 250 kWth equipped with a specifically developed dry gas cleaning and heat recovery system. The dry gas cleaning device is a simple dry gas regenerative heat exchanger where tars are stopped by condensation but working at a temperature above due point in order to avoid water condensation. Two types of heat particles separation devices have been tested in parallel multi-cyclone and ceramic filters. After several month spent on modelling design, construction and optimisation, a full test campaign of 400 hours continuous monitoring has been done where all working parameters has been monitored and gas cleaning device performances has been assessed. Results have shown: Inappropriateness of the ceramic filters for the small scale unit due to operation cost and too high sensibility of the filters to the operation conditions fluctuating in a wide range, despite a very high particle separation efficiency 99 %; Rather good efficiency of the multi-cyclone 72% but not sufficient for engine safety. Additional conventional filters where necessary for the finest part; Inappropriateness of the dry gas heat exchanger device for tar removal partly due to a low tar content of the syngas generated, below 100 mg/Nm{sup 3} , but also due to their composition which would have imposed, to be really efficient, a theoretical condensing temperature of 89 C below the water condensation temperature. These results have been confirmed by laboratory tests and modelling. However the tar cracking phase have shown very interesting results and proved the feasibility of thermal cracking with full cleaning of the heat exchanger without further mechanical

  13. A new approach in CHP steam turbines thermodynamic cycles computations

    Directory of Open Access Journals (Sweden)

    Grković Vojin R.

    2012-01-01

    Full Text Available This paper presents a new approach in mathematical modeling of thermodynamic cycles and electric power of utility district-heating and cogeneration steam turbines. The approach is based on the application of the dimensionless mass flows, which describe the thermodynamic cycle of a combined heat and power steam turbine. The mass flows are calculated relative to the mass flow to low pressure turbine. The procedure introduces the extraction mass flow load parameter νh which clearly indicates the energy transformation process, as well as the cogeneration turbine design features, but also its fitness for the electrical energy system requirements. The presented approach allows fast computations, as well as direct calculation of the selected energy efficiency indicators. The approach is exemplified with the calculation results of the district heat power to electric power ratio, as well as the cycle efficiency, versus νh. The influence of νh on the conformity of a combined heat and power turbine to the grid requirements is also analyzed and discussed. [Projekat Ministarstva nauke Republike Srbije, br. 33049: Development of CHP demonstration plant with gasification of biomass

  14. The adoption of new smart-grid technologies incentives, outcomes, and opportunities

    CERN Document Server

    Guo, Christopher; Narayanan, Anu

    2015-01-01

    RAND Corporation researchers review the current technical, regulatory, and economic context of the electricity market and theoretical benefits of developing a smart grid; discuss some entrepreneurial opportunities associated with smart-grid data; examine empirical evidence related to smart-grid adoption and implementation; and offer policy suggestions for overcoming identified barriers.

  15. Challenges and Opportunities of Information Technology in the 90s. Track VIII: Managing Distributed Computing Services.

    Science.gov (United States)

    CAUSE, Boulder, CO.

    Six papers from the 1990 CAUSE Conference Track VIII: Managing Distributed Computing are presented. Authors discuss the challenges and opportunities involved in providing user managers with direct access to institutional databases to support their decision making and planning activities. Papers and their authors are as follows: "Rendering an…

  16. Process Intensification in Fuel Cell CHP Systems, the ReforCELL Project

    Directory of Open Access Journals (Sweden)

    José Luis Viviente

    2016-10-01

    Full Text Available This paper reports the findings of a FP7/FCH JU project (ReforCELL that developed materials (catalysts and membranes and an advance autothermal membrane reformer for a micro Combined Heat and Power (CHP system of 5 kWel based on a polymer electrolyte membrane fuel cell (PEMFC. In this project, an active, stable and selective catalyst was developed for the reactions of interest and its production was scaled up to kg scale (TRL5 (TRL: Technology Readiness Level. Simultaneously, new membranes for gas separation were developed. In particular, dense supported thin palladium-based membranes were developed for hydrogen separation from reactive mixtures. These membranes were successfully scaled up to TRL4 and used in lab-scale reactors for fluidized bed steam methane reforming (SMR and autothermal reforming (ATR and in a prototype reactor for ATR. Suitable sealing techniques able to integrate the different membranes in lab-scale and prototype reactors were also developed. The project also addressed the design and optimization of the subcomponents (BoP for the integration of the membrane reformer to the fuel cell system.

  17. Energy Savings Potential and RD&D Opportunities for Non-Vapor-Compression HVAC Technologies

    Energy Technology Data Exchange (ETDEWEB)

    none,

    2014-03-01

    While vapor-compression technologies have served heating, ventilation, and air-conditioning (HVAC) needs very effectively, and have been the dominant HVAC technology for close to 100 years, the conventional refrigerants used in vapor-compression equipment contribute to global climate change when released to the atmosphere. This Building Technologies Office report: --Identifies alternatives to vapor-compression technology in residential and commercial HVAC applications --Characterizes these technologies based on their technical energy savings potential, development status, non-energy benefits, and other factors affecting end-user acceptance and their ability to compete with conventional vapor-compression systems --Makes specific research, development, and deployment (RD&D) recommendations to support further development of these technologies, should DOE choose to support non-vapor-compression technology further.

  18. Can information and communication technologies support patient engagement? A review of opportunities and challenges in health social work.

    Science.gov (United States)

    Craig, Shelley L; Calleja Lorenzo, Maria Victoria

    2014-10-01

    Despite becoming a prerequisite for participation in an information-based society, the use of information communication technologies (ICT) within social work and health care remains in its infancy. Currently, there is a push to adopt newer technologies to enhance practice. This article aims to highlight some of the innovative ways in which ICT have been adopted and adapted to augment social work practice. The need for social workers to become proficient in the use of newer technologies, opportunities for implementing ICT within a health care setting, and potential challenges at the professional, ethical, and systemic level are explored. Using the available literature as a guide, recommendations and strategies to strengthen implementation of ICTs into health social work are provided.

  19. Waste Heat Recovery. Technology and Opportunities in U.S. Industry

    Energy Technology Data Exchange (ETDEWEB)

    Johnson, Ilona [BCS, Inc., Laurel, MD (United States); Choate, William T. [BCS, Inc., Laurel, MD (United States); Davidson, Amber [BCS, Inc., Laurel, MD (United States)

    2008-03-01

    This study was initiated in order to evaluate RD&D needs for improving waste heat recovery technologies. A bottomup approach is used to evaluate waste heat quantity, quality, recovery practices, and technology barriers in some of the largest energyconsuming units in U.S. manufacturing. The results from this investigation serve as a basis for understanding the state of waste heat recovery and providing recommendations for RD&D to advance waste heat recovery technologies.

  20. Are mainstream mobile technologies bringing about new opportunities for people with disabilities? Insights from three case studies.

    Science.gov (United States)

    Gower, Valerio; Salatino, Claudia; Pigini, Lucia; Caracciolo, Antonio

    2015-01-01

    The market of mobile technologies has considerably increased in the past few years and the costs have consequently decreased. This rapid technological evolution can be seen in two different ways from the perspective of people with disability: on the one side it represents a great opportunity to create new solutions for improving independence; on the other it may represent a source of social exclusion if appropriate assistive solutions are not available to make technology usable by people with disability. This paper describe three case studies of persons with disabilities that have undergone an Assistive Technology assessment at the DAT service of Fondazione Don Gnocchi (Milan, Italy) involving the use of mobile ICT based Assistive Technologies. In all the three cases the appropriate solution for performing the desired activities is represented by a combination of mainstream products and assistive products. The three use cases described support the idea that mobile technologies can be powerful and versatile instruments to create assistive solutions for improving independence in daily life.

  1. Technology transfer opportunities: patent license: electrochemical technique for introducing and redistributing ionic species into the earth

    Science.gov (United States)

    Leinz, Reinhard

    1996-01-01

    Scientists at the U.S. Geological Survey have expanded applications of the Chim electrode, technology used to perform partial geochemical extractions from soils. Recent applications of the the improved electrode technology show that geochemical extraction efficiencies can be improved by 2 orders of magnitude or better to about 30%.

  2. Language Learning through Mobile Technologies: An Opportunity for Language Learners and Teachers

    Science.gov (United States)

    Bachore, Mebratu Mulatu

    2015-01-01

    These days, the innovations of technologies are contributing significantly to the quality of education in spite of their limitations. Mobile technologies are rapidly attracting new users, providing increasing capacity, and allowing more sophisticated use. Since they are becoming very accessible for individuals in most parts of the world, it has a…

  3. Financing Projects That Use Clean-Energy Technologies. An Overview of Barriers and Opportunities

    Energy Technology Data Exchange (ETDEWEB)

    Goldman, D. P. [New Energy Capital, LLC, Hanover, NH (United States); McKenna, J. J. [Hamilton Clark & Co., Washington, DC (United States); Murphy, L. M. [National Renewable Energy Lab. (NREL), Golden, CO (United States)

    2005-10-01

    This technical paper describes the importance of project financing for clean-energy technology deployment. It describes the key challenges in financing clean-energy technology projects, including technical risks, credit worthiness risk, revenue security risk, market competition, scale and related cost, as well as first-steps to overcome those barriers.

  4. THE ASSESSMENT OF OPPORTUNITIES AND THREATS FOR CHANGES OF TECHNOLOGIES AGGREGATE THROUGH ORDER PARAMETERS

    Directory of Open Access Journals (Sweden)

    T.A. Nelyubina

    2009-09-01

    Full Text Available In this article, author considers a class of technologies aggregates, which can be present as complex socio-economic systems. The order parameters are chosen as instrument of reflect the system integrity of this technologies aggregates. The analysis of aggregates through order parameters permit: to diagnose the state of the system and its life phase, understand the compatibility extent between the current state of system and the assumed modifications in it, understand the nature of attendant risks. It also allows to compare the systems, track the dynamics of order parameters and forecast the trends of the future changes. Author formulates number and definitions of order parameters for this class of technologies aggregates; proposes the assessment method of condition of order parameters for technologies aggregate of region; makes express-assessment of preparedness level of technologies aggregates of some regions to innovation changes.

  5. Regulatory Compliance and Environmental Benefit Analysis of Combined Heat and Power (CHP Systems in Taiwan

    Directory of Open Access Journals (Sweden)

    Wen-Tien Tsai

    2013-01-01

    Full Text Available The energy conservation achieved by utilizing waste heat in the energy and industrial sectors has became more and more important after the energy crisis in the 1970s because it plays a vital role in the potential energy-efficiency improvement. In this regard, cogeneration (combined heat and power, CHP systems are thus becoming attractive due to the energy, economic, and environmental policies for pursuing stable electricity supply, sustainable development and environmental pollution mitigation in Taiwan. The objective of this paper is to present an updated analysis of CHP systems in Taiwan during the period from 1990 to 2010. The description in the paper is thus based on an analysis of electricity supply/consumption and its sources from CHP systems during the past two decades, and centered on two important regulations in compliance with CHP systems (i.e., Energy Management Law and Environmental Impact Assessment Act. Based on the total net power generation from CHP systems (i.e., 35,626 GWh in 2011, it was found that the carbon dioxide reduction benefits were estimated to be around 20,000 Gg.

  6. Mobile technologies among people with serious mental illness: opportunities for future services.

    Science.gov (United States)

    Ben-Zeev, Dror; Davis, Kristin E; Kaiser, Susan; Krzsos, Izabela; Drake, Robert E

    2013-07-01

    Several national bodies have proposed using mobile technology to improve mental health services. But rates of current use and interest in using technology to enhance services among individuals with serious mental illness are uncertain. The authors surveyed 1,592 individuals with serious mental illness regarding their use of mobile devices and interest in using mobile technologies to enhance mental health services. Seventy-two percent of survey respondents reported currently owning a mobile device, a rate approximately 12 % lower than the general adult population. The most common uses were for talking, followed by texting, and internet activities. Both mobile device users and nonusers expressed interest in future mobile services.

  7. Future pathways for today's technologies. Limits and opportunities

    Energy Technology Data Exchange (ETDEWEB)

    Niessen, Stefan [AREVA GmbH, Erlangen (Germany). Innovation- and Patent Management

    2015-06-01

    The majority of the feed-in tariffs as determined by the German Energy Feed-in Act (EEG) develop as follows: they decrease as the efficiency of technologies grows. However, there are some exceptions: offshore wind and geothermal energy feed-in tariffs have been rising, while storage technologies are not included at all although they are needed to make up for intermittent renewable generation. Furthermore, nuclear energy is burdened with the fuel tax, a kind of negative feed-in tariff. These technologies seem to be confronted with specific restrictions that yet prevent large-scale development. A thorough analysis of these limitations guides to the way to overcome them.

  8. Technology Transfer Strategies for Creating Growth Opportunities in Frontier Markets of Sub-Saharan Africa

    DEFF Research Database (Denmark)

    Nielsen, Ulrik B.

    In the past decade, Africa has developed from being an extremely impoverished continent with discouraging prospects to a more promising destination and home to some of the fastest growing Frontier Market economies. Approximately 75% of Africans rely on agriculture for their livelihoods, making...... it the most important economic sector. Despite possessing the world´s largest reservoir of unused arable land (about 60%), Africa has the lowest agricultural productivity, amounting to approximately 10% of global agricultural output. This suggests that scaling up agricultural production in SSA could...... to create growth opportunities in Frontier Markets of Sub-Saharan Africa....

  9. Integration and Penetration Opportunities of Alternative Energy, Fuels, and Technologies within Military Systems, Logistics, and Operations

    Science.gov (United States)

    2010-01-01

    er -to -V ol um e (m W h/ m m 3) Note: European Ban 160 1756835 0.298 0.219 0.334 Sources: Varta Product Specifications, Handbook of Batteries (David... Linden ) 0.115 29 0.062 Figure 8. Rechargeable Battery Energy Density Comparison Small lightweight portable power afforded by battery ...I N S T I T U T E F O R D E F E N S E A N A L Y S E S Integration and Penetration Opportunities of Alternative

  10. The Potential of RFID Technology in the Textile and Clothing Industry: Opportunities, Requirements and Challenges

    Science.gov (United States)

    Legnani, Elena; Cavalieri, Sergio; Pinto, Roberto; Dotti, Stefano

    In the current competitive environment, companies need to extensively exploit the use of advanced technologies in order to develop a sustainable advantage, enhance their operational efficiency and better serve customers. In this context, RFID technology has emerged as a valid support for the company progress and its value is becoming more and more apparent. In particular, the textile and clothing industry, characterised by short life-cycles , quick response production , fast distribution, erratic customer preferences and impulsive purchasing, is one of the sectors which can extensively benefit from the RFID technology. However, actual applications are still very limited, especially in the upstream side of the supply network. This chapter provides an insight into the main benefits and potentials of this technology and highlights the main issues which are currently inhibiting its large scale development in the textile and clothing industry. The experience of two industry-academia projects and the relative fallouts are reported.

  11. Contributions to Industrial Development of Science and Technology Institutions in Colombia and Opportunities for Bilateral Cooperation.

    Science.gov (United States)

    1979-12-01

    Mnufactures agricultura icne obanedo n and UK IStansard technology, cent to Anuasaies:S imlens bumpiing antdrn o0gncltrl aipet broke eopand laboratory... Agricultura Science Educational Economic & Industrial Resources Resources Miritime Science Informt Information Administrat e nformatio nformatfoj

  12. Publishing Opportunities in Educational Communications, Technology, and Library Science Journals and Magazines.

    Science.gov (United States)

    Clemente, Rebecca; And Others

    1990-01-01

    Presents in tabular form a summary of publishing requirements, guidelines, and suggestions from 59 current educational communications, technology, and library science journals and magazines to serve as a reference to potential contributors. (Three references) (LRW)

  13. Emerging pervasive information and communication technologies (PICT) ethical challenges, opportunities and safeguards

    CERN Document Server

    Pimple, Kenneth D

    2013-01-01

    This book provides a wide and deep perspective on the ethical issues raised by pervasive information and communication technology (PICT) - small, powerful, and often inexpensive Internet-connected computing devices and systems. It describes complex and unfamiliar technologies and their implications, including the transformative potential of augmented reality, the power of location-linked information, and the uses of ""big data,"" and explains potential threats, including privacy invaded, security violated, and independence compromised, often through widespread and lucrative manipulation.PICT i

  14. Challenges and opportunities of silent commerce - applying Radio Frequency Identification technology

    Directory of Open Access Journals (Sweden)

    Teuta Cata

    2006-04-01

    Full Text Available This research paper investigates applications of Radio Frequency Technology (RFID as an application of ubiquitous commerce. RFID has a wide application in the supply chain but still is very limited for customer support. This study introduces the concept of the Silent CRM (s-CRM which is an application of RFID to proactively support customer needs. Challenges of RFID application within companies, outside of companies and about the technology itself are discussed as well.

  15. Opportunities for renewable energy technologies in water supply in developing country villages

    Energy Technology Data Exchange (ETDEWEB)

    Niewoehner, J.; Larson, R.; Azrag, E.; Hailu, T.; Horner, J.; VanArsdale, P. [Water for People, Denver, CO (United States)

    1997-03-01

    This report provides the National Renewable Energy Laboratory (NREL) with information on village water supply programs in developing countries. The information is intended to help NREL develop renewable energy technologies for water supply and treatment that can be implemented, operated, and maintained by villagers. The report is also useful to manufacturers and suppliers in the renewable energy community in that it describes a methodology for introducing technologies to rural villages in developing countries.

  16. Decentralized biogas technology of anaerobic digestion and farm ecosystem: opportunities and challenges

    Directory of Open Access Journals (Sweden)

    Junye eWang

    2014-03-01

    Full Text Available Long-term economic and environmental concerns have resulted in a great amount of research on renewable sources of biomass and bioenergy to replace fossil fuels in the past decades. Decentralized biogas technology is one of the most potential technologies of biomass and bioenergy by using agricultural waste materials (e.g., animal manure, crop straw and by-products from food industries as feedstocks. By-products from biogas production, called digestate, are nutrient rich which could potentially be reused as green fertilizers in agriculture, thereby providing a sustainable substitute for synthetic fertilizers for ecosystem farm. Thus, the biogas production of anaerobic digestion (AD is win-win option for livestock and crop producers to address issues of waste management and energy supply, and to avoid contamination of surface and ground waters and emissions of odors and greenhouse gases. In this paper, we review biogas production technology and then evaluate environmental effects of digestate used as fertilizer. Finally, we discuss issues of deployment of decentralized biogas technology for ecosystem farms. Economic and technological barriers still exist for large scale deployment of biogas technology. Two national scale deployments in China and Nepal showed that the operational status of biogas digesters is not optimal and up to 50% of plants are non-functional after a short operation period regardless of the social and economic factors. Main barriers are a wide variation of feedstocks and environmental conditions (e.g., temperature over space and time. It becomes clear that the experimental conditions of the pilot plants need to be adjusted and calibrated to the local feedstocks and climate. Also, more research needs to be done in cold fermentation technology.

  17. Science Notebooks for the 21st Century. Going Digital Provides Opportunities to Learn "with" Technology Rather than "from" Technology

    Science.gov (United States)

    Fulton, Lori; Paek, Seungoh; Taoka, Mari

    2017-01-01

    Students of today are digital natives who for the most part come to school with experiences that may surpass those of their teachers. They use tablet computers and other devices in their personal lives and are eager to use them in the classroom. For teachers, this means they must integrate technology in ways that allow their students to learn with…

  18. RFID technology in health environment opportunities and challenges for modern cancer care.

    Science.gov (United States)

    Safdari, Reza; Maserat, Elham; Maserat, Elnaz

    2012-01-01

    Cancers are significant contributors to the mortality and health care expenditures. Cancer can be reduced and monitored by new information technology. Radio frequency identification or RFID is a wireless identification technology. The use of this technology can be employed for identifying and tracking clinical staff, patients, supplies, medications and equipments. RFID can trace and manage chemotherapy drugs. There are different types of RFID. Implantable RFID allowing a chip to be embedded under the skin and that store the cancer patient's identifier. These are concerns about applications of RFID. Privacy, security and legal issues are key problems. This paper describes capabilities, benefits and confidentiality aspects in radio frequency identification systems and solutions for overcoming challenges.

  19. EERE-SBIR technology transfer opportunity. H2 Safety Sensors for H2

    Energy Technology Data Exchange (ETDEWEB)

    Johnston, Mariann R. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2015-12-01

    The Office of Energy Efficiency and Renewable Energy’s Fuel Cell Technologies Office (FCTO) works in partnership with industry (including small businesses), academia, and DOE's national laboratories to establish fuel cell and hydrogen energy technologies as economically competitive contributors to U.S. transportation needs. The work that is envisioned between the SBIR/STTR grantee and Los Alamos National Laboratory would involve Technical Transfer of Los Alamos Intellectual Property (IP) on Thin-film Mixed Potential Sensor (U.S. Patent 7,264,700) and associated know-how for H2 sensor manufacturing and packaging.

  20. Research and Development Opportunities for Technologies to Influence Water Consumption Behavior

    Energy Technology Data Exchange (ETDEWEB)

    Levin, Todd [Argonne National Lab. (ANL), Argonne, IL (United States); Horner, Robert M. [Argonne National Lab. (ANL), Argonne, IL (United States); Muehleisen, Ralph T. [Argonne National Lab. (ANL), Argonne, IL (United States)

    2016-09-01

    In April 2015, Argonne National Laboratory hosted a two-day workshop that convened water experts and stakeholders from across industry, government, and academia to undertake three primary tasks: 1) identify technology characteristics that are favorable for motivating behavioral change, 2) identify barriers that have prevented the development and market adoption of technologies with these characteristics in the water sector, and 3) identify concrete research and development pathways that could be undertaken to overcome these barriers, increase the penetration of technologies that influence water consumption behavior, and ultimately reduce domestic water consumption. While efforts to reduce water consumption have gained momentum in recent years, there are a number of key barriers that have limited the effectiveness of such efforts. Chief among these is the fact that many consumers have limited awareness of their water consumption patterns because of poor data availability, and/or are unmotivated to reduce their consumption because of low costs and split incentives. Without improved data availability and stronger price signals, it will be difficult to effect true transformative behavioral change. This report also reviews a number of technology characteristics that have successfully motivated behavioral change in other sectors, as well as several technologies that could be developed specifically for the water sector. Workshop participants discussed how technologies that provide active feedback and promote measurable goals and social accountability have successfully influenced changes in other types of behavior. A range of regulatory and policy actions that could be implemented to support such efforts are also presented. These include institutional aggregation, revenue decoupling, and price structure reforms. Finally, several R&D pathways were proposed, including efforts to identify optimal communication strategies and to better understand consumer perceptions and

  1. Density functional theory and beyond-opportunities for quantum methods in materials modeling semiconductor technology.

    Science.gov (United States)

    Shankar, Sadasivan; Simka, Harsono; Haverty, Michael

    2008-02-13

    In the semiconductor industry, the use of new materials has been increasing with the advent of nanotechnology. As critical dimensions decrease, and the number of materials increases, the interactions between heterogeneous materials themselves and processing increase in complexity. Traditionally, applications of ab initio techniques are confined to electronic structure and band gap calculations of bulk materials, which are then used in coarse-grained models such as mesoscopic and continuum models. Density functional theory is the most widely used ab initio technique that was successfully extended to several applications. This paper illustrates applications of density functional theory to semiconductor processes and proposes further opportunities for use of such techniques in process development.

  2. Overview of Opportunities for Co-Location of Solar Energy Technologies and Vegetation

    Energy Technology Data Exchange (ETDEWEB)

    Macknick, J.; Beatty, B.; Hill, G.

    2013-12-01

    Large-scale solar facilities have the potential to contribute significantly to national electricity production. Many solar installations are large-scale or utility-scale, with a capacity over 1 MW and connected directly to the electric grid. Large-scale solar facilities offer an opportunity to achieve economies of scale in solar deployment, yet there have been concerns about the amount of land required for solar projects and the impact of solar projects on local habitat. During the site preparation phase for utility-scale solar facilities, developers often grade land and remove all vegetation to minimize installation and operational costs, prevent plants from shading panels, and minimize potential fire or wildlife risks. However, the common site preparation practice of removing vegetation can be avoided in certain circumstances, and there have been successful examples where solar facilities have been co-located with agricultural operations or have native vegetation growing beneath the panels. In this study we outline some of the impacts that large-scale solar facilities can have on the local environment, provide examples of installations where impacts have been minimized through co-location with vegetation, characterize the types of co-location, and give an overview of the potential benefits from co-location of solar energy projects and vegetation. The varieties of co-location can be replicated or modified for site-specific use at other solar energy installations around the world. We conclude with opportunities to improve upon our understanding of ways to reduce the environmental impacts of large-scale solar installations.

  3. Life cycle assessment of micro production technologies - solar cells, household wind turbines and micro motors; Livscyklusvurdering af mikroproduktionsteknologier - solceller, husstandsvindmoeller og mikromotorer

    Energy Technology Data Exchange (ETDEWEB)

    Faeborg Poulsen, A.; Kruse, H.; Hvid Ipsen, K.

    2000-07-15

    This report contains a life cycle based estimation of environmental effects of CHP based on the micro production technologies: solar cells, household wind turbines and micro motors. The technologies cover CHP production on very small plants which are characterised by being located by the individual consumer. (BA)

  4. Network Capacity Assessment of CHP-based Distributed Generation on Urban Energy Distribution Networks

    Science.gov (United States)

    Zhang, Xianjun

    The combined heat and power (CHP)-based distributed generation (DG) or dis-tributed energy resources (DERs) are mature options available in the present energy market, considered to be an effective solution to promote energy efficiency. In the urban environment, the electricity, water and natural gas distribution networks are becoming increasingly interconnected with the growing penetration of the CHP-based DG. Subsequently, this emerging interdependence leads to new topics meriting serious consideration: how much of the CHP-based DG can be accommodated and where to locate these DERs, and given preexisting constraints, how to quantify the mutual impacts on operation performances between these urban energy distribution networks and the CHP-based DG. The early research work was conducted to investigate the feasibility and design methods for one residential microgrid system based on existing electricity, water and gas infrastructures of a residential community, mainly focusing on the economic planning. However, this proposed design method cannot determine the optimal DG sizing and siting for a larger test bed with the given information of energy infrastructures. In this context, a more systematic as well as generalized approach should be developed to solve these problems. In the later study, the model architecture that integrates urban electricity, water and gas distribution networks, and the CHP-based DG system was developed. The proposed approach addressed the challenge of identifying the optimal sizing and siting of the CHP-based DG on these urban energy networks and the mutual impacts on operation performances were also quantified. For this study, the overall objective is to maximize the electrical output and recovered thermal output of the CHP-based DG units. The electricity, gas, and water system models were developed individually and coupled by the developed CHP-based DG system model. The resultant integrated system model is used to constrain the DG's electrical

  5. Effects of Technology Immersion on Middle School Students' Learning Opportunities and Achievement

    Science.gov (United States)

    Shapley, Kelly; Sheehan, Daniel; Maloney, Catherine; Caranikas-Walker, Fanny

    2011-01-01

    An experimental study of the Technology Immersion model involved comparisons between 21 middle schools that received laptops for each teacher and student, instructional and learning resources, professional development, and technical and pedagogical support, and 21 control schools. Using hierarchical linear modeling to analyze longitudinal survey…

  6. OPPORTUNITIES TO MARKET U.S. TECHNOLOGIES THROUGHOUT THE WESTERN HEMISPHERE

    Energy Technology Data Exchange (ETDEWEB)

    M.A. Ebadian, Ph.D

    1999-01-01

    This project involves an open-ended, continuous process of information gathering with respect to Latin American and Caribbean environmental issues. This entails the development of contacts with individuals and institutions conducting research and work on issues of sustainability and environmental technology in the Americas. As part of this phase, a database containing information on firms, nongovernmental organizations (NGOs), governmental institutions, and other participants in Latin America's environmental sector was developed and is continually being updated. In addition, FIU-HCET's efforts were geared toward determining environmental technological needs in different parts of the region and identifying the most significant and lucrative markets. The project requires that FIU-HCET continually cement those contacts already established, continue updating the database to be made available to external users, and identify U.S. companies with the necessary expertise to participate in the Latin American and Caribbean markets. To aid in this endeavor, comprehensive, country-specific studies of the market for environmental goods and services are drafted and published by FIU-HCET. FIU-HCET, with sponsorship from OST, will make new, innovative, and more cost-effective technologies available for transfer throughout the Western Hemisphere. Environmental/energy technology development projects encompass the range of problems experienced by LACN. This includes mixed waste characterization and treatment, soils and groundwater remediation. In addition, future activities will include the issues of energy, climate change, and fossil fuels.

  7. Transformative Reduction of Transportation Greenhouse Gas Emissions. Opportunities for Change in Technologies and Systems

    Energy Technology Data Exchange (ETDEWEB)

    Vimmerstedt, Laura [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Brown, Austin [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Newes, Emily [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Markel, Tony [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Schroeder, Alex [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Zhang, Yimin [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Chipman, Peter [U.S. Department of Transportation, Washington, D.C. (United States); Johnson, Shawn [U.S. Department of Transportation, Washington, D.C. (United States)

    2015-04-30

    The transportation sector is changing, influenced by concurrent, ongoing, dynamic trends that could dramatically affect the future energy landscape, including effects on the potential for greenhouse gas emissions reductions. Battery cost reductions and improved performance coupled with a growing number of electric vehicle model offerings are enabling greater battery electric vehicle market penetration, and advances in fuel cell technology and decreases in hydrogen production costs are leading to initial fuel cell vehicle offerings. Radically more efficient vehicles based on both conventional and new drivetrain technologies reduce greenhouse gas emissions per vehicle-mile. Net impacts also depend on the energy sources used for propulsion, and these are changing with increased use of renewable energy and unconventional fossil fuel resources. Connected and automated vehicles are emerging for personal and freight transportation systems and could increase use of low- or non-emitting technologies and systems; however, the net effects of automation on greenhouse gas emissions are uncertain. The longstanding trend of an annual increase in transportation demand has reversed for personal vehicle miles traveled in recent years, demonstrating the possibility of lower-travel future scenarios. Finally, advanced biofuel pathways have continued to develop, highlighting low-carbon and in some cases carbon-negative fuel pathways. We discuss the potential for transformative reductions in petroleum use and greenhouse gas emissions through these emerging transportation-sector technologies and trends and present a Clean Transportation Sector Initiative scenario for such reductions, which are summarized in Table ES-1.

  8. Opportunity from Crisis: A Common Agenda for Higher Education and Science, Technology and Innovation Policy Research

    Science.gov (United States)

    Jacob, Merle; Hellström, Tomas

    2014-01-01

    This paper makes a plea for the construction of a common agenda for higher education and science, technology and innovation (STI) policy research. The public higher education and research sector in all countries is currently in the grip of several challenges arising from increased accountability, internationalization and in some cases dwindling…

  9. R&D Needs and Opportunities in Food Science and Technology

    Science.gov (United States)

    This is an analysis of the relevant trends, market economics, science and technology needs of the Agricultural Research Service National Program on Quality and Utilization of Agricultural Products (NP 306), specifically issues that impact on the foods aspects of the program. It provides information ...

  10. Stakeholder identification of advanced technology opportunities at international ports of entry

    Energy Technology Data Exchange (ETDEWEB)

    Parker, S.K. [Sandia National Labs., Albuquerque, NM (United States). Energy Policy and Planning Dept.; Icerman, L. [Icerman and Associates, Santa Fe, NM (United States)

    1997-01-01

    As part of the Advanced Technologies for International and Intermodal Ports of Entry (ATIPE) Project, a diverse group of stakeholders was engaged to help identify problems experienced at inland international border crossings, particularly those at the US-Mexican border. The fundamental issue at international ports of entry is reducing transit time through the required documentation and inspection processes. Examples of other issues or problems, typically manifested as time delays at border crossings, repeatedly mentioned by stakeholders include: (1) lack of document standardization; (2) failure to standardize inspection processes; (3) inadequate information and communications systems; (4) manual fee and tariff collection; (5) inconsistency of processes and procedures; and (6) suboptimal cooperation among governmental agencies. Most of these issues can be addressed to some extent by the development of advanced technologies with the objective of allowing ports of entry to become more efficient while being more effective. Three categories of technologies were unambiguously of high priority to port of entry stakeholders: (1) automated documentation; (2) systems integration; and (3) vehicle and cargo tracking. Together, these technologies represent many of the technical components necessary for pre-clearance of freight approaching international ports of entry. Integration of vehicle and cargo tracking systems with port of entry information and communications systems, as well as existing industry legacy systems, should further enable border crossings to be accomplished consistently with optimal processing times.

  11. Contributions to Economic Development of Science and Technology Institutions in Nigeria and Opportunities for Bilateral Cooperation.

    Science.gov (United States)

    1979-09-01

    Hydrobiology for fisheries. Biochemistry Enzymology. Microbial chemistry. Nutrition Toxicology of cassava and herbicides. Storage of agriculture...principal research centers for the topics of concern. For example, NIFOR already operates as a national information servicefor palm oil, and this type...natural science technology, although the audience for these publications remains to be clearly defined. Trade fairs and seminars of the chambers of commerce

  12. Communication Opportunities via Special Messaging Technology for Two Post-Coma Persons with Multiple Disabilities

    Science.gov (United States)

    Lancioni, Giulio E.; O'Reilly, Mark F.; Singh, Nirbhay N.; Sigafoos, Jeff; Buonocunto, Francesca; Sacco, Valentina; Colonna, Fabio; Navarro, Jorge; Lanzilotti, Crocifissa; de Pace, Claudia; Megna, Marisa; Oliva, Doretta

    2011-01-01

    This study extended the assessment of a special messaging technology with two additional post-coma adults who had emerged from a minimally conscious state, but showed multiple disabilities including profound motor and communication impairments. For each participant, the study involved an ABAB design, in which the A represented baseline phases and…

  13. The Challenge and Opportunity of Technology: An Interview with Mark Warschauer.

    Science.gov (United States)

    Ancker, William P.

    2002-01-01

    Interviews Mark Warshauer, Vice Chair of the Department of Education at the University of California, Irvine. His research focuses on the role of information and communication technologies (ICT) in second and foreign language teaching, the impact of ICT on literacy, and the relationship of ICT to institutional reform, democracy, and social…

  14. Challenges and Opportunities of Information Technology in the 90s. Track VI: Managing Academic Information Systems.

    Science.gov (United States)

    CAUSE, Boulder, CO.

    Six papers from the 1990 CAUSE conference's Track VI, Managing Academic Information Systems are presented. Papers discuss issues related to the integration of merging technologies - computing, communications, classrooms - and their effects on the way "academic business" is conducted. Papers and their authors are as follows:…

  15. Communication opportunities via special messaging technology for two post-coma persons with multiple disabilities.

    Science.gov (United States)

    Lancioni, Giulio E; O'Reilly, Mark F; Singh, Nirbhay N; Sigafoos, Jeff; Buonocunto, Francesca; Sacco, Valentina; Colonna, Fabio; Navarro, Jorge; Lanzilotti, Crocifissa; de Pace, Claudia; Megna, Marisa; Oliva, Doretta

    2011-01-01

    This study extended the assessment of a special messaging technology with two additional post-coma adults who had emerged from a minimally conscious state, but showed multiple disabilities including profound motor and communication impairments. For each participant, the study involved an ABAB design, in which the A represented baseline phases and the B represented intervention phases with the special messaging technology. The technology involved a net-book computer provided with specific software, a global system for mobile communication (GSM) modem, microswitches, and prerecorded verbal lists of persons' names and messages. Both participants learned to send out and receive (listen to) messages independently during the intervention, thus providing clear support for previous data in the area. They sent out means of about three and 17 messages and received means of about two and six messages per 20- and 30-min session, respectively. The positive impact of the technology was discussed in relation to previous data in this area and the possibility of helping post-coma persons with multiple disabilities engage in basic communication with distant partners.

  16. The Quantified Self (QS) Movement and Some Emerging Opportunities for the Educational Technology Field

    Science.gov (United States)

    Lee, Victor R.

    2013-01-01

    The Quantified Self (QS) movement is a growing global effort to use new mobile and wearable technologies to automatically obtain personal data about everyday activities. The social and material infrastructure associated with the Quantified Self (QS) movement provides a number of ideas that educational technologists should consider incorporating…

  17. Leadership in Mobile Technology: An Opportunity for Family and Consumer Sciences Teacher Educators

    Science.gov (United States)

    Godfrey, Roxie V.; Duke, Sandra E.

    2014-01-01

    A stroll across campus reveals that students are plugged into mobile technology. They never have to break stride in their social connectivity as they pursue an education.Where does the family and consumer sciences (FCS) teacher educator fit into this opportunistic scenario? From its inception, FCS has been at the forefront in the application of…

  18. Source-separated urine opens golden opportunities for microbial electrochemical technologies.

    Science.gov (United States)

    Ledezma, Pablo; Kuntke, Philipp; Buisman, Cees J N; Keller, Jürg; Freguia, Stefano

    2015-04-01

    The food security of a booming global population demands a continuous and sustainable supply of fertilisers. Their current once-through use [especially of the macronutrients nitrogen (N), phosphorus (P), and potassium (K)] requires a paradigm shift towards recovery and reuse. In the case of source-separated urine, efficient recovery could supply 20% of current macronutrient usage and remove 50-80% of nutrients present in wastewater. However, suitable technology options are needed to allow nutrients to be separated from urine close to the source. Thus far none of the proposed solutions has been widely implemented due to intrinsic limitations. Microbial electrochemical technologies (METs) have proved to be technically and economically viable for N recovery from urine, opening the path for novel decentralised systems focused on nutrient recovery and reuse.

  19. Hanford Site Cleanup Challenges and Opportunities for Science and Technology--A Strategic Assessment

    Energy Technology Data Exchange (ETDEWEB)

    Wood, Thomas W.; Johnson, Wayne L.; Kreid, Dennis K.; Walton, Terry L.

    2001-02-01

    The sheer expanse of the Hanford Site, the inherent hazards associated with the significant inventory of nuclear materials and wastes, the large number of aging contaminated facilities, the diverse nature and extent of environmental contamination, and the proximity to the Columbia River make Hanford perhaps the world's largest and most complex environmental cleanup project. It is not possible to address the more complex elements of this enormous challenge in a cost-effective manner without strategic investments in science and technology. Success requires vigorous and sustained efforts to enhance the science and technology basis, develop and deploy innovative solutions, and provide firm scientific bases to support site cleanup and closure decisions at Hanford.

  20. Opportunities and challenges for innovation in the design of low-carbon energy technologies

    DEFF Research Database (Denmark)

    Bjarklev, Araceli; Kjær, Tyge; Andersen, Jan;

    2012-01-01

    Footprint, concepts and tools from Life Cycle Assessment, and relevant elements from eco-efficiency theoretical frameworks. Often systemic approaches tend to be driven by completely rational models. However, our main contribution is to consider a more holistic approach that also includes socio......Though there is broad consensus that one of the solutions to the current environmental challenge will be based on the use of low-carbon technologies, and even though there is a big potential to turn to a more sustainable design and innovation, there are several elements that need to be taken...... as a study object and discusses the question: What are the main possibilities and challenges when designing low-carbon illumination technologies? To answer this question, we use a systemic approach including environmental, economic, energy and political issues using relevant concepts from the Ecological...

  1. Technology Challenges and Opportunities for Very Large In-Space Structural Systems

    Science.gov (United States)

    Belvin, W. Keith; Dorsey, John T.; Watson, Judith J.

    2009-01-01

    Space solar power satellites and other large space systems will require creative and innovative concepts in order to achieve economically viable designs. The mass and volume constraints of current and planned launch vehicles necessitate highly efficient structural systems be developed. In addition, modularity and in-space deployment/construction will be enabling design attributes. While current space systems allocate nearly 20 percent of the mass to the primary structure, the very large space systems of the future must overcome subsystem mass allocations by achieving a level of functional integration not yet realized. A proposed building block approach with two phases is presented to achieve near-term solar power satellite risk reduction with accompanying long-term technology advances. This paper reviews the current challenges of launching and building very large space systems from a structures and materials perspective utilizing recent experience. Promising technology advances anticipated in the coming decades in modularity, material systems, structural concepts, and in-space operations are presented. It is shown that, together, the current challenges and future advances in very large in-space structural systems may provide the technology pull/push necessary to make solar power satellite systems more technically and economically feasible.

  2. Plant Pathology and Information Technology: Opportunity for Management of Disease Outbreak and Applications in Regulation Frameworks

    Directory of Open Access Journals (Sweden)

    Andrea Luvisi

    2016-08-01

    Full Text Available In many European rural areas, agriculture is not only an economic activity, but it is strictly linked to environmental and social characteristics of the area. Thus, sometimes, a pathogen can become a social threat, as in the case of Xylella fastidiosa and olive trees (Olea europaea L. in Salento. Fast and systemic response to threats represents the key to success in stopping pest invasions, and proves a great help in managing lots of data in a short time or coordinating large-scale monitoring coming from applying Information Technology tools. Regarding the field of applications, the advantages provided by new technologies are countless. However, is it the same in agriculture? Electronic identification tools can be applied for plant health management and certification. Treatments, agrochemical management or impact assessment may also be supported by dematerialization of data. Information Technology solution for urban forestry management or traceability of commodities belonging to “Food from Somewhere” regimes were analyzed and compared to protection from pests of a unique tree heritage such as olive trees in Salento.

  3. Resource Recovery from Wastewater by Biological Technologies: Opportunities, Challenges, and Prospects.

    Science.gov (United States)

    Puyol, Daniel; Batstone, Damien J; Hülsen, Tim; Astals, Sergi; Peces, Miriam; Krömer, Jens O

    2016-01-01

    Limits in resource availability are driving a change in current societal production systems, changing the focus from residues treatment, such as wastewater treatment, toward resource recovery. Biotechnological processes offer an economic and versatile way to concentrate and transform resources from waste/wastewater into valuable products, which is a prerequisite for the technological development of a cradle-to-cradle bio-based economy. This review identifies emerging technologies that enable resource recovery across the wastewater treatment cycle. As such, bioenergy in the form of biohydrogen (by photo and dark fermentation processes) and biogas (during anaerobic digestion processes) have been classic targets, whereby, direct transformation of lipidic biomass into biodiesel also gained attention. This concept is similar to previous biofuel concepts, but more sustainable, as third generation biofuels and other resources can be produced from waste biomass. The production of high value biopolymers (e.g., for bioplastics manufacturing) from organic acids, hydrogen, and methane is another option for carbon recovery. The recovery of carbon and nutrients can be achieved by organic fertilizer production, or single cell protein generation (depending on the source) which may be utilized as feed, feed additives, next generation fertilizers, or even as probiotics. Additionlly, chemical oxidation-reduction and bioelectrochemical systems can recover inorganics or synthesize organic products beyond the natural microbial metabolism. Anticipating the next generation of wastewater treatment plants driven by biological recovery technologies, this review is focused on the generation and re-synthesis of energetic resources and key resources to be recycled as raw materials in a cradle-to-cradle economy concept.

  4. Resource Recovery from Wastewater by Biological Technologies: Opportunities, Challenges, and Prospects

    Science.gov (United States)

    Puyol, Daniel; Batstone, Damien J.; Hülsen, Tim; Astals, Sergi; Peces, Miriam; Krömer, Jens O.

    2017-01-01

    Limits in resource availability are driving a change in current societal production systems, changing the focus from residues treatment, such as wastewater treatment, toward resource recovery. Biotechnological processes offer an economic and versatile way to concentrate and transform resources from waste/wastewater into valuable products, which is a prerequisite for the technological development of a cradle-to-cradle bio-based economy. This review identifies emerging technologies that enable resource recovery across the wastewater treatment cycle. As such, bioenergy in the form of biohydrogen (by photo and dark fermentation processes) and biogas (during anaerobic digestion processes) have been classic targets, whereby, direct transformation of lipidic biomass into biodiesel also gained attention. This concept is similar to previous biofuel concepts, but more sustainable, as third generation biofuels and other resources can be produced from waste biomass. The production of high value biopolymers (e.g., for bioplastics manufacturing) from organic acids, hydrogen, and methane is another option for carbon recovery. The recovery of carbon and nutrients can be achieved by organic fertilizer production, or single cell protein generation (depending on the source) which may be utilized as feed, feed additives, next generation fertilizers, or even as probiotics. Additionlly, chemical oxidation-reduction and bioelectrochemical systems can recover inorganics or synthesize organic products beyond the natural microbial metabolism. Anticipating the next generation of wastewater treatment plants driven by biological recovery technologies, this review is focused on the generation and re-synthesis of energetic resources and key resources to be recycled as raw materials in a cradle-to-cradle economy concept. PMID:28111567

  5. The Marine Technology Liguria District, an opportunity for Collaboration and Training

    Science.gov (United States)

    Carmisciano, C.; Tivegna, P.; Sgherri, R. G.; Gambetta, M.; Caratori Tontini, F.; Stefanelli, P.; Cocchi, L.

    2008-05-01

    This work focus on the newly born DLTM, namely the Distretto Ligure delle Tecnologie Marine, based in La Spezia, Liguria Region (IT). The main involved partners are: Ministries, Regione Liguria Council, Spedia SpA Company, Industries, SMEs (SMBs), Universities and National Research Institutes. The DLTM has been created as an answer to the local versus global needs of marine products innovation, technology and science. In order to provide, both the local and international community, effective solutions the DLTM aims to: - promote Innovation and pre-competitiveness of activities related to industrial research; - enhance the value and visibility of excellence areas existing in the Ligurian region (in the big enterprises as well as in SMEs) concerning marine technology; - enhance the value of academic activities focusing their R&D on industrial products/processes, assuring, evaluating and preventing environmental sustainability also in case of extreme events; - harmonize/make sustainable the economy and the society promoting scientific innovation and technological development, by means of Universities, Public and Private Research Institutes (at regional, national and EU level); - help the exchange of ideas and realization of projects aimed at developing the District objectives; - increase the dissemination and valorisation of District results and achievements, build capacity in the sectors of interest to the District. The DLTM is characterized by two main macro-themes. The first concerns infrastructures, materials and processes, while the second is committed to eco-compatible solutions for harbours, ships and coastal scenarios, security and control management of human activities, risky operations and extreme natural events. The former macro-theme is expected to provide the community with innovative solutions, technologies, materials, processes applied to marine sectors, shipyard and related subsystems and components, in a wide sense such as leisure, commercial, navy

  6. Implementation of renewable energy technology - Opportunities and barriers. Summary of country studies

    Energy Technology Data Exchange (ETDEWEB)

    Painuly, J.P.; Fenhann, J.V.

    2002-07-01

    The project was launched to identify barriers to the implementation of renewable energy technologies (RETs) and explore measures to overcome the identified barriers. National institutions in Egypt, Ghana and Zimbabwe carried out the country studies based on the basic methodological framework provided by the UNEP Centre. The objectives of the project included strengthening institutional capacity for analysis and implementation of RET projects in the participating countries and bring out experiences on RETs barriers and removal measures for dissemination so that others can benefit from the knowledge so gained. An important highlight of the studies was involvement of stake holders in the process of identification of barriers and measures to remove them. A preliminary identification of relevant RETs for their countries was done by the country teams in the initial stage of the project. After that, national workshops involving various stake holders were held between July and September 1999 to discuss the RETs and barriers to their implementation. Based on the discussions, a few important RETs were identified for more detailed study. PV systems for rural electrification, solar water heating systems and large-scale biogas system were identified and analysed for barriers in the Egypt country study. Economic, information and policy barriers were identified as major barriers for these technologies. Solar water pumps, biogas and small hydro were the focus of study in Ghana. In this case also, economic, information and policy barriers were found to be the important barriers for the selected technologies. In the case of Zimbabwe, focus was on identification of primary and secondary barriers to RETs dissemination. The primary barriers included lack of capacity to develop proposals, lack of information for policy making and framework for information dissemination. The study concluded that the secondary barriers as seen and experienced by the stake holders are due to primary

  7. Pollution prevention opportunity assessment for building 878, manufacturing science and technology, organization 14100.

    Energy Technology Data Exchange (ETDEWEB)

    Klossner, Kristin Ann

    2004-05-01

    This report describes the methodology, analysis and conclusions of a preliminary assessment carried out for activities and operations at Sandia National Laboratories Building 878, Manufacturing Science and Technology, Organization 14100. The goal of this assessment is to evaluate processes being carried out within the building to determine ways to reduce waste generation and resource use. The ultimate purpose of this assessment is to analyze and prioritize processes within Building 878 for more in-depth assessments and to identify projects that can be implemented immediately.

  8. Firms navigating through innovation spaces: a conceptualization of how firms search and perceive technological, market and productive opportunities globally.

    Science.gov (United States)

    McKelvey, Maureen

    2016-01-01

    The main contribution of this paper is a theory-based conceptual framework of innovation spaces, and how firms must navigate through them to innovate. The concept of innovation systems - at the regional, sectoral and national levels - have been highly influential. Previous literature developing the concept of innovation systems has stressed the importance of institutions, networks and knowledge bases at the regional, sectoral and national levels. This paper primarily draws upon an evolutionary and Schumpeterian economics perspective, in the following three senses. The conceptualization of 'innnovation spaces' focuses upon how and why firm search for innovations is influenced the opportunities within certain geographical contexts. This means that the firm create opportunities and can span different context, but they are influence by the context in term of the access, flow and co-evolution of ideas, resources, technology, people and knowledge, which help stimulate business innovation in terms of products, process and services. The paper concludes with an agenda for future research and especially the need to focus on globalization as a process of intensifying linkages across the globe.

  9. Brain-machine interfaces for space applications-research, technological development, and opportunities.

    Science.gov (United States)

    Summerer, Leopold; Izzo, Dario; Rossini, Luca

    2009-01-01

    Recent advances in brain research and brain-machine interfaces suggest these devices could play a central role in future generation computer interfaces. Successes in the use of brain machine interfaces for patients affected by motor paralysis, as well as first developments of games and gadgets based on this technology have matured the field and brought brain-machine interfaces to the brink of more general usability and eventually of opening new markets. In human space flight, astronauts are the most precious "payload" and astronaut time is extremely valuable. Astronauts operate under difficult and unusual conditions since the absence of gravity renders some of the very simple tasks tedious and cumbersome. Therefore, computer interfaces are generally designed for safety and functionality. All improvements and technical aids to enhance their functionality and efficiency, while not compromising safety or overall mass requirements, are therefore of great interest. Brain machine interfaces show some interesting properties in this respect. It is however not obvious that devices developed for functioning on-ground can be used as hands-free interfaces for astronauts. This chapter intends to highlight the research directions of brain machine interfaces with the perceived highest potential impact on future space applications, and to present an overview of the long-term plans with respect to human space flight. We conclude by suggesting research and development steps considered necessary to include brain-machine interface technology in future architectures for human space flight.

  10. Artificial intelligence and exponential technologies business models evolution and new investment opportunities

    CERN Document Server

    Corea, Francesco

    2017-01-01

    Artificial Intelligence is a huge breakthrough technology that is changing our world. It requires some degrees of technical skills to be developed and understood, so in this book we are going to first of all define AI and categorize it with a non-technical language. We will explain how we reached this phase and what historically happened to artificial intelligence in the last century. Recent advancements in machine learning, neuroscience, and artificial intelligence technology will be addressed, and new business models introduced for and by artificial intelligence research will be analyzed. Finally, we will describe the investment landscape, through the quite comprehensive study of almost 14,000 AI companies and we will discuss important features and characteristics of both AI investors as well as investments. This is the “Internet of Thinks” era. AI is revolutionizing the world we live in. It is augmenting the human experiences, and it targets to amplify human intelligence in a future not so distant from...

  11. Photovoltaic technology and applications: Overview for the workshop on photochemistry research opportunities

    Energy Technology Data Exchange (ETDEWEB)

    Benner, J.P. [National Renewable Energy Laboratory, Golden, CO (United States)

    1996-09-01

    The business surrounding photovoltaic energy conversion for terrestrial applications has changed dramatically in the last several years. It is now a business that makes money. Industry is responding. with manufacturing capacity expansions, and planned expansions, that will triple U.S. annual output within the next eighteen months. The majority of this product is exported (70%) where it is proven to be a cost competitive alternative. This industry provides experience in manufacturing and reliability in fielded systems that will serve as the basis for extrapolating growth to larger-scale installations and utility systems. The largest part of the National Photovoltaic Program budget supports assisting industry in advancing manufacturing technology and stimulating applications to reduce cost and expand the evolving industry. A growing segment of society looks to photovoltaics as an alternative that may be needed to replace conventional electric generating capacity. The grand challenge for photovoltaics is to make the technology economically competitive for large scale electric power generation before real or perceived evidence of environmental damage from conventional sources dictates its use at economically disruptive costs.

  12. Health Information Technology and Care Coordination: The Next Big Opportunity for Informatics?

    Science.gov (United States)

    Bates, D W

    2015-08-13

    The costs of care in the U.S. are very high, in part because canre is relatively uncoordinated. To begin to address this and other issues, health care reform was passed, including the notion of accountable care. Under acountable care arrangements, providers are at risk for the costs of the care they provide to groups of patients. Evaluation of costs has made it clear that a large proportion of these costs are in the post-acute setting, and also that many specific problems such as adverse events and unnecessary readmissions occur following transitions. However, the electronic health records of today do not provide a great deal of assistance with the coordination of care, and even the best organizations have relatively primitive systems with respect to care coordination, even though communication is absolutely central to better coordination of care and health information technology (HIT) is a powerful lever for improving communication. This paper identifies specific gaps in care coordination today, presents a framework for better coordinating care using HIT, then describes how specific technologies can be leveraged. Also discussed are the need to build and test specific interventions to improve HIT-related care coordination tools, and the key policy steps needed to accomplish this.

  13. Thermal Energy for Lunar In Situ Resource Utilization: Technical Challenges and Technology Opportunities

    Science.gov (United States)

    Gordon, Pierce E. C.; Colozza, Anthony J.; Hepp, Aloysius F.; Heller, Richard S.; Gustafson, Robert; Stern, Ted; Nakamura, Takashi

    2011-01-01

    Oxygen production from lunar raw materials is critical for sustaining a manned lunar base but is very power intensive. Solar concentrators are a well-developed technology for harnessing the Sun s energy to heat regolith to high temperatures (over 1375 K). The high temperature and potential material incompatibilities present numerous technical challenges. This study compares and contrasts different solar concentrator designs that have been developed, such as Cassegrains, offset parabolas, compound parabolic concentrators, and secondary concentrators. Differences between concentrators made from lenses and mirrors, and between rigid and flexible concentrators are also discussed. Possible substrate elements for a rigid mirror concentrator are selected and then compared, using the following (target) criteria: (low) coefficient of thermal expansion, (high) modulus of elasticity, and (low) density. Several potential lunar locations for solar concentrators are compared; environmental and processing-related challenges related to dust and optical surfaces are addressed. This brief technology survey examines various sources of thermal energy that can be utilized for materials processing on the lunar surface. These include heat from nuclear or electric sources and solar concentrators. Options for collecting and transporting thermal energy to processing reactors for each source are examined. Overall system requirements for each thermal source are compared and system limitations, such as maximum achievable temperature are discussed.

  14. EFFICIENCY OF THE USE OF HEAT PUMPS ON THE CHP PLANTS

    Directory of Open Access Journals (Sweden)

    Juravleov A.A.

    2007-04-01

    Full Text Available The work is dedicated to the calculus of the efficiency of the use of heat pumps on the CHP plants. There are presented the interdependences between the pay-back period and NPV of heat pump and the price of 1 kWt of thermal power of heat pump and of the tariff of electricity.

  15. A price mechanism for supply demand matching in local grid of households with micro-CHP

    NARCIS (Netherlands)

    Larsen, G.K.H.; van Foreest, N.D.; Scherpen, J.M.A.

    2012-01-01

    This paper describes a dynamic price mechanism to coordinate eletric power generation from micro Combined Heat and Power (micro-CHP) systems in a network of households. It is assumed that the households are prosumers, i.e. both producers and consumers of electricity. The control is done on household

  16. CHP2 gene expression and quantitation in Egyptian patients with acute leukemia

    Directory of Open Access Journals (Sweden)

    Amira Ahmed Hammam

    2014-12-01

    Conclusions: Many studies suggest that CHP2 expression is a novel prognostic marker in AL and thus needs to be incorporated into the patient stratification and treatment protocols. In addition, a quarter of AL patients fail therapy and novel treatments that are focused on undermining specifically the leukemic process are needed urgently.

  17. A Compound Herbal Preparation (CHP) in the Treatment of Children with ADHD: A Randomized Controlled Trial

    Science.gov (United States)

    Katz, M.; Adar Levine, A.; Kol-Degani, H.; Kav-Venaki, L.

    2010-01-01

    Objective: Evaluation of the efficacy of a patented, compound herbal preparation (CHP) in improving attention, cognition, and impulse control in children with ADHD. Method: Design: A randomized, double-blind, placebo-controlled trial. Setting: University-affiliated tertiary medical center. Participants: 120 children newly diagnosed with ADHD,…

  18. Reliability Indices Utlization in Combined Heat and Power ( CHP Optimal Operation

    Directory of Open Access Journals (Sweden)

    Hamed Hosseinnia

    2014-12-01

    Full Text Available The reason for using cogeneration more that heat and power separately is that, it is more efficient. In this paper the goal is finding the optimized CHP system utility size and thermal storage considering reliability limits of boiler and grid connected bus. Loss of Load Expectation (LOLE and Expected energy not supplied (EENS are considered as two reliability indices to insure the security of operation. Non-sequential Monte Carlo simulation method is introduced to the reliability assessment of CHP, and a normal distribution electrical load model is built to simulate the hourly electrical load. CHP model combined with a two-state reliability model is applied to Monte Carlo simulation method, and results show that the CHP reliability model works well with non-sequential Monte Carlo simulation. Non-Sequential Monte Carlo method is used to generate scenarios. Also in order to reduce computation time and due to the large number of scenarios, a scenario reduction technique is used. GAMS software is used for optimization process.

  19. Changes of the thermodynamic parameters in failure conditions of the micro-CHP cycle

    Directory of Open Access Journals (Sweden)

    Matysko Robert

    2014-03-01

    Full Text Available The paper presents the calculations for the failure conditions of the ORC (organic Rankine cycle cycle in the electrical power system. It analyses the possible reasons of breakdown, such as the electrical power loss or the automatic safety valve failure. The micro-CHP (combined heat and power system should have maintenance-free configuration, which means that the user does not have to be acquainted with all the details of the ORC system operation. However, the system should always be equipped with the safety control systems allowing for the immediate turn off of the ORC cycle in case of any failure. In case of emergency, the control system should take over the safety tasks and protect the micro-CHP system from damaging. Although, the control systems are able to respond quickly to the CHP system equipped with the inertial systems, the negative effects of failure are unavoidable and always remain for some time. Moreover, the paper presents the results of calculations determining the inertia for the micro-CHP system of the circulating ORC pump, heat removal pump (cooling condenser and the heat supply pump in failure conditions.

  20. Health technology assessment in the Balkans: opportunities for a balanced drug assessment system.

    Science.gov (United States)

    Dankó, Dávid; Petrova, Guenka

    2014-11-02

    Countries in the Balkan region use pharmaco-economic data for decisions about the inclusion of new pharmaceuticals into their positive drug lists, but no predefined frameworks are used and resources for health technology assessment (HTA) are limited. The goal of this analysis is to investigate into possible development directions for the HTA system in the region, and provide some practical recommendations for a sustainable model. For this purpose, the main factors currently influencing HTA in Balkan countries are briefly presented, and possible development strategies are compared. A resource-saving balanced assessment approach is proposed. It is aligned with available resources and capabilities, and helps access to new pharmaceuticals while ensuring the transparency of decision-making processes and the stability of the pharmaceutical budget.

  1. Potential Opportunities for Investment in Space Technologies in Latin-America: a Case for Mexico

    Science.gov (United States)

    Sanchez, G.

    2002-01-01

    Student, Master of Space Studies. International Space University. Strasbourg Central The objective of this paper is to analyze the possible commercial benefits that the global manufacturing space industry could obtain by investing in Latin-American countries. Spacecraft manufacturers have recently been complaining about small margins. They claim that customers demand technological advancement at the same time as they push for quick delivery and competitive prices. They also argue that operators (their main customers) do have great profits. Thus, manufacturers would like to raise the prices of their spacecraft (SpaceNews. January 7, 2002. P.17). This may sound logical, but it would be interesting to analyze if the industry could find alternative ways of saving money while remaining competitive. Mexico is a good example of a Latin-American country that has received foreign investment for establishing manufacturing and assembly plants for different industries. This has been mainly due to two special characteristics of the Mexican manufacturing workforce: low labor costs and qualified, reliable human resources. As a result, Mexican manufacturing industry has acquired a solid reputation worldwide. A similar story can be told about other industries such as electronics, computer assembly, clothes, etc. It is probably worth to make an analogy with a labor-demanding industry that already has experience in the Mexican market: the car industry has found a formula to keep manufacturing costs low while maintaining production and quality levels. Mexico currently manufactures and assembles cars for European, Japanese and American companies for the international market. If the same success story could be repeated for the spacecraft manufacturing industry, the benefits would be enormous. Manufacturers could consider relocating their plants to Mexico to manufacture and test parts or entire spacecraft. This would help reduce the cost of human labor, especially because of the long

  2. Latest on Mobile Methane Measurements with Fast Open-Path Technology: Experiences, Opportunities & Perspectives

    Science.gov (United States)

    Burba, George; Anderson, Tyler; Ediger, Kevin; von Fischer, Joseph; Gioli, Beniamino; Ham, Jay; Hupp, Jason; Kohnert, Katrin; Larmanou, Eric; Levy, Peter; Polidori, Andrea; Pikelnaya, Olga; Price, Eric; Sachs, Torsten; Serafimovich, Andrei; Zondlo, Mark; Zulueta, Rommel

    2016-04-01

    Methane plays a critical role in the radiation balance, chemistry of the atmosphere, and air quality. The major sources of methane include agricultural and natural production, landfill emissions, oil and gas development sites, and natural gas distribution networks in rural and urban environments. The majority of agricultural and natural methane production occurs in areas with little infrastructure or easily available grid power (e.g., rice fields, arctic and boreal wetlands, tropical mangroves, etc.) Past approaches for direct measurements of methane fluxes relied on fast closed-path analyzers, which typically require powerful pumps and grid power. Power and labor demands may be among the key reasons why such methane fluxes were often measured at locations with good infrastructure and grid power, and not necessarily with high methane production. Landfill methane emissions were traditionally assessed via point-in-time measurements taken at monthly or longer time intervals using techniques such as the trace plume method, the mass balance method, etc. These are subject to large uncertainties because of the snapshot nature of the measurements, while the changes in emission rates are continuous due to ongoing landfill development, changes in management practices, and the barometric pumping phenomenon. Installing a continuously operating flux station in the middle of an active landfill requires a low-power approach with no cables stretching across the landfill. The majority of oil and gas and urban methane emission happens via variable-rate point sources or diffused spots in topographically challenging terrains, such as street tunnels, elevated locations at water treatment plants, vents, etc. Locating and measuring methane emissions from such sources is challenging when using traditional micrometeorological techniques, and requires development of novel approaches. In 2010, a new lightweight high-speed high-resolution open-path technology was developed with the goal of

  3. S'COOL Provides Research Opportunities and Current Data for Today's Technological Classroom

    Science.gov (United States)

    Green, Carolyn J.; Chambers, Lin H.; Racel, Anne M.

    1999-01-01

    NASA's Students' Cloud Observations On-Line (S'COOL) project, a hands-on educational project, was an innovative idea conceived by the scientists in the Radiation Sciences Branch at NASA Langley Research Center, Hampton, Virginia, in 1996. It came about after a local teacher expressed the idea that she wanted her students to be involved in real-life science. S'COOL supports NASA's Clouds and the Earth's Radiant Energy System (CERES) instrument, which was launched on the Tropical Rainforest Measuring Mission (TRMM) in November, 1997, as part of NASA's Earth Science Enterprise. With the S'COOL project students observe clouds and related weather conditions, compute data and note vital information while obtaining ground truth observations for the CERES instrument. The observations can then be used to help validate the CERES measurements, particularly detection of clear sky from space. In addition to meeting math, science and geography standards, students are engaged in using the computer to obtain, report and analyze current data, thus bringing modern technology into the realm of classroom, a paradigm that demands our attention.

  4. US - India Partnership in Science and Technology, Environment and Health: Opportunities and Challenges

    Energy Technology Data Exchange (ETDEWEB)

    Kulkarni, Satish V [Georgetown University

    2010-10-06

    Today, the US – India strategic partnership is rooted in shared values and is broad in nature and scope, with our two countries working together on global and energy security, climate change and clean environment, life sciences and public health, economic prosperity and trade, and education. A key outcome of this partnership has been the signing of the historic Indo-US Civil Nuclear Deal. Science and technology (S&T) have always been important elements of this partnership, and US Secretary of State Condoleezza Rice and Indian S&T Minister Kapil Sibal signed an agreement on S&T Cooperation between the two countries in October 2005. In March 2006, recognizing the expanding role of S&T, President George Bush and Prime Minister Manmohan Singh formed a Bi-National S&T Commission and established a Joint S&T Endowment Fund focused on innovation, entrepreneurship and commercialization. In July 2009, US Secretary of State Hillary Clinton and Indian Foreign Minister Krishna signed the Endowment Agreement with a total equivalent funding of $30M (equal contribution from US and India). While these steps take our engagement to new heights, US-India collaboration in S&T is not new and has been ongoing for several decades, principally through agencies like NSF, NIH, EPA, DOE, NASA, NOAA, the PL480 US-India Fund, and the Indian Diaspora. However, acting as a damper, especially during the cold war days, this engagement has been plagued by sanctions and the resulting tensions and mistrust which continue to linger on even today. In this context, several ongoing activities in energy, space, climate change and education will be highlighted. Also, with the S&T and the Civil Nuclear Agreements and climate change as examples, the interplay of science, policy and politics will be discussed.

  5. Challenges and Opportunities with Empowering Baby Boomers for Personal Health Information Management Using Consumer Health Information Technologies: an Ecological Perspective

    Directory of Open Access Journals (Sweden)

    Cynthia M. LeRouge

    2014-09-01

    Full Text Available “Baby Boomers” (adults born between the years of 1946 and 1964 make up the largest segment of the population in many countries, including the United States (about 78 million Americans [1]. As Baby Boomers reach retirement age and beyond, many will have increasing medical needs and thus demand more health care resources that will challenge the healthcare system. Baby Boomers will likely accelerate the movement toward patient self-management and prevention efforts. Consumer Health Information Technologies (CHIT hold promise for empowering health consumers to take an active role in health maintenance and disease management, and thus, have the potential to address Baby Boomers' health needs. Such innovations require changes in health care practice and processes that take into account Baby Boomers' personal health needs, preferences, health culture, and abilities to use these technologies. Without foundational knowledge of barriers and opportunities, Baby Boomers may not realize the potential of these innovations for improving self-management of health and health outcomes. However, research to date has not adequately explored the degree to which Baby Boomers are ready to embrace consumer health information technology and how their unique subcultures affect adoption and diffusion. This position paper describes an ecological conceptual framework for understanding and studying CHIT aimed at satisfying the personal health needs of Baby Boomers. We explore existing literature to provide a detailed depiction of our proposed conceptual framework, which focuses characteristics influencing Baby Boomers and their Personal Health Information Management (PHIM and potential information problems. Using our ecological framework as a backdrop, we provide insight and implications for future research based on literature and underlying theories represented in our model.

  6. Micro Cooling, Heating, and Power (Micro-CHP) and Bio-Fuel Center, Mississippi State University

    Energy Technology Data Exchange (ETDEWEB)

    Louay Chamra

    2008-09-26

    Initially, most micro-CHP systems will likely be designed as constant-power output or base-load systems. This implies that at some point the power requirement will not be met, or that the requirement will be exceeded. Realistically, both cases will occur within a 24-hour period. For example, in the United States, the base electrical load for the average home is approximately 2 kW while the peak electrical demand is slightly over 4 kW. If a 3 kWe micro- CHP system were installed in this situation, part of the time more energy will be provided than could be used and for a portion of the time more energy will be required than could be provided. Jalalzadeh-Azar [6] investigated this situation and presented a comparison of electrical- and thermal-load-following CHP systems. In his investigation he included in a parametric analysis addressing the influence of the subsystem efficiencies on the total primary energy consumption as well as an economic analysis of these systems. He found that an increase in the efficiencies of the on-site power generation and electrical equipment reduced the total monthly import of electricity. A methodology for calculating performance characteristics of different micro-CHP system components will be introduced in this article. Thermodynamic cycles are used to model each individual prime mover. The prime movers modeled in this article are a spark-ignition internal combustion engine (Otto cycle) and a diesel engine (Diesel cycle). Calculations for heat exchanger, absorption chiller, and boiler modeling are also presented. The individual component models are then linked together to calculate total system performance values. Performance characteristics that will be observed for each system include maximum fuel flow rate, total monthly fuel consumption, and system energy (electrical, thermal, and total) efficiencies. Also, whether or not both the required electrical and thermal loads can sufficiently be accounted for within the system

  7. Structural insights into ChpT, an essential dimeric histidine phosphotransferase regulating the cell cycle in Caulobacter crescentus.

    Science.gov (United States)

    Fioravanti, Antonella; Clantin, Bernard; Dewitte, Frédérique; Lens, Zoé; Verger, Alexis; Biondi, Emanuele G; Villeret, Vincent

    2012-09-01

    Two-component and phosphorelay signal-transduction proteins are crucial for bacterial cell-cycle regulation in Caulobacter crescentus. ChpT is an essential histidine phosphotransferase that controls the activity of the master cell-cycle regulator CtrA by phosphorylation. Here, the 2.2 Å resolution crystal structure of ChpT is reported. ChpT is a homodimer and adopts the domain architecture of the intracellular part of class I histidine kinases. Each subunit consists of two distinct domains: an N-terminal helical hairpin domain and a C-terminal α/β domain. The two N-terminal domains are adjacent within the dimer, forming a four-helix bundle. The ChpT C-terminal domain adopts an atypical Bergerat ATP-binding fold.

  8. Finding Inspiration in the Common Core: An Uncommon Opportunity to Refine the Role of the School Library and Technology Planning Committee

    Science.gov (United States)

    Cravey, Nancy

    2013-01-01

    The implementation of the Common Core State Standards for English Language Arts affords school librarians and their planning committees an opportunity to reinvigorate their roles in the school as curators of the school library collection, innovators in the use of instructional technology, and leaders in instructional planning. By focusing on these…

  9. The scale of transition: an integrated study of the performance of CHP biomass plants in the Netherlands

    OpenAIRE

    Proka, Antonia; Hisschemöller, Matthijs; Papyrakis, Elissaios

    2014-01-01

    Combined heat and power (CHP) plants using biomass are considered important to substantially increase the share of renewables in the total energy supply and meet ambitious climate targets. The analysis focuses on the links between the size of bio-fuelled CHP plants and their techno-economic and environmental performance, as well as social acceptance. In an exploratory way, this paper compares the performance of six bioenergy plants in the Netherlands in these three key areas, thereby focusing...

  10. Commercializing light-duty plug-in/plug-out hydrogen-fuel-cell vehicles: "Mobile Electricity" technologies and opportunities

    Science.gov (United States)

    Williams, Brett D.; Kurani, Kenneth S.

    Starting from the premise that new consumer value must drive hydrogen-fuel-cell-vehicle (H 2FCV) commercialization, a group of opportunities collectively called "Mobile Electricity" is characterized. Mobile Electricity (Me-) redefines H 2FCVs as innovative products able to import and export electricity across the traditional vehicle boundary. Such vehicles could provide home recharging and mobile power, for example for tools, mobile activities, emergencies, and electric-grid-support services. This study integrates and extends previous analyses of H 2FCVs, plug-in hybrids, and vehicle-to-grid (V2G) power. Further, it uses a new electric-drive-vehicle and vehicular-distributed-generation model to estimate zero-emission-power versus zero-emission-driving tradeoffs, costs, and grid-support revenues for various electric-drive vehicle types and levels of infrastructure service. By framing market development in terms of new consumer value flowing from Me-, this study suggests a way to move beyond the battery versus fuel-cell zero-sum game and towards the development of integrated plug-in/plug-out hybrid platforms. As one possible extension of this Me- product platform, H 2FCVs might supply clean, high-power, and profitable Me- services as the technologies and markets mature.

  11. Economic Potential of CHP in Detroit Edison Service Area: the Customer Perspective

    Energy Technology Data Exchange (ETDEWEB)

    Kelly, J.

    2003-10-10

    can realistically be expected, based on consumer investment in combined heat and power systems (CHP) and the effect of utility applied demand response (DR). (2) Evaluate and quantify the impact on the distribution utility feeder from the perspective of customer ownership of the DE equipment. (3) Determine the distribution feeder limits and the impact DE may have on future growth. For the case study, the Gas Technology Institute analyzed a single 16-megawatt grid feeder circuit in Ann Arbor, Michigan to determine whether there are economic incentives to use small distributed power generation systems that would offset the need to increase grid circuit capacity. Increasing circuit capacity would enable the circuit to meet consumer's energy demands at all times, but it would not improve the circuit's utilization factor. The analysis spans 12 years, to a planning horizon of 2015. By 2015, the demand for power is expected to exceed the grid circuit capacity for a significant portion of the year. The analysis was to determine whether economically acceptable implementation of customer-owned DE systems would reduce the peak power demands enough to forestall the need to upgrade the capacity of the grid circuit. The analysis was based on economics and gave no financial credit for improved power reliability or mitigation of environmental impacts. Before this study was completed, the utility expanded the capacity of the circuit to 22 MW. Although this expansion will enable the circuit to meet foreseeable increases in peak demand, it also will significantly decrease the circuit's overall utilization factor. The study revealed that DE penetration on the selected feeder is not expected to forestall the need to upgrade the grid circuit capacity unless interconnection barriers are removed. Currently, a variety of technical, business practice, and regulatory barriers discourage DE interconnection in the US market.

  12. Agricultural Technology Opportunities.

    Science.gov (United States)

    North Carolina State Board of Education, Raleigh. Agricultural Technology Education Section.

    Agricultural education programs available through North Carolina's newly created system of industrial education center, technical institutes, and community colleges are described. The information is for use by administrators, and teachers of adult agricultural courses and counselors of high school dropouts and graduates. It describes the need for…

  13. Modelling of energy systems with a high percentage of CHP and wind power

    Energy Technology Data Exchange (ETDEWEB)

    Lund, H. [Aalborg University (Denmark). Dept. of Development and Planning; Muenster, E. [PlanEnergi s/i, Skorping (Denmark)

    2003-11-01

    This paper presents the energy system analysis model EnergyPLAN, which has been used to analyse the integration of large scale wind power into the national Danish electricity system. The main purpose of the EnergyPLAN model is to design suitable national energy planning strategies by analysing the consequences of different national energy investments. The model emphasises the analysis of different regulation strategies and different market economic optimisation strategies. At present wind power supply 15% of the Danish electricity demand and ca 50% is produced in CHP (combined heat and power production). The model has been used in the work of an expert group conducted by the Danish Energy Agency for the Danish Parliament. Results are included in the paper in terms of strategies, in order to manage the integration of CHP and wind power in the future Danish energy supply in which more than 40% of the supply is expected to come from wind power. (author)

  14. Commercialisation of fuel cells for combined heat and power (CHP) application

    Science.gov (United States)

    Packer, Julian

    1992-01-01

    Combined heat and power or co-generation is an ideal application for the fuel cell. This paper has been written from the perspective of a current designer, builder and operator of small-scale (i.e. sub 1 MW) combined heat and power. Conventional current CHP is described together with typical applications. The perceived advantages of fuel cells are also discussed together with the potential for fuel cells opening up currently unapproachable markets. Various matters relevant to the application of fuel cells are also described including: initial and life costs for fuel cells CHP systems; maintenance requirements, security of supply requirements. In addition to these commercial aspects, technical issues including interfacing to building systems, control, protection, monitoring, operating procedures and performance are also discussed.

  15. Flue gas condensation in straw fired CHP plants; Roeggaskondensation i halmfyrede kraftvarmeanlaeg

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2000-06-15

    The high price of straw and a general demand for increased use of straw in power and heat production are expected to result in an increased need for efficient fuel utilization. The use of flue gas condensation in straw fired CHP plants can contribute to a higher exploitation of energy, and at the same time open of the possibility of utilization of wet (cheaper) fuels without energy loss. Furthermore flue gas condensation can contribute to the flue gas cleaning process through removal of HCl and SO{sub 2} as well as in particle cleaning in wet cleaning processes. With starting point in a straw fired CHP plant the technical and economic consequences of installation of a flue gas condensation system are investigated. Fuel exploitation and power/heat production distribution is included in the investigation. (BA)

  16. Thermal gain of CHP steam generator plants and heat supply systems

    Science.gov (United States)

    Ziganshina, S. K.; Kudinov, A. A.

    2016-08-01

    Heating calculation of the surface condensate heat recovery unit (HRU) installed behind the BKZ-420-140 NGM boiler resulting in determination of HRU heat output according to fire gas value parameters at the heat recovery unit inlet and its outlet, heated water quantity, combustion efficiency per boiler as a result of installation of HRU, and steam condensate discharge from combustion products at its cooling below condensing point and HRU heat exchange area has been performed. Inspection results of Samara CHP BKZ-420-140 NGM power boilers and field tests of the surface condensate heat recovery unit (HRU) made on the bimetal calorifier base KCk-4-11 (KSk-4-11) installed behind station no. 2 Ulyanovsk CHP-3 DE-10-14 GM boiler were the basis of calculation. Integration of the surface condensation heat recovery unit behind a steam boiler rendered it possible to increase combustion efficiency and simultaneously decrease nitrogen oxide content in exit gases. Influence of the blowing air moisture content, the excess-air coefficient in exit gases, and exit gases temperature at the HRU outlet on steam condensate amount discharge from combustion products at its cooling below condensing point has been analyzed. The steam condensate from HRU gases is offered as heat system make-up water after degasification. The cost-effectiveness analysis of HRU installation behind the Samara CHP BKZ-420-140 NGM steam boiler with consideration of heat energy and chemically purified water economy has been performed. Calculation data for boilers with different heat output has been generalized.

  17. Renewables and CHP with District Energy in Support of Sustainable Communities

    Energy Technology Data Exchange (ETDEWEB)

    Snoek, Chris

    2010-09-15

    This paper addresses the powerful idea of connecting many energy users to environmentally optimum energy sources through integrated community energy systems. Such systems require piping networks for distributing thermal energy, i.e., district heating and cooling (DHC) systems. The possibilities and advantages of the application of integrated energy concepts are discussed, including the economic and environmental benefits of integrating localized electrical generating systems (CHP), transportation systems, industrial processes and other thermal energy requirements. Examples of a number of operating systems are provided. Some of the R and D carried out by the IEA Implementing Agreement on District Heating and Cooling is also described.

  18. Development of a Wood Powder Fuelled 35 kW Stirling CHP Unit

    DEFF Research Database (Denmark)

    Pålsson, M.; Carlsen, Henrik

    2003-01-01

    , using wood powder as fuel will be developed at Lund University, Sweden, in cooperation with the Technical University of Denmark and with the wood powder boiler manufacturer VTS AB. The unit is to be run in CHP operation by Vattenfall - the largest electric power company in Sweden - in a one-year field...... test in Ĭvkarleby, Sweden, and the operation of the unit will be evaluated at the end of the field test period. The unit is intended for blocks of flats, schools, local heat production plants and the wood industry....

  19. Operational Strategies for a Portfolio of Wind Farms and CHP Plants in a Two-Price Balancing Market

    DEFF Research Database (Denmark)

    Hellmers, Anna; Zugno, Marco; Skajaa, Anders

    2015-01-01

    In this paper we explore the portfolio effect of a system consisting of a Combined Heat and Power (CHP) plant and a wind farm. The goal is to increase the overall profit of the portfolio by reducing imbalances, and consequently their implicit penalty in a two-price balancing market for electricity....... We investigate two different operational strategies, which differ in whether the CHP plant and the wind farm are operated jointly or independently, and we evaluate their economic performance on a real case study based on a CHP-wind system located in the western part of Denmark. We present......-horizon fashion, so that forecasts for heat demand, wind power production and market prices are updated at each iteration. We conclude that the portfolio strategy is the most profitable due to the two-price structure of the balancing market. This encourages producers to handle their imbalances outside the market....

  20. The experience of living with stroke and using technology: opportunities to engage and co-design with end users

    NARCIS (Netherlands)

    Nasr, N.; Leon, B.; Mountain, G.A.; Nijenhuis, S.M.; Prange, G.B.; Sale, P.; Amirabdollahian, F

    2015-01-01

    Purpose: We drew on an interdisciplinary research design to examine stroke survivors’ experiences of living with stroke and with technology in order to provide technology developers with insight into values, thoughts and feelings of the potential users of a to-be-designed robotic technology for home

  1. Evaluation of the operational cost savings potential from a D-CHP system based on a monthly power-to-heat ratio analysis

    Directory of Open Access Journals (Sweden)

    Alta Knizley

    2015-12-01

    Full Text Available This paper focuses on the analysis of a combined heat and power (CHP system utilizing two power generation units operating simultaneously under differing operational strategies (D-CHP on the basis of operational cost savings. A cost optimization metric, based on the facility monthly power-to-heat ratio (PHR, is presented in this paper. The PHR is defined as the ratio between the facility electric load and thermal load. Previous work in this field has suggested that D-CHP system performance may be improved by limiting operation of the system to months in which the PHR is relatively low. The focus of this paper is to illustrate how the facility PHR parameter could be used to establish the potential of a D-CHP system to reduce operational cost with respect to traditional CHP systems and conventional systems with separate heating and power. This paper analyzes the relationship between the PHR and the operational cost savings of eight different benchmark buildings. Achieving operational cost savings through optimal operation based on monthly PHR for these building types can enhance the implementation potential of D-CHP and CHP systems. Results indicate that the PHR parameter can be used to predict the potential for a D-CHP system to reduce the operational cost.

  2. Opportunity Design

    DEFF Research Database (Denmark)

    2012-01-01

    or development oriented, the act of ‘recognition’ is still a central part of the definition. Recently the term “Opportunity Design” has been introduced, suggesting that opportunities can be proactively and intentionally designed. However, the relatedness between the opportunity recognition process...... and opportunity design is not clear. Furthermore, there is still a lack of approaches, methods and tools, which can support entrepreneurs in designing the entrepreneurial opportunities. In this paper, we take steps towards defining opportunity design in respect to the opportunity recognition process, and identify...... some of the specific approaches applicable to the design of opportunities. By looking at industrial designers working with entrepreneurial opportunities, it becomes evident that there is a set of approaches, which can turn the opportunity recognition process into an intentional and proactive process....

  3. Energy-optimisation of biogas-fuelled CHP units; Energetische Optimierung von Biogas-BHKW's

    Energy Technology Data Exchange (ETDEWEB)

    Soltic, P.; Edenhauser, D.; Winkler, A.

    2008-07-15

    This illustrated final report for the Swiss Federal office of Energy (SFOE) reports on the energy-related optimisation of combined heat and power (CHP) units that are fuelled with non-processed biogas. Ways of increasing the efficiency of these units as far as the production of electricity is concerned are examined and commented on. Also, ways of using the heat generated by the CHP units to produce electricity using other, exergetic means are also described. Systems such as Stirling engines and existing and new thermo-electrical elements are discussed. The economic viability of the systems is also discussed.

  4. Modeling and optimization of a 1 kWe HT-PEMFC-based micro-CHP residential system

    DEFF Research Database (Denmark)

    Arsalis, Alexandros; Nielsen, Mads Pagh; Kær, Søren Knudsen

    2012-01-01

    A high temperature-proton exchange membrane (HT-PEMFC)-based micro-combined-heat-and-power (CHP) residential system is designed and optimized, using a genetic algorithm (GA) optimization strategy. The proposed system consists of a fuel cell stack, steam methane reformer (SMR) reactor, water gas...... shift (WGS) reactor, heat exchangers, and other balance-of-plant (BOP) components. The objective function of the single-objective optimization strategy is the net electrical efficiency of the micro-CHP system. The implemented optimization procedure attempts to maximize the objective function...

  5. Survey of controllability in decentralized CHP plants. Optimal operation of priority production units; Kortlaegning af decentrale kraftvarmevaerkers regulerbarhed. Optimal drift af prioriterede anlaeg - Teknologisk grundlag

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2005-03-15

    The present report presents results from two closely related projects, carried out in parallel, under the PSO-F and U 2002. The one project is 'Survey of controllability in de-centralized combined heat and power plants' project number PSO 4724 and is fully reported here. The other project: 'Optimal operation of priority production units, project number PSO 4712, only the part project 'Technological foundations is reported here. In project 4724 the technical conditions that matter regarding controllability of electricity production in de-centralized heat and power stations are surveyed. In this context the term controllability means how fast and to which extent the load factors of the plants can be changed. Also, is has been investigated which options are available for improving the controllability, their potentials and estimates on required investments associated. The investigation covers CHP plants having a production capacity of up to 30 MW of electricity. The main part of the de-centralized CHP plants are based on spark ignited internal combustion engines (Otto engines). Most of these engines are fuelled by natural gas and a smaller part by biogas. A minor number are gas turbines fuelled by natural gas and steam turbines in industrial applications, waste incineration plants or in combined cycle power plants. The mapping has among others consisted of a number of visits on selected different types of plants including interview with people responsible for the daily operation. From these interviews data on the actual operating strategy and technical data have been provided. In addition suppliers of engines and other equipment involved have been contacted for technical information or recommendations regarding possible changes in operation strategy. Searching the Internet has been widely used for identification of technical investigations concerning e.g. operation and maintenance of relevant equipment. Finally, substantial statistical data from

  6. Pluralistic heat supply concept. Strategies and technologies for decentralised district heating in a liberalized energy market with an emphasis on CHP technology and renewable energies. AGFW principal study, first part of work. Vol. 2. Part 1: District heating systems, existing stock of buildings. Part 2: Technology development and assessment; Pluralistische Waermeversorgung. Strategien und Technologien einer pluralistischen Fern- und Nahwaermeversorgung in einem liberalisierten Energiemarkt unter besonder Beruecksichtigung der Kraft-Waerme-Kopplung und regenerativer Energien. AGFW-Hauptstudie. 1. Bearbeitungsabschnitt. Bd. 2. T. 1: Waermeversorgung des Gebaeudebestandes. T. 2: Technologieentwicklung und -bewertung

    Energy Technology Data Exchange (ETDEWEB)

    Neuffer, H.; Witterhold, F.G. [Arbeitsgemeinschaft Fernwaerme e.V., Frankfurt am Main (Germany); Pfaffenberger, W. [Bremer Energie Institut, Bremen (DE)] [and others

    2001-08-01

    In order to prepare the basis for the comparative analysis of various carbon dioxide mitigation policies in terms of energy performance of buildings, economic efficiency and ecologic benefits, the wide variety of community district heating services is defined in part A, based on a very differential and extensive characterisation of selected dwellings and the building types. The last chapter of part A discusses the impacts of an enhanced CHP electricity production on the energy system of the Federal Republic of Germany. Part B explains the basic aspects and the approaches used for a building-specific modelling of the various structures of dwellings and the further development of methods applied for energy analysis and energy system modelling at the national level. (orig./CB) [German] Zur Vorbereitung des energetischen, oekonomischen und oekologischen Vergleichs verschiedener CO{sub 2}-Minderungsmassnahmen werden zunaechst in Teil A die unterschiedlichen Versorgungsaufgaben kommunaler Fernwaermeversorgungssysteme anhand einer sehr differenzierten und umfangreichen Charakterisierung der ausgewaehlten Siedlungs- und Gebaeudestrukturen definiert. Im letzten Kapitel von Teil A werden ausserdem die Rueckwirkungen einer verstaerkten KWK-Stromerzeugung auf das Energiesystem der Bundesrepublik Deutschland diskutiert. Teil B erlaeutert die Grundlagen und die Entwicklung der gebaeudescharfen Modellierung von Siedlungsstrukturen und eine Weiterentwicklung von Energiesystemmodellen. (orig./CB)

  7. A comparison of cost-benefit analysis of biomass and natural gas CHP projects in Denmark and the Netherlands

    NARCIS (Netherlands)

    Groth, Tanja; Scholtens, Bert

    2016-01-01

    We investigate what drives differences in the project appraisal of biomass and natural gas combined heat and power (CHP) projects in two countries with very similar energy profiles. This is of importance as the European Commission is assessing the potential scope of harmonizing renewable electricity

  8. Optimization of operation for combined heat and power plants - CHP plants - with heat accumulators using a MILP formulation

    Energy Technology Data Exchange (ETDEWEB)

    Grue, Jeppe; Bach, Inger [Aalborg Univ. (Denmark). Inst. of Energy Technology]. E-mails: jeg@iet.auc.dk; ib@iet.auc.dk

    2000-07-01

    The power generation system in Denmark is extensively based on small combined heat and power plants (CHP plants), producing both electricity and district heating. This project deals with smaller plants spread throughout the country. Often a heat accumulator is used to enable electricity production, even when the heat demand is low. This system forms a very complex problem, both for sizing, designing and operation of CHP plants. The objective of the work is the development of a tool for optimisation of the operation of CHP plants, and to even considering the design of the plant. The problem is formulated as a MILP-problem. An actual case is being tested, involving CHP producing units to cover the demand. The results from this project show that it is of major importance to consider the operation of the plant in detail already in the design phase. It is of major importance to consider the optimisation of the plant operation, even at the design stage, as it may cause the contribution margin to rise significantly, if the plant is designed on the basis of a de-tailed knowledge of the expected operation. (author)

  9. Information and communication technologies and gender in climate change and green economy: Situating women’s opportunities and challenges in Zambian policies and strategies

    Directory of Open Access Journals (Sweden)

    Justina Namukombo

    2016-03-01

    Full Text Available Zambia’s 2012 report on the United Nations Conference on Sustainable Development (RIO +20 identifies existing opportunities on the country’s transitioning to green economy. The RIO +20 conference of 2012 has resulted in new momentum in addressing problems of sustainable development. However, this article argues that there are practical challenges that require paying attention to, especially those involving women. The article addressed one key question: To what extent can women participate in the transitioning process to green economy in Zambia and what opportunities and challenges exists? The study used document analysis to answer the above question. National policy documents were reviewed to understand interventions on environmental management. Whilst going through the documents, the study used gender analysis frameworks (education, skills, roles in family and society, access to infrastructure to bring out qualitative and quantitative information on women. Using suggested green economy interventions in the literature as benchmark, qualitative analysis was used to project possible participation of women in green economy activities and possible challenges to be faced. The study found that participation of women will be limited despite existing opportunities because of challenges of access to information and communication technology infrastructures, low educational levels and skills and financial constraints. As Zambia undergoes a transitioning process, these limitations should be addressed in planned green economy policies and interventions to maximise benefits.Keywords: Green economy; Gender; Policies; Strategies; ICT; Zambia

  10. SHORT, MEDIUM AND LONG-TERM OPPORTUNITIES AND NEEDS FOR RESEARCH FOR SUSTAINABLE FARM ANIMAL BREEDING AND REPRODUCTION TECHNOLOGY IN EU

    Directory of Open Access Journals (Sweden)

    D. Kompan

    2007-06-01

    Full Text Available The European landscape is characterised by a range of diverse farming systems. These relate not only to varied geographical environments, but also to different social and cultural environments for farming and food production. This diversity is unique to Europe and underlines the importance of European agriculture. Animal breeding is a knowledge intensive sector, and for the future competitiveness of animal breeding and animal production, high level European research is indispensable. The preparation of Strategic Research Agenda were in a full process: opportunities and problems, gaps, short, medium and long term opportunities and needs for research. Each country experts from different group have opportunity to help define his country dimension of animal breeding in its regional and country context, and also in relation to European and global developments. The Farm Animal Breeding and Reproduction European Technology Platform, brings together a wide range of interested parties to produce a vision of how livestock breeding might develop in the next 20 years, and constitutes the first step in achieving that vision.

  11. Large-scale educational telecommunications systems for the US: An analysis of educational needs and technological opportunities

    Science.gov (United States)

    Morgan, R. P.; Singh, J. P.; Rothenberg, D.; Robinson, B. E.

    1975-01-01

    The needs to be served, the subsectors in which the system might be used, the technology employed, and the prospects for future utilization of an educational telecommunications delivery system are described and analyzed. Educational subsectors are analyzed with emphasis on the current status and trends within each subsector. Issues which affect future development, and prospects for future use of media, technology, and large-scale electronic delivery within each subsector are included. Information on technology utilization is presented. Educational telecommunications services are identified and grouped into categories: public television and radio, instructional television, computer aided instruction, computer resource sharing, and information resource sharing. Technology based services, their current utilization, and factors which affect future development are stressed. The role of communications satellites in providing these services is discussed. Efforts to analyze and estimate future utilization of large-scale educational telecommunications are summarized. Factors which affect future utilization are identified. Conclusions are presented.

  12. The path-to-purchase is paved with digital opportunities: An inventory of shopper-oriented retail technologies

    OpenAIRE

    Willems, Kim; Smolders, Annelien; Brengman, Malaika; Luyten, Kris; Schöning, Johannes

    2016-01-01

    This study focuses on innovative ways to digitally instrument the servicescape in bricks-and-mortar retailing. In the present digital era, technological developments allow for augmenting the shopping experience and capturing moments-of-truth along the shopper's path-to-purchase. This article provides an encompassing inventory of retail technologies resulting from a systematic screening of three secondary data sources, over 2008–2016: (1) the academic marketing literature, (2) retailing relate...

  13. Advanced technology care innovation for older people in Italy: necessity and opportunity to promote health and wellbeing.

    Science.gov (United States)

    Lattanzio, Fabrizia; Abbatecola, Angela M; Bevilacqua, Roberta; Chiatti, Carlos; Corsonello, Andrea; Rossi, Lorena; Bustacchini, Silvia; Bernabei, Roberto

    2014-07-01

    Even though there is a constant and accelerating growth of the aging population worldwide, such a rapid rise is negatively impacting available home and community services not able to encompass the necessities associated with the increased number of older people. In particular, there are increasing demands on e-health care services and smart technologies needed for frail elders with chronic diseases and also for those experiencing active aging. Advanced Technology Care Innovation for older persons encompasses all sectors (assistive technology, robotics, home automation, and home care- and institution-based healthcare monitoring, telemedicine) dedicated to promoting health and wellbeing in all types of living environments. Considering that there is a large concern and demand by older persons to remain in familiar social living surroundings, study projects joined with industries have been currently initiated, especially across Europe to improve health and wellbeing. This article will highlight the latest updates in Europe and, in particular in Italy, regarding scientific projects dedicated to unraveling how diverse needs can be translated into an up-to-date technology innovation for the growing elder population. We will provide information regarding advanced technology designed for those with specific geriatric-correlated conditions in familiar living settings and for individuals aging actively. This is an important action because numerous emerging developments are based on user needs identified by geriatricians, thus, underlining the indispensable role of geriatric medicine toward future guidelines on specific technology.

  14. Analysis of the impact of Heat-to-Power Ratio for a SOFC-based mCHP system for residential application under different climate regions in Europe

    DEFF Research Database (Denmark)

    Liso, Vincenzo; Zhao, Yingru; Brandon, Nigel;

    2011-01-01

    In this paper, the ability of a micro combined heat and power (mCHP) system to cover the heat and electricity demand of a single-family residence is investigated. A solid oxide fuel cell based mCHP system coupled with a hot water storage tank is analyzed. The energy profiles of single-family hous......In this paper, the ability of a micro combined heat and power (mCHP) system to cover the heat and electricity demand of a single-family residence is investigated. A solid oxide fuel cell based mCHP system coupled with a hot water storage tank is analyzed. The energy profiles of single......-family households in different European countries are evaluated. The range of Heat-to-Power Ratio for the SOFC based mCHP System of 0.5 to 1.5 shows good agreement with the hot water, space heating and electricity demand during the warm seasons across Europe. This suggests that the fuel cell system should be sized...... according to the summer energy demand. The winter energy demand shows a Heat-to-Power Ratio which cannot be covered by the mCHP unit alone. To ensure that the mCHP system meets both the thermal and electrical energy demand over the entire year, an auxiliary boiler and a hot water storage tank need...

  15. COMPARISON OF MATHEMATICAL MODELS FOR HEAT EXCHANGERS OF UNCONVENTIONAL CHP UNITS

    Directory of Open Access Journals (Sweden)

    Peter Durcansky

    2015-08-01

    Full Text Available An unconventional CHP unit with a hot air engine is designed as the primary energy source with fuel in the form of biomass. The heat source is a furnace designed for combustion of biomass, whether in the form of wood logs or pellets. The transport of energy generated by the biomass combustion to the working medium of a hot-air engine is ensured by a special heat exchanger connected to this resource. The correct operation of the hot-air engine is largely dependent on an appropriate design of the exchanger. The paper deals with the calculation of the heat exchanger for the applicationsmentioned, using criterion equations, and based on CFD simulations.

  16. Investigation of Continuous Gas Engine CHP Operation on Biomass Producer Gas

    DEFF Research Database (Denmark)

    Ahrenfeldt, Jesper; Henriksen, Ulrik Birk; Jensen, Torben Kvist

    2005-01-01

    More than 2000 hours of gas engine operation with producer gas from biomass as fuel has been conducted on the gasification CHP demonstration and research plant, named “Viking” at the Technical University of Denmark. The gas engine is an integrated part of the entire gasification plant. The excess...... heat from the exhaust gas is utilised for drying and pyrolysis of the biomass in the gasification system, and the engine directly controls the load of the gasifier. Two different control approaches have been applied and investigated: one where the flow rate of the producer gas is fixed and the engine...... investigated. The engine and the plant are equipped with continuously data acquisition that monitors the operation including the composition of the producer gas and the flow. Producer gas properties and contaminations have been investigated. No detectable tar or particle content was observed...

  17. Trial operation of a phosphoric acid fuel cell (PC25) for CHP applications in Europe

    Energy Technology Data Exchange (ETDEWEB)

    Uhrig, M.; Droste, W.; Wolf, D. [Ruhrgas AG, Dorsten (Germany)

    1996-12-31

    In Europe, ten 200 kW phosphoric acid fuel cells (PAFCs) produced by ONSI (PC25) are currently in operation. Their operators collaborate closely in the European Fuel Cell Users Group (EFCUG). The experience gained from trial operation by the four German operators - HEAG, HGW/HEW, Thyssengas and Ruhrgas - coincides with that of the other European operators. This experience can generally be regarded as favourable. With a view to using fuel cells in combined heat and power generation (CHP), the project described in this report, which was carried out in cooperation with the municipal utility of Bochum and Gasunie of the Netherlands, aimed at gaining experience with the PC 25 in field operation under the specific operating conditions prevailing in Europe. The work packages included heat-controlled operation, examination of plant behavior with varying gas properties and measurement of emissions under dynamic load conditions. The project received EU funding under the JOULE programme.

  18. Implications of the modelling of stratified hot water storage tanks in the simulation of CHP plants

    Energy Technology Data Exchange (ETDEWEB)

    Campos Celador, A., E-mail: alvaro.campos@ehu.es [ENEDI Research Group-University of the Basque Country, Departamento de Maquinas y Motores Termicos, E.T.S.I. de Bilbao Alameda de Urquijo, s/n 48013 Bilbao, Bizkaia (Spain); Odriozola, M.; Sala, J.M. [ENEDI Research Group-University of the Basque Country, Departamento de Maquinas y Motores Termicos, E.T.S.I. de Bilbao Alameda de Urquijo, s/n 48013 Bilbao, Bizkaia (Spain)

    2011-08-15

    Highlights: {yields} Three different modelling approaches for simulation of hot water tanks are presented. {yields} The three models are simulated within a residential cogeneration plant. {yields} Small differences in the results are found by an energy and exergy analysis. {yields} Big differences between the results are found by an advanced exergy analysis. {yields} Results on the feasibility study are explained by the advanced exergy analysis. - Abstract: This paper considers the effect that different hot water storage tank modelling approaches have on the global simulation of residential CHP plants as well as their impact on their economic feasibility. While a simplified assessment of the heat storage is usually considered in the feasibility studies of CHP plants in buildings, this paper deals with three different levels of modelling of the hot water tank: actual stratified model, ideal stratified model and fully mixed model. These three approaches are presented and comparatively evaluated under the same case of study, a cogeneration plant with thermal storage meeting the loads of an urbanisation located in the Bilbao metropolitan area (Spain). The case of study is simulated by TRNSYS for each one of the three modelling cases and the so obtained annual results are analysed from both a First and Second-Law-based viewpoint. While the global energy and exergy efficiencies of the plant for the three modelling cases agree quite well, important differences are found between the economic results of the feasibility study. These results can be predicted by means of an advanced exergy analysis of the storage tank considering the endogenous and exogenous exergy destruction terms caused by the hot water storage tank.

  19. Energie-Cites opinion on the directive project of CHP. To meet urban energy requirements with optimal energy efficiency and production closer to residents; Avis d'Energie-Cites sur le project de directive cogeneration. Satisfaire les besoins energetiques urbains avec la meilleure efficacite energetique et une production plus proche des habitants

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2003-01-01

    The Directive on ''the promotion of cogeneration based on a useful heat demand in the internal energy market'' should be adopted very soon. The initial aim of the Directive is to strengthen existing measures to promote CHP in line with the Community target of doubling the share of CHP in EU electricity generation from 9% in 1994 to 18% by 2010. But no target has been mentioned. Energie-Cites states, in this document, its opinion of this draft proposal. Cogeneration is a well-tried and proven technology which has achieved tangible results and is one of the more efficient ways for the EU to fulfill the commitments it made under the Kyoto Protocol. (A.L.B.)

  20. Symposium on hydrogen technology and fuel cells - opportunities for the economy; Symposium Wassertechnologie und Brennstoffzellen - Chancen fuer die Wirtschaft

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2002-07-01

    This volume contains 17 contributions on fuel cell technology and on the infrastructure required for hydrogen production and supply, in the form of abstracts and short reports. [German] Dieser Band enthaelt 17 Beitraege zum Themenkreis Brennstoffzellentechnologie und die dazu erforderliche Infrastruktur fuer die Wasserstofferzeugung und -versorgung in Form von Kurzfassungen und Vortragsfolien.

  1. Another 25 Years of AIED? Challenges and Opportunities for Intelligent Educational Technologies of the Future

    Science.gov (United States)

    Pinkwart, Niels

    2016-01-01

    This paper attempts an analysis of some current trends and future developments in computer science, education, and educational technology. Based on these trends, two possible future predictions of AIED are presented in the form of a utopian vision and a dystopian vision. A comparison of these two visions leads to seven challenges that AIED might…

  2. High-affinity binding of Chp1 chromodomain to K9 methylated histone H3 is required to establish centromeric heterochromatin.

    Science.gov (United States)

    Schalch, Thomas; Job, Godwin; Noffsinger, Victoria J; Shanker, Sreenath; Kuscu, Canan; Joshua-Tor, Leemor; Partridge, Janet F

    2009-04-10

    In fission yeast, assembly of centromeric heterochromatin requires the RITS complex, which consists of Ago1, Tas3, Chp1, and siRNAs derived from centromeric repeats. Recruitment of RITS to centromeres has been proposed to depend on siRNA-dependent targeting of Ago1 to centromeric sequences. Previously, we demonstrated that methylated lysine 9 of histone H3 (H3K9me) acts upstream of siRNAs during heterochromatin establishment. Our crystal structure of Chp1's chromodomain in complex with a trimethylated lysine 9 H3 peptide reveals extensive sites of contact that contribute to Chp1's high-affinity binding. We found that this high-affinity binding is critical for the efficient establishment of centromeric heterochromatin, but preassembled heterochromatin can be maintained when Chp1's affinity for H3K9me is greatly reduced.

  3. Opportunity Design

    DEFF Research Database (Denmark)

    Løwe Nielsen, Suna; Lassen, Astrid Heidemann; Nielsen, Louise Møller

    2013-01-01

    design”. The framework explains how opportunities intentionally and pro-actively can be designed from methods and processes of moving-in and moving-out. An illustrative case of opportunity design within the area of sustainable energy and electric cars is presented to link the theoretical discussion...

  4. The Role of Proteomics in the Diagnosis and Treatment of Women's Cancers: Current Trends in Technology and Future Opportunities

    Directory of Open Access Journals (Sweden)

    Eun-Kyoung Yim Breuer

    2011-01-01

    Full Text Available Technological and scientific innovations over the last decade have greatly contributed to improved diagnostics, predictive models, and prognosis among cancers affecting women. In fact, an explosion of information in these areas has almost assured future generations that outcomes in cancer will continue to improve. Herein we discuss the current status of breast, cervical, and ovarian cancers as it relates to screening, disease diagnosis, and treatment options. Among the differences in these cancers, it is striking that breast cancer has multiple predictive tests based upon tumor biomarkers and sophisticated, individualized options for prescription therapeutics while ovarian cancer lacks these tools. In addition, cervical cancer leads the way in innovative, cancer-preventative vaccines and multiple screening options to prevent disease progression. For each of these malignancies, emerging proteomic technologies based upon mass spectrometry, stable isotope labeling with amino acids, high-throughput ELISA, tissue or protein microarray techniques, and click chemistry in the pursuit of activity-based profiling can pioneer the next generation of discovery. We will discuss six of the latest techniques to understand proteomics in cancer and highlight research utilizing these techniques with the goal of improvement in the management of women's cancers.

  5. National Database for Autism Research (NDAR): Big Data Opportunities for Health Services Research and Health Technology Assessment.

    Science.gov (United States)

    Payakachat, Nalin; Tilford, J Mick; Ungar, Wendy J

    2016-02-01

    The National Database for Autism Research (NDAR) is a US National Institutes of Health (NIH)-funded research data repository created by integrating heterogeneous datasets through data sharing agreements between autism researchers and the NIH. To date, NDAR is considered the largest neuroscience and genomic data repository for autism research. In addition to biomedical data, NDAR contains a large collection of clinical and behavioral assessments and health outcomes from novel interventions. Importantly, NDAR has a global unique patient identifier that can be linked to aggregated individual-level data for hypothesis generation and testing, and for replicating research findings. As such, NDAR promotes collaboration and maximizes public investment in the original data collection. As screening and diagnostic technologies as well as interventions for children with autism are expensive, health services research (HSR) and health technology assessment (HTA) are needed to generate more evidence to facilitate implementation when warranted. This article describes NDAR and explains its value to health services researchers and decision scientists interested in autism and other mental health conditions. We provide a description of the scope and structure of NDAR and illustrate how data are likely to grow over time and become available for HSR and HTA.

  6. Building Opportunity Out of Science and Technology (BOOST): Enhancing Capacity for Hydrologic Science in Morocco and Egypt

    Science.gov (United States)

    Fryar, A. E.; Milewski, A.; Sultan, M.; Benaabidate, L.; Laftouhi, N.; Fekri, A.; Cherif, O.; Elewa, H.; Garamoon, H.; Ward, J. W.; Hanley, C.

    2013-12-01

    Across North Africa and the Middle East, absolute water scarcity and impaired water quality pose significant challenges. Another critical issue is suitable employment opportunities for university graduates. With the support of the U.S. State Department, we developed a 2-year pilot project (BOOST) to address both problems by working with graduate students in hydrologic sciences on developing 'hard' (technical) and 'soft' (professional) skills. Two cohorts of six students each were selected from Morocco and Egypt. The Moroccans were geology students from three universities, whereas the Egyptians included four geologists, a soil scientist, and a physical geographer from four universities. English proficiency was emphasized and at least half the participants in each cohort were female. Training began during spring 2012 with an Internet-based course introducing GIS, remote sensing, and hydrologic modeling. Students traveled to the USA in summer 2012 for a week of field training activities and a week-long, 'hands-on' workshop as a capstone to the long-distance course. Field activities in the Concho River watershed of west Texas included mapping of hydraulic heads in an unconfined aquifer, measurements of stream flow and infiltration rates, and analyses of water-quality parameters (temperature, pH, electrical conductivity, dissolved oxygen, and alkalinity). In a second Internet-based course during fall 2012, students developed resumes and LinkedIn pages, gave written and oral summaries of webinars (on career options for geoscientists and hydrologic topics), and completed a module on research ethics. The capstone activity for the second course was presentation of posters on research topics at the 2012 Geological Society of America Annual Meeting. During winter-spring 2013, students participated in outreach activities such as training other students at their institutions. The group met for final debriefing and discussions with stakeholders (secondary-school educators and

  7. Technology, Pedagogy, and Epistemology: Opportunities and Challenges of Using Computer Modeling and Simulation Tools in Elementary Science Methods

    Science.gov (United States)

    Schwarz, Christina V.; Meyer, Jason; Sharma, Ajay

    2007-04-01

    This study infused computer modeling and simulation tools in a 1-semester undergraduate elementary science methods course to advance preservice teachers’ understandings of computer software use in science teaching and to help them learn important aspects of pedagogy and epistemology. Preservice teachers used computer modeling and simulation tools within their own science investigations; discussed general technology issues; and explored, evaluated, and taught their peers about a particular modeling tool. Preservice teachers expanded their vision of the software available and the role that software can play in science teaching, but desired fun, easy-to-use software with scientifically accurate information within a clear, familiar learning task. Such conflict provided a fruitful platform for discussion and for potentially advancing preservice teachers’ pedagogical and epistemological understandings.

  8. Use of integrated technology in team sports: a review of opportunities, challenges, and future directions for athletes.

    Science.gov (United States)

    Dellaserra, Carla L; Gao, Yong; Ransdell, Lynda

    2014-02-01

    Integrated technology (IT), which includes accelerometers, global positioning systems (GPSs), and heart rate monitors, has been used frequently in public health. More recently, IT data have been used in sports settings to assess training and performance demands. However, the impact of IT in sports settings is yet to be evaluated, particularly in field-based team sports. This narrative-qualitative review provides an overview of the emerging impact of IT in sports settings. Twenty electronic databases (e.g., Medline, SPORTdiscus, and ScienceDirect), print publications (e.g., Signal Processing Magazine and Catapult Innovations news releases), and internet resources were searched using different combinations of keywords as follows: accelerometers, heart rate monitors, GPS, sport training, and field-based sports for relevant articles published from 1990 to the present. A total of 114 publications were identified, and 39 that examined a field-based team sport using a form of IT were analyzed. The articles chosen for analysis examined a field-based team sport using a form of IT. The uses of IT can be divided into 4 categories: (a) quantifying movement patterns (n = 22), (b) assessing the differences between demands of training and competition (n = 12), (c) measuring physiological and metabolic responses (n = 16), and (d) determining a valid definition for velocity and a sprint effort (n = 8). Most studies used elite adult male athletes as participants and analyzed the sports of Australian Rules football, field hockey, cricket, and soccer, with sample sizes between 5 and 20 participants. The limitations of IT in a sports setting include scalability issues, cost, and the inability to receive signals within indoor environments. Integrated technology can contribute to significant improvements in the preparation, training, and recovery aspects of field-based team sports. Future research should focus on using IT with female athlete populations and developing resources to use IT

  9. The CckA-ChpT-CtrA phosphorelay system is regulated by quorum sensing and controls flagellar motility in the marine sponge symbiont Ruegeria sp. KLH11.

    Directory of Open Access Journals (Sweden)

    Jindong Zan

    Full Text Available Bacteria respond to their environment via signal transduction pathways, often two-component type systems that function through phosphotransfer to control expression of specific genes. Phosphorelays are derived from two-component systems but are comprised of additional components. The essential cckA-chpT-ctrA phosphorelay in Caulobacter crescentus has been well studied and is important in orchestrating the cell cycle, polar development and flagellar biogenesis. Although cckA, chpT and ctrA homologues are widespread among the Alphaproteobacteria, relatively few is known about their function in the large and ecologically significant Roseobacter clade of the Rhodobacterales. In this study the cckA-chpT-ctrA system of the marine sponge symbiont Ruegeria sp. KLH11 was investigated. Our results reveal that the cckA, chpT and ctrA genes positively control flagellar biosynthesis. In contrast to C. crescentus, the cckA, chpT and ctrA genes in Ruegeria sp. KLH11 are non-essential and do not affect bacterial growth. Gene fusion and transcript analyses provide evidence for ctrA autoregulation and the control of motility-related genes. In KLH11, flagellar motility is controlled by the SsaRI system and acylhomoserine lactone (AHL quorum sensing. SsaR and long chain AHLs are required for cckA, chpT and ctrA gene expression, providing a regulatory link between flagellar locomotion and population density in KLH11.

  10. Experience of Implementing a Distributed Control System for Thermal and Mechanical and Electrical Equipment at the South-West CHP

    Energy Technology Data Exchange (ETDEWEB)

    Babkin, K. V., E-mail: babkin@uztec.ru; Tsvetkov, M. S.; Kostyuk, R. I.; Chugin, A. V. [SC “South-West CHP” (Russian Federation); Bilenko, V. A.; Molchanov, K. A.; Fedunov, V. V. [JSC “Interautomatika” (Russian Federation)

    2015-01-15

    Results of implementing an SPPA-T3000-based unified distributed control system for thermal and mechanical and electrical equipment at the South-West CHP are discussed. Hardware solutions for integration with local control systems, control of electrical equipment in compliance with the standards IEC 61850, Modbus RTU, and communication between the plant control system and the System Operator of the Unified Power System are described.

  11. Scientific and technological capabilities in health-related areas: opportunities, challenges, and interactions with the industrial sector.

    Science.gov (United States)

    Vargas, Marco Antonio; Britto, Jorge

    2016-11-03

    Characterization of the scientific and technological infrastructure in health and its interactions with the industrial sector provides key elements for understanding the dynamics of innovation in health. This study conducts an exploratory analysis of the potentialities and limitations associated with scientific and technological capabilities in the health area in Brazil and the different links between the scientific and industrial sectors in health. The analysis points to important growth in internationally indexed research output, especially in certain areas such as pharmaceutics, public health, genetics, morphology, physiology, and microbiology. There has also been important growth in research groups that interact with the industrial sector in selected areas of health. The study highlights the importance of building more solid and permanent bridges between companies, research institutions, and the health system, linking the knowledge developed in research institutions to the dynamics of the industrial sector in health. Resumo: A caracterização da infraestrutura científica e tecnológica na área da saúde e das suas formas de articulação com a base produtiva representam elementos centrais na compreensão da dinâmica de inovação em saúde. Este estudo faz uma análise exploratória sobre as potencialidades e limitações associadas às capacitações científicas e tecnológicas na área da saúde no Brasil e as formas de articulação entre a base científica e a base produtiva em saúde. A análise aponta para o crescimento expressivo da produção bibliográfica com circulação internacional no campo da saúde, particularmente em determinadas áreas como farmácia, saúde coletiva, genética, morfologia, fisiologia e microbiologia. Além disso, observa-se um crescimento expressivo dos grupos de pesquisa com relacionamentos com o setor produtivo em áreas selecionadas da saúde. Destaca-se a importância da construção de pontes mais sólidas e

  12. The development of pedagogical content knowledge in science teachers: New opportunities through technology-mediated reflection and peer-exchange

    Science.gov (United States)

    Madeira, M. Cheryl-Ann

    This design-based research study investigates the development of pedagogical content knowledge among nine teacher-participants (N = 9) in three design phases. PCK is a particular type of teacher knowledge that addresses not only the teacher's understanding of the content to be instructed, but also ways of how to teach that content effectively. This knowledge has been well documented over several decades, and is seen as central to teacher expertise. However, its actual development has been difficult for researchers to investigate. This study offers a detailed perspective on how teachers developed PCK with their engagement in lesson planning and enactment of a project-based technology-enhanced lesson. The study includes two specific interventions designed to enhance teachers' development of PCK: (1) scaffolded reflection that occurs throughout the practices; and (2) peer-exchange of lesson plans, enactment ideas, and completed reflections. The findings demonstrate that teachers improve their planning and enactment of project-based technology-enhanced lessons with scaffolded reflection and peer exchange. Positive correlations were seen between teachers' engagement in the reflections and the quality of their lesson planning. Teachers who participated more deeply in the scaffolded reflections were able to understand how their lesson plans and enactment patterns fostered student understanding of relevant science concepts. Positive correlations were also seen between community influence and teacher lesson plans and enactment. Additionally, positive correlations were confirmed between teachers' level of participation in the peer exchange activities and the quality of their lesson planning and enactments. Teachers who contributed more deeply within the online and face-to-face peer community meetings benefited from the different perspectives of their peers about student learning and the best ways to succeed with project-based instruction. This study allowed some insight into

  13. Enabling renewable energy and energy efficiency technologies. Opportunities in Eastern Europe, Caucasus, Central Asia, Southern and Eastern Mediterranean

    Energy Technology Data Exchange (ETDEWEB)

    Barnsley, Ingrid; Blank, Amanda; Brown, Adam

    2015-06-01

    The increased deployment of renewable energy and energy efficiency technologies (RE&EET) in the South Eastern Mediterranean (SEMED) region and in the Early Transition Countries (ETC) could bring a host of benefits, including enhanced energy security, increased national revenues and environmental gains. A new IEA Insights paper considers policy options for supporting the deployment of RE&EET, as well as the surrounding factors that can enable – or indeed impede – the successful implementation of such support policies in both regions. Drawing on a wealth of IEA analyses and policy experiences globally, the paper: provides a summary of the energy profiles of the ETC and SEMED regions; highlights overarching, ''enabling'' factors that can help to set the necessary foundations for the successful implementation of policy to support RE&EET deployment; analyses policy options for both RE and EE, drawing on practical examples and highlighting indicative policies that correspond with varying levels of market maturity; and provides a checklist for assessing the level of supportiveness of national policy frameworks for RE&EET. The paper concludes by pointing to the significant potential for energy efficiency and renewable energy gains in both regions.

  14. Towards possible opportunities in nuclear materials science and technology at an X-ray free electron laser research facility

    Science.gov (United States)

    Froideval, A.; Badillo, A.; Bertsch, J.; Churakov, S.; Dähn, R.; Degueldre, C.; Lind, T.; Paladino, D.; Patterson, B. D.

    2011-09-01

    Spectroscopy and imaging of condensed matter have benefited greatly from the availability of intense X-ray beams from synchrotron sources, both in terms of spatial resolution and of elemental specificity. The advent of the X-ray free electron laser (X-ray FEL) provides the additional features of ultra-short pulses and high transverse coherence, which greatly expand possibilities to study dynamic processes and to image non-crystalline materials. The proposed SwissFEL facility at the Paul Scherrer Institute is one of at present four X-ray FEL projects worldwide and is scheduled to go into operation in the year 2017. This article describes a selection of problems in nuclear materials science and technology that would directly benefit from this and similar X-ray FEL sources. X-ray FEL-based experiments are proposed to be conducted on nuclear energy-related materials using single-shot X-ray spectroscopy, coherent X-ray scattering and/or X-ray photon correlation spectroscopy in order to address relevant scientific questions such as the evolution in time of the irradiation-induced damage processes, the deformation processes in nuclear materials, the ion diffusion processes in the barrier systems of geological repositories, the boiling heat transfer in nuclear reactors, as well as the structural characterization of graphite dust in advanced nuclear reactors and clay colloid aggregates in the groundwater near a radioactive waste repository.

  15. Technology-aided leisure and communication opportunities for two post-coma persons emerged from a minimally conscious state and affected by multiple disabilities.

    Science.gov (United States)

    Lancioni, Giulio E; O'Reilly, Mark F; Singh, Nirbhay N; Sigafoos, Jeff; Buonocunto, Francesca; Sacco, Valentina; Navarro, Jorge; Lanzilotti, Crocifissa; De Tommaso, Marina; Megna, Marisa; Oliva, Doretta

    2013-02-01

    This study assessed technology-aided programs for helping two post-coma persons, who had emerged from a minimally conscious state and were affected by multiple disabilities, to (a) engage with leisure stimuli and request caregiver's procedures, (b) send out and listen to text messages for communication with distant partners, and (c) combine leisure engagement and procedure requests with text messaging within the same sessions. The program for leisure engagement and procedure requests relied on the use of a portable computer with commercial software, and a microswitch for the participants' response. The program for text messaging communication involved the use of a portable computer, a GSM modem, a microswitch for the participants' response, and specifically developed software. Results indicated that the participants were successful at each of the three stages of the study, thus providing relevant evidence concerning performance achievements only minimally documented. The implications of the findings in terms of technology and practical opportunities for post-coma persons with multiple disabilities are discussed.

  16. Experimental investigation of domestic micro-CHP based on the gas boiler fitted with ORC module

    Directory of Open Access Journals (Sweden)

    Wajs Jan

    2016-09-01

    Full Text Available The results of investigations conducted on the prototype of vapour driven micro-CHP unit integrated with a gas boiler are presented. The system enables cogeneration of heat and electric energy to cover the energy demand of a household. The idea of such system is to produce electricity for own demand or for selling it to the electric grid – in such situation the system user will became the prosumer. A typical commercial gas boiler, additionally equipped with an organic Rankine cycle (ORC module based on environmentally acceptable working fluid can be regarded as future generation unit. In the paper the prototype of innovative domestic cogenerative ORC system, consisting of a conventional gas boiler and a small size axial vapour microturbines (in-house designed for ORC and the commercially available for Rankine cycle (RC, evaporator and condenser were scrutinised. In the course of study the fluid working temperatures, rates of heat, electricity generation and efficiency of the whole system were obtained. The tested system could produce electricity in the amount of 1 kWe. Some preliminary tests were started with water as working fluid and the results for that case are also presented. The investigations showed that domestic gas boiler was able to provide the saturated/superheated ethanol vapour (in the ORC system and steam (in the RC system as working fluids.

  17. Experimental investigation of domestic micro-CHP based on the gas boiler fitted with ORC module

    Science.gov (United States)

    Wajs, Jan; Mikielewicz, Dariusz; Bajor, Michał; Kneba, Zbigniew

    2016-09-01

    The results of investigations conducted on the prototype of vapour driven micro-CHP unit integrated with a gas boiler are presented. The system enables cogeneration of heat and electric energy to cover the energy demand of a household. The idea of such system is to produce electricity for own demand or for selling it to the electric grid - in such situation the system user will became the prosumer. A typical commercial gas boiler, additionally equipped with an organic Rankine cycle (ORC) module based on environmentally acceptable working fluid can be regarded as future generation unit. In the paper the prototype of innovative domestic cogenerative ORC system, consisting of a conventional gas boiler and a small size axial vapour microturbines (in-house designed for ORC and the commercially available for Rankine cycle (RC)), evaporator and condenser were scrutinised. In the course of study the fluid working temperatures, rates of heat, electricity generation and efficiency of the whole system were obtained. The tested system could produce electricity in the amount of 1 kWe. Some preliminary tests were started with water as working fluid and the results for that case are also presented. The investigations showed that domestic gas boiler was able to provide the saturated/superheated ethanol vapour (in the ORC system) and steam (in the RC system) as working fluids.

  18. CHP HIGHER EDUCATION, SCHOLARSHIPS AND DEMAND ABROAD ARE POLITICS (1942-1947

    Directory of Open Access Journals (Sweden)

    Suat ZEYREK

    2016-04-01

    Full Text Available Turkey was followed by a very slow development in the course of the republic’s first year in higher education.By 1955, there are only two universities in the three cities in Turkey.Although the new university will be declared opened by Ismet Inonu’s mouth several times it was not possible for various reasons.Turkey’s economic situation, the shortage of trained personel and it has been hampered by severe conditions of World War II.But even more important excuses should have prevented the spread of higher education in Turkey. This article will be presented in the light of the real causes of the problem of archival sources mentioned above.Period ruling party, the CHP’s higher education policy followed in scholarships and dormitories were investigated.CHP likely to promote higher education in the first primary education spread to the base and thus wants to create a higher demand.For this reason, it is necessary first of all to build infrastructure for higher education institutions and rules.Coming from big cities in different regions of Anatolia youth to take education to all students experience difficulties and inclusive, egalitarian policies were followed.

  19. Microbiological Contamination at Workplaces in a Combined Heat and Power (CHP) Station Processing Plant Biomass

    Science.gov (United States)

    Szulc, Justyna; Otlewska, Anna; Okrasa, Małgorzata; Majchrzycka, Katarzyna; Sulyok, Michael; Gutarowska, Beata

    2017-01-01

    The aim of the study was to evaluate the microbial contamination at a plant biomass processing thermal power station (CHP). We found 2.42 × 103 CFU/m3 of bacteria and 1.37 × 104 CFU/m3 of fungi in the air; 2.30 × 107 CFU/g of bacteria and 4.46 × 105 CFU/g of fungi in the biomass; and 1.61 × 102 CFU/cm2 bacteria and 2.39 × 101 CFU/cm2 fungi in filtering facepiece respirators (FFRs). Using culture methods, we found 8 genera of mesophilic bacteria and 7 of fungi in the air; 10 genera each of bacteria and fungi in the biomass; and 2 and 5, respectively, on the FFRs. Metagenomic analysis (Illumina MiSeq) revealed the presence of 46 bacterial and 5 fungal genera on the FFRs, including potential pathogens Candida tropicalis, Escherichia coli, Prevotella sp., Aspergillus sp., Penicillium sp.). The ability of microorganisms to create a biofilm on the FFRs was confirmed using scanning electron microscopy (SEM). We also identified secondary metabolites in the biomass and FFRs, including fumigaclavines, quinocitrinines, sterigmatocistin, and 3-nitropropionic acid, which may be toxic to humans. Due to the presence of potential pathogens and mycotoxins, the level of microbiological contamination at workplaces in CHPs should be monitored. PMID:28117709

  20. Microbiological Contamination at Workplaces in a Combined Heat and Power (CHP Station Processing Plant Biomass

    Directory of Open Access Journals (Sweden)

    Justyna Szulc

    2017-01-01

    Full Text Available The aim of the study was to evaluate the microbial contamination at a plant biomass processing thermal power station (CHP. We found 2.42 × 103 CFU/m3 of bacteria and 1.37 × 104 CFU/m3 of fungi in the air; 2.30 × 107 CFU/g of bacteria and 4.46 × 105 CFU/g of fungi in the biomass; and 1.61 × 102 CFU/cm2 bacteria and 2.39 × 101 CFU/cm2 fungi in filtering facepiece respirators (FFRs. Using culture methods, we found 8 genera of mesophilic bacteria and 7 of fungi in the air; 10 genera each of bacteria and fungi in the biomass; and 2 and 5, respectively, on the FFRs. Metagenomic analysis (Illumina MiSeq revealed the presence of 46 bacterial and 5 fungal genera on the FFRs, including potential pathogens Candida tropicalis, Escherichia coli, Prevotella sp., Aspergillus sp., Penicillium sp.. The ability of microorganisms to create a biofilm on the FFRs was confirmed using scanning electron microscopy (SEM. We also identified secondary metabolites in the biomass and FFRs, including fumigaclavines, quinocitrinines, sterigmatocistin, and 3-nitropropionic acid, which may be toxic to humans. Due to the presence of potential pathogens and mycotoxins, the level of microbiological contamination at workplaces in CHPs should be monitored.

  1. Performance Assessment of a Desiccant Cooling System in a CHP Application with an IC Engine

    Energy Technology Data Exchange (ETDEWEB)

    Jalalzadeh-Azar, A. A.; Slayzak, S.; Judkoff, R.; Schaffhauser, T.; DeBlasio, R.

    2005-04-01

    Performance of a desiccant cooling system was evaluated in the context of combined heat and power (CHP). The baseline system incorporated a desiccant dehumidifier, a heat exchanger, an indirect evaporative cooler, and a direct evaporative cooler. The desiccant unit was regenerated through heat recovery from a gas-fired reciprocating internal combustion engine. The system offered sufficient sensible and latent cooling capacities for a wide range of climatic conditions, while allowing influx of outside air in excess of what is typically required for commercial buildings. Energy and water efficiencies of the desiccant cooling system were also evaluated and compared with those of a conventional system. The results of parametric assessments revealed the importance of using a heat exchanger for concurrent desiccant post cooling and regeneration air preheating. These functions resulted in enhancement of both the cooling performance and the thermal efficiency, which are essential for fuel utilization improvement. Two approaches for mixing of the return air and outside air were examined, and their impact on the system cooling performance and thermal efficiency was demonstrated. The scope of the parametric analyses also encompassed the impact of improving the indirect evaporative cooling effectiveness on the overall cooling system performance.

  2. Generic Combined Heat and Power (CHP Model for the Concept Phase of Energy Planning Process

    Directory of Open Access Journals (Sweden)

    Satya Gopisetty

    2016-12-01

    Full Text Available Micro gas turbines (MGTs are regarded as combined heat and power (CHP units which offer high fuel utilization and low emissions. They are applied in decentralized energy generation. To facilitate the planning process of energy systems, namely in the context of the increasing application of optimization techniques, there is a need for easy-to-parametrize component models with sufficient accuracy which allow a fast computation. In this paper, a model is proposed where the non-linear part load characteristics of the MGT are linearized by means of physical insight of the working principles of turbomachinery. Further, it is shown that the model can be parametrized by the data usually available in spec sheets. With this model a uniform description of MGTs from several manufacturers covering an electrical power range from 30 k W to 333 k W can be obtained. The MGT model was implemented by means of Modelica/Dymola. The resulting MGT system model, comprising further heat exchangers and hydraulic components, was validated using the experimental data of a 65 k W MGT from a trigeneration energy system.

  3. Scientific challenges and opportunities in developing novel vaccines for the emerging and developing markets: New Technologies in Emerging Markets, October 16th-18th 2012, World Vaccine Congress, Lyon.

    Science.gov (United States)

    Kochhar, Sonali

    2013-04-01

    Vaccines have had a major role in enhancing the quality of life and increasing life expectancy. Despite these successes and the development of new vaccine technologies, there remain multiple infectious diseases including AIDS, malaria and tuberculosis that require effective prophylactic vaccines. New and traditional technologies have a role in the development and delivery of the new vaccine candidates. The scientific challenges, opportunities and funding models for developing vaccines for low resource settings are highlighted here.

  4. Techno-economic analysis of CHP system supplied by waste forest biomass.

    Science.gov (United States)

    Borsukiewicz-Gozdur, A; Klonowicz, P; Król, D; Wiśniewski, S; Zwarycz-Makles, K

    2015-08-01

    Poland, as for Europe, is a country with an average forest cover of approximately 30%. In these forests, more than 37M m3 of wood, mostly coniferous (over 80%), is harvested per year. In 2012, 4.2M m3 of sawn timber was produced (sawn timber without factory lumber). At the same time, in Poland there are over 8000 sawmills, whereas only about 700 of them saw over 90% of the harvested timber. So much fragmentation is a major cause of low sawmills innovation, particularly of those small ones. However, in recent years, a trend of development in this sector is noticeable, and it is through rationalisation of material and energy economy. One of the methods to increase the technical and economic effectiveness of enterprises involved in woodworking is to build in the combined heat and power system (CHP) plant with the ORC system into the existing infrastructure, which will be matched to the needs of the company. This article presents an analysis of the profitability of the investment based on the example of a medium-sized company sawing approximately 50,000 m3 of timber per year, and the economic analysis was performed for prices and costs valid in Poland. The analysis made for the 1650 kW(el) organic Rankine cycle (ORC) system, has resulted in a profitability index PI = 1.3, on the assumptions that the ORC system operates for 6000 h y(-1), will be purchased at the price of 4500 € kW(el)(-1) and at the price of electricity sales of 130 € MWh(-1).

  5. Optimal design and operation of a syngas-fuelled SOFC micro CHP system for residential applications in different climate zones in China

    DEFF Research Database (Denmark)

    Yang, Wenyuan; Zhao, Yingru; Liso, Vincenzo

    2014-01-01

    to determine the optimal match between the energy demand of the household for different climates across China and the energy supply of the micro-CHP during the whole year. Moreover, criteria for sizing the system components of the micro-CHP are specifically addressed. The developed methodology can be applied...... under difference climate conditions to ensure that it is well matched with the local heat-to-power ratio. The aim of this study is to investigate the optimal design and operation of a syngas-fuelled SOFC micro-CHP system for small households located in five different climate zones in China. The ability...... of the micro-CHP to cover the heat and electricity demand of a 70 m2 single-family apartment with an average number of occupants of 3 is evaluated. A detailed model of the micro-CHP unit coupled with a hot water storage tank and an auxiliary boiler is developed. System design trade-offs are discussed...

  6. 我国技术市场发展的机遇、挑战和战略选择研究%The Research of Opportunities,Challenges and Strategic Choice of the Technology Market Development

    Institute of Scientific and Technical Information of China (English)

    傅正华; 张玢; 林耕; 李明亮

    2016-01-01

    我国技术市场经过30多年的发展,已经进入新的发展机遇期,新科技革命、经济转型、创新型国家建设以及加快全面建成小康社会的战略目标都为技术市场的发展带来了难得的机遇;与此同时,伴随机遇而来的是挑战,现有管理体制问题、技术市场发展的机制性缺陷、技术市场发展的观念性障碍以及国际技术转移等都给技术市场发展提出了新挑战。面对机遇与挑战,国家需要作出战略性的抉择,通过促进技术交易产业平稳健康发展、进一步活跃技术交易、建立和完善国家技术转移体系和技术市场法律体系、建立健全技术市场管理和组织等措施加快技术市场的发展。%Having developed 30 years,Chinese technology market had entered into a new development opportunity.The new technological revolution,the economic transformation and the strategic goals of constructing an innovative country and speeding up to build a well -off all -round society have brought a rare opportunity for the development of Chinese technolo-gy market.At the same time,along with the opportunity are challenges,such as the existing problems of management sys-tem,institutional defects of the technology market development,the ideogenetic disorder of technology market development and international technology transfer,which have put forward new challenges to the development of technology market.Fa-cing the opportunities and challenges,the government needs to make a strategic decision,take measures such as promoting steady and healthy development of the technology trading industry,further activating technology trading,establishing and perfecting the system of the national technology transfer and technology market legal system,establishing and perfecting the technology market management and organization to speed up the development of the technology market.

  7. In-situ corrosion investigation at Masnedø CHP plant - a straw-fired power plant

    DEFF Research Database (Denmark)

    Montgomery, Melanie; Karlsson, Asger

    1999-01-01

    Various austenitic and ferritic steels were exposed on a water-cooled probe in the superheater area of a straw-fired CHP plant. The temperature of the probe ranged from 450-600°C and the period of exposure was 1400 hours. The rate of corrosion was assessed based on unattacked metal remaining....... The corrosion products and course of corrosion for the various steel types were investigated using light optical and scanning electron microscopy. The ferritic steels suffered from corrosion mainly via material loss. The austenitic steels suffered from predominantly selective corrosion which resulted...

  8. Seizing Opportunity

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    After the remarkable progress of the past five years, China has entered its new five-year plan period, starting from 2006, aiming to further its economic and social development. Though some are still talking about "China threat," many others consider the country's growth a huge opportunity. In an interview with People's Daily, Bill Fischer, former President of the Sino-European International Business School in Shanghai, comments on China's current development and also talks about problems the country fac...

  9. Wood for energy production. Technology - environment - economy

    Energy Technology Data Exchange (ETDEWEB)

    Serup, H.; Falster, H.; Gamborg, C. [and others

    1999-10-01

    `Wood for Energy Production`, 2nd edition, is a readily understood guide to the application of wood in the Danish energy supply. The first edition was named `Wood Chips for Energy Production`. It describes the wood fuel from forest to consumer and provides a concise introduction to technological, environmental, and financial matters concerning heating systems for farms, institutions, district heating plants, and CHP plants. The individual sections deal with both conventional, well known technology, as well as the most recent technological advances in the field of CHP production. The purpose of this publication is to reach the largest possible audiance, and it is designed so that the layman may find its background information of special relevance. `Wood for Energy Production` is also available in German and Danish. (au)

  10. Nanoethics: Challenges and Opportunities

    Science.gov (United States)

    Pompidou, Alain; Pompidou, Alain; Pompidou, Alain; Pompidou, Alain

    Nanoscience and its technological consequences constitute a relatively recent field of knowledge. Their rapid development around the world is characterised by an absence of specific norms and standards. Industrial applications, already promising, are not without risk, and this risk deserves to be fully and rigorously assessed. On the other hand, this vigilance and anticipation of risk does not need to deprive society as a whole of new opportunities, whether they be for developed countries and the emerging economies, or for less developed nations.

  11. Energy Analysis and Multi-Objective Optimization of an Internal Combustion Engine-Based CHP System for Heat Recovery

    Directory of Open Access Journals (Sweden)

    Abdolsaeid Ganjehkaviri

    2014-10-01

    Full Text Available A comprehensive thermodynamic study is conducted of a diesel based Combined Heat and Power (CHP system, based on a diesel engine and an Organic Rankine Cycle (ORC. Present research covers both energy and exergy analyses along with a multi-objective optimization. In order to determine the irreversibilities in each component of the CHP system and assess the system performance, a complete parametric study is performed to investigate the effects of major design parameters and operating conditions on the system’s performance. The main contribution of the current research study is to conduct both exergy and multi-objective optimization of a system using different working fluid for low-grade heat recovery. In order to conduct the evolutionary based optimization, two objective functions are considered in the optimization; namely the system exergy efficiency, and the total cost rate of the system, which is a combination of the cost associated with environmental impact and the purchase cost of each component. Therefore, in the optimization approach, the overall cycle exergy efficiency is maximized satisfying several constraints while the total cost rate of the system is minimized. To provide a better understanding of the system under study, the Pareto frontier is shown for multi-objective optimization and also an equation is derived to fit the optimized point. In addition, a closed form relationship between exergy efficiency and total cost rate is derived.

  12. European opportunities for fuel cell commercialisation

    Science.gov (United States)

    Gibbs, C. E.; Steel, M. C. F.

    1992-01-01

    The European electricity market is changing. This paper will look at the background to power generation in Europe and highlight the recent factors which have entered the market to promote change. The 1990s seem to offer great possibilities for fuel cell commercialisation. Awareness of environmental problems has never been greater and there is growing belief that fuel cell technology can contribute to solving some of these problems. Issues which have caused the power industry in Europe to re-think its methods of generation include: concern over increasing carbon dioxide emissions and their contribution to the greenhouse effect; increasing SO x and NO x emissions and the damage cause by acid rain; the possibility of adverse effects on health caused by high voltage transmission lines; environmental restrictions to the expansion of hydroelectric schemes; public disenchantment with nuclear power following the Chernobyl accident; avoidance of dependence on imported oil following the Gulf crisis and a desire for fuel flexibility. All these factors are hastening the search for clean, efficient, modular power generators which can be easily sited close to the electricity consumer and operated using a variety of fuels. It is not only the power industry which is changing. A tightening of the legislation concerning emissions from cars is encouraging European auto companies to develop electric vehicles, some of which may be powered by fuel cells. Political changes, such as the opening up of Eastern Europe will also expand the market for low-emission, efficient power plants as attempts are made to develop and clean up that region. Many Europeans organisations are re-awakening their interest, or strengthening their activities, in the area of fuel cells because of the increasing opportunities offered by the European market. While some companies have chosen to buy, test and demonstrate Japanese or American fuel cell stacks with the aim of gaining operational experience and

  13. Taking the gene-editing revolution to the next level: An interdisciplinary view on challenges, threats and opportunities of CRISPR-Cas9 and related technologies (in preparation)

    DEFF Research Database (Denmark)

    Nordberg, Ana; Minssen, Timo; Holm, Sune Hannibal

    2017-01-01

    Gene-editing technologies, such as CRIPSR-Cas9 technology, hold promises for the advancement of science and technology. These foundational technologies enable to precisely modify genetic structures of living organisms. Potential applications include both plant, animal and human genetic interventi...

  14. The Opportunities and Challenges Brought about by RFID(Radio Frequency Identification Devices) Technology to ILAS(Integrated Library Automation System)%RFID技术带给ILAS的机遇与挑战

    Institute of Scientific and Technical Information of China (English)

    廖佳杰; 张丽; 王惠芳

    2015-01-01

    面对RFID技术带来的机遇与挑战,图书馆自动化集成系统(ILAS)开发商应主动实施基于RFID技术的应用开发,不能只是简单地应用RFID标签来取代条形码,而应在RFID技术基础上,创建全新的应用理念和业务模式,赋予ILAS智能化的内涵,充分利用RFID技术为图书馆信息化建设提供一个全新的手段。介绍了ILAS与RFID系统的应用现状,阐述了RFID技术带给ILAS的机遇与挑战。%Facing the opportunities and challenges brought about by the RFID technology, ILAS developers should actively implement the application development based on RFID technology, shouldn’t simply use RFID tags to replace the barcode, and should create a bran-new application concept and service mode based on RFID technology, give the intelligent connotation of ILAS, and provide a totally new method for library’s information construction by making full use of the RFID technology. This paper introduces the application status of ILAS and RFID system, and expounds the opportunities and challenges brought about by RFID technology to ILAS.

  15. 图书馆如何应对信息技术发展带来的机会与挑战%Discussion on How Libraries Confront Opportunities and Challenges Brought by Information Technologies

    Institute of Scientific and Technical Information of China (English)

    杨楠; 秦小燕; 沈蓉蓉; 高雪青

    2012-01-01

    Rapid development of new technologies brings great development opportunities and unorecedented challenges to libraries. Librarians shuould get advantages and avoid disadvantages, provide readers convenience library services with new technologies, adjust the attitude to keep up with the pace of information technology development, coordinate the relationship between speed and quality, and confront challenges brought by information technologies.%新技术的发展给图书馆带来了极好的发展机遇和前所未有的冲击。图书馆人应趋利避害,让读者充分享受新技术带来的便利服务,调整心态跟上技术发展的步伐,协调好速度与质量的关系,积极应对信息技术发展带来的挑战。

  16. Development of HT-PEMFC components and stack for CHP unit

    Energy Technology Data Exchange (ETDEWEB)

    Jensen, Jens Oluf; Li, Q. (Technical Univ. of Denmark, Dept. of Chemistry, Kgs. Lyngby (Denmark)); Terkelsen, C.; Rudbech, H.C.; Steenberg, T. (Danish Power System Aps, Charlottenlund (Denmark)); Thibault de Rycke (IRD Fuel Cell A/S, Svendborg (Denmark))

    2009-10-15

    The aim of the project has been to further develop components for an all Danish high temperature PEM fuel cells stack for application in combined heat and power units (CHP units). The final product aimed at was a 1.5-2 kW stack for operation at 150-200 deg. C. The project follows the previous PSO project 4760, 'High Temperature PEM Fuel Cell'. The project has addressed the HT-PEM fuel cells form a components point of view and the materials here for. The main areas were polymer and membrane development, electrode and MEA development (MEA = membrane electrode assembly, i.e. the cells.) and stack development. The membrane development begins with the polymer. The polymerization technique was improved significantly in two ways. Better understanding of the process and the critical issues has led to more reproducible results with repeated high molecular weights. The molecular weight is decisive for the membrane strength and durability. The process was also scaled up to 100-200 g polymer pr. batch in a new polymerization facility build during the project. It is dimensioned for larger batches too, but this was not verified during the project. The polymer cannot be purchased in the right quality for fuel cell membranes and it is important that it manufacture is not a limiting factor at the present state. Experiments with other membrane casting techniques were also made. The traditional PBI doped with phosphoric acid is still the state of art membrane for the HT-PEM fuel cells, but progress was also made with modified membranes. Different variants of PBI were synthesized and tested. Electrodes have been manufactured by a spray technique in contrast to the previously applied tape casting. The hand held spray gun previously led to an improvement of the electrodes, but the reproducibility was limited. Subsequently the construction of a semi automated spray machine was started and results like of the best hand sprayed electrodes were obtained. A viable way of MEA rim

  17. Market Assessment of Biomass Gasification and Combustion Technology for Small- and Medium-Scale Applications

    Energy Technology Data Exchange (ETDEWEB)

    Peterson, D.; Haase, S.

    2009-07-01

    This report provides a market assessment of gasification and direct combustion technologies that use wood and agricultural resources to generate heat, power, or combined heat and power (CHP) for small- to medium-scale applications. It contains a brief overview of wood and agricultural resources in the U.S.; a description and discussion of gasification and combustion conversion technologies that utilize solid biomass to generate heat, power, and CHP; an assessment of the commercial status of gasification and combustion technologies; a summary of gasification and combustion system economics; a discussion of the market potential for small- to medium-scale gasification and combustion systems; and an inventory of direct combustion system suppliers and gasification technology companies. The report indicates that while direct combustion and close-coupled gasification boiler systems used to generate heat, power, or CHP are commercially available from a number of manufacturers, two-stage gasification systems are largely in development, with a number of technologies currently in demonstration. The report also cites the need for a searchable, comprehensive database of operating combustion and gasification systems that generate heat, power, or CHP built in the U.S., as well as a national assessment of the market potential for the systems.

  18. Fuel-efficiency of hydrogen and heat storage technologies for integration of fluctuating renewable energy sources

    DEFF Research Database (Denmark)

    Mathiesen, Brian Vad; Lund, Henrik

    2005-01-01

    sources as well as power plants and CHP (Combined heat and power production). Emphasis is put on the need for ancillary services. Devices to store electricity as well as devices to store heat can be used to help the integration of fluctuating sources. Electricity storage technologies can be used...... to relocate electricity production directly from the sources, while heat storage devices can be used to relocate the electricity production from CHP plants and hereby improve the ability to integrate RES. The analyses are done by advanced computer modelling and the results are given as diagrams showing...

  19. Clean Energy Technologies: A Preliminary Inventory of the Potential for Electricity Generation

    Energy Technology Data Exchange (ETDEWEB)

    Bailey, Owen; Worrell, Ernst

    2005-08-03

    The nation's power system is facing a diverse and broad set of challenges. These range from restructuring and increased competitiveness in power production to the need for additional production and distribution capacity to meet demand growth, and demands for increased quality and reliability of power and power supply. In addition, there are growing concerns about emissions from fossil fuel powered generation units and generators are seeking methods to reduce the CO{sub 2} emission intensity of power generation. Although these challenges may create uncertainty within the financial and electricity supply markets, they also offer the potential to explore new opportunities to support the accelerated deployment of cleaner and cost-effective technologies to meet such challenges. The federal government and various state governments, for example, support the development of a sustainable electricity infrastructure. As part of this policy, there are a variety of programs to support the development of ''cleaner'' technologies such as combined heat and power (CHP, or cogeneration) and renewable energy technologies. Energy from renewable energy sources, such as solar, wind, hydro, and biomass, are considered carbon-neutral energy technologies. The production of renewable energy creates no incremental increase in fossil fuel consumption and CO{sub 2} emissions. Electricity and thermal energy production from all renewable resources, except biomass, produces no incremental increase in air pollutants such as nitrogen oxides, sulfur oxides, particulate matter, and carbon monoxide. There are many more opportunities for the development of cleaner electricity and thermal energy technologies called ''recycled'' energy. A process using fossil fuels to produce an energy service may have residual energy waste streams that may be recycled into useful energy services. Recycled energy methods would capture energy from sources that would otherwise

  20. Modelling of a solid oxide fuel cell CHP system coupled with a hot water storage tank for a single household

    DEFF Research Database (Denmark)

    Liso, Vincenzo; Zhao, Yingru; Yang, Wenyuan

    2015-01-01

    In this paper a solid oxide fuel cell (SOFC) system for cogeneration of heat and power integrated with a stratified heat storage tank is studied. The use of a storage tank with thermal stratification allows one to increase the annual operating hours of CHP: heat can be produced when the request...... produced by gasification and natural gas. The tank model considers the temperature gradients over the tank height. The results of the numerical simulation are used to size the SOFC system and storage heat tank to provide energy for a small household using two different fuels. In particular it was shown...... is low (for instance during the night), taking advantage of thermal stratification to increases the heat recovery performance. A model of the SOFC system is presented to estimate the energy required to meet the average electric energy demand of the residence. Two fuels are considered, namely syngas...

  1. Increased electrical efficiency in biofueled CHP plants by biomass drying; Oekat elutbyte i biobraensleeldade kraftvaermeanlaeggningar med hjaelp av foertorkning

    Energy Technology Data Exchange (ETDEWEB)

    Berntsson, Mikael; Thorson, Ola; Wennberg, Olle

    2010-09-15

    In this report, integrated biofuel drying has been studied for two cases. One is the existing CHP plant at ENA Energi AB in Enkoeping and the other is a theoretical case. The thought plant is assumed to have a steam generating performance that is probable for a future CHP plant optimised for power production. The CHP plant at ENA Energi with its integrated bed drying system has been used as a model in this study. The plant has a grate fired boiler with the capacity to co-produce 24 MW electricity and 55 MW heat. It is designed to use biofuel with moisture content between 40 and 55 %. However, the boiler is able to manage even dryer fuels with the moisture content of about 35 % without complications. Since the boiler operates on part load during most of the season, there are free capacity which can be used for delivering heat to the drying system. The increased power production is a result of mainly two factors: Increased demand of heat as the dryer uses district heating and thus improved possibility to produce steam; and, The season of operation can be extended, since the point where the minimum load of the boiler occurs can be pushed forward as a result of increased demand of heat. For future CHP plants, an optimised plant has been used as a model. The steam data is assumed to be 170 bar and 540 deg C with reheating. For this plant, both on-site and offsite drying have been studied. The case study comprises a whole season of operation and the fuel is assumed to be dried from 50 to 10 %. The size of the optimised plant is as to fit the dimension of a main production unit in a district heating net equal to the tenth largest in Sweden. Heat delivery is assumed to be 896 GWh/year and the maximum heat delivery of district heating is 250 MW. The sizing of the boiler is made to maximise the production of electricity, and thus dependent of the drying strategy used. Flue gas condensation is assumed to be used as much as possible. It decreases the basis for power production

  2. Tumor associated antigen CHP2 promotes intraperitoneal metastasis of HEK293 cells in nude mice%肿瘤相关抗原CHP2促进HEK293细胞在裸鼠腹腔内的转移

    Institute of Scientific and Technical Information of China (English)

    钱晓萍; 孙秀媛; 李国栋; 张毓; 陈慰峰

    2009-01-01

    目的:研究肿瘤相关抗原CHP2对HEK293细胞在裸鼠腹腔内转移能力的影响,并初步探讨其可能的分子机制.方法:通过Boyden小室法检测CHP2转染细胞和对照细胞的体外转移能力.对BALB/c裸鼠进行腹腔接种,观察裸鼠体内的成瘤与组织浸润情况并进行HE染色.利用RT-PCR方法检测HEK293细胞中部分转移相关分子的基因表达水平.结果:CHP2增强HEK293细胞在体外穿过Matrigel胶的侵袭能力,同时显著加速HEK293细胞在裸鼠腹腔内的成瘤速度并促进肿瘤对腹腔主要脏器的浸润.CHP2上调转移相关分子骨桥蛋白(osteopon-tin,OPN)在HEK293细胞中的表达,但对基质金属蛋白酶MMP2的表达没有明显影响.结论:CHP2显著增强HEK293细胞在体外及裸鼠腹腔内的转移能力,OPN表达上调可能参与CHP2对HEK293细胞的转移促进作用.

  3. Nanotechnology: Opportunities and Challenges

    Science.gov (United States)

    Meyyappan, Meyya

    2003-01-01

    Nanotechnology seeks to exploit novel physical, chemical, biological, mechanical, electrical, and other properties, which arise primarily due to the nanoscale nature of certain materials. A key example is carbon nanotubes (CNTs) which exhibit unique electrical and extraordinary mechanical properties and offer remarkable potential for revolutionary applications in electronics devices, computing, and data storage technology, sensors, composites, nanoelectromechanical systems (NEMS), and as tip in scanning probe microscopy (SPM) for imaging and nanolithography. Thus the CNT synthesis, characterization, and applications touch upon all disciplines of science and engineering. This presentation will provide an overview and progress report on this and other major research candidates in Nanotechnology and address opportunities and challenges ahead.

  4. Frontier Aerospace Opportunities

    Science.gov (United States)

    Bushnell, Dennis M.

    2014-01-01

    Discussion and suggested applications of the many ongoing technology opportunities for aerospace products and missions, resulting in often revolutionary capabilities. The, at this point largely unexamined, plethora of possibilities going forward, a subset of which is discussed, could literally reinvent aerospace but requires triage of many possibilities. Such initial upfront homework would lengthen the Research and Development (R&D) time frame but could greatly enhance the affordability and performance of the evolved products and capabilities. Structural nanotubes and exotic energetics along with some unique systems approaches are particularly compelling.

  5. Opportunity NOx

    Energy Technology Data Exchange (ETDEWEB)

    Karrs, M.; Albano, J.V. [ABB Lummus Global Inc., (United States)

    2002-03-01

    Legislation on the emission of oxides of nitrogen (NO{sub x}) from stationery fired sources is becoming ever more stringent. The only proven technology for reducing NOx to below 10 ppm in flue gas is selective catalytic reduction (SCR) at temperatures of 400 - 700 Fahrenheit. But, since modern refinery and petrochemical heater stack temperatures are below this range, retrofitting a catalytic reducer to an existing heater was difficult and expensive. ABB Lummus Heat Transfer took up this problem and have developed a low impact solution for SCR retrofits. The system developed is compact and the modular design facilitates fabrication almost anywhere in the world. The modular design keeps downtime to a minimum. The investment costs are site specific but the system has marked advantages over the retrofitting of low NO{sub x} burners.

  6. Straw for energy production. Technology - Environment - Economy

    Energy Technology Data Exchange (ETDEWEB)

    Nikolaisen, L.; Nielsen, C.; Larsen, M.G.; Nielsen, V.; Zielke, U.; Kristensen, J.K.; Holm-Christensen, B.

    1998-12-31

    `Straw for Energy Production`, second edition, provides a readily accessible background information of special relevance to the use of straw in the Danish energy supply. Technical, environmental, and economic aspects are described in respect of boiler plants for farms, district heating plants, and combined heat and power plants (CHP). The individual sections deal with both well-known, tested technology and the most recent advances in the field of CHP production. This publication is designed with the purpose of reaching the largest possible numbers of people and so adapted that it provides a valuable aid and gives the non-professional, general reader a thorough knowledge of the subject. `Straw for Energy Production` is also available in German and Danish. (au)

  7. Technical support for the Ohio Clean Coal Technology Program. Volume 2, Baseline of knowledge concerning process modification opportunities, research needs, by-product market potential, and regulatory requirements: Final report

    Energy Technology Data Exchange (ETDEWEB)

    Olfenbuttel, R.; Clark, S.; Helper, E.; Hinchee, R.; Kuntz, C.; Means, J.; Oxley, J.; Paisley, M.; Rogers, C.; Sheppard, W.; Smolak, L. [Battelle, Columbus, OH (United States)

    1989-08-28

    This report was prepared for the Ohio Coal Development Office (OCDO) under Grant Agreement No. CDO/R-88-LR1 and comprises two volumes. Volume 1 presents data on the chemical, physical, and leaching characteristics of by-products from a wide variety of clean coal combustion processes. Volume 2 consists of a discussion of (a) process modification waste minimization opportunities and stabilization considerations; (b) research and development needs and issues relating to clean coal combustion technologies and by-products; (c) the market potential for reusing or recycling by-product materials; and (d) regulatory considerations relating to by-product disposal or reuse.

  8. Wood for energy production. Technology - environment - economy[Denmark

    Energy Technology Data Exchange (ETDEWEB)

    Serup, H.; Falster, H.; Gamborg, C. [and others

    1999-07-01

    'Wood for Energy Production', 2nd edition, is a readily understood guide to the application of wood in the Danish energy supply. The first edition was named 'Wood Chips for Energy Production'. It describes the wood fuel from forest to consumer and provides a concise introduction to technological, environmental, and financial matters concerning heating systems for farms, institutions, district heating plants, and CHP plants. The individual sections deal with both conventional, well known technology, as well as the most recent technological advances in the field of CHP production. The purpose of this publication is to reach the largest possible audiance, and it is designed so that the layman may find its background information of special relevance. 'Wood for Energy Production' is also available in German and Danish. (au)

  9. Opportunities and Challenges of University Library Service Brought by Mobile Technology Changes%移动技术的变革给高校图书馆读者服务带来的机遇和挑战

    Institute of Scientific and Technical Information of China (English)

    李双双

    2015-01-01

    With the popularity of modern communications and electronic equipment, mobile technology in people's lives and work more and more applications, it brings new opportunities and challenges to college library service mode. This article will first analyze the characteristics and advantages of mobile technology, and then sort the problem in the application of mo-bile technology encountered during the university library service activities, measures to move the final analysis techniques you need service opportunities and technology, hoping to to provide theoretical and practical inspiration for the construction of the relevant university library.%随着现代通信和电子设备的普及,移动技术在人们生活和工作中的应用也越来越多,这给高校图书馆读者服务模式带来了新的机遇和挑战。本文将首先分析移动技术的特点及优势,然后梳理在应用移动技术过程中高校图书馆服务活动所遇到的问题,最后分析移动技术为读者服务所带来的机遇及技术的应用措施,希望可以为相关高校图书馆的建设提供一定的理论和实践启示。

  10. Combined Heat and Power (CHP Allocation and Capacity Determination According to Fuzzy Bus Thermal Coefficient and Nodal Pricing Method using Cooperative Game Theory

    Directory of Open Access Journals (Sweden)

    Mohamad Hasan Moradi

    2014-12-01

    Full Text Available In this paper a hybrid and practical method is presented to allocate and determine combined heat and power capacity (CHP generator at a bus. This method consists of two stages. First, the suitable buses for CHP installation will be found by the bus thermal coefficient . This coefficient indicates the possibility of the heat selling around each bus and will be calculated by using the Fuzzy method. Next, for each of the appropriate buses, considering the obtained heat capacity and electrical power ratio to the heat of the CHPs in the market, several CHPs are recommended. Second, on the one hand, the improvement of the technical criteria after the CHPs installation is derived by using the nodal pricing methods as the financial benefits of the distribution companies and on the other hand, the investors’ financial benefits from the sold heat output of the CHPs is determined. Finally, using the Game Theory and considering the distribution companies and investors as the players, the suitable location and capacity for CHP installation based on the set Game strategy is obtained. The proposed method is implemented to a sample distribution feeder in the Hamadan city and the results are shown.

  11. UTBB FDSOI: Evolution and opportunities

    Science.gov (United States)

    Monfray, Stephane; Skotnicki, Thomas

    2016-11-01

    As today's 28 nm FDSOI (Fully Depleted Silicon On Insulator) technology is at the industrialization level, this paper aims to summarize the key advantages allowed by the thin BOX (Buried Oxide) of the FDSOI, through the technology evolution but also new opportunities, among logic applications and extending the possibilities offered by the platform. We will summarize how the advantages provided by the thin BOX have been first explored and developed, and how the back biasing techniques are the key to the outstanding performances provided by the FDSOI at low voltage. Then, as the FDSOI technology is also a solution to develop innovative platforms and applications, we will detail some opportunities. In particular, we will present monolithic 3D integration, ultra-low power devices for IoT (Internet of Things) and ultra-sensitive sensors.

  12. NASA/DOD Aerospace Knowledge Diffusion Research Project. Paper 27: Knowledge diffusion and US government technology policy: Issues and opportunities for sci/tech librarians

    Science.gov (United States)

    Pinelli, Thomas E.; Barclay, Rebecca O.; Hannah, Stan; Lawrence, Barbara; Kennedy, John M.

    1992-01-01

    Federal involvement in simulating economic growth through the development and application of technology policy is currently the subject of serious debate. A recession and the recognition that an internationally competitive economy is a prerequisite for the attainment of national goals have fostered a number of technology policy initiatives aimed at improving the economic competitiveness of American industry. This paper suggests that the successful implementation of U.S. technology policy will require the adoption of a knowledge diffusion model, the development of user oriented information products and services, and a more 'activist' approach on the part of sci/tech librarians in the provision of scientific and technical information (STI). These changes will have a dramatic impact on the sci/tech library of the future and the preparation of sci/tech librarians.

  13. NASA/DoD Aerospace Knowledge Diffusion Research Project. XXVII - Knowledge diffusion and U.S. government technology policy: Issues and opportunities for sci/tech librarians

    Science.gov (United States)

    Pinelli, Thomas E.; Barclay, Rebecca O.; Hannah, Stan; Lawrence, Barbara; Kennedy, John M.

    1992-01-01

    Federal involvement in stimulating economic growth through the development and application of technology policy is currently the subject of serious debate. A recession and the recognition that an internationally competitive economy is a prerequisite for the attainment of national goals have fostered a number of technology policy initiatives aimed at improving the economic competitiveness of American industry. This paper suggests that the successful implementation of U.S. technology policy will require the adoption of a knowledge diffusion model, the development of user oriented information products and services, and a more 'activist' approach on the part of sci/tech librarians in the provision of scientific and technical information (STI). These changes will have a dramatic impact on the sci/tech library of the future and the preparation of sci/tech librarians.

  14. Opportunities of the new technological model of light vehicle fuels in South America; Oportunidades futuras no novo modelo tecnologico de combustiveis para veiculos leves na America do Sul

    Energy Technology Data Exchange (ETDEWEB)

    Dourado, Jose Diamantino de A. [Centro Federal de Educacao Tecnologica Celso Sukow da Fonseca (CEFET-RJ), Rio de Janeiro, RJ (Brazil); Chaves, Hernani Aquini F.; Jones, Cleveland Maximino [Universidade do Estado do Rio de Janeiro (UERJ), Rio de Janeiro, RJ (Brazil). Dept. de Estratigrafia e Paleontologia (DEPA)

    2008-07-01

    The purpose of this work is to show which solutions the South American market is putting forth for the new technological model of the automotive fuel for light duty vehicles. A strong and irreversible trend is underway, which is seeking more environmentally friendly and economically attractive alternatives for the conventional automotive technology, based on the consumption of gasoline and diesel fuel. This trend is evident not only in Latin America, but also in many other countries and regions, and has resulted in a great number of vehicle conversions, so as to operate with vehicular natural gas. Another important way in which this trend has expressed itself is the commercial acceptance and success of the tetra fuel technology vehicles. (author)

  15. Biomass polygeneration - technology state-of-the-art, systems and policy instruments; Bioenergikombinat - tekniktrender, system och styrmedel

    Energy Technology Data Exchange (ETDEWEB)

    Gode, Jenny; Hagberg, Linus; Holmgren, Kristina; Stripple, Haakan

    2007-09-15

    The development status of biofuel technologies and pellets has been reviewed, with focus on the possibilities for polygeneration with combined heat and power (CHP). Policy instruments important for the development of polygeneration plants have been analysed and interviews with potential stakeholders have been carried out. Fermentation of biomass for ethanol production, gasification and conversion to synthesis gas, biodiesel production from vegetable and animal oils, as well as anaerobic digestion for biogas production are examples of common biofuel technologies. Some of these are commercially available whereas others require further development. Substantial research and development is also spent to develop new technologies for biofuel production. Biofuel production can often benefit from integration with CHP resulting in increased efficiency and energy balances. The potentials for integration vary between different biofuels, but the most common options are integration with respect to the raw material, heat demand, waste heat and waste products. The integration potential for pellets is mainly associated with the raw material and the heat demand for drying of the raw material. Integration of biofuel and/or pellets production with CHP might increase the potential for power production since a new heat customer is provided the whole year around. The heat demand for some biofuels and for pellets can be covered by district heating, whereas some biofuels require steam. Policy instruments can strongly influence the development of biofuels and thereby has a potential to affect the incentives for investments in polygeneration. From a climate point of view, it can be argued that biomass is better used for emission reductions in other sectors where higher reduction of greenhouse gases can be achieved to a lower cost. However, there are other driving forces that motivate increased use of biofuels, such as security of supply, need of revised agriculture policy and reduction of

  16. Modelling of a Solid Oxide Fuel Cell CHP System Coupled with a Hot Water Storage Tank for a Single Household

    Directory of Open Access Journals (Sweden)

    Vincenzo Liso

    2015-03-01

    Full Text Available In this paper a solid oxide fuel cell (SOFC system for cogeneration of heat and power integrated with a stratified heat storage tank is studied. The use of a storage tank with thermal stratification allows one to increase the annual operating hours of CHP: heat can be produced when the request is low (for instance during the night, taking advantage of thermal stratification to increases the heat recovery performance. A model of the SOFC system is presented to estimate the energy required to meet the average electric energy demand of the residence. Two fuels are considered, namely syngas produced by gasification and natural gas. The tank model considers the temperature gradients over the tank height. The results of the numerical simulation are used to size the SOFC system and storage heat tank to provide energy for a small household using two different fuels. In particular it was shown that in the case of syngas, due to larger system heat output, a larger tank volume was required in order to accumulate unused heat over the night. The detailed description of the tank model will be useful to energy system modelers when sizing hot water tanks. Problem formulation is reported also using a Matlab script.

  17. Vegetables Business Opportunities in Ghana: 2014

    NARCIS (Netherlands)

    Saavedra Gonzalez, Y.R.; Dijkxhoorn, Y.; Elings, A.; Glover-Tay, J.; Koomen, I.; Maden, van der E.C.L.J.; Nkansah, G.; Obeng, P.

    2014-01-01

    This report addresses the current performance, overall business climate of the vegetable sector and tries to come up with a number of business opportunities. These include business opportunities for high-quality exports, greenhouse technology, and healthy food for the domestic market. It equally adv

  18. Irrigation-based livelihood challenges and opportunities : a gendered technology of irrigation development intervention in the Lower Moshi irrigation scheme Tanzania

    NARCIS (Netherlands)

    Kissawike, K.

    2008-01-01

    This thesis is a study of a modernised irrigation scheme in Tanzania. It aims to understand how irrigation and agricultural technologies have interacted with local society to transform production, paying particular attention to gender relations and changes for women farmers. The thesis seeks to c

  19. Record of the facility deactivation, decommissioning, and material disposition (D and D) workshop: A new focus for technology development, opportunities for industry/government collaboration

    Energy Technology Data Exchange (ETDEWEB)

    Bedick, R.C.; Bossart, S.J.; Hart, P.W.

    1995-07-01

    This workshop was held at the Morgantown Energy Technology Center (METC) in Morgantown, West Virginia, on July 11--12, 1995. The workshop sought to establish a foundation for continued dialogue between industry and the DOE to ensure that industry`s experiences, lessons learned, and recommendations are incorporated into D and D program policy, strategy, and plans. The mission of the D and D Focus Area is to develop improved technologies, processes and products, to characterize, deactivate, survey, maintain, decontaminate, dismantle, and dispose of DOE surplus structures, buildings, and contents. The target is a five-to-one return on investment through cost avoidance. The cornerstone of the D and D focus area activities is large-scale demonstration projects that actually decontaminate, decommission, and dispose of a building. The aim is to demonstrate innovative D and D technologies as part of an ongoing DOE D and D project. OTD would pay the incremental cost of demonstrating the innovative technologies. The goal is to have the first demonstration project completed within the next 2 years. The intent is to select projects, or a project, with visible impact so all of the stakeholders know that a building was removed, and demonstrate at a scale that is convincing to the customers in the EM program so they feel comfortable using it in subsequent D and D projects. The plan is to use a D and D integrating contractor who can then use the expertise in this project to use in jobs at other DOE sites.

  20. Technology-Aided Leisure and Communication Opportunities for Two Post-Coma Persons Emerged from a Minimally Conscious State and Affected by Multiple Disabilities

    Science.gov (United States)

    Lancioni, Giulio E.; O'Reilly, Mark F.; Singh, Nirbhay N.; Sigafoos, Jeff; Buonocunto, Francesca; Sacco, Valentina; Navarro, Jorge; Lanzilotti, Crocifissa; De Tommaso, Marina; Megna, Marisa; Oliva, Doretta

    2013-01-01

    This study assessed technology-aided programs for helping two post-coma persons, who had emerged from a minimally conscious state and were affected by multiple disabilities, to (a) engage with leisure stimuli and request caregiver's procedures, (b) send out and listen to text messages for communication with distant partners, and (c) combine…

  1. Opportunities of the development of three dimensional printing technology for the petrochemical industry%3D打印技术的发展给石化行业提供的机会

    Institute of Scientific and Technical Information of China (English)

    李汉初

    2015-01-01

    综述了三维(3D)打印技术的发展历程、前景、瓶颈及优势,并分析了3D打印技术给石化行业提供的机会。3D打印技术具有可实现个性化生产、产品精度极高以及一次性生产复杂一体化产品等优点。耗材是3D打印产品最主要的成本,是制约3D打印技术广泛应用的瓶颈,耗材研发是3D打印技术发展的关键。3D打印技术的快速发展将给石化行业在科研、设备制造及管理等方面提供良好的发展机会,特别是研发3D打印所需新材料将给石化行业带来效益,开发高端3D打印耗材有利于企业在未来竞争中占据有利位置,提升竞争力。%The development course, prospect, bottleneck and advantages of the three dimensional(3D) printing technology were summarized and the opportunity of 3D printing technology for petrochemical industry was analyzed. 3D printing technology has the characters of realizing personalized production, preparing high-precision products and complex integrated products all at once. Consumables are the most important cost of 3D printing products, which are the bottleneck of restricting the extensive use of 3D printing technology. The research and development of consumables is the key to develop 3D printing technology. The rapid development of 3D printing technology will provide good opportunities for petrochemical industry, such as scientific research, instrument manufacture and management,etc,especially the development of new materials for 3D printing will bring benefits to the petrochemical industry. Developing high-end consumables for 3D printing is beneficial for the enterprises to occupy the advantaged position in the future competition and enhance the competitiveness.

  2. Trajetórias tecnológicas no segmento offshore: ambiente e oportunidades Technological trajectories in the offshore segment: enviroment and opportunities

    Directory of Open Access Journals (Sweden)

    José Benedito Ortiz Neto

    2008-08-01

    Full Text Available Este artigo apresenta as diferentes trajetórias tecnológicas do segmento offshore na indústria petrolífera mundial considerando os seus principais aspectos e marcos constituintes. Mais especificamente, serão analisadas as trajetórias diferentes nas duas primeiras grandes províncias de petróleo do segmento offshore: o Golfo do México (EUA e o Mar do Norte (Europa. Junto com a Bacia de Campos (Brasil, são as mais produtivas e ricas do planeta e onde as três trajetórias tecnológicas foram desenvolvidas. Esse levantamento histórico é importante porque resgata os elementos que dão as bases do conhecimento tecnológico que permitiu à Petrobras, de forma inédita, iniciar as suas atividades offshore nas décadas de 1960-1970. Será visto aqui que a exploração offshore significou o surgimento de um novo paradigma tecnológico sustentado por três trajetórias.This article presents different technological trajectories concerning the offshore exploration segment in the world petroleum industry, considering their main aspects and components. More specifically, different trajectories will be analyzed in the first two largest crude oil territories: Gulf of Mexico (USA and Sea North (Europe. These, along with Bacia de Campos in Brazil, are the most productive and the richest regions in the planet and, therefore, where the three technological trajectories have been developed. This historic survey is important because it reveals the elements that provide the basis for technological knowledge, which allowed Petrobras to start its offshore activities in the 60s and 70s, via an original technology. The offshore exploration meant the emergence of a new technological paradigm supported by three trajectories.

  3. Study and Evaluation of Liquid Air Energy Storage Technology For a Clean and Secure Energy Future Challenges and opportunities for Alberta wind energy industry

    Directory of Open Access Journals (Sweden)

    Hadi H. Alyami

    2015-08-01

    Full Text Available Global energy demand is steadily increasing each year. Many jurisdictions are seeking to incorporate sustainable and renewable energy sources to help meeting the demand and doing so in a responsible method to the environment and the next generation. In a wide-context, renewable energy sources are promising, yet cannot be controlled in such a way that is responsive to energy demand fluctuation. Liquid Air Energy Storage (LAES technology seeks to bridge the gap that exists between energy supply and demand in an effort to mitigate the current demand deficiency. The volume ratio of air to liquid air is nearly 700:1. Liquid air is a dense energy carrier that is by converting renewable energy at off-peak periods into liquid air the energy can be stored until a peak-demand period when energy producers are maximising output to meet the demand. The energy is then retrieved from the liquid air through rapid expansion as it re-gasifies through a gas turbine and converted into electricity. A commercial scale pilot plant in Slough, UK illustrates the application of this technology empirically. The application of this technology in Canada might have challenges as public policy respective jurisdictions play a role. A case of point of applications where LAES can be integrated is the renewable energy market; particularly the wind power in Alberta. This paper’s analysis embraces wind power industry in Alberta from the perspective of both the electric system operator and the power generation plant. As such, it serves as an alleviating proposal of the current wind energy issues in Alberta – including the uncertainty of forecasting system. The analysis assumed energy storage technologies as a viable stand-alone mitigation with no consideration of the current technological and operational advancements in power systems such HVDC grids, distributed generation concepts and among others.

  4. Power and heat from CHP fuel cell systems in the basement. Testing of fuel cell-driven heating systems; Kleinkraftwerke im Keller sorgen fuer Strom und Waerme. Brennstoffzellen-Heizgeraete in der Erprobung

    Energy Technology Data Exchange (ETDEWEB)

    Tschaetsch, H.U.

    2002-03-25

    The article discusses important aspects of a joint project funded by industry, utilities and the State Government of North Rhine-Westphalia. The field test results, the performance and engineering data of the innovative energy conversion and storage system based on the fuel cell-driven CHP technology for on-site power and heat production for a multi-family house are described in detail. (orig./CB) [German] Die Entwicklung der Brennstoffzellen-Technologie fuer die dezentrale Strom- und Waermeversorgung ist in einer entscheidenden Phase. In einem Mehrfamilienhaus in Gelsenkirchen begann im Januar 2002 der erste Praxistest eines Vaillant Brennstoffzellen-Heizgeraetes (BZH), das mit einem Kostenaufwand von rd. 2,2 Mio. Euro entwickelt wurde. Die Projektpartner Vaillant GmbH, Remscheidt, Ruhrgas AG, Essen, Eon Engineering GmbH, Gelsenkirchen, ELE Emscher Lippe Energie GmbH, Gelsenkirchen, und EUS - Gesellschaft fuer innovative Energieumwandlung und -speicherung mbH., Gelsenkirchen, wollen mit dem vom Land Nordrhein-Westfalen (NRW) mit insgesamt 800 000 Euro unterstuetzten Feldtest zeigen, dass die einzelnen Komponenten Brennstoffzelle, Warmwasserspeicher und Zusatzheizgeraet ueber einen Energiemanager (Prozesssteuerung) kostenoptimal zusammenarbeiten koennen. (orig.)

  5. Industrial Development Opportunity & Trend of Chinese Medicine

    Institute of Scientific and Technical Information of China (English)

    Wang YiTao

    2001-01-01

    @@ While having a great development opportunity, CM faces a great marketing competition when entering to WTO. An important change will take place in CM technology, industry as well as overseas and domestic marketing. The domestic CM industry and marketing tend to be "internationalized” while the foreign herbal and traditional drugs tend to be "CM”. This article aims to explore the opportunity, trend and future of CM by analyzing the present status of CM technology, industry and marketing.

  6. Industrial Development Opportunity & Trend of Chinese Medicine

    Institute of Scientific and Technical Information of China (English)

    Wang; YiTao

    2001-01-01

    While having a great development opportunity, CM faces a great marketing competition when entering to WTO. An important change will take place in CM technology, industry as well as overseas and domestic marketing. The domestic CM industry and marketing tend to be "internationalized” while the foreign herbal and traditional drugs tend to be "CM”. This article aims to explore the opportunity, trend and future of CM by analyzing the present status of CM technology, industry and marketing.  ……

  7. The application of soft sensors in the pulp and paper and cement manufacturing sectors for process and energy performance improvement : opportunity analysis and technology assessment

    Energy Technology Data Exchange (ETDEWEB)

    Champagne, M. [Effective Assets Inc., Ottawa, ON (Canada); Amazouz, M.; Platon, R. [Natural Resources Canada, Varennes, PQ (Canada). CANMET Energy Technology Centre

    2005-06-01

    Information from process experts and operators, research and development experts and sensors and control systems developers and providers is presented in order to help with the development and implementation of soft sensor technology. A soft sensor is the correlation from various raw data sources to create a new source of relevant information. Soft sensor technology is a useful tool in reducing energy consumption, operating costs, environmental impact and in improving final product quality. This report presents an introduction to soft sensor technology with reference to the need for soft sensors; first principal models; statistical based models; black box models; key success factors for a soft sensor project; benefits and drawbacks of soft sensor technology; and barriers to implementation of soft sensors. It discusses the state of the art in soft sensor research and development and industrial applications including design techniques and commercial software tools. Potential applications of soft sensors in the pulp and paper industry were discussed with reference to chemical pulping; mechanical pulping; newsprint and papermaking; and current applications of sensors in pulp and paper in Canada. Potential applications of soft sensors in the cement industry were also discussed. A survey was also conducted to obtain the opinions of industry experts, such as developers, suppliers and end-users of soft sensor applications. Interview notes were included in annex form. Key areas of future research and development include development of multi-grade models; development of adaptive models able to cope with production changes and shutdowns; increasing the awareness of plant managers and operators; development of user-friendly software; and recommendations on future work. 26 refs., 3 tabs., 6 figs., 2 appendices.

  8. Long-Term Care and Health Information Technology: Opportunities and Responsibilities for Long-Term and Post-Acute Care Providers

    OpenAIRE

    MacTaggart, Patricia; Thorpe, Jane Hyatt

    2013-01-01

    Long-term and post-acute care providers (LTPAC) need to understand the multiple aspects of health information technology (HIT) in the context of health systems transformation in order to be a viable participant. The issues with moving to HIT are not just technical and funding, but include legal and policy, technical and business operations, and very significantly, governance. There are many unanswered questions. However, changes in payment methodologies, service delivery models, consumer expe...

  9. Technology-aided recreation and communication opportunities for post-coma persons affected by lack of speech and extensive motor impairment.

    Science.gov (United States)

    Lancioni, Giulio E; Singh, Nirbhay N; O'Reilly, Mark F; Sigafoos, Jeff; Buonocunto, Francesca; Sacco, Valentina; Navarro, Jorge; Lanzilotti, Crocifissa; D'Amico, Fiora; Sasanelli, Giovanni; De Tommaso, Marina; Megna, Marisa

    2013-09-01

    This study assessed technology-aided intervention programs for two post-coma men who had re-acquired consciousness, but were unable to engage in personally or socially relevant occupations, given their lack of functional speech and their extensive motor disabilities. The microswitches used for accessing the program contents consisted of (a) a pressure sensor fixed in the palm of the first man's hand that could be activated with a small hand closure movement, and (b) an optic sensor fixed under the chin of the second man that could be activated by mouth opening movements. The programs' content consisted of recreation and communication options, which involved activating music, videos, and basic requests, sending and receiving (listening to) text messages, and placing phone calls. The results showed that the men (a) used the technology-aided programs successfully to manage the recreation and communication options available and (b) showed consistent preference for the sessions with the technology-aided program over other daily events. Family and staff members interviewed about the participants' programs (seven members for each participant) thought that the participants enjoyed the intervention sessions with the programs and that the programs had beneficial effects for them. Implications of the findings are discussed.

  10. Potential of ORC Systems to Retrofit CHP Plants in Wastewater Treatment Stations

    Directory of Open Access Journals (Sweden)

    Ricardo Chacartegui

    2013-12-01

    Full Text Available Wastewater treatment stations take advantage of the biogas produced from sludge in anaerobic digesters to generate electricity (reciprocating gas engines and heat (cooling water and engine exhaust gases. A fraction of this electricity is used to operate the plant while the remaining is sold to the grid. Heat is almost entirely used to support the endothermic anaerobic digestion and a minimum fraction of it is rejected to the environment at a set of fan coolers. This generic description is applicable to on-design conditions. Nevertheless, the operating conditions of the plant present a large seasonal variation so it is commonly found that the fraction of heat rejected to the atmosphere increases significantly at certain times of the year. Moreover, the heat available in the exhaust gases of the reciprocating engine is at a very high temperature (around 650 oC, which is far from the temperature at which heat is needed for the digestion of sludge (around 40 oC in the digesters. This temperature difference offers an opportunity to introduce an intermediate system between the engines and the digesters that makes use of a fraction of the available heat to convert it into electricity. An Organic Rankine Cycle (ORC with an appropriate working fluid is an adequate candidate for these hot/cold temperature sources. In this paper, the techno-economic effect of adding an Organic Rankine Cycle as the intermediate system of an existing wastewater treatment station is analysed. On this purpose, different working fluids and system layouts have been studied for a reference wastewater treatment station giving rise to optimal systems configurations. The proposed systems yield very promising results with regard to global efficiency and electricity production (thermodynamically and economically.

  11. Classical Biological Control of Invasive Legacy Crop Pests: New Technologies Offer Opportunities to Revisit Old Pest Problems in Perennial Tree Crops

    Directory of Open Access Journals (Sweden)

    Mark S. Hoddle

    2014-12-01

    Full Text Available Advances in scientific disciplines that support classical biological control have provided “new tools” that could have important applications for biocontrol programs for some long-established invasive arthropod pests. We suggest that these previously unavailable tools should be used in biological control programs targeting “legacy pests”, even if they have been targets of previously unsuccessful biocontrol projects. Examples of “new tools” include molecular analyses to verify species identities and likely geographic area of origin, climate matching and ecological niche modeling, preservation of natural enemy genetic diversity in quarantine, the use of theory from invasion biology to maximize establishment likelihoods for natural enemies, and improved understanding of the interactions between natural enemy and target pest microbiomes. This review suggests that opportunities exist for revisiting old pest problems and funding research programs using “new tools” for developing biological control programs for “legacy pests” could provide permanent suppression of some seemingly intractable pest problems. As a case study, we use citricola scale, Coccus pseudomagnoliarum, an invasive legacy pest of California citrus, to demonstrate the potential of new tools to support a new classical biological control program targeting this insect.

  12. Classical Biological Control of Invasive Legacy Crop Pests: New Technologies Offer Opportunities to Revisit Old Pest Problems in Perennial Tree Crops.

    Science.gov (United States)

    Hoddle, Mark S; Warner, Keith; Steggall, John; Jetter, Karen M

    2014-12-23

    Advances in scientific disciplines that support classical biological control have provided "new tools" that could have important applications for biocontrol programs for some long-established invasive arthropod pests. We suggest that these previously unavailable tools should be used in biological control programs targeting "legacy pests", even if they have been targets of previously unsuccessful biocontrol projects. Examples of "new tools" include molecular analyses to verify species identities and likely geographic area of origin, climate matching and ecological niche modeling, preservation of natural enemy genetic diversity in quarantine, the use of theory from invasion biology to maximize establishment likelihoods for natural enemies, and improved understanding of the interactions between natural enemy and target pest microbiomes. This review suggests that opportunities exist for revisiting old pest problems and funding research programs using "new tools" for developing biological control programs for "legacy pests" could provide permanent suppression of some seemingly intractable pest problems. As a case study, we use citricola scale, Coccus pseudomagnoliarum, an invasive legacy pest of California citrus, to demonstrate the potential of new tools to support a new classical biological control program targeting this insect.

  13. Research opportunities to advance solar energy utilization.

    Science.gov (United States)

    Lewis, Nathan S

    2016-01-22

    Major developments, as well as remaining challenges and the associated research opportunities, are evaluated for three technologically distinct approaches to solar energy utilization: solar electricity, solar thermal, and solar fuels technologies. Much progress has been made, but research opportunities are still present for all approaches. Both evolutionary and revolutionary technology development, involving foundational research, applied research, learning by doing, demonstration projects, and deployment at scale will be needed to continue this technology-innovation ecosystem. Most of the approaches still offer the potential to provide much higher efficiencies, much lower costs, improved scalability, and new functionality, relative to the embodiments of solar energy-conversion systems that have been developed to date.

  14. Problems from Hell, Solution in the Heavens?: Identifying Obstacles and Opportunities for Employing Geospatial Technologies to Document and Mitigate Mass Atrocities

    Directory of Open Access Journals (Sweden)

    Ben Yunmo Wang

    2013-10-01

    Full Text Available At the evolving frontier of modern humanitarianism, non-governmental organizations are using satellite technology to monitor mass atrocities. As a documentation tool, satellites have the potential to collect important real-time evidence for alleged war crimes and crimes against humanity. However, the field remains experimental and ill-defined, while useful court evidence cannot be produced without a standard methodology and code of ethics. Members of the groundbreaking Satellite Sentinel Project review the historical development of satellite documentation and some of its landmark projects, and propose necessary measures to advance the field forward.

  15. Long-term care and health information technology: opportunities and responsibilities for long-term and post-acute care providers.

    Science.gov (United States)

    MacTaggart, Patricia; Thorpe, Jane Hyatt

    2013-01-01

    Long-term and post-acute care providers (LTPAC) need to understand the multiple aspects of health information technology (HIT) in the context of health systems transformation in order to be a viable participant. The issues with moving to HIT are not just technical and funding, but include legal and policy, technical and business operations, and very significantly, governance. There are many unanswered questions. However, changes in payment methodologies, service delivery models, consumer expectations, and regulatory requirements necessitate that LTPAC providers begin their journey.

  16. Opportunities and threats of WTO membership of Ukraine in foreign trade of high-technology products under conditions of co-operation with EU countries and Customs Union of Belarus, Kazakhstan, and Russia

    Directory of Open Access Journals (Sweden)

    Kyzym Mykola O.

    2014-01-01

    Full Text Available The article considers the problem of consequences of membership in the World Trade Organisation (WTO for Ukraine in foreign trade of high-technology products under conditions of co-operation with EU countries and the Customs Union of Belarus, Kazakhstan and Russia (CU. The article shows that after Ukraine joined WTO there were some rather significant reductions of tariff rates for Ukrainian products and liberalisation of access to the world markets, at the same time the internal Ukrainian market became more open for imported products. The article studies specific features and changes in the high-technology products market after Ukraine joined WTO. It analyses dynamics of volumes and specific weight of the world export-import of high-technology products and the structure of the world export and import of high technology products, including by individual countries and groups. The article makes a conclusion about a weak high-technology component of the Ukrainian export. It studies the structure of export of high-technology products of EU, CU and Ukraine. It shows that in order to develop the high-technology products market Ukraine needs to develop foreign trade with EU countries and also to continue co-operation with CU countries, in particular, with Russia. The article shows that the aerospace industry products takes the biggest specific weight in the export of high-technology products of Ukraine. It considers prospects of development of civil aircraft production in the world and Ukraine under the modern conditions. It analyses strengths and weaknesses of the aircraft construction industry and also threats and opportunities for aircraft construction of Ukraine due to external environment influence. The article shows that Ukraine cannot keep national aircraft building on its own, that is why it is necessary to develop close co-operation both with Russian enterprises and with the countries of the Western Europe. It offers recommendations on

  17. 3D打印技术对我国制造业带来的机遇探讨%Opportunities of 3 D Printing Technology to Chinese Manufacturing Industry

    Institute of Scientific and Technical Information of China (English)

    吴春兰; 韩晓红

    2014-01-01

    近年来3D打印技术得到了人们的普遍关注,其给传统制造业带来的变革不可估量,被认为是“第三次工业革命”的主要标志。通过对我国传统制造业面临困境的分析发现,3D打印技术可以为我国制造业的转型升级带来机遇。但现实是现阶段大多数吸引人们眼球的3D打印技术应用都还只是演示或单件产品,其成本与实用性往往被忽略。因此结合自身的实际冷静看待3D打印技术才是充分发挥起优势的前提。%In recent years,3D printing technology has been widely concerned,its potential to the traditional manufacturing industry has been immeasurable,and is considered the main logo of the"third industrial revolution".Through the analysis of China's traditional manufacturing industry we find it is faced with several difficulties,3D printing technology can bring opportunities for transformation and upgrading of China's manufacturing industry.But the reality is that most ex-cellent use of 3D printing technology at this stage are just a demonstration or a single product,the cost and practicality are often ignored.But whether it is as part of advanced manufacturing tech-nology,or production tools is still a very interesting problem to be tested.Therefore,the actual cool look with their own 3D printing technology is the prerequisite for starting full advantage.

  18. Opportunity Cost: A Reexamination

    Science.gov (United States)

    Parkin, Michael

    2016-01-01

    Is opportunity cost an ambiguous and arbitrary concept or a simple, straightforward, and fruitful one? This reexamination of opportunity cost addresses this question, and shows that opportunity cost is an ambiguous concept because "two" definitions are in widespread use. One of the definitions is indeed simple, fruitful, and one that…

  19. Rewriting the Opportunity Theory

    DEFF Research Database (Denmark)

    Korsgaard, Steffen T.

    The aim of this paper is to further the discussion of opportunity theory by discussing its ontological and epistemological underpinnings, which have been neglected in previous discussions. The idea that opportunities have an objective component is critically examined drawing on insights from social...... constructionism. It is argued that opportunity theory needs to be rewritten....

  20. PLAY ANALYSIS AND DIGITAL PORTFOLIO OF MAJOR OIL RESERVOIRS IN THE PERMIAN BASIN: APPLICATION AND TRANSFER OF ADVANCED GEOLOGICAL AND ENGINEERING TECHNOLOGIES FOR INCREMENTAL PRODUCTION OPPORTUNITIES

    Energy Technology Data Exchange (ETDEWEB)

    Shirley P. Dutton; Eugene M. Kim; Ronald F. Broadhead; William Raatz; Cari Breton; Stephen C. Ruppel; Charles Kerans; Mark H. Holtz

    2003-04-01

    A play portfolio is being constructed for the Permian Basin in west Texas and southeast New Mexico, the largest petroleum-producing basin in the US. Approximately 1300 reservoirs in the Permian Basin have been identified as having cumulative production greater than 1 MMbbl of oil through 2000. Of these major reservoirs, approximately 1,000 are in Texas and 300 in New Mexico. On a preliminary basis, 32 geologic plays have been defined for Permian Basin oil reservoirs and assignment of each of the 1300 major reservoirs to a play has begun. The reservoirs are being mapped and compiled in a Geographic Information System (GIS) by play. Detailed studies of three reservoirs are in progress: Kelly-Snyder (SACROC unit) in the Pennsylvanian and Lower Permian Horseshoe Atoll Carbonate play, Fullerton in the Leonardian Restricted Platform Carbonate play, and Barnhart (Ellenburger) in the Ellenburger Selectively Dolomitized Ramp Carbonate play. For each of these detailed reservoir studies, technologies for further, economically viable exploitation are being investigated.

  1. AA-CAES. Opportunities and challenges of advanced adiabatic compressed-air energy storage technology as a balancing tool in interconnected grids

    Energy Technology Data Exchange (ETDEWEB)

    Marquardt, Roland; Moser, Peter [RWE Power AG, Essen (Germany). Forschung und Entwicklung, Neue Technologien; Hoffmann, Stephanie [GE Global Research Europe, Garching (Germany); Pazzi, Simone [GE Infrastructure, Oil and Gas, Firenze (Italy); Klafki, Michael [ESK GmbH (RWE Group), Freiberg (Germany); Zunft, Stefan [Deutsches Zentrum fuer Luft- und Raumfahrt (DLR), Stuttgart (Germany). Inst. fuer Technische Thermodynamik

    2008-07-01

    An expansion of CO{sub 2}-neutral energy supply is in the focus of European and national environmental policy and will be crucially supported by offshore wind power generation in future. Grid-compatible integration of these fluctuating electricity quantities will - in the medium term already - require substantial adjustments of the German grid and power plant system in order to cope with the upcoming new boundary conditions. The development of new technologies for large-scale electricity storage is a key element in future flexible European electricity transmission systems. Electricity storage in Adiabatic CAES power plants offers the prospect of making a substantial contribution to reach this goal. This concept allows efficient, local zero-emission electricity storage on the basis of compressed air in underground caverns. The compression and expansion of air in turbomachinery help to balance power generation peaks that are not demand-driven on the one hand and consumption-induced load peaks on the other. Before this concept can be implemented, however, several technical problems must be solved and technical development work done, especially in the field of turbomachinery and the required heat storage device. This paper outlines the technical possibilities and the need for development. Ongoing development activities are described and first interim results presented. (orig.)

  2. Operating Experiences with a Small-scale CHP Pilot Plant based on a 35 kWel Hermetic Four Cylinder Stirling Engine for Biomass Fuels

    DEFF Research Database (Denmark)

    Biedermann, F.; Carlsen, Henrik; Schoech, M.;

    2003-01-01

    Within the scope of the RD&D project presented a small-scale CHP plant with a hermetic four cylinder Stirling engine for biomass fuels was developed and optimised in cooperation with the Technical University of Denmark, MAWERA Holzfeuerungsanlagen GesmbH, an Austrian biomass furnace and boiler...... exchanger of the Stirling engine, of the air preheater and of the entire combustion system. Furthermore, the optimisation of the pneumatic cleaning system to reduce ash deposition in the hot heat exchanger is of great relevance....

  3. A Geothermal Energy Supported Gas-steam Cogeneration Unit as a Possible Replacement for the Old Part of a Municipal CHP Plant (TEKO

    Directory of Open Access Journals (Sweden)

    L. Böszörményi

    2001-01-01

    Full Text Available The need for more intensive utilization of local renewable energy sources is indisputable. Under the current economic circumstances their competitiveness in comparison with fossil fuels is rather low, if we do not take into account environmental considerations. Integrating geothermal sources into combined heat and power production in a municipal CHP plant would be an excellent solution to this problem. This concept could lead to an innovative type of power plant - a gas-steam cycle based, geothermal energy supported cogeneration unit.

  4. Current status and future perspectives of electron interactions with molecules, clusters, surfaces, and interfaces [Workshop on Fundamental challenges in electron-driven chemistry; Workshop on Electron-driven processes: Scientific challenges and technological opportunities

    Energy Technology Data Exchange (ETDEWEB)

    Becker, Kurt H.; McCurdy, C. William; Orlando, Thomas M.; Rescigno, Thomas N.

    2000-09-01

    This report is based largely on presentations and discussions at two workshops and contributions from workshop participants. The workshop on Fundamental Challenges in Electron-Driven Chemistry was held in Berkeley, October 9-10, 1998, and addressed questions regarding theory, computation, and simulation. The workshop on Electron-Driven Processes: Scientific Challenges and Technological Opportunities was held at Stevens Institute of Technology, March 16-17, 2000, and focused largely on experiments. Electron-molecule and electron-atom collisions initiate and drive almost all the relevant chemical processes associated with radiation chemistry, environmental chemistry, stability of waste repositories, plasma-enhanced chemical vapor deposition, plasma processing of materials for microelectronic devices and other applications, and novel light sources for research purposes (e.g. excimer lamps in the extreme ultraviolet) and in everyday lighting applications. The life sciences are a rapidly advancing field where the important role of electron-driven processes is only now beginning to be recognized. Many of the applications of electron-initiated chemical processes require results in the near term. A large-scale, multidisciplinary and collaborative effort should be mounted to solve these problems in a timely way so that their solution will have the needed impact on the urgent questions of understanding the physico-chemical processes initiated and driven by electron interactions.

  5. Appropriate Technology as Indian Technology.

    Science.gov (United States)

    Barry, Tom

    1979-01-01

    Describes the mounting enthusiasm of Indian communities for appropriate technology as an inexpensive means of providing much needed energy and job opportunities. Describes the development of several appropriate technology projects, and the goals and activities of groups involved in utilizing low scale solar technology for economic development on…

  6. Technology.

    Science.gov (United States)

    Online-Offline, 1998

    1998-01-01

    Focuses on technology, on advances in such areas as aeronautics, electronics, physics, the space sciences, as well as computers and the attendant progress in medicine, robotics, and artificial intelligence. Describes educational resources for elementary and middle school students, including Web sites, CD-ROMs and software, videotapes, books,…

  7. Play Analysis and Digital Portfolio of Major Oil Reservoirs in the Permian Basin: Application and Transfer of Advanced Geological and Engineering Technologies for Incremental Production Opportunities

    Energy Technology Data Exchange (ETDEWEB)

    Shirley P. Dutton; Eugene M. Kim; Ronald F. Broadhead; Caroline L. Breton; William D. Raatz; Stephen C. Ruppel; Charles Kerans

    2004-01-13

    are in progress: Kelly-Snyder (SACROC unit) in the Pennsylvanian and Lower Permian Horseshoe Atoll Carbonate play, Fullerton in the Leonard Restricted Platform Carbonate play, and Barnhart (Ellenburger) in the Ellenburger Selectively Dolomitized Ramp Carbonate play. For each of these detailed reservoir studies, technologies for further, economically viable exploitation are being investigated.

  8. DIGITAL PAKISTAN: OPPORTUNITIES & CHALLENGES

    Directory of Open Access Journals (Sweden)

    Ghulam Muhammad Kundi

    2008-12-01

    Full Text Available ABSTRACT IT has revolutionized the social and organizational life around the globe. Given the newness of IT as a technology, there is a lot of potential that needs to be explored. It is however, argued that as IT can revolutionize the economic development, by the same coin, although its mismanagement in adoption process can end up in problems or even straight failure of the technology at the business-end. This study was conducted with reference to opportunities and challenges in the IT adoption process in Pakistan. The aim of the study was to point out the barriers that are impeding the country’s computerization process in order to provide facts to the policy makers for smooth computerization. The primary data collected through structured questionnaires was analyzed and tested through correlation, regressions analysis and t-test. Out of 10 hypotheses, 3 were accepted while in the rest null hypotheses were not substantiated. Based on primary and secondary data analysis this study has found that all independent bureaucratic, political, education and social and cultural variables are mutually correlated and have significant impact on shaping and reshaping of IT in Pakistan, while the Pakistan IT policy is inconsistent, administrative machinery attitude is negative and non cooperative, procedures are cumbersome and implementation is weak and ineffective, not to mention the lack of IT knowledge on the bureaucratic side. The political environment is instable and law and order is worse which is discouraging the investment. Moreover, physical and legal infrastructure is insufficient and the country is lacking good quality IT professionals. IT organization alignment is another serious issue in Pakistan. However, government incentives and growing interest from the private sector indicate positive attitude towards computerization of the country.

  9. DIGITAL PAKISTAN: OPPORTUNITIES & CHALLENGES

    Directory of Open Access Journals (Sweden)

    Ghulam Muhammad Kundi

    2008-10-01

    Full Text Available IT has revolutionized the social and organizational life around the globe. Given the newness of IT as a technology, there is a lot of potential that needs to be explored. It is however, argued that as IT can revolutionize the economic development, by the same coin, although its mismanagement in adoption process can end up in problems or even straight failure of the technology at the business-end. This study was conducted with reference to opportunities and challenges in the IT adoption process in Pakistan. The aim of the study was to point out the barriers that are impeding the country’s computerization process in order to provide facts to the policy makers for smooth computerization. The primary data collected through structured questionnaires was analyzed and tested through correlation, regressions analysis and t-test. Out of 10 hypotheses, 3 were accepted while in the rest null hypotheses were not substantiated. Based on primary and secondary data analysis this study has found that all independent bureaucratic, political, education and social and cultural variables are mutually correlated and have significant impact on shaping and reshaping of IT in Pakistan, while the Pakistan IT policy is inconsistent, administrative machinery attitude is negative and non cooperative, procedures are cumbersome and implementation is weak and ineffective, not to mention the lack of IT knowledge on the bureaucratic side. The political environment is instable and law and order is worse which is discouraging the investment. Moreover, physical and legal infrastructure is insufficient and the country is lacking good quality IT professionals. IT organization alignment is another serious issue in Pakistan. However, government incentives and growing interest from the private sector indicate positive attitude towards computerization of the country.

  10. Field potential soil variability index to identify precision agriculture opportunity

    Science.gov (United States)

    Precision agriculture (PA) technologies used for identifying and managing within-field variability are not widely used despite decades of advancement. Technological innovations in agronomic tools, such as canopy reflectance or electrical conductivity sensors, have created opportunities to achieve a ...

  11. Nuevas tecnologías: posibilidades de apoyo a la investigación en red New technologies: support opportunities for network research

    Directory of Open Access Journals (Sweden)

    A. Rodríguez-Martín

    2012-11-01

    environments of research training, different inventories of the research resources that are available for exchanges and shared use between groups and laboratories, and finally, a shared scientific documentation system with the appropriate maintenance of the previously listed tools. Large administrative structures and detailed plans are not needed to comply with all of the above functions. The availability of effective tools, however, to combine efforts and search for resources in all of these areas is needed, with the agility and flexibility that allow us to currently use new communication and information technologies. The results of this research support area should lead to an increase in the efficacy and quality of the network by increasing the flow of information and the inter-group collaboration in teaching, research and professional development, along with the transfer and dissemination of research results.

  12. Situation analysis in relation to district heating and CHP in the Baltic Sea Region: Estonia, Latvia, Lithuania, Poland, Russia, Kaliningrad

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2000-11-01

    such bodies must be to secure the implementation of national energy policy, and of the acquis communautaire in the countries where this is relevant. Laying out the role gas, district heating and CHP respectively should be a main priority. Institute a continuous dialogue between key political and market actors, to optimise the relation between natural gas, district heating, and condensing power. Its aim should also be to institute measures that will boost investments. (EHS)

  13. Meeting the challenge of providing flexible learning opportunities: Considerations for technology adoption amongst academic staff | Relever le défi de fournir des occasions d’apprentissage flexibles : considérations pour l’adoption de la technologie

    Directory of Open Access Journals (Sweden)

    Negin Mirriahi

    2015-03-01

    Full Text Available This paper reports on a subset of findings from a larger study investigating resistance from academic staff to the integration of technology with on-campus foreign language teaching at one North American higher education institution. The study revealed that the factors influencing technology adoption paralleled Davis’ Technology Acceptance Model’s tenets of perceived usefulness and ease of use. Further, this study supports Lai and Savage’s (2013 assertion of a lack of attention to the pedagogical affordances of technology when adoption decisions are made by instructors, thus we highlight the need for higher education leaders to determine strategies promoting awareness of the benefits technology-enabled teaching and learning can bring to advance educationally-rich flexible learning opportunities. Cet article traite d’un sous-ensemble de résultats provenant d’une étude plus vaste ayant enquêté sur la résistance des universitaires envers l’intégration de la technologie à l’enseignement en langue étrangère sur le campus dans un établissement nord-américain d’études supérieures. L’étude a révélé que les facteurs ayant une influence sur l’adoption de la technologie coïncident avec les principes du modèle d’acceptation de la technologie de Davis sur l’utilité perçue et la facilité d’utilisation. De plus, cette étude appuie l’assertion de Lai et Savage (2013 d’un manque d’attention envers les affordances pédagogiques de la technologie lorsque les décisions d’adoption sont prises par les formateurs. Nous soulignons donc le besoin, pour les meneurs de l’éducation supérieure, de déterminer les stratégies qui favorisent la connaissance des avantages de l’enseignement et de l’apprentissage que permet la technologie pour faire progresser les occasions d’apprentissage flexibles et riches sur le plan éducatif.

  14. Child-Computer Interaction SIG: New Challenges and Opportunities

    DEFF Research Database (Denmark)

    Hourcade, Juan Pablo; Iversen, Ole Sejer; Revelle, Glenda

    2016-01-01

    This SIG will provide child-computer interaction researchers and practitioners an opportunity to discuss four topics that represent new challenges and opportunities for the community. The four areas are: interactive technologies for children under the age of five, technology for inclusion, privacy...

  15. Altmetric opportunities for Libraries

    NARCIS (Netherlands)

    Gerritsma, W.

    2015-01-01

    Just over five years ago the concept of altmetrics was minted. For libraries and librarians this has brought a new plethora of opportunities. In the first place there is the traditional extension role. Outreach opportunities on the subject of altmetrics are manyfold, and librarians could seize the o

  16. 75 FR 3791 - Broadband Technology Opportunities Program

    Science.gov (United States)

    2010-01-22

    ... remote terminal, fiber node, wireless tower, or other equivalent access point) to a primary IP routing entity in a centralized facility (i.e., in the central office, the cable headend, the wireless switching... wireless switching station, or other equivalent centralized facility) to an Internet point of presence....

  17. Defense Technology Opportunities for First Responders

    Science.gov (United States)

    2004-11-01

    Forecast International, Mindbranch Market Research and Analysis , and Dialog were searched. The following are quotes from: Electro-Optical (EO...data is available for UWB GPR. Business Communications Company (BCC), Frost & Sullivan, Forecast International, Mindbranch Market Research and Analysis , and

  18. Recycling technologies and market opportunities: Proceedings

    Energy Technology Data Exchange (ETDEWEB)

    Goland, A.N.; Petrakis, L. [eds.

    1993-09-20

    These proceedings are the result of our collective effort to meet that challenge. They reflect the dedication and commitment of many people in government, academia, the private sector and national laboratories to finding practical solutions to one of the most pressing problems of our time -- how to deal effectively with the growing waste s that is the product of our affluent industrial society. The Conference was successful in providing a clear picture of the scope of the problem and of the great potential that recycling holds for enhancing economic development while at the same time, having a significant positive impact on the waste management problem. That success was due in large measure to the enthusiastic response of our panelists to our invitation to participate and share their expertise with us.

  19. Equal opportunities in diversity

    CERN Multimedia

    Laëtitia Pedroso

    2010-01-01

    Promoting equal opportunities at CERN and advising the Director-General on all related matters is the task of the Equal Opportunities Officer, Doris Chromek-Burckhart, and Tim Smith, chair of the Equal Opportunities Advisory Panel. Changes are being introduced: in future, the focus of their work will be broadened to cover all aspects of diversity promotion.   The term "equal opportunities" has always been broader in scope than the equal treatment of men and women but this is what it has traditionally been confined to in practice. "We wanted to change how people see our mission", explains Doris Chromek-Burckhart. The word "diversity" has much wider connotations than "equal opportunities" and makes it clearer that we are also dealing with differences in nationality, religion, age, culture and physical ability”. Getting away from the old clichés is vital to ensuring equal treatment for everyone. The diversit...

  20. Future Propulsion Opportunities for Commuter Airplanes

    Science.gov (United States)

    Strack, W. C.

    1982-01-01

    Commuter airplane propulsion opportunities are summarized. Consideration is given to advanced technology conventional turboprop engines, advanced propellers, and several unconventional alternatives: regenerative turboprops, rotaries, and diesels. Advanced versions of conventional turboprops (including propellers) offer 15-20 percent savings in fuel and 10-15 percent in DOC compared to the new crop of 1500-2000 SHP engines currently in development. Unconventional engines could boost the fuel savings to 30-40 percent. The conclusion is that several important opportunities exist and, therefore, powerplant technology need not plateau.

  1. Nanotechnology in biorobotics: opportunities and challenges

    Energy Technology Data Exchange (ETDEWEB)

    Ricotti, Leonardo, E-mail: l.ricotti@sssup.it; Menciassi, Arianna [Scuola Superiore Sant’Anna, The BioRobotics Institute (Italy)

    2015-02-15

    Nanotechnology recently opened a series of unexpected technological opportunities that drove the emergence of novel scientific and technological fields, which have the potential to dramatically change the lives of millions of citizens. Some of these opportunities have been already caught by researchers working in the different fields related to biorobotics, while other exciting possibilities still lie on the horizon. This article highlights how nanotechnology applications recently impacted the development of advanced solutions for actuation and sensing and the achievement of microrobots, nanorobots, and non-conventional larger robotic systems. The open challenges are described, together with the most promising research avenues involving nanotechnology.

  2. PERFORMANCE ANALYSIS OF l kW RESIDENTIAL SOFC-CHP SYSTEM%1kW家用SOFC-CHP系统建模及性能分析

    Institute of Scientific and Technical Information of China (English)

    徐晗; 党政; 白博峰

    2011-01-01

    A combined heating and power system (CHP) driven by natrual gas was established based on solid oxide fuel cell (SOFC), relevant SOFC heat and mass transfer equations as well as electrochemical equations were deduced, and component models were built and solved by FORTRAN as a tool to predict the system performance of a 1 kW residential SOFC-CHP system. The results indicate that the system efficiency is much higher than the generating efficiency of SOFC under the design-point condition. A maximum value of electric power appears with the increase of the inlet fuel flow, fuel utilization and electric efficiency decrease, system cogeneration efficiency experiences a rising trend, and the cell temperature gradient distribution becomes growingly even. Reducing the excess air ratio could enhance the system performance.The above conclusions are very useful for the design and optimization of the residential SOFC-CHP system.%构建一个以天然气为燃料的SOFC-CHP系统,推导SOFC传热传质及电化学方程,建立各个组件的数学模型,编写计算程序,对发电功率为1kW的家用SOFC-CHP系统在设计工况下进行性能模拟并探讨不同系统参数对性能的影响.计算结果表明:在设计工况下,系统热电联供效率远高于电池单独发电的效率;此外,随着燃料入口流量的增大,系统发电功率存在一个最大值,燃料利用率与发电效率不断减小,系统热电联供效率不断增大,SOFC的温度梯度分布则越来越平缓;同时发现降低过量空气系数可以提高该CHP系统的性能.

  3. 从数字城市到智慧城市的技术发展机遇与挑战%Opportunities and challenges in technology development from Digital City to Smart City

    Institute of Scientific and Technical Information of China (English)

    梁军; 黄骞

    2013-01-01

    Today, an important change from Digital City to Smart City is occurring with in the City Informatization Progress, which brought opportunities and challenges to the concepts and techniques development.In this article, we first discuss the role while Digital City plays in the City System, then reach the conclusion that the integration between Digital City and Internet of Things would push the evolution from from Digital City to Smart City.Bybuilding a comprehensive city digital neural network system, the city system would become more and more intelligento In the end, we discuss opportunities and challenges brought bythe key technologies in Smart City development, such as Network, Internet of Things, Big Data, NoSQL, SOA, ESB, Cloud Computing, GIS ,BIM, Social Computing etc.%当前,城市信息化正在历经从数字城市向智慧城市的重要转变,这也带来了理念与技术发展的诸多机遇与挑战,本文首先讨论数字城市在城市系统中的地位与意义,进一步明确了数字城市与物联网的集成,使数字城市向智慧城市发展,通过构筑全面的城市数字神经网络系统,促使城市系统的行为智能化的趋势.最后讨论了网络通信技术、物联网、大数据与NoSQL、SOA与ESB、云计算、地理信息技术与BIM、社会计算及其他它相关技术的发展对智慧城市建设的推动作用,以及这些技术在智慧城市建设的集成应用中将带来新的机遇与挑战.

  4. Equal Opportunities Questionnaire

    CERN Document Server

    2007-01-01

    The initiative to promote Equal Opportunities at CERN started in 1993. The first Equal Opportunities Officer was appointed in 1996, which was followed by the creation of the Equal Opportunities Advisory Panel in 1998. Initially the concern was mainly the fair treatment of women in the work-place. Today the emphasis has evolved to ensuring that diversity is used to increase creativity and productivity in the work-place. In order to ensure that all aspects of Equal Opportunities and Diversity are covered, CERN’s Equal Opportunities team has prepared a survey to obtain your input. Your answers are confidential and will only be used for generating statistics. The questionnaire is on-line and can be accessed via: https://espace.cern.ch/EOQ. We hope that you will take a few minutes of your time to give your input and would be grateful if you could reply before 15/10/07. For further information about Equal Opportunities at CERN see: http://cern.ch/equal-opportunities The Equa...

  5. Equal Opportunities Questionnaire

    CERN Document Server

    2007-01-01

    The initiative to promote Equal Opportunities at CERN started in 1993. The first Equal Opportunities Officer was appointed in 1996 followed by the creation of the Equal Opportunities Advisory Panel in 1998. Initially the concern was mainly the fair treatment of women in the work-place. Today the emphasis has evolved to ensuring that diversity is used to increase creativity and productivity in the work-place. In order to ensure that all aspects of Equal Opportunities and Diversity are covered, CERN’s Equal Opportunities team has prepared a survey to obtain your input. Your answers are confidential and will only be used for generating statistics. The questionnaire is on-line and can be accessed via: https://espace.cern.ch/EOQ. We hope that you will take a few minutes of your time to give your input and would be grateful if you could reply before 15/10/07. For further information about Equal Opportunities at CERN see: http://cern.ch/equal-opportunities The Equal Opportuni...

  6. Compelling Research Opportunities using Isotopes

    Energy Technology Data Exchange (ETDEWEB)

    None

    2009-04-23

    Isotopes are vital to the science and technology base of the US economy. Isotopes, both stable and radioactive, are essential tools in the growing science, technology, engineering, and health enterprises of the 21st century. The scientific discoveries and associated advances made as a result of the availability of isotopes today span widely from medicine to biology, physics, chemistry, and a broad range of applications in environmental and material sciences. Isotope issues have become crucial aspects of homeland security. Isotopes are utilized in new resource development, in energy from bio-fuels, petrochemical and nuclear fuels, in drug discovery, health care therapies and diagnostics, in nutrition, in agriculture, and in many other areas. The development and production of isotope products unavailable or difficult to get commercially have been most recently the responsibility of the Department of Energy's Nuclear Energy program. The President's FY09 Budget request proposed the transfer of the Isotope Production program to the Department of Energy's Office of Science in Nuclear Physics and to rename it the National Isotope Production and Application program (NIPA). The transfer has now taken place with the signing of the 2009 appropriations bill. In preparation for this, the Nuclear Science Advisory Committee (NSAC) was requested to establish a standing subcommittee, the NSAC Isotope Subcommittee (NSACI), to advise the DOE Office of Nuclear Physics. The request came in the form of two charges: one, on setting research priorities in the short term for the most compelling opportunities from the vast array of disciplines that develop and use isotopes and two, on making a long term strategic plan for the NIPA program. This is the final report to address charge 1. NSACI membership is comprised of experts from the diverse research communities, industry, production, and homeland security. NSACI discussed research opportunities divided into three areas: (1

  7. Opportunities for computer abuse

    DEFF Research Database (Denmark)

    Willison, Robert Andrew; Backhouse, James

    2005-01-01

    Systems risk refers to the likelihood that an IS is inadequately guarded against certain types of damage or loss. While risks are posed by acts of God, hackers and viruses, consideration should also be given to the `insider' threat of dishonest employees, intent on undertaking some form of computer...... for the offender. To achieve this goal a model known as the `Crime Specific Opportunity Structure' is advanced. Focussing on the opportunities for computer abuse, the model addresses the nature of such opportunities with regards to the organisational context and the threats posed by rogue employees. Drawing...

  8. Opportunities with thermoplastics.

    Science.gov (United States)

    Vaahs, Tilo

    2003-04-01

    Whether as substitutes for glass and metal, or completely novel injection moulded applications, engineering polymers offer a range of opportunities for developing cost-effective, safe and smart medical devices.

  9. CHP biomass gasifier for the Zwarts Gerbera Nursery. Technical and economic feasibility; Biomassavergasser-WKK voor Gerberakwekerij Zwarts. Technische inpassing en economische haalbaarheid

    Energy Technology Data Exchange (ETDEWEB)

    Peeters, S.; Hart, A. [Energy Matters, Driebergen (Netherlands)

    2011-10-15

    This report describes the feasibility of a CHP gasifier at the Zwarts gerbera nursery. Using the insights from this study, a picture has been sketched for energy production by means of gasification in the horticultural sector. Note, however, that each plant specie has its own specific growth requirements in terms of nutrients, heating-cooling, light, but also relative humidity and CO2. So a 'typical' horticulturer with an 'average' energy requirement is hard to define. The economic viability must be determined for each individual situation. The outcomes of this study can therefore not be automatically used for other projects. Technically, a lot is possible, so the submitted quotes show. Of the 16 suppliers, 3 offer CHP gasifiers which, subject to conditions, not only burn wood but also other low-grade residual waste such as road verge grass, reed and miscanthus. This low-grade residual waste has the advantage of being cheaper than wood. A low biomass price lowers the operating costs and improves the economic profitability of the relatively expensive installations. The investment for a complete CHP gasifier is 5 to 10 times higher than for a normal gas CHP installation. The CO2 consumption also influences the economic profitability. Buying CO2 is a costly business. The technical and economic feasibility of harvesting CO2 from flue gas was therefore explored. Two CO2 harvesting installations (of Procede and Knook) were examined for this purpose. According to Procede and Knook, CO2 harvesting is not economically profitable for a CHP gasifier with a relatively low power capacity (up to 800 kWe). CO2 procurement or generation by means of the existing gas-fired boiler therefore seems more viable. The technical-economic feasibility study shows that an investment in a CHP gasifier is not profitable due to the relatively high investment and maintenance costs. CO2 demand and the uncertain biomass prices are stumbling blocks. However, the picture changes

  10. Modelling of a CHP SOFC system fed with biogas from anaerobic digestion of municipal waste integrated with solar collectors and storage unit

    Directory of Open Access Journals (Sweden)

    Domenico Borello

    2012-12-01

    Full Text Available The paradigm of the sustainable energy community is recognized as the future energy approach due to its economical, technical and environmental benefits. Future systems should integrate renewable energy systems applying a “community-scale” approach to maximize energy performances, while minimizing environmental impacts. Efforts have to be directed toward the promotion of integrated technical systems needed to expand the use of renewable energy resources, to build sustainable local and national energy networks, to guarantee distribution systems for urban facilities and to reduce pollution. In this framework poly-generation is a promising design perspective, for building and district scale applications, in particular where different types of energy demand are simultaneously present and when sufficient energy intensity justifies investments in smart grids and district heating networks. In situ anaerobic digestion of biomass and organic waste has the potential to provide sustainable distributed generation of electric power together with a viable solution for the disposal of municipal solid wastes. A thermal recovery system can provide the heat required for district-heating. The system analysed is a waste-to-energy combined heat and power (CHP generation plant that perfectly fits in the sustainable energy community paradigm. The power system is divided in the following sections: a a mesophilic - single phase anaerobic digestion of Organic Fraction of Municipal Solid Waste for biogas production; b a fuel treatment section with desulphurizer and pre-reformer units; c a Solid Oxide Fuel Cell (SOFC for CHP production; d a solar collector integrated system(integrated storage system - ISS. An integrated TRNSYS/ASPEN Plus model for simulating the power system behaviour during a typical reference period (day or year was developed and presented. The proposed ISS consists of a solar collector integrated with storage systems system designed to

  11. Convergence creates opportunities across health care system.

    Science.gov (United States)

    Fox, Brent I; Felkey, Bill G

    2014-04-01

    Industrial design students at Auburn do a creativity exercise where they are asked to combine a common household appliance with an animal. Have you seen a snake light? In health technology, we have a similar opportunity. In the connection between jewelry and vital sign monitoring technology or household security and health status monitoring, we are witnessing active convergence that will benefit patients, providers, and health systems.

  12. Science Policy: A World of Opportunities

    Science.gov (United States)

    Mazza, Anne-Marie

    2017-01-01

    Opportunities are everywhere for scientists to engage in public policy, whether they stay at the bench or decide to move directly into the policy arena. In its 19th year, the National Academies of Sciences, Engineering, and Medicine's Christine Mirzayan Science and Technology Policy Graduate Fellowship Program provides early career individuals with the opportunity to spend 12 weeks at the Academies in Washington, DC learning about science and technology policy and the role that scientists and engineers play in advising the nation. Fellows leave the program prepared to engage in policy whether in DC, at the international level, or at the state and local level back at their home institutions. This discussion will explore these opportunities and highlight some of the positions pursued by Mirzayan alumni.

  13. External costs related to power production technologies. ExternE national implementation for Denmark

    Energy Technology Data Exchange (ETDEWEB)

    Schleisner, L.; Sieverts Nielsen, P.

    1997-12-01

    The objective of the ExternE National Implementation project has been to establish a comprehensive and comparable set of data on externalities of power generation for all EU member states and Norway. The tasks include the application of the ExternE methodology to the most important fuel cycles for each country as well as to update the already existing results; to aggregate these site- and technology-specific results to more general figures. The current report covers the results of the national implementation for Denmark. Three different fuel cycles have been chosen as case studies. These are fuel cycles for an offshore wind farm and a wind farm on land, a decentralised CHP plant based on natural gas and a decentralised CHP plant based on biogas. The report covers all the details of the application of the methodology to these fuel cycles aggregation to a national level. (au) EU-JOULE 3. 59 tabs., 25 ills., 61 refs.

  14. PV opportunities in India

    Science.gov (United States)

    Stone, Jack L.; Ullal, Harin S.

    1996-01-01

    The growing middle class in India, coupled with a need for electricity to provide basic services to the masses, provides an opportunity to deploy photovoltaic systems in cost-effective applications ranging from grid-connected to isolated location requirements. This need is being satisfied by aggressive government programs, the availability of funds from agencies such as the World Bank, and the desire of Indian industries to form joint ventures for in-country manufacturing. The relaxed restrictions on doing business in India makes today's opportunities timely indeed.

  15. Research opportunities in photochemical sciences

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-07-01

    The workshop entitled {open_quotes}Research Opportunities in Photochemical Sciences{close_quotes} was initiated by the U.S. Department of Energy (DOE), Office of Energy Research (ER), Office of Basic Energy Sciences (BES), Division of Chemical Sciences. The National Renewable Energy Laboratory (NREL) in Golden, Colorado was requested by ER to host the workshop. It was held February 5-8, 1996 at the Estes Park Conference Center, Estes Park, CO, and attended by about 115 leading scientists and engineers from the U.S., Japan, and Europe; program managers for the DOE ER and Energy Efficiency and Renewable Energy (EERE) programs also attended. The purpose of the workshop was to bridge the communication gap between the practioneers and supporters of basic research in photochemical science and the practioneers and supporters of applied research and development in technologies related to photochemical science. For the purposes of the workshop the definition of the term {open_quotes}photochemical science{close_quotes} was broadened to include homogeneous photochemistry, heterogeneous photochemistry, photoelectrochemistry, photocatalysis, photobiology (for example, the light-driven processes of biological photosynthesis and proton pumping), artificial photosynthesis, solid state photochemistry, and solar photochemistry. The technologies under development through DOE support that are most closely related to photochemical science, as defined above, are the renewable energy technologies of photovoltaics, biofuels, hydrogen energy, carbon dioxide reduction and utilization, and photocatalysis for environmental cleanup of water and air. Individual papers were processed separately for the United states Department of Energy databases.

  16. Information and Communication Technologies and Industrial Clusters:Opportunities and Spread%信息技术对产业集群空间组织的影响研究

    Institute of Scientific and Technical Information of China (English)

    宋周莺; 刘卫东

    2013-01-01

      信息时代,信息技术对传统地理学的许多理论和概念提出了新的挑战。其中,尤其值得我们关注的是信息技术对传统产业集群理论提出的挑战以及赋予其的新活力。本文结合统计数据、企业访谈和问卷调查等数据,以37个实地调研的产业集群为案例,分析信息技术可能带来的产业集群空间组织的演变及延伸。研究表明,信息技术的广泛应用为产业集群的发展和演化提供了一种新的契机和媒介,信息技术带来的产业集群空间组织变革过程中既有集聚又有扩散。总体来说,可以归纳为四种模式,即网络式集群、“信息港”式集群、虚拟集群、走向衰落。%In information age, the widespread application of information and communica-tion technologies (ICTs) has been argued to be changing the way by which companies compete and succeed, the business models, and the value-creating processes. Such recent advances have initiated debates on the changing of traditional industrial cluster theory. On one hand, ICTs has been offering opportunities to industrial clusters, as to transfer, col-lect, manage a great amount of information. On the other hand, ICTs is important to the spatial transformation of firms, especially for small and medium-sized enterprises(SMEs), as to reduce the space and time barriers. It is against such a background that this paper takes 37 industrial clusters in China as case studies, to look into the impacts of ICTs on spatial organization of industrial clusters. The authors argue that ICTs has been a key factor in spatial transformation of clusters, and the application of ICTs tends to lead to four kinds of cluster organization, as network-cluster, teleport-cluster, virtual cluster and declining-cluster.

  17. Urbanization as opportunity

    OpenAIRE

    Fuller, Brandon; Romer, Paul

    2014-01-01

    Urbanization deserves urgent attention from policy makers, academics, entrepreneurs, and social reformers of all stripes. Nothing else will create as many opportunities for social and economic progress. The urbanization project began roughly 1,000 years after the transition from the Pleistocene to the milder and more stable Holocene interglacial. In 2010, the urban population in developing...

  18. Investment Insight Opportunities Ahead

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    Over the next five years, China will be shitting its focus to more balanced development and what it sees as quality growth. Its two main strategies are promoting innovation-with the government-backed industrial upgrading-and strengthening the rural economy. This shift will lead to massive investment and fresh, wealth-making opportunities. In the stock

  19. Expanding Student Assessment Opportunities.

    Science.gov (United States)

    Bartscher, Beth; Carter, Andrea; Lawlor, Anna; McKelvey, Barbara

    This paper describes an approach for expanding assessment opportunities for students to demonstrate their understanding of content. The targeted population consisted of elementary and junior high school students in two schools in a growing middle-class community in north central Illinois. The elementary school enrolled 467 students and the junior…

  20. Opportunity Cost: A Reply

    Science.gov (United States)

    Parkin, Michael

    2016-01-01

    The author's objective for this reply in reexamining opportunity cost was to draw attention to two conflicting definitions of the concept in current use and to argue the case for dropping one of them. The comments of Daniel Arce, Rod O'Donnell, and Daniel Stone might be read as demonstration that the author has failed on both counts. Such a…

  1. Land of Expat Opportunity

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    The international work force continues to grow as employment opportunities entice foreigners to live in China Forty-four-year-old Daniell Goodin has spent almost two decades working abroad, calling Indonesia, Hong Kong and the United States "home" for different periods of time. In May, the Australian native arrived in China, working

  2. Scientific Opportunities with ispace, a Lunar Exploration Company

    Science.gov (United States)

    Acierno, K. T.

    2016-11-01

    This presentation introduces ispace, a Tokyo-based lunar exploration company. Technology applied to the Team Hakuto Google Lunar XPRIZE mission will be described. Finally, it will discuss how developing low cost and mass efficient rovers can support scientific opportunities.

  3. Overcoming Residents Opportunity Apathy in Danish Social Housing Democracy

    DEFF Research Database (Denmark)

    Bertelsen, Olav W.

    2014-01-01

    In this paper, I discuss how various technologies can support democratic collaboration in the social housing sector in Denmark, and help overcome opportunity apathy. I exemplify the discussion with an ongoing process of strategy development, in a Danish housing organization....

  4. User Frustrations as Opportunities

    Directory of Open Access Journals (Sweden)

    Michael Weiss

    2012-04-01

    Full Text Available User frustrations are an excellent source of new product ideas. Starting with this observation, this article describes an approach that entrepreneurs can use to discover business opportunities. Opportunity discovery starts with a problem that the user has, but may not be able to articulate. User-centered design techniques can help elicit those latent needs. The entrepreneur should then try to understand how users are solving their problem today, before proposing a solution that draws on the unique skills and technical capabilities available to the entrepreneur. Finally, an in-depth understanding of the user allows the entrepreneur to hone in on the points of difference and resonance that are the foundation of a strong customer value proposition.

  5. Project X: Physics Opportunities

    CERN Document Server

    Kronfeld, Andreas S; Al-Binni, Usama; Altmannshofer, Wolfgang; Ankenbrandt, Charles; Babu, Kaladi; Banerjee, Sunanda; Bass, Matthew; Batell, Brian; Baxter, David V; Berezhiani, Zurab; Bergevin, Marc; Bernstein, Robert; Bhattacharya, Sudeb; Bishai, Mary; Blum, Thomas; Bogacz, S Alex; Brice, Stephen J; Brod, Joachim; Bross, Alan; Buchoff, Michael; Burgess, Thomas W; Carena, Marcela; Castellanos, Luis A; Chattopadhyay, Subhasis; Chen, Mu-Chun; Cherdack, Daniel; Christ, Norman H; Chupp, Tim; Cirigliano, Vincenzo; Coloma, Pilar; Coppola, Christopher E; Cowsik, Ramanath; Crabtree, J Allen; Delahaye, Jean-Pierre; Denisov, Dmitri; deNiverville, Patrick; de Gouvêa, André; Dharmapalan, Ranjan; Dolgov, Alexander; Dvali, Georgi; Eichten, Estia; Engelfried, Jürgen; Ferguson, Phillip D; Gabriel, Tony; Gal, Avraham; Gallmeier, Franz; Ganezer, Kenneth S; Gardner, Susan; Glenzinski, Douglas; Godfrey, Stephen; Golubeva, Elena S; Gori, Stefania; Graves, Van B; Greene, Geoffrey; Griffard, Cory L; Haisch, Ulrich; Handler, Thomas; Hartfiel, Brandon; Hawari, Ayman; Heilbronn, Lawrence; Hill, James E; Huber, Patrick; Jaffe, David E; Johnson, Christian; Kamyshkov, Yuri; Kaplan, Daniel M; Kerbikov, Boris; Kiburg, Brendan; Kirk, Harold G; Klein, Andreas; Knoepfel, Kyle; Kopeliovich, Boris; Kopeliovich, Vladimir; Kopp, Joachim; Korsch, Wolfgang; Kribs, Graham; Lipton, Ronald; Liu, Chen-Yu; Lorenzon, Wolfgang; Lu, Zheng-Tian; Makins, Naomi C R; McKeen, David; Mills, Geoffrey; Mohapatra, Rabindra; Mokhov, Nikolai V; Mocko, Michael; Muhrer, Guenter; Mumm, Pieter; Okun, Lev; Neuffer, David; Palmer, Mark A; Palmer, Robert; Pattie, Robert W; Phillips, David G; Pronsikh, Vitaly; Pitts, Kevin; Pospelov, Maxim; Quigg, Chris; Ramberg, Erik; Ray, Amlan; Reimer, Paul E; Richards, David G; Ritz, Adam; Roy, Amit; Ruggles, Arthur; Ryne, Robert; Sarkar, Utpal; Saunders, Andy; Semertzidis, Yannis K; Serebrov, Anatoly; Shimizu, Hirohiko; Shrock, Robert; Snopok, Pavel V; Snow, William M; Sikdar, Arindam K; Soha, Aria; Spanier, Stefan; Striganov, Sergei; Tang, Zhaowen; Townsend, Lawrence; Urheim, Jon; Vainshtein, Arkady; Van Kooten, Richard J; Van de Water, Richard; Van de Water, Ruth S; Wehring, Bernard; Whitehead, Lisa; Wilson, Robert J; Worcester, Elizabeth; Young, Albert R; Wester, William C; Zeller, Geralyn

    2013-01-01

    Part 2 of "Project X: Accelerator Reference Design, Physics Opportunities, Broader Impacts". In this Part, we outline the particle-physics program that can be achieved with Project X, a staged superconducting linac for intensity-frontier particle physics. Topics include neutrino physics, kaon physics, muon physics, electric dipole moments, neutron-antineutron oscillations, new light particles, hadron structure, hadron spectroscopy, and lattice-QCD calculations.

  6. Equal Opportunities Advisory Panel

    CERN Multimedia

    HR Department

    2006-01-01

    At its meeting on 7 December 2006, the Standing Concertation Committee took note of the appointment of four new members of the Panel: Wisla Carena, Pierre Charrue, Sue Foffano and Markus Nordberg. The present composition of the Panel (appointed ad personam) is as follows: Tiziano Camporesi (Chairperson), Wisla Carena, Pierre Charrue, Sue Foffano, Josi Schinzel (Equal Opportunities Officer), Markus Nordberg, Christine Petit-Jean-Genaz et Elena Wildner. Human Resources Department Tel. 74480

  7. Engineering opportunities in cancer immunotherapy.

    Science.gov (United States)

    Jeanbart, Laura; Swartz, Melody A

    2015-11-24

    Immunotherapy has great potential to treat cancer and prevent future relapse by activating the immune system to recognize and kill cancer cells. A variety of strategies are continuing to evolve in the laboratory and in the clinic, including therapeutic noncellular (vector-based or subunit) cancer vaccines, dendritic cell vaccines, engineered T cells, and immune checkpoint blockade. Despite their promise, much more research is needed to understand how and why certain cancers fail to respond to immunotherapy and to predict which therapeutic strategies, or combinations thereof, are most appropriate for each patient. Underlying these challenges are technological needs, including methods to rapidly and thoroughly characterize the immune microenvironment of tumors, predictive tools to screen potential therapies in patient-specific ways, and sensitive, information-rich assays that allow patient monitoring of immune responses, tumor regression, and tumor dissemination during and after therapy. The newly emerging field of immunoengineering is addressing some of these challenges, and there is ample opportunity for engineers to contribute their approaches and tools to further facilitate the clinical translation of immunotherapy. Here we highlight recent technological advances in the diagnosis, therapy, and monitoring of cancer in the context of immunotherapy, as well as ongoing challenges.

  8. Demokrat Parti’nin Kuruluş Süreci ve DP – CHP Siyasî Mücadelesi (1945-1947)

    OpenAIRE

    2016-01-01

    Bu çalışmada, çok partili hayata dönüşle başlayan sürecin en önemli muhalefetpartisi olan DP’nin kuruluş sürecini ve partinin bu süreçte siyasi olarakyaşadığı olaylar üzerinde durulmuştur. Çiftçiyi Topraklandırma Kanunusonrasında ortaya çıkan DP, oluşum süreci boyunca CHP tarafından birtakımengellemelerle karşılaşmıştır. Yapılan baskılara rağmen, parti teşkilatlarıaralıksız olarak çalışarak, 1950 seçimlerini kazanmış ve iktidar olmuşlardır.Ancak bu süreç kolay gerçekleşmemiştir. Bu çalışma 19...

  9. Overview of energy-conservation research opportunities

    Energy Technology Data Exchange (ETDEWEB)

    Hopp, W.J.; Hauser, S.G.; Hane, G.J.; Gurwell, W.E.; Bird, S.P.; Cliff, W.C.; Williford, R.E.; Williams, T.A.; Ashton, W.B.

    1981-12-01

    This document is a study of research opportunities that are important to developing advanced technologies for efficient energy use. The study's purpose is to describe a wide array of attractive technical areas from which specific research and development programs could be implemented. Research areas are presented for potential application in each of the major end-use sectors. The study develops and applies a systematic approach to identifying and screening applied energy conservation research opportunities. To broadly cover the energy end-use sectors, this study develops useful information relating to the areas where federally-funded applied research will most likely play an important role in promoting energy conservation. This study is not designed to produce a detailed agenda of specific recommended research activities. The general information presented allows uniform comparisons of disparate research areas and as such provides the basis for formulating a cost-effective, comprehensive federal-applied energy conservation research strategy. Chapter 2 discusses the various methodologies that have been used in the past to identify research opportunities and details the approach used here. In Chapters 3, 4, and 5 the methodology is applied to the buildings, transportation, and industrial end-use sectors and the opportunities for applied research in these sectors are discussed.Chapter 6 synthesizes the results of the previous three chapters to give a comprehensive picture of applied energy conservation research opportunities across all end-use sectors and presents the conclusions to the report.

  10. Emerging opportunities: the internet, marketing and museums

    Directory of Open Access Journals (Sweden)

    Richani Evdoxia

    2016-01-01

    Full Text Available The tremendous impact of applying new technologies is obvious when it comes to museums. Internet forms an integral part of museums everyday life and decision making. Websites, online communities, social media, and mobile applications comprise elements of the modern museum’s digital self, which complements the real museum of permanent and temporary exhibitions, storage rooms, visitors’ facilities, laboratories and, most important, museum objects. This environment inevitably affects museum marketing strategies and creates relevant opportunities.

  11. [Progress on biogas technology and engineering].

    Science.gov (United States)

    Liu, Xiaofeng; Yuan, Yuexiang; Yan, Zhiying

    2010-07-01

    Dwindling supplies of conventional energy sources and the demand to increase the share of renewable energy for sustainability have increased the significance of biogas, the product of synergistic fermentation of biodegrable organic wastes from municipal, agricultural and industrial activities by microbial populations under anaerobic conditions. With extensive research and engineering practice, many technologies and modes have been developed for biogas production and application. Currently, the most widely used mode is the complete-mixing mesophilic fermentation. Europe, especially Germany, is leading the world in the combined heat and power production (CHP) from biogas. In this paper, updated progress in biogas technologies is reviewed, with focuses on anaerobic microorganisms, bioreactor configurations and process development, biogas production and applications, in which perspectives of biogas as a clean and renewable energy are projected.

  12. Funding Opportunity: Genomic Data Centers

    Science.gov (United States)

    Funding Opportunity CCG, Funding Opportunity Center for Cancer Genomics, CCG, Center for Cancer Genomics, CCG RFA, Center for cancer genomics rfa, genomic data analysis network, genomic data analysis network centers,

  13. New imaging techniques and opportunities in endoscopy.

    Science.gov (United States)

    Kiesslich, Ralf; Goetz, Martin; Hoffman, Arthur; Galle, Peter Robert

    2011-09-06

    Gastrointestinal endoscopy is undergoing major improvements, which are driven by new available technologies and substantial refinements of optical features. In this Review, we summarize available and evolving imaging technologies that could influence the clinical algorithm of endoscopic diagnosis. Detection, characterization and confirmation are essential steps required for proper endoscopic diagnosis. Optical and nonoptical methods can help to improve each step; these improvements are likely to increase the detection rate of neoplasias and reduce unnecessary endoscopic treatments. Furthermore, functional and molecular imaging are emerging as new diagnostic tools that could provide an opportunity for personalized medicine, in which endoscopy will define disease outcome or predict the response to targeted therapy.

  14. Geothermal development opportunities in developing countries

    Energy Technology Data Exchange (ETDEWEB)

    Kenkeremath, D.C.

    1989-11-16

    This report is the proceedings of the Seminar on geothermal development opportunities in developing countries, sponsored by the Geothermal Division of the US Department of Energy and presented by the National Geothermal Association. The overall objectives of the seminar are: (1) Provide sufficient information to the attendees to encourage their interest in undertaking more geothermal projects within selected developing countries, and (2) Demonstrate the technological leadership of US technology and the depth of US industry experience and capabilities to best perform on these projects.

  15. Smart grids opportunities, developments, and trends

    CERN Document Server

    Ali, A B M Shawkat

    2013-01-01

    A Smart Grid delivers renewable energy as a main source of electricity from producers to consumers using two-way monitoring through Smart Meter technology that can remotely control consumer electricity use. This can help to storage excess energy; reduce costs, increase reliability and transparency, and make processes more efficiently. Smart Grids: Opportunities, Developments, and Trends discusses advances in Smart Grid in today's dynamic and rapid growing global economical and technological environments.Current development in the field are systematically explored with an introduction, detailed

  16. Plastics recycling: challenges and opportunities.

    Science.gov (United States)

    Hopewell, Jefferson; Dvorak, Robert; Kosior, Edward

    2009-07-27

    Plastics are inexpensive, lightweight and durable materials, which can readily be moulded into a variety of products that find use in a wide range of applications. As a consequence, the production of plastics has increased markedly over the last 60 years. However, current levels of their usage and disposal generate several environmental problems. Around 4 per cent of world oil and gas production, a non-renewable resource, is used as feedstock for plastics and a further 3-4% is expended to provide energy for their manufacture. A major portion of plastic produced each year is used to make disposable items of packaging or other short-lived products that are discarded within a year of manufacture. These two observations alone indicate that our current use of plastics is not sustainable. In addition, because of the durability of the polymers involved, substantial quantities of discarded end-of-life plastics are accumulating as debris in landfills and in natural habitats worldwide. Recycling is one of the most important actions currently available to reduce these impacts and represents one of the most dynamic areas in the plastics industry today. Recycling provides opportunities to reduce oil usage, carbon dioxide emissions and the quantities of waste requiring disposal. Here, we briefly set recycling into context against other waste-reduction strategies, namely reduction in material use through downgauging or product reuse, the use of alternative biodegradable materials and energy recovery as fuel. While plastics have been recycled since the 1970s, the quantities that are recycled vary geographically, according to plastic type and application. Recycling of packaging materials has seen rapid expansion over the last decades in a number of countries. Advances in technologies and systems for the collection, sorting and reprocessing of recyclable plastics are creating new opportunities for recycling, and with the combined actions of the public, industry and governments it

  17. Informal Opportunity among SMEs

    DEFF Research Database (Denmark)

    Rezaei, Shahamak; Dana, Leo-Paul; Goli, Marco

    2013-01-01

    Based on interviews with (legal and illegal) immigrants to Denmark, meetings with stakeholders and with experts in the field, this article addresses issues regarding the underground economy. Our findings show that, in Denmark, the existence of an underground economy makes it possible for semi......-compliant and non-compliant immigrants to make a living. We suggest that the underground economy in Denmark will continue to provide networks of illegal residents with opportunities for informal economic activities as trust allows entrepreneurs to function below the radar, by owning enterprises registered using...

  18. Creating Innovative Opportunities

    DEFF Research Database (Denmark)

    Ljungberg, Daniel; McKelvey, Maureen; Lassen, Astrid Heidemann

    2012-01-01

    to illustrations of the processes, and the 86 case studies in knowledge intensive entrepreneurship in Europe. These case studies were developed during the European Union research project AEGIS (Advancing Knowledge-Intensive Entrepreneurship and Innovation for Economic Growth and Well-being in Europe). The case...... studies do demonstrate how the individual KIE ventures are dependent upon variables and processes in the surrounding innovation systems. The overall analysis of the cases provides insight into how KIE processes link the KIE venture and the innovation system, thereby highlighting e.g. the importance...... of knowledge networks to create innovative opportunities....

  19. Opportunity and obligation

    CERN Multimedia

    2012-01-01

    As anyone in the press or VIP offices can tell you, CERN is in the spotlight like never before. In the first two months of 2012, we welcomed some 56 VIP visits and 144 media visits on site. Not long ago, those were the kind of numbers we’d have had in six months, and 2012 is not a one-off.   Ever since CERN turned 50 in 2004, our visitor numbers have been growing, and that includes teachers and members of the public as well as VIPs and the media. It’s a sign of the explosion of interest around the world in our science, and to me it means two things. Firstly, it means that I owe everyone at CERN a vote of thanks, since I know that visits impinge on everyone’s time. I can assure you all, however, that it is time well spent. That’s because the second thing it tells me is that growing interest in CERN brings opportunity. Our current visibility gives the particle physics community the opportunity to drive science up the popular and political agendas, and it...

  20. An ideological analysis of AKP, CHP and MHP's 2007 general election campaignAKP, CHP ve MHP’nin 2007 genel seçim kampanyalarına yönelik ideolojik bir analiz

    Directory of Open Access Journals (Sweden)

    Köksal Şahin

    2014-10-01

    Full Text Available The most colourful moments of the political elections are the campaign terms. During campaign periods political parties have many opportunities to present themselves and influence undecided voters and also have intensive efforts to satisfy their own voters. This study is about the ideological themes of the general elections in Turkey on 22 July 2007 which is a very important turning point in the Turkish politics. According to this, to the election posters and ads of three major parties that exceed the threshold has been made content analysis and the rally speeches of the chairman were subjected to discourse analysis. The major problem context of this study is the evaluations suggesting that political map of Turkey has been static rather than movable with the mentioned election which was processed in a deep political crisis atmosphere and that election is one of the breaking points of Turkish political life. The main questions, to which has been tried to find answer for in this study is during the critical election challenge which main issues the leaders were focused on and what the dominant ideological themes were on the electoral rallying. As a main result it can be said that all parties that exceed the threshold and enter the parliament used nationalist rhetoric and rituals. ÖzetSiyasal seçim süreçlerinin en renkli anları kampanya dönemleridir. Siyasal partiler seçmenlerle yakın temas kurdukları, kendilerini takdim için birçok imkân elde ettikleri kampanya dönemlerinde kararsızları etkilemek ve kendi seçmenlerini de tatmin etmek için yoğun bir çaba sarf ederler. Bu çalışma Türk siyasi hayatındaki önemli dönemeçlerden biri olarak kabul edilen 22 Temmuz 2007 “Genel Seçiminin” kampanya dönemindeki ideolojik temalara yöneliktir. Bu doğrultuda ülke seçim barajını aşan üç büyük partinin seçim afiş ve ilanları içerik analizine, genel başkanların miting konuşmaları da söylem analizine tabi tutulmu

  1. Energy Savings Potential and Research & Development Opportunities for Commercial Refrigeration

    Energy Technology Data Exchange (ETDEWEB)

    none,

    2009-09-01

    This study documents the energy consumption of commercial refrigeration equipment (CRE) in the U.S. and evaluated the energy savings potential of various technologies and energy efficiency measures that could be applied to such equipment. The study provided an overview of CRE applications, assessed the energy-savings potential of CRE in the U.S., outline key barriers to adoption of energy-savings technologies, and recommended opportunities for advanced energy saving technology research. The study was modeled after an earlier 1996 report by Arthur D. Little, Inc., and updated key information, examined more equipment types, and outlined long-term research and development opportunities.

  2. Generating innovation opportunities:

    DEFF Research Database (Denmark)

    Kallio, Anne; Bergenholtz, Carsten

    2011-01-01

    This study examines how a company can generate innovation opportunities by exploring and absorbing customer knowledge. The exploration can be performed via an in-depth or broad search for resources beyond organisational boundaries. Salespeople are an essential channel for an in-depth search...... in relation to customers, since salespeople possess rich knowledge of the customers. In order to be useful, such knowledge has to be absorbed in the company. Most of the literature on absorptive capacity has focused on R&D, while less focus has been placed on studying the role of individuals...... in the development of integrative practices. This paper demonstrates how a community of practice can enable organisations to move from potential absorptive capacity to realised absorptive capacity....

  3. Opportunities within ASTERICS

    Science.gov (United States)

    van der Meer, Rob; Cimò, Giuseppe

    2016-04-01

    ASTERICS, The Astronomy ESFRI and Research Infrastructure Cluster project, brings together astronomers and astroparticle physicists of 22 institutes in Europe to help Europe's world-leading observatories work together to find common solutions to their Big Data challenges, their interoperability and scheduling, and their data access, searching for cross-cutting solutions with mutual and wide-ranging benefit to all concerned. ASTERICS is a four year project, funded through the European Union's Horizon 2020 Framework Programme. The facilities supported by ASTERICS include SKA, CTA, KM3NeT, E-ELT. ASTERICS aims to open up multi messenger astronomy to all scientists and the public through the Virtual Observatory and the citizen science work. I will draw a picture of the landscape in which ASTERICS operates and the possible interaction with the Very Large Volume Neutrino Telescope community. Attention will be given to emerging opportunities for the Neutrino community and how these can be recognised or created.

  4. Evolutionary constraints or opportunities?

    Science.gov (United States)

    Sharov, Alexei A.

    2014-01-01

    Natural selection is traditionally viewed as a leading factor of evolution, whereas variation is assumed to be random and non-directional. Any order in variation is attributed to epigenetic or developmental constraints that can hinder the action of natural selection. In contrast I consider the positive role of epigenetic mechanisms in evolution because they provide organisms with opportunities for rapid adaptive change. Because the term “constraint” has negative connotations, I use the term “regulated variation” to emphasize the adaptive nature of phenotypic variation, which helps populations and species to survive and evolve in changing environments. The capacity to produce regulated variation is a phenotypic property, which is not described in the genome. Instead, the genome acts as a switchboard, where mostly random mutations switch “on” or “off” preexisting functional capacities of organism components. Thus, there are two channels of heredity: informational (genomic) and structure-functional (phenotypic). Functional capacities of organisms most likely emerged in a chain of modifications and combinations of more simple ancestral functions. The role of DNA has been to keep records of these changes (without describing the result) so that they can be reproduced in the following generations. Evolutionary opportunities include adjustments of individual functions, multitasking, connection between various components of an organism, and interaction between organisms. The adaptive nature of regulated variation can be explained by the differential success of lineages in macro-evolution. Lineages with more advantageous patterns of regulated variation are likely to produce more species and secure more resources (i.e., long-term lineage selection). PMID:24769155

  5. Technology Transfer/Commercialization Report

    Science.gov (United States)

    2002-01-01

    Contents include the following: (1) Who we are. (2) Technology opportunities and successes in 2002: Hilbert-Huang transform; new sensors via sol-gel-filled fiber optics; hierarchical segmentation software. (3) Activities in 2002: encouraging researcher involvement; inventorying new technologies; patenting Goddard technologies; promoting Goddard technologies; establishing new agreements;seeking and bestowing awards. (4) How to reach Goddard's: technology commercialization office.

  6. Fourier Series Optimization Opportunity

    Science.gov (United States)

    Winkel, Brian

    2008-01-01

    This note discusses the introduction of Fourier series as an immediate application of optimization of a function of more than one variable. Specifically, it is shown how the study of Fourier series can be motivated to enrich a multivariable calculus class. This is done through discovery learning and use of technology wherein students build the…

  7. Biometric technology overview

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    Biometrics was identified as one amongst 10 emerging technologies which would change the world in the twenty-first century. Components and processes of biometric system and the relevant technologies are explained in this article. Examples of biometric applications and trends of biometric research, together with industry development,are introduced, which illustrate the challenges and opportunities of this technology.

  8. Learning Opportunities (Editorial

    Directory of Open Access Journals (Sweden)

    Denise Koufogiannakis

    2009-12-01

    Full Text Available We’ve reached the end of another year of publication at EBLIP, my first at the helm as Editor‐in‐Chief, and four full years of publication since we began. This year was a busy one with several changes to the editorial team, the addition of more Editorial Advisors, and new evidence summary writers joining our team. Most importantly, the journal continues to grow and thrive, with more people than ever participating in its success. This year we added a new section called Using Evidence in Practice, and in this issue there are two articles in that section which provide practical examples of applying evidence in the workplace. Putting evidence into practice is what EBLIP is all about, so it is my hope that this new section makes the application of evidence based practice more concrete for readers. As we began working on issue 4.4, the Editorial Team decided that it would be a good idea to seek out an Editorial Intern to help with some of the tasks we never seem to get to, given that we are all volunteers. We see the internship as an opportunity to give a library and information studies student a chance to get involved with an open access journal and learn about publishing in library and information studies, which will hopefully benefit them as they begin their new career. The Editorial Intern will assist with marketing and promotion of the journal, soliciting potential manuscripts, and proofreading. They will also participate in all editorial meetings and general discussions. We anticipate that they will bring a wealth of enthusiasm and fresh ideas to our conversations so that EBLIP Editors can also continue to learn and grow by having a fresh set of eyes involved with our processes. It will certainly be a win‐win situation and a learning opportunity for all involved. We are pleased to announce that Andrea Baer has accepted the position of Editorial Intern and joined our team in mid‐November. Andrea is currently attending the University of

  9. Polyhydroxyalkanoates, challenges and opportunities.

    Science.gov (United States)

    Wang, Ying; Yin, Jin; Chen, Guo-Qiang

    2014-12-01

    Microbial polyhydroxyalkanoates (PHA) have been developed as biodegradable plastics for the past many years. However, PHA still have only a very limited market. Because of the availability of large amount of shale gas, petroleum will not raise dramatically in price, this situation makes PHA less competitive compared with low cost petroleum based plastics. Therefore, two strategies have been adopted to meet this challenge: first, the development of a super PHA production strain combined with advanced fermentation processes to produce PHA at a low cost; second, the construction of functional PHA production strains with technology to control the precise structures of PHA molecules, this will allow the resulting PHA with high value added applications. The recent systems and synthetic biology approaches allow the above two strategies to be implemented. In the not so distant future, the new technology will allow PHA to be produced with a competitive price compared with petroleum-based plastics.

  10. スターリングエンジンを用いた家庭用向け小型CHP システムの構築

    OpenAIRE

    黄,樹偉; 王,振鑫

    2011-01-01

    A prototype of micro Combined Heat & Power system( or micro-CHP system) with an electric output of 4.8[W] and a heat supply of 268[W]has been developed for home use by using a small Stirling engine to drive a DC generator, which serves as a starter motor as well. Water supplied to the cooler of the engine is heated by the cooling fins and then heated further by the exhaust gas, resulting in warm water which is outputted as the heat supply from this system. Although the electric output of this...

  11. Arc of opportunity.

    Science.gov (United States)

    Delaney, Adam Vai

    2011-07-01

    Born in Port Moresby, Papua New Guinea, the author had a 20 year career in diplomacy, political affairs, and development policy analysis at the Pacific Islands Forum, the United Nations in New York; the Prime Minister's Department in Papua New Guinea (PNG) and in the Foreign Ministry of PNG. He has also been involved in theatre for over a decade in PNG, and participated in a three-month program at the Eugene O'Neill Theatre Center in Connecticut, USA. He is currently the Business Development Manager at the Torres Strait Regional Authority (Commonwealth) on Thursday Island. Since 1975 the Australian government's overseas development policy has supported various sectoral programs in its neighbouring countries, in particular Papua New Guinea and the Solomon Islands. The "creative" field has not been prominent in this strategy. While natural resources and the sports sectors have gained much greater attention, in terms of being viable international commercial enterprises, the arts, have remained stagnant. In this paper the need for joint programs genuinely supporting "wellbeing" and promoting social enterprise throughout the "arc of opportunity" is described to harness Melanesian creativity to compete successfully in world-markets, starting with penetration of the largest economy at its door-step: Australia.

  12. From Quanta to the Continuum: Opportunities for Mesoscale Science

    Energy Technology Data Exchange (ETDEWEB)

    Crabtree, George [Argonne National Lab. (ANL), Argonne, IL (United States); Sarrao, John [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Alivisatos, Paul [Univ. of California, Berkeley, CA (United States); Barletta, William [MIT (Massachusetts Inst. of Technology), Cambridge, MA (United States); Bates, Frank [Univ. of Minnesota, Minneapolis, MN (United States); Brown, Gordon [Stanford Univ., CA (United States); French, Roger [Case Western Reserve Univ., Cleveland, OH (United States); Greene, Laura [Univ. of Illinois, Urbana, IL (United States); Hemminger, John [Univ. of California, Irvine, CA (United States); Kastner, Marc [MIT (Massachusetts Inst. of Technology), Cambridge, MA (United States); Kay, Bruce [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Lewis, Jennifer [Univ. of Illinois, Urbana, IL (United States); Ratner, Mark [Northwestern Univ., Evanston, IL (United States); Anthony, Rollett [Carnegie Mellon Univ., Pittsburgh, PA (United States); Rubloff, Gary [University of Maryland, College Park, MD (United States); Spence, John [Arizona State Univ., Mesa, AZ (United States); Tobias, Douglas [Univ. of California, Irvine, CA (United States); Tranquada, John [Brookhaven National Lab. (BNL), Upton, NY (United States)

    2012-09-01

    This report explores the opportunity and defines the research agenda for mesoscale science—discovering, understanding, and controlling interactions among disparate systems and phenomena to reach the full potential of materials complexity and functionality. The ability to predict and control mesoscale phenomena and architectures is essential if atomic and molecular knowledge is to blossom into a next generation of technology opportunities, societal benefits, and scientific advances.. The body of this report outlines the need, the opportunities, the challenges, and the benefits of mastering mesoscale science.

  13. Online citizen science games: Opportunities for the biological sciences.

    Science.gov (United States)

    Curtis, Vickie

    2014-12-01

    Recent developments in digital technologies and the rise of the Internet have created new opportunities for citizen science. One of these has been the development of online citizen science games where complex research problems have been re-imagined as online multiplayer computer games. Some of the most successful examples of these can be found within the biological sciences, for example, Foldit, Phylo and EteRNA. These games offer scientists the opportunity to crowdsource research problems, and to engage with those outside the research community. Games also enable those without a background in science to make a valid contribution to research, and may also offer opportunities for informal science learning.

  14. Strandby Harbour on solar cooling. Demonstration of 8.000 m{sup 2} solar collectors combined with flue gas cooling with a absorption cooling system; Combined heat and power plant (CHP); Strandby havn paa solkoeling. Demonstration af 8.000 m{sup 2} solfangere kombineret med roeggaskoeling med absorptionskoeleanlaeg

    Energy Technology Data Exchange (ETDEWEB)

    Soerensen, Flemming (Strandby Varmevaerk, Strandby (Denmark)); Soerensen, Per Alex (PlanEnergi, Skoerping (Denmark)); Ulbjerg, F. (Ramboell, Odense (Denmark)); Sloth, H. (Houe and Olsen, Thisted (Denmark))

    2010-04-15

    The aim of the project was to demonstrate 1) high solar heating ratio (18% annually) at a decentralized natural gas combined heat and power plant; 2) increased efficiency (5% of the heat consumption) in a natural gas CHP by using an extra flue gas cooler and an absorption heat pump; 3) a double tank system where a new tank during winter is used for cooling/ heat storage for the absorption heat pump and during summer for solar heat storage in serial operation with the old tank. The concept of combining solar power, absorption cooling and natural gas-fired small-scale CHP in Strandby met expectations and could be replicated in other CHP plants. However, it is important to note that if major construction modifications in the flue gas condensation system in the boiler or engine are required, the operating hours must not be reduced significantly in the amortisation period for the conversion. (ln)

  15. 77 FR 55217 - Health Information Technology Implementation

    Science.gov (United States)

    2012-09-07

    ... HUMAN SERVICES Health Resources and Services Administration Health Information Technology Implementation... of the Public Health Service Act) Health Information Technology Implementation for Health Center... organizational challenges. In the effort to preserve the opportunity to advance information technology...

  16. 77 FR 2734 - Health Information Technology Implementation

    Science.gov (United States)

    2012-01-19

    ... HUMAN SERVICES Health Resources and Services Administration Health Information Technology Implementation...) (section 330 of the Public Health Service Act) Health Information Technology Implementation for Health... operations. In the effort to preserve the opportunity to advance information technology resources of...

  17. Playful Technology

    DEFF Research Database (Denmark)

    Johansen, Stine Liv; Eriksson, Eva

    2013-01-01

    In this paper, the design of future services for children in Danish public libraries is discussed, in the light of new challenges and opportunities in relation to new media and technologies. The Danish government has over the last few years initiated and described a range of initiatives regarding...... in the library, the changing role of the librarians and the library space. We argue that intertwining traditional library services with new media forms and engaging play is the core challenge for future design in physical public libraries, but also that it is through new media and technology that new...

  18. Adult Learning Opportunities in Nepal

    Science.gov (United States)

    Regmi, Krishna; Regmi, Sharada

    2008-01-01

    This paper presents the initial findings from a study of education system in Nepal. This paper examines the adult learning opportunities within the educational and cultural contexts by reviewing available literature relevant to Nepal. Findings show that there are wider opportunities for adult learning than those considered from education and…

  19. Oilseeds business opportunities in Ethiopia

    NARCIS (Netherlands)

    Wijnands, J.H.M.; Biersteker, J.; Hiel, R.

    2007-01-01

    In this study the business opportunities for Dutch companies in the Ethiopian oilseeds sector are explored. Opportunities for setting up sustainable export chains should mutually benefit Dutch companies as well as the Ethiopian oilseeds sector in particular and the Ethiopian society in general.

  20. Cost-Efficient and Sustainable Deployment of Renewable Energy Sources towards the 20% Target by 2020, and beyond. D2.6. Synthesis Report on Possible Valleys of Opportunity for Cooperation Mechanisms in Europe, Based on Wind, Biomass and Solar Energy Technologies

    Energy Technology Data Exchange (ETDEWEB)

    Dalla Longa, F. [ECN Policy Studies, Amsterdam (Netherlands)

    2013-02-15

    This document concludes the work carried out within Work Package 2 of the RES4Less project with a synthesis of the main results. The aim of WP2 is to identify so called Valleys of Opportunity (VoO) for an enhanced deployment of Renewable Energy Sources (RES) across Europe, based on cooperation among Member States (MS). The general expectation is that Valleys of Opportunity will be located in areas where RES resources are more abundant. Specifically, Northern countries could exploit their large wind potential, especially within the North Sea basin. Eastern countries could benefit from the presence of large and to some extent untapped biomass resources. Southern countries could take advantage of the fact that the amount of daily sun-hours is relatively large, making the deployment of Solar-based technologies economically attractive. In order to establish a preliminary set of candidate VoOs that look attractive from an economical perspective, a methodology has been developed to systematically analyze RES surpluses in EU, characterize them in terms of costs and technology composition, and determine which member states could be interested in exploiting them. The analysis has been applied to the renewable electricity (RES-E) sector using ECN model RESolve-E and its satellite model RES4Less. The results of the modelling exercise provide a starting point towards the identification of realizable VoOs. The subsequent steps in the analysis are: (a) Elaborate on the model outcomes focusing on a specific technology and a specific region; (b) Conduct a reality check on the model outcomes against known actual plans and expected developments, and eventually complement any shortcomings by drawing information from additional sources; (c) Narrow down candidate VoOs to more realistic VoOs by considering practical barriers, constraints and restrictions that are not address by the model but are very likely to come into play; (d) Identify an interesting case study to bring forward for an

  1. Activism and the Online Mediation Opportunity Structure

    DEFF Research Database (Denmark)

    Uldam, Julie

    2013-01-01

    The annual United Nations (UN) Framework Convention on Climate Change conferences provides a transnational mediation opportunity structure for activist networks to contest policies that favor market-based models for solving the climate crisis. Online technologies, including commercial social media...... to climate change activism. This impedes possibilities for using online media to protest at the radical end of the climate justice movement spectrum. This article explores this interrelationship between activist demands and (online) modes of action through a focus on the mobilization efforts of London...

  2. Skeletal tissue engineering: opportunities and challenges.

    Science.gov (United States)

    Luyten, F P; Dell'Accio, F; De Bari, C

    2001-12-01

    Tissue engineering is a field of biomedicine that is growing rapidly and is critically driven by scientific advances in the areas of developmental and cell biology and biomaterial sciences. Regeneration of skeletal tissues is among the most promising areas of biological tissue repair and is providing a broad spectrum of potential clinical applications, including joint resurfacing. The availability of novel tools such as pluripotent stem cells, morphogens, smart biomaterials and gene transfer technologies, makes us dream of many exciting novel therapeutic approaches. Despite these opportunities in regenerative medicine, good clinical practice requires the clinician to question the consistency, reproducibility, validation and appropriate regulation of these new biological treatments.

  3. Research by residents: obstacles and opportunities.

    Science.gov (United States)

    Torous, John; Padmanabhan, Jaya

    2015-02-01

    As the psychiatric field continues to evolve in a world with nascent mobile technology (Hilty et al., 2014), novel neuroscience and genetic research, and new payment and care models (Fried et al., 2014) it is likely that the psychiatry residents learn today will not match what they will be practicing tomorrow. Residents have the opportunity to help shape that future through conducting research today. While the prospect of research can initially seem daunting to the busy resident, here we examine, from psychiatry residents' perspective, the common pitfalls and rewards of research during residency.

  4. Network Virtualization - Opportunities and Challenges for Operators

    Science.gov (United States)

    Carapinha, Jorge; Feil, Peter; Weissmann, Paul; Thorsteinsson, Saemundur E.; Etemoğlu, Çağrı; Ingþórsson, Ólafur; Çiftçi, Selami; Melo, Márcio

    In the last few years, the concept of network virtualization has gained a lot of attention both from industry and research projects. This paper evaluates the potential of network virtualization from an operator's perspective, with the short-term goal of optimizing service delivery and rollout, and on a longer term as an enabler of technology integration and migration. Based on possible scenarios for implementing and using network virtualization, new business roles and models are examined. Open issues and topics for further evaluation are identified. In summary, the objective is to identify the challenges but also new opportunities for telecom operators raised by network virtualization.

  5. Analysis of risks and investments’ opportunities in water sector

    Directory of Open Access Journals (Sweden)

    Fjona Zeneli

    2016-01-01

    These opportunities result from the difference between water supply and water demand; an increasingly difference that requires capital investments in production and water treatment technologies. Investments need to be combined with the knowledge on the legislation, regulatory framework and technological developments. This article may serve to clarify type of investments in drinking water sector, known by literature, to identify opportunities of investment in this sector, indicating the theoretical framework of beta and alpha risk ratio coefficient calculation and to suggest how these types of investments can be allocated to the investment portfolios.

  6. Efficiencies and emissions of a 192 kw{sub el} Otto engine CHP-unit running on biogas at the research station ''Unterer Lindenhof''

    Energy Technology Data Exchange (ETDEWEB)

    Thomas, Bernd; Wyndorps, Agnes

    2012-06-15

    An Otto engine CHP-unit running on biogas has been under investigation for more than two years. Within this time data regarding temperatures, energy flows, biogas composition, emissions etc. were collected, and this paper presents some of the results. In detail, electric and thermal output are discussed for one full year. From these data the monthly electric availability of the unit can be calculated, which ranges from 84.0 to 96.4%. In addition, the utilization of the heat produced by the CHP-unit during one year is displayed. It was found that 18.2% of the heat was needed for heating purposes within the biogas plant, and 64.5% of the heat could be supplied to the district heating system. Hence, 17.3% of the useful heat had to be released to the ambient air by an additional cooler. Regarding emissions, a strong impact of the excess air ratio on emissions of NO{sub X} has been observed. Moreover, the effect on electric efficiency is outlined in this paper. As known from theory, the experimental results revealed that an increase in the excess air ratio helps to lower NO{sub X}-emissions, while electric efficiency is reduced by this means. (copyright 2012 WILEY-VCH Verlag GmbH 8 Co. KGaA, Weinheim)

  7. Three novel NY-ESO-1 epitopes bound to DRB1*0803, DQB1*0401 and DRB1*0901 recognized by CD4 T cells from CHP-NY-ESO-1-vaccinated patients.

    Science.gov (United States)

    Mizote, Yu; Taniguchi, Taku; Tanaka, Kei; Isobe, Midori; Wada, Hisashi; Saika, Takashi; Kita, Shoichi; Koide, Yukari; Uenaka, Akiko; Nakayama, Eiichi

    2010-07-19

    Three novel NY-ESO-1 CD4 T cell epitopes were identified using PBMC obtained from patients who were vaccinated with a complex of cholesterol-bearing hydrophobized pullulan (CHP) and NY-ESO-1 protein (CHP-NY-ESO-1). The restriction molecules were determined by antibody blocking and using various EBV-B cells with different HLA alleles as APC to present peptides to CD4 T cells. The minimal epitope peptides were determined using various N- and C-termini truncated peptides deduced from 18-mer overlapping peptides originally identified for recognition. Those epitopes were DRB1*0901-restricted NY-ESO-1 87-100, DQB1*0401-restricted NY-ESO-1 95-107 and DRB1*0803-restricted NY-ESO-1 124-134. CD4 T cells used to determine those epitope peptides recognized EBV-B cells or DC that were treated with recombinant NY-ESO-1 protein or NY-ESO-1-expressing tumor cell lysate, suggesting that the epitope peptides are naturally processed. These CD4 T cells showed a cytokine profile with Th1 characteristics. Furthermore, NY-ESO-1 87-100 peptide/HLA-DRB1*0901 tetramer staining was observed. Multiple Th1-type CD4 T cell responses are beneficial for inducing effective anti-tumor responses after NY-ESO-1 protein vaccination.

  8. Applications mechanisms of energetic efficiency in energy-intensive industries segments in Brazil: opportunities for current technological structures; Aplicacoes de mecanismos de eficiencia energetica em segmentos industriais energo-intensivos brasileiros: oportunidades relativas as atuais estruturas tecnologicas

    Energy Technology Data Exchange (ETDEWEB)

    Dorileo, Ivo Leandro [Universidade Federal do Mato Grosso (NIEPE/UFMT), Cuiaba, MT (Brazil). Nucleo Interdisciplinar de Estudos em Planejamento; Berni, Mauro Donizeti [Universidade Estadual de Campinas (NIPE/UNICAMP), SP (Brazil). Nucleo Interdisciplinar de Planejamento Energetico; Paccola, Jose Angelo; Silva Junior, Herculano Xavier da; Bernardes, Cyro Barbosa [MCPAR Engenharia, Campinas, SP (Brazil)

    2010-07-01

    This work presents energy efficiency mechanisms analysis in the Brazilian industrial sector. Significant energy savings can be made in this sector and rely on urgent widespread implementation of mechanisms. The experience of the developed countries is demonstrated and serves as base for the critical evaluation of the Brazilian situation, considering the current technological period, the investments and economic perspectives in industrial segments of pulp and paper, iron and steel and non-ferrous metals. (author)

  9. Expanding educational access and opportunities: The globalization and foreign direct investment of multinational corporations and their influence on STEM, project-based learning and the national science and technology fair in schools in Costa Rica

    Science.gov (United States)

    Valdez, Joaquin G.

    The purpose of this qualitative study was to examine the influence of globalization and the foreign direct investment (FDI) of multinational corporations (MNCs) on the curriculum in schools in Costa Rica. The study focused primarily on Science, Technology, Engineering and Mathematics (STEM), Project-Based Learning (PBL), 21st century skills, and the national science and technology fair. The high influx of MNCs such as Intel has changed the global and educational culture of the country increasing the number of knowledge-based workers in Costa Rica. As a result, policy changes have been instituted in education to mirror the demands of sustaining the country's global economy. This study was supported by the creation of three research questions that would attempt to answer 1) the extent that teachers implementing STEM curriculum trace their practices back to policy, globalization, and multinational corporations as well as the extent to which the economic growth of Costa Rica and STEM education are related, 2) how mandating the national science and technology fair has influenced 21st century skills through project-based learning and the use of technology by teachers and its impact on curriculum and instruction, and 3) how has the national science and technology fair policy changed the value of STEM education for students, teachers, and educational leaders. To further understand the outcome of this study, four theoretical frameworks were applied that included, Spring's theory of world educational culture, Friedman's world flatteners, Wagner's 21st century skills and partnerships for 21st century skills, and Slough and Milam's STEM project-based learning theoretical framework. Each framework was applied to support the changes to the educational system; survival skills necessary to compete in the global job market; application of 21st century skills in the classroom and in the science projects students created. A research team comprised of 14 doctoral students, led by Dr

  10. Opportunities for high wind energy penetration

    DEFF Research Database (Denmark)

    Tande, J.O.; Hansen, J.C.

    1997-01-01

    Wind power is today a mature technology, which at windy locations, is economically competitive to conventional power generation technologies. This and growing global environmental concerns have led governments to encourage and plan for wind energy development, a typical aim being 10% of electricity...... consumption. The successful operation of the three major power systems of Cape Verde, with a total wind energy penetration of about 15% since December 1994, demonstrates that power systems can be operated with high penetration of wind energy by adding simple control and monitoring systems only. Thorough...... analyses conclude that expanding to even above 15% wind energy penetration in the Cape Verde power systems is economical. Worldwide, numerous locations with favorable wind conditions and power systems similar to the Capeverdean provide good opportunities for installing wind farms and achieving high wind...

  11. Biogas Opportunities Roadmap Progress Report

    Energy Technology Data Exchange (ETDEWEB)

    None, None

    2015-12-01

    In support of the Obama Administration's Climate Action Plan, the U.S. Department of Energy, the U.S. Environmental Protection Agency, and U.S. Department of Agriculture jointly released the Biogas Opportunities Roadmap Progress Report, updating the federal government's progress to reduce methane emissions through biogas systems since the Biogas Opportunities Roadmap was completed by the three agencies in July 2014. The report highlights actions taken, outlines challenges and opportunities, and identifies next steps to the growth of a robust biogas industry.

  12. Biomass combustion gas turbine CHP

    Energy Technology Data Exchange (ETDEWEB)

    Pritchard, D.

    2002-07-01

    This report summarises the results of a project to develop a small scale biomass combustor generating system using a biomass combustor and a micro-gas turbine indirectly fired via a high temperature heat exchanger. Details are given of the specification of commercially available micro-turbines, the manufacture of a biomass converter, the development of a mathematical model to predict the compatibility of the combustor and the heat exchanger with various compressors and turbines, and the utilisation of waste heat for the turbine exhaust.

  13. Heat Pumps in CHP Systems

    DEFF Research Database (Denmark)

    Ommen, Torben Schmidt

    that three configurations are particular advantageous, whereas the two remaining configurations result in system performance close to or below what may be expected from an electric heater. One of the three advantageous configurations is required to be positioned at the location of the heat demand, whereas...

  14. 新技术给视频监控业务在中小企业市场发展带来的机遇%Opportunity of Video Surveillance Used in SME with New Technology

    Institute of Scientific and Technical Information of China (English)

    王彬

    2011-01-01

    Considering the characteristics of SME (small medium enterprise), this paper proposes video surveillance business promotion strategy in SME based on analysis of 3G mobile video surveillance and intelligence analysis technology.%通过对3G移动视频监控及智能分析技术的分析,结合中小企业的特点,给出视频监控业务在中小企业推广的策略。

  15. Additive manufacturing in production: challenges and opportunities

    Science.gov (United States)

    Ahuja, Bhrigu; Karg, Michael; Schmidt, Michael

    2015-03-01

    Additive manufacturing, characterized by its inherent layer by layer fabrication methodology has been coined by many as the latest revolution in the manufacturing industry. Due to its diversification of Materials, processes, system technology and applications, Additive Manufacturing has been synonymized with terminology such as Rapid prototyping, 3D printing, free-form fabrication, Additive Layer Manufacturing, etc. A huge media and public interest in the technology has led to an innovative attempt of exploring the technology for applications beyond the scope of the traditional engineering industry. Nevertheless, it is believed that a critical factor for the long-term success of Additive Manufacturing would be its ability to fulfill the requirements defined by the traditional manufacturing industry. A parallel development in market trends and product requirements has also lead to a wider scope of opportunities for Additive Manufacturing. The presented paper discusses some of the key challenges which are critical to ensure that Additive Manufacturing is truly accepted as a mainstream production technology in the industry. These challenges would highlight on various aspects of production such as product requirements, process management, data management, intellectual property, work flow management, quality assurance, resource planning, etc. In Addition, changing market trends such as product life cycle, mass customization, sustainability, environmental impact and localized production will form the foundation for the follow up discussion on the current limitations and the corresponding research opportunities. A discussion on ongoing research to address these challenges would include topics like process monitoring, design complexity, process standardization, multi-material and hybrid fabrication, new material development, etc.

  16. The Evolution of Shea Butter's "Paradox of paradoxa" and the Potential Opportunity for Information and Communication Technology (ICT to Improve Quality, Market Access and Women's Livelihoods across Rural Africa

    Directory of Open Access Journals (Sweden)

    Julia Bello-Bravo

    2015-05-01

    Full Text Available Shea trees grow across 4 million km2 of sub-Saharan Africa. Shea parklands provide a sustainable source of edible fat (shea butter that, in terms of volume, is currently second only to cocoa butter as a vegetal source of stearic acid in the multi-billion dollar chocolate and cosmetic sectors. However, in terms of international trade, shea has been opaque to consumers of edible products (where the majority of shea exports end their global journey and actually only well-known in western markets as a cosmetic ingredient. The millions of women collectors have been disconnected from global supply chains, as the majority of their sheanuts are factory processed, supplied by traders who, in many cases, do not understand quality issues nor share knowledge with their village-based collectors—this is the “Paradox of paradoxa”. This review provides the background to this issue by contextualizing the industry and describing how weak post-harvest quality control impacts the shea supply chain. The paper then explains how this knowledge was incorporated into a 3D animation available for free transmission to rural African audiences and viewing on portable devices like video capable mobile phones. This tool offers the potential of low-cost multiple benefits to users, which we term here a win-cubed [win3] opportunity, where women collectors can receive free knowledge of using less resources to produce higher quality shea kernels which in turn offer higher extraction yields, lowering production costs, of a better and more marketable product.

  17. 數位落差與數位機會對幼兒資訊教學活動的影響 The Impact of the Digital Divide and Digital Opportunity on the Integration of Information Technology into Instructional Activities for Young Children

    Directory of Open Access Journals (Sweden)

    陳儒晰 Ru-Si Chen

    2013-06-01

    Full Text Available 幼兒教育(下稱幼教)場域的資訊教學活動,不只受到社會結構性限制與數位落差的影響,亦連結數位機會的提供對行動主體的資訊科技近用與使用作為之賦權。研究者藉由觀察與訪談蒐集幼兒、幼教人員和家長對此議題所呈現的資料,描繪數位落差與數位機會對幼兒資訊教學活動的形塑和影響。研究結果指出,幼兒再現家長社經背景與社會群體身分的差異,在近用、使用和參與資訊科技輔助學習表現顯現數位學習落差;但透過幼教人員與幼兒園提供數位學習機會,可協助弱勢群體幼兒有更多機會近用資訊科技,並應用資訊科技轉化其學習參與和成就表現。最後,研究者針對研究結果進行討論並提出建議,以為相關單位從事幼教資訊專業發展革新與行動實踐作為之參照。 The integration of information technology into instructional activities in early childhood education is not only affected by social-structural limitations and the digital divide, but also related to the provision of digital opportunities, and the empowerment of agents to access and use information. Based on data collected through interviews with parents and educators, and observation of situations in which information technology is integrated into instruction, the researcher describes how the application of information technology in young children’s pedagogy is influenced and shaped by the digital divide and digital opportunity. According to the results, differences in parents’ socio-economic backgrounds and membership of social groups are reproduced through the digital divide in children’s access to, use of, and engagement with information technology. However, if young children from minority or disadvantaged groups are able to access information technology, through the provision of equal digital opportunities in kindergartens, their engagement and

  18. US Forest Service Recreation Opportunities

    Data.gov (United States)

    US Forest Service, Department of Agriculture — A map service on the www depicting the recreation opportunity information that the Forest Service collects through the Recreation Portal and shares with the public...

  19. Employment opportunities for the disabled

    NARCIS (Netherlands)

    Delsen, L.W.M.

    1996-01-01

    Policy makers in the OECD Member States have developed quite different programmes and institutional arrangements to create and promote employment opportunities for the disabled. These policy approaches include legal interventions, employment support services, financial support of open employment and

  20. New Opportunities for Targeted Immunotherapy

    Science.gov (United States)

    A team of NCI researchers has reported that several types of gastrointestinal cancer have tumor-specific mutations that can be recognized by the immune system, thereby offering a new therapeutic opportunity for patients with these tumors.