WorldWideScience

Sample records for chp plant based

  1. Investment in new power generation under uncertainty: Benefits of CHP vs. condensing plants in a copula-based analysis

    International Nuclear Information System (INIS)

    In this paper, we apply a spread-based real options approach to analyze the decision-making problem of an investor who has the choice between an irreversible investment in a condensing power plant without heat utilization and a plant with combined heat-and-power (CHP) generation. Our investigation focuses on large-scale fossil-fueled generation technologies and is based on a stochastic model that uses copula functions to provide the input parameters of the real options model. We define the aggregated annual spread as assessment criteria for our investigation since it contains all relevant volatile input parameters that have an impact on the evaluation of investment decisions. We show that the specific characteristics of CHP plants, such as additional revenues from heat sales, promotion schemes, specific operational features, and a beneficial allocation of CO2 allowances, have a significant impact on the option value and therefore on the optimal timing for investment. For the two fossil-fueled CHP technologies investigated (combined-cycle gas turbine and steam turbine), we conclude from our analysis that a high share of CHP generation reduces the risk exposure for the investor. The maximal possible CHP generation depends significantly on the local heat demand in the surroundings of the power plant. Considering this, the size of the heat sink available could gain more relevance in the future selection process of sites for new large-scale fossil power plants.

  2. CHP plant Legionowo Poland - Final report

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2004-12-01

    In 1997, a new Energy Law was passed in Poland. An important element of the law is that local energy planning is made obligatory. The law describes obligatory tasks and procedures for Polish municipalities related to planning and organisation of the energy sector. With the objective of supporting the Polish municipalities in their obligations according to the energy law of 1997, the project 'Energy Planning in Poland at Municipal Level - Support to Decision Makers' was launched. As part of the project, Municipal Guideline Reports have been elaborated for three model municipalities. These guidelines present the basis for the Energy Supply Plans in these municipalities. For the city of Legionowo, the following was recommended: 1. The planning processes initiated during the project should be continues/followed up, 2. Master Plan for the district heating system should be prepared, 3. The possibilities of establishment of a major natural gas-fired CHP plant of the Combined Cycle type should be investigated. The present report is the final Master Plan based on the following reports: Master Plan for Legionowo - Status Report; Master Plan for Legionowo - Hydraulic Analysis; CHP Plant Legionowo Poland - CHP Feasibility Analysis. The final Master Plan describes the status in the DH Company in Legionowo, possible improvements and an investment plan for the selected scenario. (BA)

  3. Local CHP Plants between the Natural Gas and Electricity Systems

    DEFF Research Database (Denmark)

    Bregnbæk, Lars; Schaumburg-Müller, Camilla

    2005-01-01

    Local combined heat and power (CHP) plants in Denmark constitute an important part of the national energy conversion capacity. In particular they supply a large share of the district heating networks with heat. At the same time they are important consumers as seen from the gas network system, and...... they contribute significantly to the electricity production. CHP is, together with the wind power, the almost exclusive distributed generation in Denmark. This paper deals with the CHP as intermediary between the natural gas system and the electricity system. In particular, the relationship between the...... variations in the load will be correlated between the systems, because both demands in part depend on the climate. The analysis in the paper is based on a numerical model which simulates the operation of a CHP plant with heat storage. The conditions for the operation of the plant are assumed to be consistent...

  4. Small-scale CHP Plant based on a 35 kWel Hermetic Four Cylinder Stirling Engine for Biomass Fuels- Development, Technology and Operating Experiences

    DEFF Research Database (Denmark)

    Obernberger, I.; Carlsen, Henrik; Biedermann, F.

    2003-01-01

    ) process and the Stirling engine process. The ORC process represents an economically interesting technology for small-scale biomass-fired combined heat and power plants in a power range between 400 and 1,500 kWel. A newly developed ORC technology with a nominal electric capacity of 1,000 kW was implemented...... in the biomass CHP plant Lienz (A) in the framework of an EU demonstration project. This plant was put in operation in February 2002. Stirling engines are a promising solution for installations with nominal electric capacities between 10 and 150 kW. A biomass CHP pilot plant based on a 35 kWel-Stirling engine...

  5. Co-production of pyrolysis oil and district cooling in biomass-based CHP plants: Utilizing sequential vapour condensation heat as driving force in an absorption cooling machine

    International Nuclear Information System (INIS)

    The ever-increasing demand for cooling requires new and sustainable ways of producing it. Absorption cooling is one such well-known technique that can be employed, the driving force in which is heat. When a flash pyrolysis process, with sequential vapour condensation, is integrated into a biomass-based combined heat and power plant (CHP plant), excess heat may arise in the condensers. This study demonstrates the utilization of this excess heat in an absorption cooling machine for producing district cooling. The maximum boiler load in the used CHP plant was 80 MW: the excess condenser heat created during the period June–August was 6.4 MW, which resulted in the production of 5 MW district cooling. The production of electrical power increased by 8.6% on a yearly basis, with a base load production during June–August of 2.8 MW. Using an absorption cooling machine increases the energy conversion efficiency of the CHP plant with an integrated pyrolysis process by 1.3% on a yearly basis; the energy efficiency of the pyrolysis process alone increases by 6%. An increased utilization of the condenser heat for district cooling is possible at an almost constant overall energy conversion efficiency and is demonstrated with two additional cases. - Highlights: • Energy enhancement of a biomass-based CHP plant with integrated pyrolysis process. • Simulation of a single-stage absorption cooling cycle in CHEMCAD. • Utilizing waste condenser heat for district cooling production in three cases. • Simulation of a plant with productions of heat, power, cooling and bio-oil

  6. Monitoring of the energy performance of a district heating CHP plant based on biomass boiler and ORC generator

    International Nuclear Information System (INIS)

    More than seventy district heating (DH) plants based on biomass are operating in South Tyrol (Italy) and most of them supply heat to residential districts. Almost 20% of them are cogenerative systems, thus enabling primary energy savings with respect to the separate production of heat and power. However, the actual performance of these systems in real operation can considerably differ from the nominal one. The main objectives of this work are the assessment of the energy performance of a biomass boiler coupled with an Organic Rankine Cycle (i.e. ORC) generator under real operating conditions and the identification of its potential improvements. The fluxes of energy and mass of the plant have been measured onsite. This experimental evaluation has been supplemented with a thermodynamic model of the ORC generator, calibrated with the experimental data, which is capable to predict the system performance under different management strategies of the system. The results have highlighted that a decrease of the DH network temperature of 10 °C can improve the electric efficiency of the ORC generator of one percentage point. Moreover, a DH temperature reduction could decrease the main losses of the boiler, namely the exhaust latent thermal loss and the exhaust sensible thermal loss, which account for 9% and 16% of the boiler input power, respectively. The analysis of the plant has pointed out that the ORC pump, the flue gases extractor, the thermal oil pump and the condensation section fan are the main responsible of the electric self-consumption. Finally, the negative effect of the subsidisation on the performance of the plant has been discussed. - Highlights: • Energy performance of a biomass boiler coupled to an ORC turbine in real operation. • Potential improvements of a CHP plant connected to a DH network. • Performance prediction by means of a calibrated ORC thermodynamic model. • Influence of the DH temperature on the electric efficiency. • Impact of the

  7. A Stochastic Unit Commitment Model for a Local CHP Plant

    DEFF Research Database (Denmark)

    Ravn, Hans V.; Riisom, Jannik; Schaumburg-Müller, Camilla

    2005-01-01

    presents a stochastic unit commitment model for a single local CHP plant (consisting of CHP unit, boiler, and heat storage facility) which takes into account varying spot prices. Further, additional technology is implemented in the model in the form of an immersion heater. Simulations are conducted using...... the spot prices of the years 2001-2003, both with and without the immersion heater included in the model, and the results are compared to the full information case....

  8. A microeconomic analysis of decentralized small scale biomass based CHP plants—The case of Germany

    International Nuclear Information System (INIS)

    Alternative energy sources, such as biomass CHP plants, have recently gained significantly in importance and action is due both on the large scale corporate level and on the small scale. Hence, making the scope and economic outline of such projects easily intelligible without losing relevant details seems a key factor to further promote the necessary developments. The model setup presented in this paper may therefore serve as a starting point for generating numerical results based on real life cases or scenarios. Its focus lies on the economic analysis of decentralized biomass CHP plants. It presents a new approach to analyzing the economic aspects of biomass CHP plants implementing a formal microeconomic approach. As Germany claims a leading role in the market for renewable energy production, the paper also takes a closer look on the effects of German energy policy with respect to biomass CHP plants. - Highlights: • A formal microeconomic model is used to analyse a decentralized biomass CHP plant. • Model setup is used to generate numerical results based on real life scenarios. • Nested CES production function is a new approach to model economics of biomass CHP. • Analysis presents insight into microeconomics and cost drivers of biomass CHP. • Evaluation of energy policy design with respect to environmental policy goals

  9. Biomass CHP plant Guessing: reliable solution for fossil free municipality

    International Nuclear Information System (INIS)

    The start up of the biomass gasification CHP plant in 2002 marked the last step of the small Austrian town of Guessing towards the supply with 100 % biomass based renewable energy. Furthermore a sustainable process of regional development has been set into force, which turned this former poor region into a prospering European centre of renewable energy. Reaching an electric efficiency of 25 % and a total efficiency of 80 %, the process of steam blown gasification and gas utilisation in an engine enables economic operation even in small plants. For more than 11,000 operating hours the system could prove its reliability. Due to the favourable characteristics of the product gas research projects beyond electricity production were already started. (authors)

  10. CHP plant Legionowo Poland. Description of the electricity market in Poland/CHP-feasibility analysis

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2003-04-01

    In 1997, a new energy law was passed in Poland. An important element of the law is that local energy is made obligatory. The law describes obligatory tasks and procedures for the Polish municipalities related to planning and organisation of the energy sector. With the objective of supporting the Polish municipalities in their obligations according to the energy law, the project 'Energy Planning in Poland at Municipal Level - Support to Decision Makers' was launched. As part of the project, Municipal Guideline Reports have been elaborated for three model municipalities. These guidelines present the basis for energy supply plans in the three municipalities. For the city of Legionowo, the following was recommended: 1. The planning processes initiated during the project should be continued/followed up, 2. Master Plan for the district heating system should be prepared, 3. The possibilities of establishment of a major natural gas-fired CHP plant of the combined cycle type should be investigated. The present report describes the electricity market in Poland, the market in which a CHP plant in Legionowo will have to operate. Furthermore the report presents the results of the feasibility analysis carried out for a new CHP plant in Legionowo. (BA)

  11. CHP-plant with PEM fuel cells; Kraftvarmeanlaeg med PEM braendselsceller - Fase 1. Afsluttende rapport

    Energy Technology Data Exchange (ETDEWEB)

    Moth, K.; Damgaard Schmidt, J.

    2004-11-01

    The aim of this ambitious project was to design and construct a PEM fuel cell based CHP plant. The project succeeded. Furthermore, the project has contributed significantly to knowledge acquisition of data as regards design and construction of plants of this type, and the participants in the projects are placed in a good position in preparation for further activities within this area. (BA)

  12. CHP plant can do a power of good.

    Science.gov (United States)

    Baillie, Jonathan

    2009-10-01

    With mounting pressure on hospitals and other healthcare facilities to reduce their energy bills, coupled with the need to reduce their carbon footprint, developer and supplier of combined heat and power systems Cogenco argues that adding CHP plant to existing energy generation equipment such as gas boilers has never made greater financial sense. Jonathan Baillie reports. PMID:19911560

  13. Analysis of the location for peak heating in CHP based combined district heating systems

    International Nuclear Information System (INIS)

    Combined heat and power (CHP) is the main technology for providing the base load of district heating in China. However, CHP is not efficient for providing the peak load; instead, a peak boiler with high efficiency could be used to compensate the peak load. This paper studies how the location of the peak boiler can affect the energy efficiency and economic performance of such CHP based combined district heating system. Firstly, the connection mode and the control strategy for different peak heating locations are analyzed. Then the effect of the peak boiler's location on the initial investment of the network and the cost for distributing heat is studied. The objective is to place the peak boiler in a location where the overall costs are the smallest. Following this rule, the results indicate that the peak boiler should be located at the CHP plant if that allows using cheaper ‘self-use electricity’ in CHP for distributing the heat. However, if the market electricity price is used everywhere, or if energy efficiency is more emphasized, the location of the peak boiler should be closer to the users with dense heat loads. - Highlights: • Location for peak heating in the CHP based combined DH system is studied. • Regulation or control strategies for combined DH are summarized. • The heat load duration curve for combined DH is demonstrated. • Network design for combined DH with peak boiler outside of the CHP is analyzed

  14. Reactive power control with CHP plants - A demonstration

    DEFF Research Database (Denmark)

    Nyeng, Preben; Østergaard, Jacob; Andersen, Claus A.;

    2010-01-01

    power rating of 7.3 MW on two synchronous generators. A closed-loop control is implemented, that remote controls the CHP plant to achieve a certain reactive power flow in a near-by substation. The solution communicates with the grid operator’s existing SCADA system to obtain measurements from the......In this project the potential for ancillary services provision by distributed energy resources is investigated. Specifically, the provision of reactive power control by combined heat and power plants is examined, and the application of the new standard for DER communication systems, IEC 61850...... lines to underground cables has changed the reactive power balance, and third, the TSO has introduced restrictions in the allowed exchange of reactive power between the transmission system and distribution grids (known as the Mvar-arrangement). The demonstration includes a CHP plant with an electric...

  15. Biomass based oxyfuel combustion in CHP power plant with opportunity of oxygen storage system for carbon capture and storage

    OpenAIRE

    Hasan, Mohammad Mahmodul

    2012-01-01

    Carbon dioxide (CO2) emission from coal-based power plants is one of the major environmental concerns since coal will remain as a dominant source of energy for the next few decades. Therefore, the CO2 emission requires to be decreased and move towards renewable energy sources to meet the environmental and sustainability targets. However, it will not be able to meet the worldwide energy demand because of the limited commercialization of renewable energy sources. As coal is the most leading ene...

  16. Hashoj has a CHP-plant and biogas-plant that are adjusting to the future

    International Nuclear Information System (INIS)

    In Denmark many small combined heat and power (CHP) plants struggles for survival in a time with a very low price on electricity and therefore a high price on heat, to maintain the credibility of the plant. But that gives the CHP-plants some special problems to deal with. A visit to Hashoj CHP -plant shows what their situation are, and how some of these new perspectives, are to be solved. The CHP-plant operates together with a biogas- plant. The biogas plant has also made some investments to meet the problems that a liberalised market for electricity will make for a supplier of the basic energy for producing green electricity. (authors)

  17. Characterization of ultrafine and fine particles from CHP Plants

    Energy Technology Data Exchange (ETDEWEB)

    2009-08-15

    Samples of particles collected at CHP plants in the project 'Survey of emissions from CHP Plants' have been analysed in this project to give information on the morphology and chemical composition of individual particle size classes. The objective of this project was to characterize ultrafine and fine particles emitted to the atmosphere from Danish CHP plants. Nine CHP plants were selected in the Emission Survey Project as being representative for the different types of CHP plants operating in Denmark: 1) Three Waste-to Energy (WTE) plants. 2) Three biomass fired (BM) plants (two straw fired, one wood/saw dust fired). 3) Two gas fired (GF) plants (one natural gas, one landfill gas fired). 4) One gasoil (GO) fired plant. At the WTE and BM plants, various types of emission control systems implemented. The results from these plants represent the composition and size distribution of combustion particles that are emitted from the plants emission control systems. The measured emissions of particles from the waste-to-energy plants WTE1-3 are generally very low. The number and mass concentrations of ultrafine particles (PM{sub 0.1}) were particularly low in the flue gas from WTE2 and WTE3, where bag filters are used for the reduction of particle emissions. The EDX analysis of particles from the WTE plants indicates that the PM{sub 0.1} that penetrates the ECS at WTE can contain high fractions of metals such as Fe, Mn and Cu. The SEM analysis of particles from WTE1-3 showed that the particles were generally porous and irregular in shape. The concentrations of particles in the flue gas from the biomass plants were generally higher than found for the WTE plants. The time series results showed that periodical, high concentration peaks of PM emissions occur from BM1 and BM2. The chemical composition of the particles emitted from the three biomass plants is generally dominated by C, O and S, and to some extend also Fe and Si. A high amount of Cu was found in selected

  18. Optimization of operation for combined heat and power plants - CHP plants - with heat accumulators using a MILP formulation

    Energy Technology Data Exchange (ETDEWEB)

    Grue, Jeppe; Bach, Inger [Aalborg Univ. (Denmark). Inst. of Energy Technology]. E-mails: jeg@iet.auc.dk; ib@iet.auc.dk

    2000-07-01

    The power generation system in Denmark is extensively based on small combined heat and power plants (CHP plants), producing both electricity and district heating. This project deals with smaller plants spread throughout the country. Often a heat accumulator is used to enable electricity production, even when the heat demand is low. This system forms a very complex problem, both for sizing, designing and operation of CHP plants. The objective of the work is the development of a tool for optimisation of the operation of CHP plants, and to even considering the design of the plant. The problem is formulated as a MILP-problem. An actual case is being tested, involving CHP producing units to cover the demand. The results from this project show that it is of major importance to consider the operation of the plant in detail already in the design phase. It is of major importance to consider the optimisation of the plant operation, even at the design stage, as it may cause the contribution margin to rise significantly, if the plant is designed on the basis of a de-tailed knowledge of the expected operation. (author)

  19. THE BREAKEVEN POINT GIVEN LIMIT COST USING BIOMASS CHP PLANT

    Directory of Open Access Journals (Sweden)

    Paula VOICU

    2015-06-01

    Full Text Available Biomass is a renewable source, non-fossil, from which can be obtained fuels, which can be used in power generation systems. The main difference of fossil fuels is the availability biomass in nature and that it is in continue "reproduction". The use its enable the use of materials that could be destined destruction, as a source of energy "renewable", though result with many ecological values. In this paper we will study, applying a calculation model in view optimal sizing of the cogeneration plant based on biomass, biomass cost limit for the net present value is zero. It will consider that in cogeneration systems and in heating peak systems using biomass. After applying the mathematical model for limit value of biomass cost will determine the nominal optimal coefficient of cogeneration, for which discounted net revenue value is zero. Optimal sizing of CHP plants based on using biomass will be given by optimum coefficient of cogeneration determined following the application of the proposed mathematical model.

  20. Modelling biomass-fuelled small-scale CHP plants for process synthesis optimisation

    OpenAIRE

    Savola, Tuula

    2007-01-01

    In this work possible process improvements for biomass-fuelled small-scale combined heat and power (CHP) plants are evaluated and a new mixed integer nonlinear programming (MINLP) model for process synthesis optimisation of these processes is presented. Small-scale (1-20 MWe) CHP plants are of interest, as in Finland the potential to increase the CHP production is in converting small heating units to CHP production. However, the profitability of these small-scale CHP investments should be hig...

  1. Quasi static optimized management of a multinode CHP plant

    International Nuclear Information System (INIS)

    Combined Heat and Power (CHP) plants are increasingly used, when feasible, as a mean to reduce fuel consumption and CO2 emissions. The thermal and electrical production must be adapted to load requirements and must lead to the fulfilment of all the constraints imposed by energy saving regulations. As one of such requirements [a minimum 'fuel energy savings ratio' (FESR)] is an integral constraint that can be evaluated only at the end of each year of production, during the design phase of the plant it is of the utmost importance to have a fast algorithm able to simulate and optimize the operating conditions of all the candidate CHPs configurations, as the non-compliance with FESR regulations may lead to loose significant tax discounts, and therefore make the investment less profitable. The paper describes a suitable algorithm and its application to the optimization of a real CHP site located in Italy; besides, this work has led, as a further step toward the optimized control of larger systems, to the introduction of an additional degree of freedom ('on-off' state of some machines) extending in principle the optimization procedure to multinode CHP plants.

  2. Energetic and environmental performance of three biomass upgrading processes integrated with a CHP plant

    International Nuclear Information System (INIS)

    Highlights: ► We simulate CHP-integrated production of wood pellets, torrefied wood pellets and pyrolysis slurry. ► Integration increases operation hours and district heat output by up to 38% and 22%. ► Additionally installed equipment reduces yearly power generation by up to 7%. ► Wood pellet production performs best energetically and environmentally. ► Integrated concepts substantially reduce fuel consumption and CO2 emissions. - Abstract: In order to react on future expected increased competition on restricted biomass resources, communal combined heat and power (CHP) plants can be integrated with biomass upgrading processes that add valuable products to the portfolio. In this paper, outgoing from a base case, the retrofit integration of production of wood pellets (WPs), torrefied wood pellets (TWPs) and wood fast pyrolysis slurry (PS) with an existing wood-fired CHP plant was simulated. Within the integration concept, free boiler capacity during times of low district heat demands is used to provide energy for the upgrading processes. By detailed part-load modelling, critical process parameters are discussed. With help of a multiperiod model of the heat duration curve, the work further shows the influence of the integration on plant operating hours, electricity production and biomass throughput. Environmental and energetic performance is assessed according to European standard EN 15603 and compared to the base case as well as to stand-alone production in two separate units. The work shows that all three integration options are well possible within the operational limits of the CHP plant. Summarising, this work shows that integration of WP, TWP and PS production from biomass with a CHP plant by increasing the yearly boiler workload leads to improved primary energy efficiency, reduced CO2 emissions, and, when compared to stand-alone production, also to substantial fuel savings

  3. Operating Experiences with a Small-scale CHP Pilot Plant based on a 35 kWel Hermetic Four Cylinder Stirling Engine for Biomass Fuels

    DEFF Research Database (Denmark)

    Biedermann, F.; Carlsen, Henrik; Schoech, M.;

    2003-01-01

    Within the scope of the RD&D project presented a small-scale CHP plant with a hermetic four cylinder Stirling engine for biomass fuels was developed and optimised in cooperation with the Technical University of Denmark, MAWERA Holzfeuerungsanlagen GesmbH, an Austrian biomass furnace and boiler...... exchanger of the Stirling engine, of the air preheater and of the entire combustion system. Furthermore, the optimisation of the pneumatic cleaning system to reduce ash deposition in the hot heat exchanger is of great relevance....

  4. Evaluation of Exhaust Gas Condensing Economizer Installation at Riga CHP Plants

    OpenAIRE

    Zigurs, Aris; Kunickis, Maris; Balodis, Maris; Linkevics, Olegs; Stuklis, Ilmars; Ivanova, Polina

    2015-01-01

    In this study, passive exhaust gas condensing economizer installation is evaluated at Riga CHP plants No. 1 and No. 2 to increase efficiency of heat only boilers (HOBs). Five options are investigated: two options for Riga CHP plant No. 1 and three options for Riga CHP plant No. 2. The study provides the analysis of HOBs operation statistics, determination of HOBs operation trends, development of production programmes, as well as economic and sensitivity analysis of the considered options. Bas...

  5. In-situ corrosion investigation at Masnedø CHP plant - a straw-fired power plant

    DEFF Research Database (Denmark)

    Montgomery, Melanie; Karlsson, Asger

    1999-01-01

    Various austenitic and ferritic steels were exposed on a water-cooled probe in the superheater area of a straw-fired CHP plant. The temperature of the probe ranged from 450-600°C and the period of exposure was 1400 hours. The rate of corrosion was assessed based on unattacked metal remaining. The...

  6. Load scheduling for decentralized CHP plants

    DEFF Research Database (Denmark)

    Nielsen, Henrik Aalborg, orlov 31.07.2008; Madsen, Henrik; Nielsen, Torben Skov

    This report considers load scheduling for decentralized combined heat and power plants where the revenue from selling power to the transmission company and the fuel cost may be time-varying. These plants produce both heat and power with a fixed ratio between these outputs. A heat storage facility...... is used to be able to deviate from this restriction. The load scheduling must be performed with only approximate knowledge about the future. At present in Denmark this uncertainty is only associated with the heat demand, but in the future revenues of produced energy and the fuel costs might also be...... uncertain and dependent on time. It is suggested to use a combination of background knowledge of the operator and computer tools to solve the scheduling problem. More specificly it is suggested that the plant is equipped with (i) an automatic on-line system for forecasting the heat demand, (ii) an...

  7. Exergy diagnosis of coal fired CHP plant with application of neural and regression modelling

    Directory of Open Access Journals (Sweden)

    Stanek Wojciech

    2012-01-01

    Full Text Available Mathematical models of the processes, that proceed in energetic machines and devices, in many cases are very complicated. In such cases, the exact analytical models should be equipped with the auxiliary empirical models that describe those parameters which are difficult to model in a theoretical way. Regression or neural models identified basing on measurements are rather simple and are characterized by relatively short computation time. For this reason they can be effectively applied for simulation and optimization of steering and regulation processes, as well as, for control and thermal diagnosis of operation (eq. power plants or CHP plants. In the paper regression and neural models of thermal processes developed for systems of operation control of thermal plants are presented. Theoretical-empirical model of processes proceeding in coal fired CHP plant have been applied. Simulative calculations basing on these models have been carried out. Results of simulative calculations have been used for the exergetic evaluation of considered power plant. The diagnosis procedure let to investigate the formation of exergy costs in interconnected components of the system of CHP, as well as, investigate the influence of defects in operation of components on exergy losses and on the exergetic cost in other components. [Acknowledgment. The paper has been prepared within the RECENT project (REsearch Center for Energy and New Technologies supported by 7th Framework Programme, Theme 4, Capacities.

  8. Is micro-CHP price controllable under price signal controlled Virtual Power Plants?

    DEFF Research Database (Denmark)

    You, Shi; Træholt, Chresten; Poulsen, Bjarne

    2011-01-01

    As micro-combined heat and power (micro-CHP) systems move towards mass deployment together with other kinds of distributed energy resources (DER), an increasing emphasis has been placed on how to coordinate such a large diversified DER portfolio in an efficient way by the Virtual Power Plant (VPP...... three different micro-CHP systems to investigate the feasibility of being controlled by price. Such analysis is relevant for both controller designs for micro-CHP systems and VPP related operations. The results indicate that controlling the micro-CHP systems by price is feasible but could result in...

  9. Thermodynamic indices assessing the integration of coal-fired CHP plants with post-combustion CO2 processing units (CPU)

    International Nuclear Information System (INIS)

    Highlights: • Although, CHP plants are pro-ecological, they also need CO2 capture units. • CHP integrated with CO2 capture needs a modification of thermodynamic indices. • Indices of the relative internal load of heat and electricity have been elaborated. • Formulae of the net Energy Utilization Factor have been calculated. • Partial energy efficiencies of heat and electricity production have been determined. - Abstract: Although cogeneration is an effective way of reducing the CO2 emission in CHP plants, installations permitting the removal of CO2 ought to be applied. Installations based on chemical absorption using amine solvents is justified in the case of power plants and CHP plants. The CO2 processing unit (CPU) is characterized by a large amount of stream for solvent regeneration and the consumption of electricity mainly in compressors of CO2 product. Additional internal consumption of heat and electricity produces waste heat due to the condensation of H2O in the mixture of CO2 and H2O resulting from the desorption of CO2 and interstage cooling of the CO2 compressors. The waste heat recovery system can be connected with the preheating of network water in the district heating systems cooperating with CHP plants. In this way the integration of the CHP plants with the post-combustion CO2 processing unit is realized. This integration requires some supplements in algorithms describing the thermodynamic indices in comparison with traditional cogeneration systems. Firstly, the indices of the internal load of heat and electricity was changed. This influences the net Energy Utilization Factor, secondly the analyzed thermodynamic index, and thirdly the partial energy efficiencies of the production of heat and electricity in a CHP unit. In this last case the principle of avoided fuel expenditure and the exergy method in coupled processes have been applied. The new algorithms for calculations mentioned above thermodynamic indices and the results of their

  10. Emissions from decentralised CHP plants 2007 - Energinet.dk Environmental project no. 07/1882. Project report 5 - Emission factors and emission inventory for decentralised CHP production

    Energy Technology Data Exchange (ETDEWEB)

    Nielsen, Malene; Nielsen, Ole-Kenneth; Thomsen, M.

    2010-06-15

    Updated emission factors for decentralised combined heat and power (CHP) plants with a capacity < 25MWe have been estimated based on project emission measurements as well as emission measurements performed in recent years that were collected. The emission factors valid for 2006/2007 have been estimated for the plant technologies: Municipal solid waste (MSW) incineration plants, plants combusting straw or wood, natural gas fuelled reciprocating engines, biogas fuelled engines, natural gas fuelled gas turbines, gas oil fuelled reciprocating engines, gas oil fuelled gas turbines, steam turbines combusting residual oil and reciprocating engines combusting biomass producer gas based on wood. The emission factors for MSW incineration plants are much lower than the emission factors that were estimated for year 2000. The considerable reduction in the emission factors is a result of lower emission limit values in Danish legislation since 2006 that has lead to installation of new and improved flue gas cleaning systems in most MSW incineration plants. For CHP plants combusting wood or straw no major technical improvements have been implemented. The emission factors for natural gas fuelled reciprocating engines have been reduced since year 2000 as a result of technical improvements that have been carried out due to lower emission limit values in Danish legislation. The NO{sub x} emission factor for natural gas fuelled gas turbines has decreased 62 % since year 2000. This is a result of installation of low-NO{sub x} burners in almost all gas turbines that has been necessary to meet new emission limits in Danish legislation. The emission measurements programme included screening of the emissions of HCB, PCB, PCDD/-F and PBDD/-F. Compared to the Danish national emission decentralized CHP plants are major emission sources for CH{sub 4}, NO{sub x}, SO{sub 2}, heavy metals and HCB. (author)

  11. Operational Strategies for a Portfolio of Wind Farms and CHP Plants in a Two-Price Balancing Market

    DEFF Research Database (Denmark)

    Hellmers, Anna; Zugno, Marco; Skajaa, Anders;

    2015-01-01

    -horizon fashion, so that forecasts for heat demand, wind power production and market prices are updated at each iteration. We conclude that the portfolio strategy is the most profitable due to the two-price structure of the balancing market. This encourages producers to handle their imbalances outside the market.......In this paper we explore the portfolio effect of a system consisting of a Combined Heat and Power (CHP) plant and a wind farm. The goal is to increase the overall profit of the portfolio by reducing imbalances, and consequently their implicit penalty in a two-price balancing market for electricity....... We investigate two different operational strategies, which differ in whether the CHP plant and the wind farm are operated jointly or independently, and we evaluate their economic performance on a real case study based on a CHP-wind system located in the western part of Denmark. We present a...

  12. Emissions from decentralised CHP plants 2007 - Energinet.dk Environmental project no. 07/1882

    DEFF Research Database (Denmark)

    Nielsen, Malene; Nielsen, Ole-Kenneth; Thomsen, Marianne

    values in Danish legislation since 2006 that has lead to installation of new and improved flue gas cleaning systems in most MSW incineration plants. For CHP plants combusting wood or straw no major technical improvements have been implemented. The emission factors for natural gas fuelled reciprocating...... estimated for the plant technologies: Municipal solid waste (MSW) incineration plants, plants combusting straw or wood, natural gas fuelled reciprocating engines, biogas fuelled engines, natural gas fuelled gas turbines, gas oil fuelled reciprocating engines, gas oil fuelled gas turbines, steam turbines...... combusting residual oil and reciprocating engines combusting biomass producer gas based on wood. The emission factors for MSW incineration plants are much lower than the emission factors that were estimated for year 2000. The considerable reduction in the emission factors is a result of lower emission limit...

  13. Optimal designs of small CHP plants in a market with fluctuating electricity prices

    DEFF Research Database (Denmark)

    Lund, Henrik; Andersen, A.N.

    2005-01-01

    The paper presents the Danish experince with methodologies and software tools, which have been used to design investment and operation strategies for almost all small CHP plants in Denmark during the decade of the triple tariff.......The paper presents the Danish experince with methodologies and software tools, which have been used to design investment and operation strategies for almost all small CHP plants in Denmark during the decade of the triple tariff....

  14. Dynamic analysis of PEMFC-based CHP systems for domestic application

    International Nuclear Information System (INIS)

    Highlights: ► Dynamic model of a CHP energy system based on a PEM fuel cell was developed. ► The CHP system behavior at variable electrical and thermal load was investigated. ► The optimal RH value was assessed maximizing PEMFC performance through simulations. ► The system best operating conditions are characterized by a RH value equal to 50%. -- Abstract: Fuel cell-based CHP systems for distributed residential power generation represent an interesting alternative to traditional thermoelectric plants. This is mainly due to the high efficiency obtainable in the production of electricity and heat in a decentralised, quiet and environmental friendly way. The current paper focuses on the development, in Matlab®Simulink environment, of a complete dynamic model of a residential cogenerative (CHP) energy system consisting of the Proton Exchange Membrane fuel cell (PEMFC), fuel processor, heat exchangers, humidifier and auxiliary hot water boiler. The target of the study is the investigation through such a model of the behavior of CHP systems based on fuel cell (FC) at variable electrical and thermal load, in reference to typical load curves of residential users. With the aim to evaluate the system performance (efficiency, fuel consumption, hot water production, response time) and then to characterize its better operating conditions with particular attention to air relative humidity, suitable simulations were carried out. They are characterized by the following of a typical electrical load trend and in relation to two different thermal load profiles. The dynamic model presented in this paper has allowed to observe the fully functioning of the FC based system under variable loads and it has permitted to design appropriate control logics for this system.

  15. Implications of the modelling of stratified hot water storage tanks in the simulation of CHP plants

    Energy Technology Data Exchange (ETDEWEB)

    Campos Celador, A., E-mail: alvaro.campos@ehu.es [ENEDI Research Group-University of the Basque Country, Departamento de Maquinas y Motores Termicos, E.T.S.I. de Bilbao Alameda de Urquijo, s/n 48013 Bilbao, Bizkaia (Spain); Odriozola, M.; Sala, J.M. [ENEDI Research Group-University of the Basque Country, Departamento de Maquinas y Motores Termicos, E.T.S.I. de Bilbao Alameda de Urquijo, s/n 48013 Bilbao, Bizkaia (Spain)

    2011-08-15

    Highlights: {yields} Three different modelling approaches for simulation of hot water tanks are presented. {yields} The three models are simulated within a residential cogeneration plant. {yields} Small differences in the results are found by an energy and exergy analysis. {yields} Big differences between the results are found by an advanced exergy analysis. {yields} Results on the feasibility study are explained by the advanced exergy analysis. - Abstract: This paper considers the effect that different hot water storage tank modelling approaches have on the global simulation of residential CHP plants as well as their impact on their economic feasibility. While a simplified assessment of the heat storage is usually considered in the feasibility studies of CHP plants in buildings, this paper deals with three different levels of modelling of the hot water tank: actual stratified model, ideal stratified model and fully mixed model. These three approaches are presented and comparatively evaluated under the same case of study, a cogeneration plant with thermal storage meeting the loads of an urbanisation located in the Bilbao metropolitan area (Spain). The case of study is simulated by TRNSYS for each one of the three modelling cases and the so obtained annual results are analysed from both a First and Second-Law-based viewpoint. While the global energy and exergy efficiencies of the plant for the three modelling cases agree quite well, important differences are found between the economic results of the feasibility study. These results can be predicted by means of an advanced exergy analysis of the storage tank considering the endogenous and exogenous exergy destruction terms caused by the hot water storage tank.

  16. An energetic-exergetic analysis of a residential CHP system based on PEM fuel cell

    International Nuclear Information System (INIS)

    Highlights: → A zero-dimensional of a micro cogenerative (CHP) energy system based on a Proton Exchange Membrane fuel cell (PEMFC) has been developed. → The electrochemical model has been validated with experimental data. → The performances of this CHP system have been evaluated through a series of simulations. → An energy/exergy analysis of the simulation results has allowed to define the PEMFC optimal operating conditions. → The PEMFC optimal operating conditions detected are: 1 atm, 353.15 K and 100% RH. -- Abstract: The use of fuel cell systems for distributed residential power generation represents an interesting alternative to traditional thermoelectric plants due to their high efficiency and the potential recovering of the heat generated by the internal electrochemical reactions. In this paper the study of a micro cogenerative (CHP) energy system based on a Proton Exchange Membrane fuel cell (PEMFC) is reported. With the aim to evaluate the performance and then the feasibility of this non-conventional energy system, in consideration of thermal and electrical basic demand of a multifamily apartment blocks, a zero-dimensional PEMFC model in Aspen Plus environment has been developed. A simulations sequence has been carried out at different operating conditions of the fuel cell (varying temperature, pressure and relative humidity). Subsequently, on the basis of the obtained results, an energy/exergy analysis has been conducted to define the optimal operating conditions of the PEMFC that ensures the most efficient use of the energy and exergy inputs.

  17. Modeling and optimization of a 1 kWe HT-PEMFC-based micro-CHP residential system

    DEFF Research Database (Denmark)

    Arsalis, Alexandros; Nielsen, Mads Pagh; Kær, Søren Knudsen

    2012-01-01

    A high temperature-proton exchange membrane (HT-PEMFC)-based micro-combined-heat-and-power (CHP) residential system is designed and optimized, using a genetic algorithm (GA) optimization strategy. The proposed system consists of a fuel cell stack, steam methane reformer (SMR) reactor, water gas...... shift (WGS) reactor, heat exchangers, and other balance-of-plant (BOP) components. The objective function of the single-objective optimization strategy is the net electrical efficiency of the micro-CHP system. The implemented optimization procedure attempts to maximize the objective function by...

  18. Calorimetric studies and lessons on fires and explosions of a chemical plant producing CHP and DCPO

    International Nuclear Information System (INIS)

    Highlights: ► We analyzed fire and explosion incidents in a plant producing CHP and DCPO. ► Data from calorimeters reveal causes and phenomena associated with the incidents. ► The credible worst scenario was thermal explosion. ► Incidents may be avoided by implementing DIERS methodology. - Abstract: Cumene hydroperoxide (CHP) has been used in producing phenol, dicumyl peroxide (DCPO) and as an initiator for synthesizing acrylonitrile–butadiene–styrene (ABS) resin by copolymerization in Taiwan. Four incidents of fire and explosion induced by thermal runaway reactions were occurred in a same plant producing CHP, DCPO and bis-(tert-butylperoxy isopropyl) benzene peroxide (BIBP). The fourth fire and explosion occurred in the CHP reactor that resulted in a catastrophic damage in reaction region and even spread throughout storage area. Descriptions on the occurrences of these incidents were assessed by the features of processes, reaction schemes and unexpected side reactions. Calorimetric data on thermokinetics and pressure were used for explaining the practical consequences or which the worst cases encountered in this kind of plant. Acceptable risk associated with emergency relief system design is vital for a plant producing organic peroxide. These basic data for designing an inherently safer plant can be conducted from adiabatic calorimetry. An encouraging deduction has been drawn here, these incidents may be avoided by the implementation of API RP 520, API RP 521, DIERS technology, OSHA 1910.119 and AIChE's CCPS recommended PSM elements.

  19. EFFICIENCY OF THE USE OF HEAT PUMPS ON THE CHP PLANTS

    Directory of Open Access Journals (Sweden)

    Juravleov A.A.

    2007-04-01

    Full Text Available The work is dedicated to the calculus of the efficiency of the use of heat pumps on the CHP plants. There are presented the interdependences between the pay-back period and NPV of heat pump and the price of 1 kWt of thermal power of heat pump and of the tariff of electricity.

  20. Technical, environmental and economic analysis of co-firing of gasified biofuel in a natural gas combined cycle (NGCC) combined heat and power (CHP) plant

    Energy Technology Data Exchange (ETDEWEB)

    Marbe, Asa; Harvey, Simon; Berntsson, Thore [Heat and Power Technology, Department of Energy and Environment, Chalmers, 412 96 Goeteborg (Sweden)

    2006-08-15

    The goal of this study is to evaluate co-firing of gasified CO{sub 2} neutral biofuel in a retrofitted natural gas combined cycle (NGCC) combined heat and power (CHP) unit designed for natural gas operation. This type of situation may be particularly relevant if future CO{sub 2} abatement policies require that owners of natural gas fired CHP units reduce CO{sub 2} emissions. The study investigates the technical, economic and environmental performance of the CHP unit for different fractions of gasified biofuel in the unit's fuel mix. The power plant simulation program GateCycle was used for plant performance evaluation. The calculations are based on a large size (about 300MW{sub e}) NGCC CHP plant that is planned to be built on the West coast of Sweden, producing electricity and district heating for the local energy utility company. The results from this study show that it is possible to co-fire up to 40% (energy basis) biofuel product gas in the CHP unit. At this level of product gas co-firing, the unit's electrical and total efficiencies decrease by approximately 2%-points, compared to operation on natural gas only. Global CO{sub 2} emissions can be reduced by approximately 400,000 tonnes/year. The total costs for the local utility company depend on the prevailing CO{sub 2} taxation rules, and on the assumed premium value of the renewable power produced. For the base case conditions assumed in the study, the cost of electricity (COE) for a natural gas fired NGCC CHP unit is 253SEK/MWh, increasing to 306SEK/MWh when a biofuel gasifier is integrated to the unit. A premium value for renewable electricity of 285SEK/MWh is required for equal COE values to be achieved by the two systems. (author)

  1. Technical, environmental and economic analysis of co-firing of gasified biofuel in a natural gas combined cycle (NGCC) combined heat and power (CHP) plant

    International Nuclear Information System (INIS)

    The goal of this study is to evaluate co-firing of gasified CO2 neutral biofuel in a retrofitted natural gas combined cycle (NGCC) combined heat and power (CHP) unit designed for natural gas operation. This type of situation may be particularly relevant if future CO2 abatement policies require that owners of natural gas fired CHP units reduce CO2 emissions. The study investigates the technical, economic and environmental performance of the CHP unit for different fractions of gasified biofuel in the unit's fuel mix. The power plant simulation program GateCycle was used for plant performance evaluation. The calculations are based on a large size (about 300MWe) NGCC CHP plant that is planned to be built on the West coast of Sweden, producing electricity and district heating for the local energy utility company. The results from this study show that it is possible to co-fire up to 40% (energy basis) biofuel product gas in the CHP unit. At this level of product gas co-firing, the unit's electrical and total efficiencies decrease by approximately 2%-points, compared to operation on natural gas only. Global CO2 emissions can be reduced by approximately 400,000 tonnes/year. The total costs for the local utility company depend on the prevailing CO2 taxation rules, and on the assumed premium value of the renewable power produced. For the base case conditions assumed in the study, the cost of electricity (COE) for a natural gas fired NGCC CHP unit is 253SEK/MWh, increasing to 306SEK/MWh when a biofuel gasifier is integrated to the unit. A premium value for renewable electricity of 285SEK/MWh is required for equal COE values to be achieved by the two systems. (author)

  2. Flue gas condensation in straw fired CHP plants; Roeggaskondensation i halmfyrede kraftvarmeanlaeg

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2000-06-15

    The high price of straw and a general demand for increased use of straw in power and heat production are expected to result in an increased need for efficient fuel utilization. The use of flue gas condensation in straw fired CHP plants can contribute to a higher exploitation of energy, and at the same time open of the possibility of utilization of wet (cheaper) fuels without energy loss. Furthermore flue gas condensation can contribute to the flue gas cleaning process through removal of HCl and SO{sub 2} as well as in particle cleaning in wet cleaning processes. With starting point in a straw fired CHP plant the technical and economic consequences of installation of a flue gas condensation system are investigated. Fuel exploitation and power/heat production distribution is included in the investigation. (BA)

  3. Optimal power flow based TU/CHP/PV/WPP coordination in view of wind speed, solar irradiance and load correlations

    International Nuclear Information System (INIS)

    Highlights: • Formulate probabilistic OPF with VPE, multi-fuel options, POZs, FOR of CHP units. • Propose a new powerful optimization method based on enhanced black hole algorithm. • Coordinate of TUs, WPPs, PVs and CHP units together in the proposed problem. • Evaluate the impacts of inputs’ uncertainties and their correlations on the POPF. • Use the 2m + 1 point estimated method. - Abstract: This paper addresses a novel probabilistic optimisation framework for handling power system uncertainties in the optimal power flow (OPF) problem that considers all the essential factors of great impact in the OPF problem. The object is to study and model the correlation and fluctuation of load demands, photovoltaic (PV) and wind power plants (WPPs) which have an important influence on transmission lines and bus voltages. Moreover, as an important tool of saving waste heat energy in the thermoelectric power plant, the power networks share of combined heat and power (CHP) has increased dramatically in the past decade. So, the probabilistic OPF (POPF) problem considering valve point effects, multi-fuel options and prohibited zones of thermal units (TUs) is firstly formulated. The PV, WPP and CHP units are also modeled. Then, a new method utilizing enhanced binary black hole (EBBH) algorithm and 2m + 1 point estimated method is proposed to solve this problem and to handle the random nature of solar irradiance, wind speed and load of consumers. The correlation between input random variables is considered using a correlation matrix. Finally, numerical results are presented and considered regarding the IEEE 118-busses, including PV, WPP, CHP and TU at several busses. The simulation and comparison results obtained demonstrate the broad advantages and feasibility of the suggested framework in the presence of dependent non-Gaussian distribution of random variables

  4. Modeling and parametric study of a 1 kWe HT-PEMFC-based residential micro-CHP system

    DEFF Research Database (Denmark)

    Arsalis, Alexandros; Nielsen, Mads Pagh; Kær, Søren Knudsen

    2011-01-01

    for fuel cell-based residential micro-CHP systems, since it can operate at higher temperature than Nafion-based fuel cells, and therefore can reach higher cogeneration efficiencies. The proposed system can provide electric power, hot water, and space heating for a typical Danish single......A detailed thermodynamic, kinetic and geometric model of a micro-CHP (Combined-Heatand-Power) residential system based on High Temperature-Proton Exchange Membrane Fuel Cell (HT-PEMFC) technology is developed, implemented and validated. HT-PEMFC technology is investigated as a possible candidate......-family household. A complete fuel processing subsystem, with all necessary balance-of-plant components, is modeled and coupled to the fuel cell stack subsystem. The micro-CHP system’s synthesis/ design and operational pattern is analyzed by means of a parametric study. The parametric study is conducted to...

  5. Aeroderivative Gas Turbo engine in CHP Plant. Compatibility Problems

    OpenAIRE

    Sorinel-Gicu TALIF

    2010-01-01

    The paper presents the possibilities to develop Combined Cycle Units based onaeroderivative Gas Turbo engines and on existing Steam Turbines. The specific compatibilityproblems of these components and the thermodynamic performances of the analyzed Combined CycleUnits are also presented.

  6. Aeroderivative Gas Turbo engine in CHP Plant. Compatibility Problems

    Directory of Open Access Journals (Sweden)

    Sorinel-Gicu TALIF

    2010-12-01

    Full Text Available The paper presents the possibilities to develop Combined Cycle Units based onaeroderivative Gas Turbo engines and on existing Steam Turbines. The specific compatibilityproblems of these components and the thermodynamic performances of the analyzed Combined CycleUnits are also presented.

  7. Network Capacity Assessment of CHP-based Distributed Generation on Urban Energy Distribution Networks

    Science.gov (United States)

    Zhang, Xianjun

    The combined heat and power (CHP)-based distributed generation (DG) or dis-tributed energy resources (DERs) are mature options available in the present energy market, considered to be an effective solution to promote energy efficiency. In the urban environment, the electricity, water and natural gas distribution networks are becoming increasingly interconnected with the growing penetration of the CHP-based DG. Subsequently, this emerging interdependence leads to new topics meriting serious consideration: how much of the CHP-based DG can be accommodated and where to locate these DERs, and given preexisting constraints, how to quantify the mutual impacts on operation performances between these urban energy distribution networks and the CHP-based DG. The early research work was conducted to investigate the feasibility and design methods for one residential microgrid system based on existing electricity, water and gas infrastructures of a residential community, mainly focusing on the economic planning. However, this proposed design method cannot determine the optimal DG sizing and siting for a larger test bed with the given information of energy infrastructures. In this context, a more systematic as well as generalized approach should be developed to solve these problems. In the later study, the model architecture that integrates urban electricity, water and gas distribution networks, and the CHP-based DG system was developed. The proposed approach addressed the challenge of identifying the optimal sizing and siting of the CHP-based DG on these urban energy networks and the mutual impacts on operation performances were also quantified. For this study, the overall objective is to maximize the electrical output and recovered thermal output of the CHP-based DG units. The electricity, gas, and water system models were developed individually and coupled by the developed CHP-based DG system model. The resultant integrated system model is used to constrain the DG's electrical

  8. Modeling and simulation of a residential micro-CHP system based on HT-PEMFC technology

    DEFF Research Database (Denmark)

    Arsalis, Alexandros; Nielsen, Mads Pagh; Kær, Søren Knudsen

    2009-01-01

    Combined-heat-and-power (CHP) technology is a well known and proved method to produce simultaneously power and heat at high efficiencies. This can be further improved by the introduction of a novel micro-CHP residential system based on High Temperature-Proton Exchange Membrane Fuel Cell (HT......-PEMFC). The HT-PEMFC (based on PBI-membrane technology) operates at temperatures near 200oC, and this can be an ideal match for cogeneration residential systems. The proposed system provides electric power, hot water, and space heating for a typical household (1-5 kWe, 5-10 kWth). The micro-CHP system is...

  9. Techno-Economic Study of Adsorption Processes for Pre-Combustion Carbon Capture at a Biomass CHP Plant

    OpenAIRE

    Oreggioni, Gabriel David; Friedrich, Daniel; Brandani, Stefano; Ahn, Hyungwoong

    2014-01-01

    An exemplary 10 MWth biomass CHP plant with a FICFB (Fast Internally Circulating Fluidised Bed) gasifier and Jenbacher type 6 gas engine was simulated to estimate the power and thermal outputs. The biomass-fuelled CHP plant was modified for carbon capture using either adsorption or amine process. It was found that a two-stage, two-bed PVSA (Pressure Vacuum Swing Adsorption) unit applied to syngas stream for pre-combustion capture spent less specific energy per captured CO2 than a conventional...

  10. Experimental development, 1D CFD simulation and energetic analysis of a 15 kw micro-CHP unit based on reciprocating internal combustion engine

    International Nuclear Information System (INIS)

    Cogeneration is commonly recognized as one of the most effective solutions to achieve the increasingly stringent reduction in primary energy consumption and greenhouse emissions. This characteristic led to the adoption of specific directives promoting this technique. In addition, a strategic role in power reliability is recognized to distributed generation. The study and prototyping of cogeneration plants, therefore, has involved many research centres. This paper deals with energetic aspects of CHP referring to the study of a 15 kW micro-CHP plant based on a LPG reciprocating engine designed, built and grid connected. The plant consists of a heat recovery system characterized by a single water circuit recovering heat from exhaust gases, from engine coolant and from the energy radiated by the engine within the shell hosting the plant. Some tests were carried out at whole open throttle and the experimental data were collected. However it was needed to perform a 1D thermo-fluid dynamics simulation of the engine to completely characterize the micro-CHP. As the heat actually recovered depends on the user's thermal load, particularly from the required temperature's level, a comparison of the results for six types of users were performed: residential, hospital, office, commercial, sports, hotel. Both Italian legislative indexes IRE and LT were evaluated, as defined by A.E.E.G resolution n. 42/02 and subsequent updates, as well as the plant's total Primary Energy Saving. - Highlights: • This paper deals with energetic aspects of CHP referring to the study of a 15 kW micro-CHP plant. • The 15 kW micro-CHP plant is based on a GPL reciprocating engine designed, built and grid connected. • Some tests were carried out at whole open throttle and the experimental data were collected. • It was needed to perform a 1D thermo-fluid dynamics simulation of the engine to completely characterize the micro-CHP. • The analysed solution is particularly suited for

  11. Should a small combined heat and power plant (CHP) open to its regional power and heat networks? Integrated economic, energy, and emergy evaluation of optimization plans for Jiufa CHP

    International Nuclear Information System (INIS)

    The development of industrial ecology has led company managers to increasingly consider their company's niche in the regional system, and to develop optimization plans. We used emergy-based, ecological-economic synthesis to evaluate two optimization plans for the Jiufa Combined Heat and Power (CHP) Plant, Shandong China. In addition, we performed economic input-output analysis and energy analysis on the system. The results showed that appropriately incorporating a firm with temporary extra productivity into its regional system will help maximize the total productivity and improve ecological-economic efficiency and benefits to society, even without technical optimization of the firm itself. In addition, developing a closer relationship between a company and its regional system will facilitate the development of new optimization opportunities. Small coal-based CHP plants have lower-energy efficiency, higher environmental loading, and lower sustainability than large fossil fuel and renewable energy-based systems. The emergy exchange ratio (EER) proved to be an important index for evaluating the vitality of highly developed ecological-economic systems

  12. Thermal gain of CHP steam generator plants and heat supply systems

    Science.gov (United States)

    Ziganshina, S. K.; Kudinov, A. A.

    2016-08-01

    Heating calculation of the surface condensate heat recovery unit (HRU) installed behind the BKZ-420-140 NGM boiler resulting in determination of HRU heat output according to fire gas value parameters at the heat recovery unit inlet and its outlet, heated water quantity, combustion efficiency per boiler as a result of installation of HRU, and steam condensate discharge from combustion products at its cooling below condensing point and HRU heat exchange area has been performed. Inspection results of Samara CHP BKZ-420-140 NGM power boilers and field tests of the surface condensate heat recovery unit (HRU) made on the bimetal calorifier base КСк-4-11 (KSk-4-11) installed behind station no. 2 Ulyanovsk CHP-3 DE-10-14 GM boiler were the basis of calculation. Integration of the surface condensation heat recovery unit behind a steam boiler rendered it possible to increase combustion efficiency and simultaneously decrease nitrogen oxide content in exit gases. Influence of the blowing air moisture content, the excess-air coefficient in exit gases, and exit gases temperature at the HRU outlet on steam condensate amount discharge from combustion products at its cooling below condensing point has been analyzed. The steam condensate from HRU gases is offered as heat system make-up water after degasification. The cost-effectiveness analysis of HRU installation behind the Samara CHP BKZ-420-140 NGM steam boiler with consideration of heat energy and chemically purified water economy has been performed. Calculation data for boilers with different heat output has been generalized.

  13. Economic analysis of a supercritical coal-fired CHP plant integrated with an absorption carbon capture installation

    International Nuclear Information System (INIS)

    Energy investments in Poland are currently focused on supercritical coal-fired unit technology. It is likely, that in the future, these units are to be integrated with carbon capture and storage (CCS) installations, which enable a significant reduction of greenhouse gas emissions into the atmosphere. A significant share of the energy market in Poland is constituted by coal-fired combined heat and power (CHP) plants. The integration of these units with CCS installation can be economically inefficient. However, the lack of such integration enhances the investment risk due to the possibility of appearing on the market in the near future high prices of emission allowances. The aforementioned factors and additional favorable conditions for the development of cogeneration can cause one to consider investing in large supercritical CHP plants. This paper presents the results of an economic analysis aimed at comparing three cases of CHP plants, one without an integrated CCS installation and two with such installations. The same steam cycle structure for all variants was adopted. The cases of integrated CHP plants differ from each other in the manner in which they recover heat. For the evaluation of the respective solutions, the break-even price of electricity and avoided emission cost were used. - Highlights: • The simulations of operation of CHP plants under changing load have been realized. • For analyzed cases sensitivity analyses of economic indices have been conducted. • Conditions of competitiveness for integration with CCS units have been identified. • Integration can be profitable if prices of allowance will reach high values, exceeding 50 €/MgCO2. • Others important factors are the investment costs and operation and maintenance costs

  14. Fuel cell power plants for decentralised CHP applications; Brennstoffzellen-Kraftwerke fuer dezentrale KWK-Anwendungen

    Energy Technology Data Exchange (ETDEWEB)

    Ohmer, Martin; Mattner, Katja [FuelCell Energy Solutions GmbH, Dresden (Germany)

    2015-06-01

    Fuel cells are the most efficient technology to convert chemical energy into electricity and heat and thus they could have a major impact on reducing fuel consumption, CO{sub 2} and other emissions (NO{sub x}, SO{sub x} and particulate matter). Fired with natural or biogas and operated with an efficiency of up to 49 % a significant reduction of fuel costs can be achieved in decentralised applications. Combined heat and power (CHP) configurations add value for a wide range of industrial applications. The exhaust heat of approximately 400 C can be utilised for heating purposes and the production of steam. Besides, it can be also fed directly to adsorption cooling systems. With more than 110 fuel cell power plants operating worldwide, this technology is a serious alternative to conventional gas turbines or gas engines.

  15. Decentralised CHP in a competitive market

    DEFF Research Database (Denmark)

    Lund, Henrik

    2004-01-01

    The article agues that decentralised CHP plants is an important part of energy supply in Denmark.......The article agues that decentralised CHP plants is an important part of energy supply in Denmark....

  16. Optimal design of CHP-based microgrids: Multiobjective optimisation and life cycle assessment

    International Nuclear Information System (INIS)

    As an alternative to current centralised energy generation systems, microgrids are adopted to provide local energy with lower energy expenses and gas emissions by utilising distributed energy resources (DER). Several micro combined heat and power technologies have been developed recently for applications at domestic scale. The optimal design of DERs within CHP-based microgrids plays an important role in promoting the penetration of microgrid systems. In this work, the optimal design of microgrids with CHP units is addressed by coupling environmental and economic sustainability in a multi-objective optimisation model which integrates the results of a life cycle assessment of the microgrids investigated. The results show that the installation of multiple CHP technologies has a lower cost with higher environmental saving compared with the case when only a single technology is installed in each site, meaning that the microgrid works in a more efficient way when multiple technologies are selected. In general, proton exchange membrane (PEM) fuel cells are chosen as the basic CHP technology for most solutions, which offers lower environmental impacts at low cost. However, internal combustions engines (ICE) and Stirling engines (SE) are preferred if the heat demand is high. - Highlights: • Optimal design of microgrids is addressed by coupling environmental and economic aspects. • An MILP model is formulated based on the ε-constraint method. • The model selects a combination of CHP technologies with different technical characteristics for optimum scenarios. • The global warming potential (GWP) and the acidification potential (AP) are determined. • The output of LCA is used as an input for the optimisation model

  17. A Geothermal Energy Supported Gas-steam Cogeneration Unit as a Possible Replacement for the Old Part of a Municipal CHP Plant (TEKO

    Directory of Open Access Journals (Sweden)

    L. Böszörményi

    2001-01-01

    Full Text Available The need for more intensive utilization of local renewable energy sources is indisputable. Under the current economic circumstances their competitiveness in comparison with fossil fuels is rather low, if we do not take into account environmental considerations. Integrating geothermal sources into combined heat and power production in a municipal CHP plant would be an excellent solution to this problem. This concept could lead to an innovative type of power plant - a gas-steam cycle based, geothermal energy supported cogeneration unit.

  18. Technical, economic and exergoeconomic assessment of small scale biomass CHP plant in an existing Brazilian's industry

    Energy Technology Data Exchange (ETDEWEB)

    Rodrigues, M.L.M.; Arrieta, F.R.P. [Papal Catholic University of Minas Gerais (PUC-Minas), Belo Horizonte, MG (Brazil). Dept. of Mechanical Engineering], Emails: mlmroduol.com.br, feliperp_arrieta@yahoo.com.br

    2009-07-01

    A technical, economic and exergoeconomic assessment was developed in order to verify the economic feasibility of the implementation of a CHP (Combined Heat and Power) plant in an existing Brazilian industry as a technological solution to assure the energy demands of its productive process. The assessment began with the attainment of the values of heat and electricity demands of the process. In a second stage, considering the current biomass availability and the existing boiler upgrade for the superheat steam generation, a small scale Rankine cycle was defined for the CHP plant. A thermodynamic model of the thermal cycle of CHP plant was crated in the EES (Engineering Equation Solver) and was used to simulating the interaction and integration with the production process and external interfaces. The simulation for the steady state operation considered the process values of heat and electricity demands considering two hypotheses: selling or not selling of electricity to the grid and burning wood chips or vegetal carbon residue as fuel. For the feasibility assessment, a cash flow was elaborated in a Microsoft Excel sheet and it was used for computing the conventional financial indicators of the CHP plant implementation: Net Present Value, Internal Rate of Return, and Pay Back. For the exergoeconomic assessment was applied the Thermo economic Structural Theory. The results show the mass, energy and entropy balances, as well as the characteristic parameters for the different equipment and the CCHP plant. The main conclusions are: there are not feasibility of the CHP plant implementation at the current electricity tariff and fuel price, but in a most favorable scenario the hypothesis of selling electricity to the grid was the most interesting among the assessed ones; the vegetal carbon residue is the fuel option with greater economic viability; the values of electricity cost calculated in the exergoeconomic analysis are coherent with the economic analysis ones and are

  19. Development of Small-Scale CHP Plant with a Wood Powder-Fueled Stirling Engine

    Science.gov (United States)

    Sato, Katsura; Ohiwa, Norio; Ishikawa, Akira; Shimojima, Hidetoshi; Nishiyama, Akio; Moriya, Yoichi

    Small-scale biomass CHP (combined heat and power) plants are in demand for environmental reasons - particularly systems fueled by wood waste, which are simple to operate and require no maintenance while having high thermal efficiency similar to oil-fired units. A 55kWe Stirling engine CHP system, combined with a simplified biomass combustion process that uses pulverized wood powder has been developed to meet these requirements. Wood powder of less than 500 μm was mainly used in these tests, and a combustion chamber length of 3 m was applied. Under these conditions, the air ratio can be reduced to 1.1 without increasing CO emissions by less than 10 ppm, and with combustion efficiency of 99.9%. Under the same conditions, NOx emissions are estimated to be less than 120 ppm (on the basis of 6% O2). Wood powder was confirmed to have excellent properties as a fuel for Stirling engines. The 55 kWe Stirling engine performance test was carried out to optimize the operating condition of wood powder burners. The status of Stirling engine operation at a full load with 55 kWe was stable, and start-up and shut -down operations were easy to perform. Operational status was evaluated as being excellent, except for an ash fouling problem in the Stirling engine heater tubes. Ash fouling characteristics were considered in the final stage of the demonstration test. This paper summarizes the wood powder combustion test and Stirling engine performance test. Furthermore, the ash fouling data is shown and the mechanism of ash fouling in heater tubes is discussed.

  20. Implementation strategy for small CHP-plants in a competitive market

    DEFF Research Database (Denmark)

    Lund, Henrik; Šiupšinskas, G.; Martinaitis, V.

    2005-01-01

    The article analyses the conditions for the replacement of boilers in the existing district-heating supplies with combined heat-and-power production (CHP) in Lithuania.......The article analyses the conditions for the replacement of boilers in the existing district-heating supplies with combined heat-and-power production (CHP) in Lithuania....

  1. Preclinical Safety Pharmacology Study of a Novel Protein-Based Cancer Vaccine CHP-NY-ESO-1

    OpenAIRE

    Harada, Naozumi; Hoshiai, Kiyotaka; Takahashi, Yoshiyasu; Sakaguchi, Yasue; Kuno, Takayoshi; Hishida, Tadashi; Shiku, Hiroshi

    2008-01-01

    CHP-NY-ESO-1 is a novel therapeutic cancer vaccine consisting of a recombinantprotein of cancer antigen NY-ESO-1 and a polysaccharide-based delivery system,cholesteryl pullulan. A pilot clinical study of CHP-NY-ESO-1 in cancer patients waspreviously conducted, and the adverse events related to this drug were observed to belimited to skin reactions at injection sites. To further establish the safety ofCHP-NY-ESO-1, we studied the effects of its subcutaneous injection on vital functionssuch as ...

  2. Dicty_cDB: CHP110 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP110 (Link to dictyBase) - - - Contig-U10711-1 | Contig-U13105-1 CHP1...10P (Link to Original site) CHP110F 130 CHP110Z 390 CHP110P 500 - - Show CHP110 Library CH (Link to library) Clone ID CHP1...11-1 | Contig-U13105-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CH/CHP1-A/CHP1...10Q.Seq.d/ Representative seq. ID CHP110P (Link to Original site) Representative DNA sequence >CHP110 (CHP1...10Q) /CSM/CH/CHP1-A/CHP110Q.Seq.d/ TGTTGGCCTACTGGNACCTCCAACAAATAACAACCAACTTAGNATTTGTCAATTATATAT

  3. Implementation strategy for small CHP-plants in a competitive market: the case of Lithuania

    Energy Technology Data Exchange (ETDEWEB)

    Lund, H. [Aalborg Univ., Dept. of Development and Planning, Aalborg (Denmark); Siupsinskas, G.; Martinaitis, V. [Vilnius Gediminas Technical Univ., Dept. of Heating and Ventilation, Vilnius (Lithuania)

    2005-11-01

    Within five years from now, Lithuania is going to close down Ignalina, the only nuclear-power plant in the country. Since Ignalina generates more than 75% of the Lithuanian electricity production, new generation capacities are needed. Traditional steam-turbines, fuelled with fossil fuels, would mean further imports of fuel as well as a rise in CO{sub 2} emissions. At the same time, several small district-heating companies one suffering from high heating-prices. Typically, the price in small towns is 20-50% higher than the price in large urban areas. Consequently, alternative strategies should be considered. This article analyses the conditions for one such strategy, namely the replacement of boilers in the existing district-heating supplies with combined heat-and-power production (CHP). Compared with new power stations, fuel can be saved and CO{sub 2}-emissions reduced. Also this strategy can be used to level the difference between low heating prices in the large urban areas and high prices in small towns and villages. (Author)

  4. Retrofitting micro gas turbines for wet operation. A way to increase operational flexibility in distributed CHP plants

    International Nuclear Information System (INIS)

    Highlights: • Thermodynamic modeling of wet micro gas turbines. • Technoeconomic analysis of mGTs retrofits for wet operation. • Demonstration of the operational flexibility increase due to wet operation. • In depth case study analysis of a CHP system in 15-min time-intervals. • Sensitivity analysis on all major economic parameters of wet operation. - Abstract: It is generally accepted that only flexible CHP plants could be a viable option in an electrical system with high penetration of variable renewables. Variable power-to-heat-ratios and decoupled power and heat generation will be basic requirements. Currently, the most common way to fulfill these specifications is the use of heat storage devices, whereas wet operation of gas turbines is an alternative way to achieve both goals. The current work is an analysis of a micro gas turbine adapted to operate with steam injection. A thermodynamic model is developed and a typical apartments building in Berlin, Germany is chosen as a case study. The study presumes the existence of a micro gas turbine and analyzes the results of its adaptation for wet operation. The environmental and economic performance of the new system is compared to that of its commercial counterpart. It is shown that the retrofitted turbine has longer annual operation time and higher electrical energy generation. The retrofit also proves to be an attractive investment for the German CHP market with internal rates of return reaching almost 20%

  5. Evaluation of the operational cost savings potential from a D-CHP system based on a monthly power-to-heat ratio analysis

    OpenAIRE

    Alta Knizley; Pedro J. Mago; James Tobermann

    2015-01-01

    This paper focuses on the analysis of a combined heat and power (CHP) system utilizing two power generation units operating simultaneously under differing operational strategies (D-CHP) on the basis of operational cost savings. A cost optimization metric, based on the facility monthly power-to-heat ratio (PHR), is presented in this paper. The PHR is defined as the ratio between the facility electric load and thermal load. Previous work in this field has suggested that D-CHP system performance...

  6. More performance by means of enhancement of the efficiency of CHP plants. CHP operation of an ORC plant; Mehr Leistung durch Effizienzsteigerung von KWK-Anlagen. KWK-Betrieb einer ORC-Anlage

    Energy Technology Data Exchange (ETDEWEB)

    Greschner, Timm; Fink, Jochen; Stadelmaier, Fabian [Duerr Cyplan Ltd., Bietigheim-Bissingen (Germany)

    2013-07-15

    In November 2012, the biogas plant of Stadtwerke Gross-Gerau-Versorgungs-GmbH (GGV) was supplemented with an energy-efficient organic Rankine cycle system (ORC) from Duerr Cyplan Ltd. (Bietigheim-Bissingen, Federal Republic of Germany). The ORC technology enables the utilization of the exhaust heat from the combustion of the gas for the power generation. Hereby, the efficiency in the power generation is increased by about 8 % in Gross-Gerau. Furthermore, the existing energy recovery concept is improved by the CHP operation of the ORC system. With the experience from Gross-Gerau new business segments can be accessed by means of the ORC technology.

  7. Survey of controllability in decentralized CHP plants. Optimal operation of priority production units; Kortlaegning af decentrale kraftvarmevaerkers regulerbarhed. Optimal drift af prioriterede anlaeg - Teknologisk grundlag

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2005-03-15

    The present report presents results from two closely related projects, carried out in parallel, under the PSO-F and U 2002. The one project is 'Survey of controllability in de-centralized combined heat and power plants' project number PSO 4724 and is fully reported here. The other project: 'Optimal operation of priority production units, project number PSO 4712, only the part project 'Technological foundations is reported here. In project 4724 the technical conditions that matter regarding controllability of electricity production in de-centralized heat and power stations are surveyed. In this context the term controllability means how fast and to which extent the load factors of the plants can be changed. Also, is has been investigated which options are available for improving the controllability, their potentials and estimates on required investments associated. The investigation covers CHP plants having a production capacity of up to 30 MW of electricity. The main part of the de-centralized CHP plants are based on spark ignited internal combustion engines (Otto engines). Most of these engines are fuelled by natural gas and a smaller part by biogas. A minor number are gas turbines fuelled by natural gas and steam turbines in industrial applications, waste incineration plants or in combined cycle power plants. The mapping has among others consisted of a number of visits on selected different types of plants including interview with people responsible for the daily operation. From these interviews data on the actual operating strategy and technical data have been provided. In addition suppliers of engines and other equipment involved have been contacted for technical information or recommendations regarding possible changes in operation strategy. Searching the Internet has been widely used for identification of technical investigations concerning e.g. operation and maintenance of relevant equipment. Finally, substantial statistical data from

  8. Efficient Heat Use from Biogas CHP Plants. Case Studies from Biogas Plants in Latvia

    OpenAIRE

    Dzene, Ilze; Slotiņa, Lāsma

    2013-01-01

    This paper is focusing on efficient heat use from biogas plants. It gives an overview about various biogas heat use options and specifically addresses biogas heat use market in Latvia. In the end three examples from typical agricultural biogas plants in Latvia and their heat use plans are described.

  9. The role of combined heat and power (CHP) in energy and climate policy

    International Nuclear Information System (INIS)

    In the energy- and environment context CHP is said to be especially energy saving and climate preserving. This report shows that from the standpoint of energy economics as well as under technical aspects this judgement holds true only under special conditions. Depending on the technical parameters, the concrete circumstances of operation and the characteristics of the power plants and heating systems compared to CHP-plants the range of realistic energy savings turns out to be very large. Related overstimations are to a good extend caused by the traditional practice of granting the energetic advantage of CHP exclusively to the district heating. If this advantage is credited to heat and power as equal shares space heating with cogenerated power of 80% efficiency reveals to be very energy conserving. The uno actu utilization of cogenerated heat and power, for the same purpose could facilitate the expansion of CHP, since the problems related to the feeding of cogenerated power into the grid for general purposes would disappear. The second main issue of this report concerns the abatement of CO2-emissions with the aid of CHP. Fuelled with natural gas, CHP-plants are attractive instruments for climate policy. This is especially true if CHP is compared to old coal-based power plants and oil-fuelled old heating systems. In the FRG, however, hard coal, and not natural gas, will be the main fuel for future CHP, lowering its CO2-advantage considerably. On the other hand high efficient combi-power plants (gas turbine plus condensing turbine) and gas heating systems have to be included in the comparative analyse. Compared to these advanced systems the CO2-characteristics of CHP are inferior. Moreover, the specific CO2-advantage of natural gas is better used by such modern mono systems rather than CHP-plants. (orig.)

  10. Evaluation of the operational cost savings potential from a D-CHP system based on a monthly power-to-heat ratio analysis

    Directory of Open Access Journals (Sweden)

    Alta Knizley

    2015-12-01

    Full Text Available This paper focuses on the analysis of a combined heat and power (CHP system utilizing two power generation units operating simultaneously under differing operational strategies (D-CHP on the basis of operational cost savings. A cost optimization metric, based on the facility monthly power-to-heat ratio (PHR, is presented in this paper. The PHR is defined as the ratio between the facility electric load and thermal load. Previous work in this field has suggested that D-CHP system performance may be improved by limiting operation of the system to months in which the PHR is relatively low. The focus of this paper is to illustrate how the facility PHR parameter could be used to establish the potential of a D-CHP system to reduce operational cost with respect to traditional CHP systems and conventional systems with separate heating and power. This paper analyzes the relationship between the PHR and the operational cost savings of eight different benchmark buildings. Achieving operational cost savings through optimal operation based on monthly PHR for these building types can enhance the implementation potential of D-CHP and CHP systems. Results indicate that the PHR parameter can be used to predict the potential for a D-CHP system to reduce the operational cost.

  11. SOFC-based micro-CHP system as an example of efficient power generation unit

    Science.gov (United States)

    Kupecki, Jakub; Badyda, Krzysztof

    2011-12-01

    Microscale combined heat and power (CHP) unit based on solid oxide fuel cells (SOFC) for distributed generation was analyzed. Operation principle is provided, and the technology development in recent years is briefly discussed. System baseline for numerical analysis under steady-state operation is given. Grid-connected unit, fuelled by biogas corresponds to potential market demand in Europe, therefore has been selected for analysis. Fuel processing method for particular application is described. Results of modeling performed in ASPEN Plus engineering software with certain assumptions are presented and discussed. Due to high system electrical efficiency exceeding 40%, and overall efficiency over 80%, technology is an example of highly competitive and sustainable energy generation unit.

  12. Simulation analysis of a repowered double fuel CHP plant including a non-evaporative heat recovery boiler

    Energy Technology Data Exchange (ETDEWEB)

    Marcin Liszka; Jan Szargut [Silesian University of Technology, Gliwice (Poland). Inst. of Thermal Technology

    2004-06-25

    Repowering analysis of a conventional, coal-fired industrial combined heat and power (CHP) plant by means of a gas turbine (GT) and heat recovery boiler (HRB) has been considered. The existing system, operating in one of the Polish chemical factories consists of coal-fired boilers, back-pressure extraction turbines, condensing turbines and steam-fed district heat exchangers. Two variants of modernization have been proposed and examined from the thermodynamic, environmental protection and economical points of view. The first one includes HRB for preheating the boiler feed water, condensate, and district water, while the steam turbine (ST) system and coal boilers work without any structural changes. The other advanced variant introduces live steam superheaters to HRB. The coal-fired boilers, in this light, supply only saturated steam (which is introduced into HRB), so they have to be readjusted by replacing the existing superheaters with convective vaporizers for proper flue gas cooling. Such a scheme ensures a considerable reduction of exergy losses in HRB and therefore leads to deeper flue gas cooling and a decrease of coal consumption for the assumed process steam and district heat demands. Heat and process steam demand duration curves for a typical year of operation of the plant have been adapted as input data. The mathematical model of the whole CHP plant has been built on GateCycle and Visual Basic software. The results obtained lead to the conclusion that repowering of a coal-fired plant by means of a GT and HRB is a very effective way to improve the thermodynamic and environmental protection aspects of power and heat generation. The introduction of the live steam superheater into HRB provides additional advantages in these fields. The economic results indicate discounted pay back periods from 3 to 11 years, depending on the situation at the electricity and fuel markets. 7 refs., 19 figs., 2 tabs.

  13. Australian coal mine methane emissions mitigation potential using a Stirling engine-based CHP system

    International Nuclear Information System (INIS)

    Methane, a major contributor to global warming, is a greenhouse gas emitted from coal mines. Abundance of coal mines and consequently a considerable amount of methane emission requires drastic measures to mitigate harmful effects of coal mining on the environment. One of the commonly adopted methods is to use emitted methane to fuel power generation systems; however, instability of fuel sources hinders the development of systems using conventional prime movers. To address this, application of Stirling engines may be considered. Here, we develop a techno-economic methodology for conducting an optimisation-based feasibility study on the application of Stirling engines as the prime movers of coal mine CHP systems from an economic and an environmental point of view. To examine the impact of environmental policies on the economics of the system, the two commonly implemented ones (i.e. a carbon tax and emissions trading scheme) are considered. The methodology was applied to a local coal mine. The results indicate that incorporating the modelled system not only leads to a substantial reduction in greenhouse gas emissions, but also to improved economics. Further, due to the heavy economic burden, the carbon tax scheme creates great incentive for coal mine industry to address the methane emissions. -- Highlights: •We study the application of Stirling engines in coal mine CHP systems. •We develop a thermo-economic approach based on the net present worth analysis. •We examine the impact of a carbon tax and ETS on the economics of the system. •The modeled system leads to a substantial reduction in greenhouse gas emissions. •Carbon tax provides a greater incentive to address the methane emissions

  14. Dicty_cDB: CHP159 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP159 (Link to dictyBase) - - - Contig-U15743-1 CHP159P (Link... to Original site) CHP159F 653 CHP159Z 743 CHP159P 1376 - - Show CHP159 Library CH (Link to library) Clone ID CHP159 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15743-1 Original site URL http://dict...TSTKXLSLDQVSLIVSIVFHHHVESSKRLQNQXKVNQAGSLVKKENLLALIKILH FDQSINRQQLNSILVQICTFSDNREELLCYILQILTGYQSIVSQQPQRKTAE...HHHVESSKRLQNQXKVNQAGSLVKKENLLALIKILH FDQSINRQQLNSILVQICTFSDNREELLCYILQILTGYQSIVSQ

  15. Marketing opportunities for CHP electricity in a virtual power plant. Direct and indirect marketing of flexibility; Vermarktungschancen fuer KWK-Strom im virtuellen Kraftwerk. Direkte und indirekte Flexibilitaetsvermarktung

    Energy Technology Data Exchange (ETDEWEB)

    Otto, Achim; Baumgart, Bastian [Trianel GmbH, Aachen (Germany). Abt. Virtuelle Kraftwerke

    2013-07-15

    The increasingly fluctuating feed-in of electricity by means of a rapid expansion of renewable energies results in an increasing demand for flexible performance for the regulation of production and consumption. An important part of the necessary flexibility could be provided by CHP plants. Their potential of flexibility is not always fully exploited.

  16. Design and test of a single effect thermal desalination plant using waste heat from m-CHP units

    International Nuclear Information System (INIS)

    This work refers to an innovative integrated system for the simultaneous production of fresh water and electricity. In particular, a 1 kWe Stirling engine coupled with a thermal desalination plant has been considered for the purpose. The prototype, which refers to the distributed micro cogeneration field, has the final aim of building and testing a single effect distillation plant with a fresh water production of about 150 L/d. Firstly, thermodynamic theories and numerical analysis have been carried out to define the final prototype configuration. Then, an experimental test phase has been carried out to evaluate the actual plant performance. The experimental analysis has been in good agreement with the predicted results. In particular, at nominal operating conditions (@50 °C) the maximum heat transfer rate was higher than the evaporator heat exchanger designed condition (5.5 kWt). Despite the non-ideal plant thermal insulation, fresh water production reached a maximum of about 7 L/h at best operating conditions, proving a good process efficiency. According to the behavior predicted by the model, fresh water production is strongly dependent on the temperature difference between the heating fluid and the salt water in the evaporator tank while it is weakly influenced by the salt content of the treated water. Moreover, the apparatus exhibited a very good response to varying thermal power input thus confirming the opportunity to feed the desalination plant also with different forms of waste heat. More precisely, the plant average efficiency was about 1.3 L/kWh of energy input with minimum and maximum values equal to 1.16 and 1.42 L/kWh. Definitely the proposed solution, studied for a coupling with a 1 kWe Stirling engine, can be easily applied also to the other micro-CHP technologies. - Highlights: • A single effect thermal desalination plant has been designed and tested. • Waste heat from different m-CHP units can be used as energy input for the plant.

  17. The method of the unit costs. A method for CHP plants cost allocation on both types of energy

    International Nuclear Information System (INIS)

    In the first part of the paper we try to explain why the production of electricity is more expansive than the production of heat. In the last part of the paper we propose a new method for fuel consumption allocation between the two forms of energy. The method leads to a scientifically higher cost for electricity but on the other hand presents some important advantages: - It establishes a correct price for both types of energy, increasing the competitiveness of the CHP plant on the heat market; - It facilitates the implementation of the energy efficiency methods focusing on electricity savings and that leads to higher fuel savings and lower greenhouse gasses emissions; - It facilitates the rehabilitation methods that lead to a higher electricity production efficiency

  18. Initial Market Assessment for Small-Scale Biomass-Based CHP

    Energy Technology Data Exchange (ETDEWEB)

    Brown, E.; Mann, M.

    2008-01-01

    The purpose of this report is to reexamine the energy generation market opportunities for biomass CHP applications smaller than 20 MW. This paper provides an overview of the benefits of and challenges for biomass CHP in terms of policy, including a discussion of the drivers behind, and constraints on, the biomass CHP market. The report provides a summary discussion of the available biomass supply types and technologies that could be used to feed the market. Two primary markets are outlined--rural/agricultural and urban--for small-scale biomass CHP, and illustrate the primary intersections of supply and demand for those markets. The paper concludes by summarizing the potential markets and suggests next steps for identifying and utilizing small-scale biomass.

  19. Energetic and exergetic efficiencies of coal-fired CHP (combined heat and power) plants used in district heating systems of China

    International Nuclear Information System (INIS)

    The efficiencies of coal-fired CHP (combined heat and power) plants used in the district heating systems of China were analyzed with a thermodynamic model in the Hysys program. The influences of four parameters were evaluated by the Taguchi method. The results indicated that the extraction steam flow rate and extraction steam pressure are the most important parameters for energetic and exergetic efficiencies, respectively. The relations between extraction steam flow rate, extraction steam pressure and the energetic and exergetic efficiencies were investigated. The energetic and exergetic efficiencies were compared to the RPES (relative primary energy savings) and the RAI (relative avoided irreversibility). Compared to SHP (separate heat and power) generation, the CHP systems save fuel energy when extraction ratio is larger than 0.15. In the analysis of RAI, the minimum extraction ratio at which CHP system has advantages compared with SHP varies between 0.25 and 0.6. The higher extraction pressure corresponds to a higher value. Two of the examined plants had design conditions giving RPES close to zero and negative RAI. The third had both positive RPES and RAI at design conditions. The minimum extraction ratio can be used as an indicator to design or choose CHP plant for a given district heating system. - Highlights: • Extraction flow rate and extraction pressure are the most important parameters. • The exergetic efficiency depends on the energy to exergy ratio and system boundary. • The minimum extraction ratio is a key indicator for CHP plants. • Program Hysys and Taguchi method are used in this research

  20. Exergetic comparison of efficiency indicators for combined heat and power (CHP)

    International Nuclear Information System (INIS)

    Legislative regulations in favor of combined heat and power (CHP) production have been implemented in many countries. Although these regulations put different emphasis on power production vs. process heat production, they are based on energy quantities and not on exergy. In order to analyze and compare the exergetic consequences of the various legislations, a relative avoided irreversibility (RAI) is defined. This can be regarded as the exergy loss that is avoided when reference plants with separate production are replaced by an actual CHP plant. Some series of industrial and district heating CHP plants, under varying operational conditions, are used as test cases. It is seen that some, but not all, CHP cases are exergetically beneficial to separate generation. Comparison with the RAI allows a quantitative assessment of the various performance indicators. It is seen that exergetic improvements were only captured to a limited degree by the various energy-based efficiency indicators. Some legislatively defined indicators even appear to discourage thermodynamic improvements

  1. Mini-Central heating and Power Plant (CHP): the choice of the optimal structure and modes of operation

    Science.gov (United States)

    Gil'manshin, I. R.; Konahina, I. A.; Kashapov, N. F.; Fahreev, N. N.

    2014-12-01

    The paper provides an overview of the different types of organizations of mini-CHP, the results of a comparative evaluation of their performance in terms of the variable load. The recommendations to improve power facilities of the mini-CHP on the basis of system analysis methods and the technical and economic optimization are defined.

  2. Preliminary experimental investigation of a natural gas-fired ORC-based micro-CHP system for residential buildings

    International Nuclear Information System (INIS)

    The continual increases in energy demand and greenhouse gas emissions, call for efficient use of energy resources. Decentralized combined heat and power (CHP) technology provides an alternative for the world to meet and solve energy-related problems including energy shortages, energy supply security, emission control and conservation of energy. This paper presents the preliminary results of an experimental investigation of a natural gas-fired micro-CHP system for residential buildings based on an organic Rankine cycle (ORC). Isopentane was used as the ORC working fluid in consideration of several criteria including its environmentally-friendly characteristics. Experiments were conducted to evaluate the performance of the developed system at different heat source temperatures of nominally 85, 80, 75, 70, and 65 °C. The maximum electrical power output of 77.4 W was generated at heating water entry temperature of 84.1 °C, corresponding to net cycle electrical efficiency of 1.66%. Further work will be done with a view to increasing the cycle electrical efficiency by using more efficient components, in particular the expander and generator. - Highlights: •A natural gas-fired ORC-based micro-scale CHP system has been developed and tested. •The good agreement between the mechanical and gross power validates the assumptions. •A vane expander suits a micro-CHP system based on an organic Rankine cycle. •A vane expander does not suit power generation by a Trilateral Flash Cycle (TFC). •Domestic gas-fired ORC systems may reduce reliance on central power stations

  3. Simulation analysis of a repowered double fuel CHP plant including a non-evaporative heat recovery boiler

    Energy Technology Data Exchange (ETDEWEB)

    Liszka, M.; Szargut, J. [Silesian Univ. of Technology, Gliwice (Poland). Inst. of Thermal Technology

    2004-07-01

    A repowering analysis of a conventional, coal-fired industrial combined heat and power (CHP) plant by means of a gas turbine (GT) and heat recovery boiler (HRB) has been taken into consideration. The existing system, operating in one of the Polish chemical factories consists of coal-fired boilers, back-pressure extraction turbines, condensing turbines and steam-fed district heat exchangers. Two variants of modernization have been proposed and examined from the thermodynamic, environmental protection and economical points of view. The first one includes HRB for preheating the boiler feed water, condensate, and district water, while the steam turbine (ST) system and coal boilers work without any structural changes. The other advanced variant introduces live steam superheaters to HRB. The coal-fired boilers, in this light, supply only saturated steam (which is introduced into HRB), so they have to be readjusted by replacing the existing superheaters with convective vaporizers for proper flue gas cooling. Such a scheme ensures a considerable reduction of exergy losses in HRB and therefore leads to deeper flue gas cooling and a decrease of coal consumption for the assumed process steam and district heat demands. Heat and process steam demand duration curves for a typical year of operation of the plant have been adapted as input data. The mathematical model of the whole CHP plant has been built on GateCycle and Visual Basic software. The model includes design and off design analyses of boilers, steam and gas turbines and also takes into account shut-down necessities, concerning machines during their operation outside the acceptable area of their key parameters (e.g. the minimum steam flow in the condensing section of the turbines from the point of view of rotor cooling). The computation was run many times for different sets of input data, read from the demand duration curves. Finally, the yearly values of solid and gaseous fuel consumption, as well as electricity

  4. CHP or biofuel production in Europe?

    OpenAIRE

    Leduc, S; Wetterlund, E.; Dotzauer, E.; Kindermann, G.

    2012-01-01

    In this study, the opportunity to invest in combined heat and power (CHP) plants and second-generation biofuel production plants in Europe is investigated. To determine the number and type of production plants, a mixed integer linear model is used, based on minimization of the total cost of the whole supply chain. Different policy scenarios are studied with varying values of carbon cost and biofuel support. The study focuses on the type of technology to invest in and the CO2 emission substitu...

  5. Development of a micro-cogeneration laboratory and testing of a natural gas CHP unit based on PEM fuel cells

    International Nuclear Information System (INIS)

    This work discusses the design and the development of a Laboratory of Micro-Cogeneration (LMC) at Politecnico di Milano. The LMC laboratory is a unique structure devoted to small-scale power generation, with the main goals of testing and improving the performance of systems that produce or utilize electric and thermal (hot and/or cold) power in a very general sense, spanning from combined heat and power (CHP) units to heaters, from absorption chillers to heat pumps, but also able to perform tests on fuel processors and electrolyzers. The laboratory features a supply of natural gas as well as H2 and O2 from a high pressure electrolyzer and of CO, CO2 and N2 from bottles, permitting to carry out experiments with simulated synthesis fuels. The maximum allowable electrical power produced, exported to the grid or to an electronic loadbank, or consumed by the system under test is 100 kW; maximum allowable thermal power is roughly 200 kW with variable temperature water circuits (from chilled water up to a 150 °C at 8 bar superheated water loop). This work outlines also the instruments used for on-line recording of thermodynamic properties, emissions and power, aiming at monitoring and reconstructing mass and energy balances. One of the first experimental campaign has been carried out on a CHP system based on polymer electrolyte membrane fuel cells (PEM), a promising candidate for distributed CHP thanks to low pollutant emissions and good efficiency, rapid startup and flexibility, although affected by a rather complex fuel processing section to provide the appropriate fuel to the PEM. This work presents the experimental analysis of a 20 kW prototype PEM CHP system complete of natural gas processor. The prototype is operated at LMC to characterize the processing section and the thermodynamic performances of the overall system. Despite its non-optimized layout, the unit has shown encouraging total efficiency (76%) and primary energy saving index (6%). - Highlights:

  6. Modelling Danish local CHP on market conditions

    DEFF Research Database (Denmark)

    Ravn, Hans V.; Riisom, Jannik; Schaumburg-Müller, Camilla;

    2004-01-01

    In Denmark, the development of local combined heat and power (CHP) plants has been characterised by large growth throughout the nineties, based in part on government subsidies in the form of feed-in tariffs. Simultaneously, there has been a significant growth of wind power, particularly in the...... Western Danish system. As both the power produced by the local CHPs and the wind power are prioritised, the production of these types of power is occasionally sufficient to meet the total demand in the system, causing the market price to drop dramatically, sometimes even to zero-level. In line with the...... liberalisation process of the energy sectors of the EU countries, it is however anticipated that Danish local CHP are to begin operating on market conditions within the year 2005. This means that the income that the local CHPs previously gained from selling electricity at the feed-in tariff is replaced in part...

  7. Energy-Exergy, Environmental and Economic Criteria in Combined Heat and Power (CHP Plants: Indexes for the Evaluation of the Cogeneration Potential

    Directory of Open Access Journals (Sweden)

    Marco F. Torchio

    2013-05-01

    Full Text Available In the first part of this work, combined heat and power (CHP criteria pertaining to energy, exergy, environmental (pollutant emission and economic aspects, have been investigated and compared. Although the constraints in legislation usually refer to energy efficiency, primary energy savings and greenhouse gas savings, other criteria should also be taken into account in order to obtain a better evaluation of a cogeneration plant. Here particular attention has been paid to saving indexes for both an individual CHP-unit and for a CHP-system, that is the complete system with all the cogeneration units and the auxiliary plants necessary to cover the users’ demand. Five indexes, named potential indexes, have been introduced to evaluate the cogeneration potential: one for energy saving, one for exergy, two for environmental aspects (global and local scale and one for economic aspects. Finally, some indexes analysed in the paper have been applied to a case study concerning a district heating cogeneration system, and the different behaviour of the energy-exergy, environmental and economic aspects has been discussed.

  8. Modeling and off-design performance of a 1 kWe HT-PEMFC (high temperature-proton exchange membrane fuel cell)-based residential micro-CHP (combined-heat-and-power) system for Danish single-family households

    DEFF Research Database (Denmark)

    Arsalis, Alexandros; Nielsen, Mads Pagh; Kær, Søren Knudsen

    2011-01-01

    A novel proposal for the modeling and operation of a micro-CHP (combined-heat-and-power) residential system based on HT-PEMFC (High Temperature-Proton Exchange Membrane Fuel Cell) technology is described and analyzed to investigate its commercialization prospects. An HT-PEMFC operates at elevated...... BOP (balance-of-plant) components, is modeled and coupled to the fuel cell stack subsystem. The micro-CHP system is simulated in LabVIEW environment to provide the ability of Data Acquisition of actual components and thereby more realistic design in the future. A part-load study has been conducted to...

  9. Increasing the flexibility of operational scheduling for a large-scale CHP plant used for generating district heat and electricity in order to meet the varying market demands

    International Nuclear Information System (INIS)

    The substantial changes in the structure of German power supply plants pose high demands on the flexibility of the operational scheduling of conventional thermal power plants. Grosskraftwerk Mannheim AG is a power plant company that is operating a plant for combined power and district heat generation. The paper describes some measures which have been taken to improve the plant's operational flexibility. In addition, the associated technical systems and their functions, as well as the state of ongoing projects are outlined. Special focus is placed on topics related to issues such as ''district-heat storage unit of the new unit 9, flexibility of operational scheduling, and efficient CHP plant operation''.

  10. Energy Analysis and Multi-Objective Optimization of an Internal Combustion Engine-Based CHP System for Heat Recovery

    Directory of Open Access Journals (Sweden)

    Abdolsaeid Ganjehkaviri

    2014-10-01

    Full Text Available A comprehensive thermodynamic study is conducted of a diesel based Combined Heat and Power (CHP system, based on a diesel engine and an Organic Rankine Cycle (ORC. Present research covers both energy and exergy analyses along with a multi-objective optimization. In order to determine the irreversibilities in each component of the CHP system and assess the system performance, a complete parametric study is performed to investigate the effects of major design parameters and operating conditions on the system’s performance. The main contribution of the current research study is to conduct both exergy and multi-objective optimization of a system using different working fluid for low-grade heat recovery. In order to conduct the evolutionary based optimization, two objective functions are considered in the optimization; namely the system exergy efficiency, and the total cost rate of the system, which is a combination of the cost associated with environmental impact and the purchase cost of each component. Therefore, in the optimization approach, the overall cycle exergy efficiency is maximized satisfying several constraints while the total cost rate of the system is minimized. To provide a better understanding of the system under study, the Pareto frontier is shown for multi-objective optimization and also an equation is derived to fit the optimized point. In addition, a closed form relationship between exergy efficiency and total cost rate is derived.

  11. Dicty_cDB: CHP463 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP463 (Link to dictyBase) - - - - CHP463P (Link to Original site) CHP463F ... sk*nvyryccnynifsinflcy*ntg*kiy*reksqksi*is**sts*ts*etc ... c*nr*tlfiwl*krsktk*klfl*frkeii*tpth*mlfqrty*lntisk ...

  12. The energetic feasibility of CHP compared to the separate production of heat and power

    International Nuclear Information System (INIS)

    At present, promotion of combined production of heat and power (CHP) plays a significant role in most national energy strategies, aiming at primary energy savings and CO2-reduction. However, it is not correct to state that rational use of energy and reduction of CO2-emission are intrinsic to CHP. The amount of energy savings and CO290%)] are strongly improving, the required performances of CHP plants being preferable to separate systems for the production of heat and power, have to be tightened. In this paper, a calculation methodology for evaluating the primary energy consumption and CO2-emission for both options (CHP and separate production of heat and power) is presented. Based on calculations with this methodology and with practical figures of performances of CHP plants and separate systems for production of heat and power, the boundary conditions that have to be met by CHP systems for being less energy consuming and less CO2-producing are discussed. (Copyright (c) 1998 Elsevier Science B.V., Amsterdam. All rights reserved.)

  13. Demonstration Stirling Engine based Micro-CHP with ultra-low emissions

    Energy Technology Data Exchange (ETDEWEB)

    Oeberg, Rolf; Olsson, Fredrik [Carl Bro Energikonsult AB (Sweden); Paalsson, Magnus [Lund Inst. of Technology (Sweden)

    2004-03-01

    This project has been initiated in order to develop a new type of natural gas fired low emission combustion system for a Stirling engine CHP-unit, and to demonstrate and evaluate the unit with the newly developed combustion system in a CHP application. The Stirling engine technology is well developed, but mostly used in special applications and CHP-applications are scarce. The very low exhaust emissions with the new combustion system would make the Stirling engine very suitable for installation in as a CHP-unit in domestic areas. The Stirling engine used in the project has been a V161 engine produced by Solo Kleinmotoren GmbH in Sindelfingen. The unit has a nominal output of 7,5 kW{sub el} and 20 kW{sub heat} (Hot water). The new combustion system was developed at Lund University and the very strict emission targets that were set up could be achieved, both in the laboratory tests and during the site-testing period. Typical performance and emission figures measured at the site installation are: Generator output (kW): 7,3; Hot water output (kW): 15; El. efficiency (%): 25,4; Total efficiency (%): 77,8; NO{sub x} (ppm): 14; CO (ppm): 112; HC (ppm): < 1; O{sub 2} (%): 8,0; Noise level 1 m from the unit (dBA): 83. The NO{sub x} emissions were reduced with almost 97 % as compared to a standard Stirling combustion system. The emission figures are considerably lower than what could be achieved in an internal combustion engine of similar size with an oxidation catalyst (report SGC 106), while the performance figures are similar for the two technologies. The site testing was carried out during a period of 1,5 year at a site owned by Goeteborg Energi. The site comprises a building structure with workshops, offices etc. covering a ground area of 2,500 m{sup 2}. A gas fired boiler with an output of 250 kW supplies hot water to a local grid for heating and tap water. The annual heat demand is typically 285 MWh and the hot water temperatures are normally 60-80 deg C. The site

  14. A Study of a Diesel Engine Based Micro-CHP System

    Energy Technology Data Exchange (ETDEWEB)

    Krishna, C.R.; Andrews, J.; Tutu, N.; Butcher, T.

    2010-08-31

    This project, funded by New York State Energy Research and Development Agency (NYSERDA), investigated the potential for an oil-fired combined heat and power system (micro-CHP system) for potential use in residences that use oil to heat their homes. Obviously, this requires the power source to be one that uses heating oil (diesel). The work consisted of an experimental study using a diesel engine and an analytical study that examined potential energy savings and benefits of micro-CHP systems for 'typical' locations in New York State. A search for a small diesel engine disclosed that no such engines were manufactured in the U.S. A single cylinder engine manufactured in Germany driving an electric generator was purchased for the experimental work. The engine was tested using on-road diesel fuel (15 ppm sulfur), and biodiesel blends. One of the main objectives was to demonstrate the possibility of operation in the so-called HCCI (Homogeneous Charge Compression Ignition) mode. The HCCI mode of operation of engines is being explored as a way to reduce the emission of smoke, and NOx significantly without exhaust treatment. This is being done primarily in the context of engines used in transportation applications. However, it is felt that in a micro-CHP application using a single cylinder engine, such an approach would confer those emission benefits and would be much easier to implement. This was demonstrated successfully by injecting the fuel into the engine air intake using a heated atomizer made by Econox Technologies LLC to promote significant vaporization before entering the cylinder. Efficiency and emission measurements were made under different electrical loads provided by two space heaters connected to the generator in normal and HCCI modes of operation. The goals of the analytical work were to characterize, from the published literature, the prime-movers for micro-CHP applications, quantify parametrically the expected energy savings of using micro-CHP

  15. A comparison between the two different combustion methods of Grate-firing and Fluidized bed, applied to a CHP-plant with MSW as fuel

    OpenAIRE

    Hasan, Belkiz; Ahsant, Aidin

    2015-01-01

    In this study, the two most frequently used incineration systems, fluidized bed and grate-firing have been compared and analyzed. The performance of Mälarenergi’s combined heat and power (CHP) plant in Västerås, which consists of a fluidized bed incinerator, has been used as benchmark to elaborate the different calculations made in this study. It extracts electricity and heat amounting to 50 and 100 MW respectively.   On average, 75-85% of the weight of Municipal Solid Waste (MSW) is converte...

  16. Potential of ORC Systems to Retrofit CHP Plants in Wastewater Treatment Stations

    Directory of Open Access Journals (Sweden)

    Ricardo Chacartegui

    2013-12-01

    Full Text Available Wastewater treatment stations take advantage of the biogas produced from sludge in anaerobic digesters to generate electricity (reciprocating gas engines and heat (cooling water and engine exhaust gases. A fraction of this electricity is used to operate the plant while the remaining is sold to the grid. Heat is almost entirely used to support the endothermic anaerobic digestion and a minimum fraction of it is rejected to the environment at a set of fan coolers. This generic description is applicable to on-design conditions. Nevertheless, the operating conditions of the plant present a large seasonal variation so it is commonly found that the fraction of heat rejected to the atmosphere increases significantly at certain times of the year. Moreover, the heat available in the exhaust gases of the reciprocating engine is at a very high temperature (around 650 oC, which is far from the temperature at which heat is needed for the digestion of sludge (around 40 oC in the digesters. This temperature difference offers an opportunity to introduce an intermediate system between the engines and the digesters that makes use of a fraction of the available heat to convert it into electricity. An Organic Rankine Cycle (ORC with an appropriate working fluid is an adequate candidate for these hot/cold temperature sources. In this paper, the techno-economic effect of adding an Organic Rankine Cycle as the intermediate system of an existing wastewater treatment station is analysed. On this purpose, different working fluids and system layouts have been studied for a reference wastewater treatment station giving rise to optimal systems configurations. The proposed systems yield very promising results with regard to global efficiency and electricity production (thermodynamically and economically.

  17. Heat Pumps in CHP Systems

    DEFF Research Database (Denmark)

    Ommen, Torben Schmidt

    capacity constraints limit the efficient operation of the CHP plants. Heat pumps (HPs) can be used to decouple such constraints, but current state of the art are not competitive all things considered. Methods to improve the high energy efficiency are required to match the politically agreed carbon emission......In the current Danish energy system, the majority of electricity and heat is produced in combined heat and power (CHP) plants. With increasing shares of intermittent renewable power production, it becomes a challenging task to match power and heat production to its demand curves, as production...... goals. The presented study investigates the possible introduction of HPs from both a thermodynamic and a system/operation management perspective, in order to find optimal integration schemes in both current and future energy scenarios. Five generic configurations of HPs in district heating (DH) systems...

  18. A Market-Based Virtual Power Plant

    DEFF Research Database (Denmark)

    You, Shi; Træholt, Chresten; Poulsen, Bjarne

    2009-01-01

    The fast growing penetration of Distributed Energy Resources (DER) and the continuing trend towards a more liberalized electricity market requires more efficient energy management strategies to handle both emerging technical and economic issues. In this paper, a market-based Virtual Power Plant...... (MBVPP) model is proposed which provides individual DER units the accesses to current electricity markets. General bidding scenario and price signal scenario as two optional operation scenarios are operated by one MBVPP. In the end, a use case of a MBVPP with micro Combined Heat and Power (μCHP) systems...... demonstrates the potential benefits and operation scenarios of the MBVPP model....

  19. Generic model of a community-based microgrid integrating wind turbines, photovoltaics and CHP generations

    International Nuclear Information System (INIS)

    Highlights: ► Proposes a generic microgrid model comprising hybrid distributed generation units. ► Examines DG performance due to both environmental condition changes and electrical faults. ► Addresses island and grid connected modes of operation for DG units. ► We demonstrate the feasibility of the proposed residential microgrid system. - Abstract: Development and deployment of low-carbon energy technologies has been a national strategy of both the UK and China for a number of years, including the use of renewable generation technologies and the improvement of energy efficiency of operations and activities. The paper addresses several issues of generic importance to a residential microgrid system such as network modelling, advanced control and integration of intelligent monitoring techniques. The system, comprising representative distributed generation technologies of photovoltaics, wind turbines and combined heat and power, has been simulated by PSCAD/EMTDC under different operational scenarios. Studies include the effect of environmental condition changes, control systems and power electronics on wind turbines and PV cells, and the mixture of wind/solar/CHP energy generation under dominance of each technology. The performance and dynamics of the system are examined against symmetrical and asymmetrical electrical faults to seek an optimal isolation and restoration of the distributed generation unit from the connected grid system. Modelling these system interactions has demonstrated the feasibility of the proposed residential microgrid system

  20. Thermodynamic, ecological and economic aspects of the use of the gas turbine for heat supply to the stripping process in a supercritical CHP plant integrated with a carbon capture installation

    International Nuclear Information System (INIS)

    Highlights: • Variants of integration of CHP plant with CCS and gas turbine unit were analyzed. • The simulations of operation of plants under changing load were realized. • Conditions of competitiveness for all solutions were identified. • Integration can be profitable if prices of allowance will reach values >60 €/MgCO2. - Abstract: This paper presents the results of thermodynamic and economic analyses for eight variants of a combined heat and power (CHP) plant fuelled with coal working under supercritical steam parameters and integrated with a CO2 capture installation and a gas turbine system. The motivation behind using a gas turbine in the system was to generate steam to supply heat for the stripping process that occurs in the separation installation to regenerate the sorbent. Additional analyses were conducted for the reference case, a CHP unit in which the CO2 separation process was not conducted, to enable an economic evaluation of the integration of a CHP unit with a CO2 separation installation according to the variants proposed. The break-even price of electricity and avoided emission costs were used to evaluate the respective solutions. In this paper, the results of the sensitivity analysis of the economic evaluation indicators in terms of the change in the annual operation time, price of emission allowance and heat demand rate for the realization of the stripping process for all cases are presented

  1. Micro CHP: implications for energy companies

    Energy Technology Data Exchange (ETDEWEB)

    Harrison, Jeremy [EA Technology (United Kingdom); Kolin, Simon; Hestevik, Svein [Sigma Elektroteknisk A/S (Norway)

    2000-08-01

    This article explains how micro combined heat and power (CHP) technology may help UK energy businesses to maintain their customer base in the current climate of liberalisation and competition in the energy market The need for energy companies to adopt new technologies and adapt to changes in the current aggressive environment, the impact of privatisation, and the switching of energy suppliers by customers are discussed. Three potential routes to success for energy companies are identified, namely, price reductions, branding and affinity marketing, and added value services. Details are given of the implementation of schemes to encourage energy efficiency, the impact of the emissions targets set at Kyoto, the advantages of micro CHP generation, business opportunities for CHP, business threats from existing energy companies and others entering the field, and the commercial viability of micro CHP.

  2. Dicty_cDB: CHP195 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP195 (Link to dictyBase) - - - Contig-U11819-1 - (Link to Or...iginal site) CHP195F 138 - - - - - - Show CHP195 Library CH (Link to library) Clone ID CHP195 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11819-1 Original site URL http://dictycdb.b...qilkvstnk**IKNYYVNRVYEIIIIINICTYKKK--- Translated Amino Acid sequence (All Frames) Frame A: tvgllvfsnt*gink*...iin*kllck*sl*nnnynkymyi*kk--- Frame B: llaywffqilkvstnk**IKNYYVNRVYEIIIIINICTYKKK--- Frame C: cwptgffkylryqq

  3. CFD simulation of Pd-based membrane reformer when thermally coupled within a fuel cell micro-CHP system

    Energy Technology Data Exchange (ETDEWEB)

    Roses, Leonardo; Manzolini, Giampaolo; Campanari, Stefano [Politecnico di Milano, Dipartimento di Energia, Via Lambruschini 4, 20156 Milano (Italy)

    2010-11-15

    In this work, a bi-dimensional CFD simulation investigates a fuel processor for hydrogen production from natural gas or biogas composed by a steam methane reformer coupled with a palladium-based hydrogen permeable membrane, the so-called ''membrane reformer'' (MREF). The heat required for the endothermic reforming reaction taking place on the MREF is supplied by a stream of hot gas coming from an external source, typically represented by a combustor burning the unconverted fuel and the unpermeated hydrogen. The resulting fuel processor arrangement, which has already been simulated by the point of view of energy and mass balances, may achieve a very high efficiency and is particularly suited for integration with fuel cells. The interest on this configuration relies on the possibility to implement this technology within a PEMFC-based micro-cogenerator (also micro-Combined Heat and Power, or m-CHP) with a net electrical power output in a range of 1-2 kW. In particular, the work focuses on the temperature profiles along the membrane, which should be kept as close as possible to 600 C to favourite permeation and avoid any damages, and examines the advantages of hot gas on co-current direction vs. counter-current with respect to the reformer flux direction. (author)

  4. Techno-economic performance analysis of bio-oil based Fischer-Tropsch and CHP synthesis platform

    International Nuclear Information System (INIS)

    The techno-economic potential of the UK poplar wood and imported oil palm empty fruit bunch derived bio-oil integrated gasification and Fischer-Tropsch (BOIG-FT) systems for the generation of transportation fuels and combined heat and power (CHP) was investigated. The bio-oil was represented in terms of main chemical constituents, i.e. acetic acid, acetol and guaiacol. The compositional model of bio-oil was validated based on its performance through a gasification process. Given the availability of large scale gasification and FT technologies and logistic constraints in transporting biomass in large quantities, distributed bio-oil generations using biomass pyrolysis and centralised bio-oil processing in BOIG-FT system are technically more feasible. Heat integration heuristics and composite curve analysis were employed for once-through and full conversion configurations, and for a range of economies of scale, 1 MW, 675 MW and 1350 MW LHV of bio-oil. The economic competitiveness increases with increasing scale. A cost of production of FT liquids of 78.7 Euro/MWh was obtained based on 80.12 Euro/MWh of electricity, 75 Euro/t of bio-oil and 116.3 million Euro/y of annualised capital cost. -- Highlights: → Biomass to liquid process and gas to liquid process synthesis. → Biorefinery economic analysis. → Pyrolysis oil to biofuel. → Gasification and Fischer-Tropsch. → Process integration, pinch analysis and energy efficiency.

  5. Two years of operations at the Elcho CHP plant - achieving high efficiency and availability and low emissions

    Energy Technology Data Exchange (ETDEWEB)

    Rafal Psik; Miroslaw Soltysiak [Foster Wheeler Energia Polska Sp. zo.o. (Poland)

    2006-07-01

    The Elcho plant based on two CFBs generating 226 MW of electricity and up to 500 MW of district heat, has been designed with flexibility in mind. Typical of CFB technology, the plant can be run on a variety of coal grades, while still maintaining its design performance. The initial fuel contract was for average-grade bituminous coal, with a higher sulfur content than that used at the adjacent old plant, which needed higher cost, low sulfur fuel because it lacked desulfurization equipment. Particular attention has been paid to ensuring that noise levels during plant operation will be very low, as the nearest local residents live less than 500 meters away. All waste handling is dust free. Fly and bottom ash go for mine restitution, while some bottom ash goes to the construction industry. In 2003, Elcho applied for and received an Integrated Pollution Prevention and Control certificate (IPPC), one of the first power plants to do so in Poland. Elcho's new CFBs have cut emissions dramatically in comparison with the old plant. 2 refs., 5 figs., 9 tabs.

  6. Development and field test of a SOLO 161 Stirling engine based micro-CHP unit with ultra-low emissions

    Energy Technology Data Exchange (ETDEWEB)

    Paalsson, Magnus [Lund Univ. (Sweden). Dept. of Heat and Power Engineering

    2001-07-01

    For the last decade, work has been made at Lund University, Sweden, on developing a new sort of natural gas combustion chamber for the V160/SOLO 161 Stirling. It is a lean premix combustion chamber with internal combustion gas recirculation and a metallic flame holder for flame stabilisation, and it has produced extremely low emissions that are comparable to the emissions of catalytic combustion. The combustion chamber is considered ready for market introduction by the end of 2001. To combine the task of adapting this combustor for the market with the need to demonstrate small-scale Stirling engine CHP technology, a project has been started with the purpose to demonstrate and evaluate the operation of a Stirling engine unit based on the SOLO 161 Stirling engine equipped with the Lund combustion chamber. The evaluation program should give information regarding operation costs, efficiencies, emissions and running characteristics. In November 2000 the engine was transferred from the Lund University laboratory to its final location in Gothenburg. The engine is now installed and all necessary adaptation of engine, gas system and water heating system is made. The unit is running unattended in normal everyday operation. Current operating time is approx. 1200 hours, and delivered electric output is approx. 6000 kWh (July 2001)

  7. Methodology for evaluation of industrial CHP production

    International Nuclear Information System (INIS)

    At the end of the century industry switched from exclusive power consumer into power consumer-producer which is one of the players on the deregulated power market. Consequently, goals of industrial plant optimization have to be changed, making new challenges that industrial management has to be faced with. In the paper is reviewed own methodology for evaluation of industrial power production on deregulated power market. The methodology recognizes economic efficiency of industrial CHP facilities as a main criterion for evaluation. Energy and ecological efficiency are used as additional criteria, in which implicit could be found social goals. Also, methodology recognizes key and limit factors for CHP production in industry. It could be successful applied, by use of available commercial software for energy simulation in CHP plants and economic evaluation. (Authors)

  8. The Impact of Modified EU ETS Allocation Principles on the Economics of CHP-based District Heating Networks

    OpenAIRE

    Westner, Günther; Madlener, Reinhard

    2011-01-01

    The economics of large-scale combined heat and power (CHP) generation for district heating (DH) applications are strongly affected by the costs and allocation mechanism of CO2 emission allowances. In the next period of the European emission trading system (EU ETS), from 2013 onwards, the allocation rules for CHP generation will be modified according to the principles announced in EU Directive 2009/29/EC. By means of a discounted cash-flow model we first show that the implementation of the mod...

  9. Using Cost-Effectiveness Tests to Design CHP Incentive Programs

    Energy Technology Data Exchange (ETDEWEB)

    Tidball, Rick [ICF International, Fairfax, VA (United States)

    2014-11-01

    This paper examines the structure of cost-effectiveness tests to illustrate how they can accurately reflect the costs and benefits of CHP systems. This paper begins with a general background discussion on cost-effectiveness analysis of DER and then describes how cost-effectiveness tests can be applied to CHP. Cost-effectiveness results are then calculated and analyzed for CHP projects in five states: Arkansas, Colorado, Iowa, Maryland, and North Carolina. Based on the results obtained for these five states, this paper offers four considerations to inform regulators in the application of cost-effectiveness tests in developing CHP programs.

  10. Dicty_cDB: CHP149 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP149 (Link to dictyBase) - - - Contig-U15648-1 CHP149P (Link to Original ... udogene (FLJ12598), the gene for a novel Mov34/MPN/PAD -1 family domain containing protein (KIAA1373 FLJ35 ...

  11. Dicty_cDB: CHP817 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP817 (Link to dictyBase) - G20462 DDB0229964 Contig-U15900-1 CHP817P (Lin ... ces. 44 1.9 1 CX075784 |CX075784.1 UCRCS08_46H11_b Parent ... Washington Navel Orange Callus cDNA Library UCRCS0 ...

  12. Dicty_cDB: CHP330 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP330 (Link to dictyBase) - - - Contig-U11900-1 CHP330P (Link to Original ... 1844.1 Clostridium magnum acoR gene, complete cds; TPP -dependent acetoin dehydrogenase alpha and beta sub ...

  13. Dicty_cDB: CHP245 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP245 (Link to dictyBase) - - - Contig-U16361-1 CHP245P (Link to Original ... 1-47.b_041.ab1 Whole-genome shotgun library of the elephant ... shark (aka elephant ... fish) Callorhinchus milii geno ...

  14. Dicty_cDB: CHP317 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP317 (Link to dictyBase) - - - Contig-U11087-1 CHP317P (Link to Original ... 2-28.g_054.ab1 Whole-genome shotgun library of the elephant ... shark (aka elephant ... fish) Callorhinchus milii geno ...

  15. Dicty_cDB: CHP127 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP127 (Link to dictyBase) - - - Contig-U16524-1 CHP127P (Link to Original ... .1 Influenza A virus (swine/Cotes d'Armor/1515/99 (H1N1 )) partial N1NA gene for Neuraminidase, genomic RNA ...

  16. Dicty_cDB: CHP837 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP837 (Link to dictyBase) - - - Contig-U16405-1 CHP837P (Link to Original ... ikyc*glyi*cfgfsilsksiqfei**ktkniw*ry shywlifkiiwws*fpy *fh*ck*tf--- ---emkvervhsllqhslefvqdqvqh*pi*nq*fqkf ...

  17. Dicty_cDB: CHP314 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP314 (Link to dictyBase) - - - Contig-U11143-1 | Contig-U16256-1 CHP314P ... ession in good prognostic human neuroblastoma upon comparison ... between good prognostic human neuroblastoma and po ...

  18. Dicty_cDB: CHP579 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP579 (Link to dictyBase) - - - Contig-U16298-1 | Contig-U16523-1 CHP579P ... Translated Amino Acid sequence tvgllx*qykffkylfif*tnt *yfh*lif*YFQIKMIPKKQKGFNGEPKSHQEIDRSQS PLKQRTNNNNYQ ... sequence (All Frames) Frame A: tvgllx*qykffkylfif*tnt *yfh*lif*YFQIKMIPKKQKGFNGEPKSHQEIDRSQS PLKQRTNNNNYQ ...

  19. Modeling and off-design performance of a 1 kWe HT-PEMFC (high temperature-proton exchange membrane fuel cell)-based residential micro-CHP (combined-heat-and-power) system for Danish single-family households

    International Nuclear Information System (INIS)

    A novel proposal for the modeling and operation of a micro-CHP (combined-heat-and-power) residential system based on HT-PEMFC (High Temperature-Proton Exchange Membrane Fuel Cell) technology is described and analyzed to investigate its commercialization prospects. An HT-PEMFC operates at elevated temperatures, as compared to Nafion-based PEMFCs and therefore can be a significant candidate for cogeneration residential systems. The proposed system can provide electric power, hot water, and space heating for a typical Danish single-family household. A complete fuel processing subsystem, with all necessary BOP (balance-of-plant) components, is modeled and coupled to the fuel cell stack subsystem. The micro-CHP system is simulated in LabVIEWTM environment to provide the ability of Data Acquisition of actual components and thereby more realistic design in the future. A part-load study has been conducted to indicate performance characteristics at off-design conditions. The system is sized to provide realistic dimensioning of the actual system. -- Research highlights: → An HT-PEMFC-based micro-CHP system is modeled in LabVIEW to provide a basis for future experimental calculations. → We examine operation in various loads to indicate performance characteristics at off-design conditions. → An electrical efficiency varying from 45.4% (25%-load) to 38.8% (full-load) was calculated. The corresponding total efficiency was around 95.2%.

  20. A new waste heat district heating system with combined heat and power (CHP) based on ejector heat exchangers and absorption heat pumps

    International Nuclear Information System (INIS)

    A new waste heat district heating system with CHP based on ejector heat exchangers and absorption heat pumps (DH-EHE) is presented to decrease heating energy consumption of existing CHP systems by recovering waste heat of exhausted steam from a steam turbine, which could also increase heat transmission capacity of the primary heating network (PHN) by decreasing temperature of the return water of existing PHN. A new ejector heat exchanger based on ejector refrigeration cycle is invented to decrease temperature of the return water of PHN to 30 °C under the designed case. DH-EHE is analyzed in terms of laws of thermodynamics and economics. Compared to conventional district heating systems with CHP (CDH), DH-EHE can decrease consumption of steam extracted from a steam turbine by 41.4% and increase heat transmission capacity of the existing PHN by 66.7% without changing the flow rate of circulating water. The heating cost of DH-EHE is 8.62 ¥/GJ less than that of CDH. Compared to CDH, the recovery period of additional investment of DH-EHE is about two years. DH-EHE shows better economic and environmental benefits, which is promising for both district heating systems for long-distance heat transmission and waste heat district heating systems. - Highlights: • Heating capacity of this new heating system increases by 41% by waste heat recovery. • Temperature of return water of the primary heating network can be reduced to 30 °C. • Heating cost of new heating system is 8.62¥/GJ less than that of conventional one. • The recovery period of additional investment of new heating system is about 2 years. • This new heating system shows better economic and environmental benefits

  1. Sizing a solar dish Stirling micro-CHP system for residential application in diverse climatic conditions based on 3E analysis

    International Nuclear Information System (INIS)

    Highlights: • 3E analysis was performed on solar CHP systems. • Significant primary energy saving and greenhouse gas reduction were obtained. • The engine was sized so that it had the best economic sound. • Various criteria at different weathers were used for sizing the engine. - Abstract: A solar dish Stirling cogeneration system is considered to provide energy demands of a residential building. As energy demands of the building and output power of the engine are functions of weather condition and solar irradiation flux, the benchmark building was considered to be located in five different cities in Iran with diverse climatic and solar irradiation conditions. The proposed solar dish Stirling micro-CHP system was analyzed based on 3E analysis. The 3E analysis evaluated primary energy saving analysis (energy analysis), carbon dioxide emission reduction (environmental analysis) and payback period for return of investment (economic analysis) and was compared to a reference building that utilized primary energy carriers for its demands. Three scenarios were considered for assessment and sizing the solar dish Stirling engine. In the first scenario, size of the solar dish Stirling engine was selected based on the lowest annual electric power demand while, in second, the highest annual electric power consumption was considered to specify size of the engine. In the third scenario, a solar dish Stirling engine with constant output capacity was considered for the five locations. It was shown that implementing the solar dish Stirling micro-CHP system had good potential in primary energy saving and carbon dioxide emission reduction in all scenarios and acceptable payback period for return of the investment in some scenarios. Finally, the best scenario for selecting size of the engine in each city was introduced using the TOPSIS decision making method. It was demonstrated that, for dry weather, the first scenario was the best while, for hot and humid cities and

  2. Expanders for micro-CHP systems with organic Rankine cycle

    International Nuclear Information System (INIS)

    The continual increases in global energy demand and greenhouse gas emissions call for more and more utilisation of sustainable energy sources, such as solar energy, biomass energy, and waste heat. Solar thermal energy, the heat of biomass combustion and waste heat may be used to drive a combined heat and power (CHP) system. In recent years, several micro-CHP systems with organic Rankine cycle (ORC) suitable for domestic applications (1-10 kWe) driven by solar thermal, biomass-fired boilers and waste heat resources have been investigated. These ORC-based micro-CHP systems have lower operation pressures and temperatures compared to conventional steam-Rankine cycle CHP systems and hence safer for household applications. However, the lack of commercially available expanders applicable to ORC-based micro-CHP systems has hindered the development of these novel CHP systems. This paper summarizes the findings of the market research for the expanders and discusses the selection and choices of the expanders for ORC-based micro-CHP systems. The working principles and the characteristics of several kinds of expanders, including turbine expanders (i.e., turboexpander), screw expanders, scroll expanders and vane expanders, are introduced and evaluated. - Highlights: → Expanders are vital to ORC-based micro-CHP but not yet commercially available. → Selection and choices of the expanders for 1-10 kWe micro-CHP are discussed. → Vane expanders modified from vane-type air motors have been applied by the authors. → Scroll expanders and vane expanders are likely the good choices for 1-10 kWe micro-CHP.

  3. Small scale CHP: Alternative integration forms in the Danish energy system

    International Nuclear Information System (INIS)

    In Denmark, introduction of small scale combined heat and power (CHP) plants were part of the energy policy during the 1990's. Thus, the installed electricity capacity on this type of units multiplied approximately ten times during this decade, to constitute more than 2000 MW in 2000, or around 20% of total installed electricity capacity. The motivation for this development was mainly energy savings due to the relatively high thermal efficiency in combined production, and the associated reduction of emissions. The remuneration for the electricity delivered to the electrical network was in part based on a feed in tariff. The construction of the tariff reflected estimated benefits to the electrical system. With the liberalisation of the electricity markets this arrangement has been questioned, and it has been suggested that the differentiated payment to local CHP should be based on electricity market prising. For Denmark this would imply that the local CHP should trade the electricity on the Nordpool electricity spot market. This paper analyses parts of these two alternative ways of economic arrangements in relation to small scale CHP. First it describes the development and status till now. Then it analyses the production patterns and associated economic consequences of a change from the tariff based system to a market system. (BA)

  4. Development of a Transient Model of a Stirling-Based CHP System

    Directory of Open Access Journals (Sweden)

    Antón Cacabelos

    2013-06-01

    Full Text Available Although the Stirling engine was invented in 1816, this heat engine still continues to be investigated due to the variety of energy sources that can be used to power it (e.g., solar energy, fossil fuels, biomass, and geothermal energy. To study the performance of these machines, it is necessary to develop and simulate models under different operating conditions. In this paper, we present a one-dimensional dynamic model based on components from Trnsys: principally, a lumped mass and a heat exchanger. The resulting model is calibrated using GenOpt. Furthermore, the obtained model can be used to simulate the machine both under steady-state operation and during a transient response. The results provided by the simulations are compared with data measured in a Stirling engine that has been subjected to different operating conditions. This comparison shows good agreement, indicating that the model is an appropriate method for transient thermal simulations. This new proposed model requires few configuration parameters and is therefore easily adaptable to a wide range of commercial models of Stirling engines. A detailed analysis of the system results reveals that the power is directly related to the difference of temperatures between the hot and cold sources during the transient and steady-state processes.

  5. CHP and CCHP Systems Today

    OpenAIRE

    Stojkov, Marinko; Hnatko, Emil; Kljajin, Milan; Živić, Marija; Hornung, Krunoslav

    2011-01-01

    The concept of the CCHP system (combined cooling, heating and power - combined cooling, heating and electricity generation) is described in this paper. The development of CCHP systems comes from the CHP system (combined heat and power generation), also known as cogeneration. CHP systems generate electricity from fuel combustion, heat as a by-product may contain even 60% to 80% of the total potential energy, and may be re-used for different applications. CHP is generally defined as the combine...

  6. A study on electricity export capability of the μCHP system with spot price

    DEFF Research Database (Denmark)

    You, Shi; Træholt, Chresten; Poulsen, Bjarne

    2009-01-01

    When a number of muCHP systems are aggregated as a virtual power plant (VPP), they will be able to participate in the electricity wholesale market with no discrimination compared to conventional large power plants. Hence, this paper investigates the electricity export capability of the muCHP system...... when the electricity buyback price is given at a value equalizing the dynamic spot price. A muCHP system is modeled with optimized generation, and the marginal price of electricity export for such system is explained. A sensitivity analysis of several key factors, e.g. fuel price, heat to power ratio...... of the muCHP unit, which influence the export capability of muCHP system, is firstly carried out in the intraday case study, followed by the annual case study which explores the annual system performance. The results show that the electricity export capability of a muCHP system is closely related to...

  7. Analysis of the impact of Heat-to-Power Ratio for a SOFC-based mCHP system for residential application under different climate regions in Europe

    DEFF Research Database (Denmark)

    Liso, Vincenzo; Zhao, Yingru; Brandon, Nigel;

    2011-01-01

    according to the summer energy demand. The winter energy demand shows a Heat-to-Power Ratio which cannot be covered by the mCHP unit alone. To ensure that the mCHP system meets both the thermal and electrical energy demand over the entire year, an auxiliary boiler and a hot water storage tank need to be...

  8. Dicty_cDB: CHP254 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP254 (Link to dictyBase) - - - Contig-U15541-1 - (Link to Original site) ... qvlf*rivftlkiakemkf*lnnghqlnqmletslkilfykv*dhqnmkh vtl *ll*fhvlvllkfhtqcgkn*sqhylktlkvvqkvlnnllfkhlvifvkkl ...

  9. Dicty_cDB: CHP249 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP249 (Link to dictyBase) - - - Contig-U14444-1 - (Link to Original site) ... XXXXKIFFLKK--- Translated Amino Acid sequence (All Frames ) Frame A: KKXKKKKKKKKKKKKKKKKKKKKKKKKKKKXKKKKXXXXX ...

  10. Design and simulation of a prototype of a small-scale solar CHP system based on evacuated flat-plate solar collectors and Organic Rankine Cycle

    International Nuclear Information System (INIS)

    Highlights: • A novel small scale solar power plant was designed and simulated. • The system is based on evacuated solar thermal collectors and an ORC system. • An average electric efficiency of 10% was found for the ORC. • The efficiency of solar collectors was found to be high in summer (>50%). • Pay-back periods lower than 5 years were estimated, in case of public funding. - Abstract: This paper presents a dynamic simulation model of a novel prototype of a 6 kWe solar power plant. The system is based on the coupling of innovative solar thermal collectors with a small Organic Rankine Cycle (ORC), simultaneously producing electric energy and low temperature heat. The novelty of the proposed system lies in the solar collector field, which is based on stationary evacuated flat-plate solar thermal collectors capable to achieve the operating temperatures typical of the concentrating solar thermal collectors. The solar field consists of about 73.5 m2 of flat-plate evacuated solar collectors, heating a diathermic oil up to a maximum temperature of 230 °C. A diathermic oil storage tank is employed in order to mitigate the fluctuations due to the variability of solar energy availability. The hot diathermic oil exiting from the tank passes through an auxiliary gas-fired burner which provides eventual additional thermal energy. The inlet temperature of the diathermic oil entering the ORC system varies as a function of the availability of solar energy, also determining an oscillating response of the ORC. The ORC was simulated in Engineering Equation Solver (EES), using zero-dimensional energy and mass balances. The ORC model was subsequently implemented in a more general TRNSYS model, including all the remaining components of the system. The model was used to evaluate the energy and economic performance of the solar CHP system under analysis, in different climatic conditions. The results show that the efficiency of the ORC does not significantly vary during the

  11. Studying effect of heating plant parameters on performances of a geothermal-fuelled series cogeneration plant based on Organic Rankine Cycle

    International Nuclear Information System (INIS)

    Highlights: • We analyzed performances of a series ORC–CHP plant versus the heating plant parameters. • ORC–CHP power is destructed when raising the heat demand or the return temperature. • Only the high supply temperatures of the heating plant affect negatively the performances. • Reducing the return temperature optimizes both the energetic and exergetic criteria. • Increasing the heat demand improves the exergetic efficiency of the total CHP system. - Abstract: The present work aims to analyze the performance characteristics of the series Combined Heat and Power (CHP) system based on Organic Rankine Cycle (ORC) under influence of the heating plant parameters without considering the chemistry of the geothermal water considered as heat source. For evaluation, energetic and exergetic criteria along with the heat transfer capacities have been determined, and also the working fluid R134a has been used. The results showed that increasing the heat demand or the return temperature and only the high supply temperatures lead to destruct the net power generated by the ORC–CHP system. While, influence of the last parameters on the total exergy efficiency and losses is different; whereas raising the heat demands optimizes these exergetic indicators, variation of the supply temperature leads to an optimum for these performances. Since increasing the return temperature has purely negative impacts on all exergetic and energetic criteria, the latter can be improved by reducing this temperature with attention to the heat transfer capacities. Thus, reduction of the return temperature about 5 °C lowers the exhausted stream losses by app. 25% and enhances the power generation by app. 52% and the total exergy efficiency by 9%

  12. Dicty_cDB: CHP682 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP682 (Link to dictyBase) - - - Contig-U13024-1 | Contig-U16344-1 CHP682P ... 28 AY530539_1( AY530539 |pid:none) Mimulus ringens def iciens (DEF ) mR... 34 6.9 AY524011_1( AY524011 |pid ... :none) Paulownia tomentosa def iciens (DEF ... 33 9.0 protein update 2008.11. 7 PSO ...

  13. Energy efficiency of CHP using condensing steam turbine with extraction

    International Nuclear Information System (INIS)

    The paper presents an investigation of energy efficiency of two CHP techniques– using only condensing steam turbine with extraction (single cycle) and using gas turbine with condensing steam turbine with extraction (double cycle) . The energy efficiency is estimated on base of two energy efficiency coefficients – brutto and effective electrical and by the fuel saving in case of CHP system comparatively with the SHP. The investigations are done by modeling using GateCycle software

  14. Dicty_cDB: CHP873 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP873 (Link to dictyBase) - - - Contig-U10720-1 CHP873P (Link to Original ... X*iiskvwfrcya*cc*tstk*rye**fe*nysmvr*kssfpt*y*krfc sip *fh*s*ts*rikts*riki*nnnnynyhhyy*rs*tirrs*tirrs*tirr ... X*iiskvwfrcya*cc*tstk*rye**fe*nysmvr*kssfpt*y*krfc sip *fh*s*ts*rikts*riki*nnnnynyhhyy*rs*tirrs*tirrs*tirr ...

  15. IVO`s CHP know-how: experience, inventions, patents

    Energy Technology Data Exchange (ETDEWEB)

    Aeijaelae, M.; Ohtonen, V. [ed.

    1997-11-01

    IVO can justly claim mastery in the co-generation of district heat and electricity - CHP. As well as looking at the issue from the viewpoint of planners, builders and operators, IVO`s engineers also view power plants through the eyes of the product developer and inventor. This approach has resulted in successful power plant configurations, inventions and patents and visions

  16. Energy consumption indicators and CHP technical potential in the Brazilian hospital sector

    International Nuclear Information System (INIS)

    Electricity demands in hospitals are characterized by their need for high quality, guaranteed supplies. The existence of captive electricity uses and the size and regularity of the electrical and heat loads required by hospitals are aspects that could well buttress the possibility of installing cogeneration plants fired by natural gas (CHP). The purpose of this paper is to estimate the CHP technical potential in Brazilian hospitals. Based on a classification of Brazilian hospitals by specific energy consumption indicators, this potential is assessed, taking into consideration gas fueled engines associated with absorption cooling systems. A potential figure of approximately 500 MWe was obtained, whose effective implementation runs up against the obstacles inherent to Brazil's hospital sector, listed at the end of this paper. Consequently, some actions are proposed for surmounting these barriers

  17. Environmental sustainability analysis of UK whole-wheat bioethanol and CHP systems

    International Nuclear Information System (INIS)

    The UK whole-wheat bioethanol and straw and DDGS-based combined heat and power (CHP) generation systems were assessed for environmental sustainability using a range of impact categories or characterisations (IC): cumulative primary fossil energy (CPE), land use, life cycle global warming potential over 100 years (GWP100), acidification potential (AP), eutrophication potential (EP) and abiotic resources use (ARU). The European Union (EU) Renewable Energy Directive's target of greenhouse gas (GHG) emission saving of 60% in comparison to an equivalent fossil-based system by 2020 seems to be very challenging for stand-alone wheat bioethanol system. However, the whole-wheat integrated system, wherein the CHP from the excess straw grown in the same season and from the same land is utilised in the wheat bioethanol plant, can be demonstrated for potential sustainability improvement, achieving 85% emission reduction and 97% CPE saving compared to reference fossil systems. The net bioenergy from this system and from 172,370 ha of grade 3 land is 12.1 PJ y−1 providing land to energy yield of 70 GJ ha−1 y−1. The use of DDGS as an animal feed replacing soy meal incurs environmental emission credit, whilst its use in heat or CHP generation saves CPE. The hot spots in whole system identified under each impact category are as follows: bioethanol plant and wheat cultivation for CPE (50% and 48%), as well as for ARU (46% and 52%). EP and GWP100 are distributed among wheat cultivation (49% and 37%), CHP plant (26% and 30%) and bioethanol plant (25%, and 33%), respectively. -- Highlights: ► UK whole-wheat energy system can achieve 85% GHG emission reduction. ► UK whole-wheat energy system can achieve 97% primary energy saving. ► The land to energy yield of the UK whole-wheat system is 70 GJ ha−1 y−1. ► Fertiliser production is the hotspot. ► DDGS and straw-based CHP system integration to wheat bioethanol is feasible

  18. Modelling the adoption of industrial cogeneration in Japan using manufacturing plant survey data

    International Nuclear Information System (INIS)

    Electric power deregulation in Japan opens opportunity for further penetration of on-site generation (cogeneration) otherwise known as distributed generation. In the paper the authors present a survey on Japanese industrial plants to fill existing gaps for the assessment of modern cogeneration (combined heat and power, CHP). The objective of the paper is to empirically examine CHP systems based on cross-sectional binary models; second to review diffusion trends of CHP by system vintage during the 1980-2000 period in the manufacturing sector. The econometric results point that the probabilities of embracing this technology increase, in declining importance, with on-site power consumption, and steam demand, operational hours as well as with payback period, purchased power. For example the survey shows that the CHP is used for the purpose of exporting power rather than meeting the plant's own consumption. Some of our results are in line with those of Dismukes and Kleit (Resource Energy Econ. 21 (1999) 153) as well with Rose and Macdonald (Energy J. 12(12) (1991) 47). We also find that a unit increase in satisfaction with CHP will lead to a 54% in CHP capacity. We find significant evidence on the cost effectiveness of CHP under conservative assumptions. Regarding the influence of satisfaction and performance indicators for the several plants, the survey threw some unexpected evidence on the nature of CHP

  19. Experience of Implementing a Distributed Control System for Thermal and Mechanical and Electrical Equipment at the South-West CHP

    International Nuclear Information System (INIS)

    Results of implementing an SPPA-T3000-based unified distributed control system for thermal and mechanical and electrical equipment at the South-West CHP are discussed. Hardware solutions for integration with local control systems, control of electrical equipment in compliance with the standards IEC 61850, Modbus RTU, and communication between the plant control system and the System Operator of the Unified Power System are described

  20. Experience of Implementing a Distributed Control System for Thermal and Mechanical and Electrical Equipment at the South-West CHP

    Energy Technology Data Exchange (ETDEWEB)

    Babkin, K. V., E-mail: babkin@uztec.ru; Tsvetkov, M. S.; Kostyuk, R. I.; Chugin, A. V. [SC “South-West CHP” (Russian Federation); Bilenko, V. A.; Molchanov, K. A.; Fedunov, V. V. [JSC “Interautomatika” (Russian Federation)

    2015-01-15

    Results of implementing an SPPA-T3000-based unified distributed control system for thermal and mechanical and electrical equipment at the South-West CHP are discussed. Hardware solutions for integration with local control systems, control of electrical equipment in compliance with the standards IEC 61850, Modbus RTU, and communication between the plant control system and the System Operator of the Unified Power System are described.

  1. Examination of energy price policies in Iran for optimal configuration of CHP and CCHP systems based on particle swarm optimization algorithm

    International Nuclear Information System (INIS)

    The current subsidized energy prices in Iran are proposed to be gradually eliminated over the next few years. The objective of this study is to examine the effects of current and future energy price policies on optimal configuration of combined heat and power (CHP) and combined cooling, heating, and power (CCHP) systems in Iran, under the conditions of selling and not-selling electricity to utility. The particle swarm optimization algorithm is used for minimizing the cost function for owning and operating various CHP and CCHP systems in an industrial dairy unit. The results show that with the estimated future unsubsidized utility prices, CHP and CCHP systems operating with reciprocating engine prime mover have total costs of 5.6 and $2.9x106 over useful life of 20 years, respectively, while both systems have the same capital recovery periods of 1.3 years. However, for the same prime mover and with current subsidized prices, CHP and CCHP systems require 4.9 and 5.2 years for capital recovery, respectively. It is concluded that the current energy price policies hinder the promotion of installing CHP and CCHP systems and, the policy of selling electricity to utility as well as eliminating subsidies are prerequisites to successful widespread utilization of such systems.

  2. Examination of energy price policies in Iran for optimal configuration of CHP and CCHP systems based on particle swarm optimization algorithm

    International Nuclear Information System (INIS)

    The current subsidized energy prices in Iran are proposed to be gradually eliminated over the next few years. The objective of this study is to examine the effects of current and future energy price policies on optimal configuration of combined heat and power (CHP) and combined cooling, heating, and power (CCHP) systems in Iran, under the conditions of selling and not-selling electricity to utility. The particle swarm optimization algorithm is used for minimizing the cost function for owning and operating various CHP and CCHP systems in an industrial dairy unit. The results show that with the estimated future unsubsidized utility prices, CHP and CCHP systems operating with reciprocating engine prime mover have total costs of 5.6 and 2.9 x 106 over useful life of 20 years, respectively, while both systems have the same capital recovery periods of 1.3 years. However, for the same prime mover and with current subsidized prices, CHP and CCHP systems require 4.9 and 5.2 years for capital recovery, respectively. It is concluded that the current energy price policies hinder the promotion of installing CHP and CCHP systems and, the policy of selling electricity to utility as well as eliminating subsidies are prerequisites to successful widespread utilization of such systems. (author)

  3. Examination of energy price policies in Iran for optimal configuration of CHP and CCHP systems based on particle swarm optimization algorithm

    Energy Technology Data Exchange (ETDEWEB)

    Tichi, S.G.; Ardehali, M.M.; Nazari, M.E. [Energy Research Center, Department of Electrical Engineering, Amirkabir University of Technology (Tehran Polytechnic), 424 Hafez Ave., Tehran 15825-4413 (Iran)

    2010-10-15

    The current subsidized energy prices in Iran are proposed to be gradually eliminated over the next few years. The objective of this study is to examine the effects of current and future energy price policies on optimal configuration of combined heat and power (CHP) and combined cooling, heating, and power (CCHP) systems in Iran, under the conditions of selling and not-selling electricity to utility. The particle swarm optimization algorithm is used for minimizing the cost function for owning and operating various CHP and CCHP systems in an industrial dairy unit. The results show that with the estimated future unsubsidized utility prices, CHP and CCHP systems operating with reciprocating engine prime mover have total costs of 5.6 and 2.9 x 10{sup 6} over useful life of 20 years, respectively, while both systems have the same capital recovery periods of 1.3 years. However, for the same prime mover and with current subsidized prices, CHP and CCHP systems require 4.9 and 5.2 years for capital recovery, respectively. It is concluded that the current energy price policies hinder the promotion of installing CHP and CCHP systems and, the policy of selling electricity to utility as well as eliminating subsidies are prerequisites to successful widespread utilization of such systems. (author)

  4. Development of Next Generation micro-CHP System

    DEFF Research Database (Denmark)

    Arsalis, Alexandros

    Novel proposals for the modeling and operation of a micro-CHP (combined-heat-andpower) residential system based on HT-PEMFC (High Temperature-Proton Exchange Membrane Fuel Cell) technology are described and analyzed to investigate the technical feasibility of such systems. The proposed systems must...... provide electricity, hot water, and space heating for an average single-family household in Denmark. A complete fuel processing subsystem, with all necessary BOP (balance-of-plant) components, is modeled and coupled to the fuel cell stack subsystem. The research project is divided into five main study...... topics: (a) Modeling, simulation and validation of the system in LabVIEW environment to provide the ability of Data Acquisition of actual components, and thereby more realistic design in the future; (b) Modeling, parametric study, and sensitivity analysis of the system in EES (Engineering Equation Solver...

  5. A study on electricity export capability of the μCHP system with spot price

    OpenAIRE

    You, Shi; Træholt, Chresten; Poulsen, Bjarne

    2009-01-01

    When a number of muCHP systems are aggregated as a virtual power plant (VPP), they will be able to participate in the electricity wholesale market with no discrimination compared to conventional large power plants. Hence, this paper investigates the electricity export capability of the muCHP system when the electricity buyback price is given at a value equalizing the dynamic spot price. A muCHP system is modeled with optimized generation, and the marginal price of electricity export for such ...

  6. Techno-economic analysis of a coal-fired CHP based combined heating system with gas-fired boilers for peak load compensation

    International Nuclear Information System (INIS)

    Combined heat and power (CHP) plants dominate the heating market in China. With the ongoing energy structure reformation and increasing environmental concerns, we propose gas-fired boilers to be deployed in underperforming heating substations of heating networks for peak load compensation, in order to improve both energy efficiency and environmental sustainability. However, due to the relatively high price of gas, techno-economic analysis is required for evaluating different combined heating scenarios, characterized by basic heat load ratio (β). Therefore, we employ the dynamic economics and annual cost method to develop a techno-economic model for computing the net heating cost of the system, considering the current state of the art of cogeneration systems in China. The net heating cost is defined as the investment costs and operations costs of the system subtracted by revenues from power generation. We demonstrate the model in a real-life combined heating system of Daqing, China. The results show that the minimum net heating cost can be realized at β=0.75 with a cost reduction of 16.8% compared to coal heating alone. Since fuel cost is the dominating factor, sensitivity analyses on coal and gas prices are discussed subsequently. - Highlights: ► Combined heating systems comply with the energy structure reformation in China. ► We consider the current state of the art of cogeneration systems in China. ► Combined heating systems can be economically more feasible and sustainable. ► The net heating cost of a combined heating system is more sensitive to coal price. ► The optimal basic heat load ratio is more easily influenced by gas price.

  7. 250 kWe class atmospheric Solid Oxide Fuel Cell (SOFC) combined heat and power (CHP) power plant installation and operation

    International Nuclear Information System (INIS)

    The 250 kWe SOFC/CHP system was designed as the first pre-commercial demonstration of Siemens Westinghouse Power Corporation's (SWPC) atmospheric-pressure SOFC technology. This integrated package combining fuel cell and heat recovery, was predicted to deliver electrical-generation efficiencies above 45% and total energy efficiency with heat recovery approaching 80%. SOFC technologies are widely heralded as the state-of-the art in stationary power generation. High electrical conversion efficiencies (up to a potential of 70% in pressurized hybrid units), very low emissions, virtually solid state (few moving parts), and high exhaust-heat recovery make SOFCs very desirable as distributed generation technologies. With their tubular technology, SWPC is recognized as the world leader in SOFC stationary systems designed for distributed generation applications. (author)

  8. ANALYSIS OF CHP POTENTIAL AT FEDERAL SITES

    Energy Technology Data Exchange (ETDEWEB)

    HADLEY, S.W.

    2002-03-11

    of these criteria. Executive Order 13123 directs federal facilities to use CHP when life-cycle costs indicate energy reduction goals will be met. FEMP can assist facilities to conduct this analysis. The model developed for this report estimates the magnitude of CHP that could be implemented under various performance and economic assumptions associated with different applications. This model may be useful for other energy technologies. It can be adapted to estimate the market potential in federal buildings for any energy system based on the cost and performance parameters that a user desires to assess. The model already incorporates a standard set of parameters based on available data for federal buildings including total building space, building type, energy use intensity, fuel costs, and the performance of many prime movers commonly used in CHP applications. These and other variables can be adjusted to meet user needs or updated in the future as new data become available.

  9. Sewage Sludge Gasification for CHP Applications

    Energy Technology Data Exchange (ETDEWEB)

    McCahey, S.; Huang, Y.; McMullan, J.T.

    2003-07-01

    Many routes previously available for sewage sludge disposal within the European Union are now prohibited or constrained by environmental legislation. Meanwhile, sewage sludge production increases annually as more rigorous treatment processes are used. This paper introduces an ongoing project, supported by the European Commission FP5 Programme, which seeks to examine the key technical environmental and economic issues relating to the gasification of sewage sludge for utilisation in CHP applications and ultimately to establish the commercial viability of the process. Sewage sludge treatment data has been collected by country and region and a database compiled. Laboratory and pilot plant scale gasification trials are underway and two small engines and a generator have been installed and commissioned. This paper discusses the concurrent development of ECLIPSE process simulation models for the three selected gasification processes, namely fluidised bed, spouted bed and fixed bed. These models have been validated and are being used to predict the behaviour of appropriately sized commercial scale plant, enabling informed decisions regarding technical suitability. The next step in this project is to determine capital costs and economic performance. Process routes will be identified that offer the most cost effective routes to reducing environmental burdens by using sewage sludge in CHP applications. (author)

  10. Evaluation of a pilot-scale wood torrefcaction plant based on pellet properties and Finnish market economics

    Directory of Open Access Journals (Sweden)

    Tapio Ranta, Jarno Föhr, Hanne Soininen

    2016-01-01

    Full Text Available In this study torrefaction was demonstrated at a Torrec Ltd. pilot plant located in Mikkeli, eastern Finland. The pilot plant with a nominal capacity of 10,000 tonnes/year began operation in August 2014. The torrefaction solution was a batch type process based on a vertical reactor, where biomass material flows by gravity without drives or actuators and torrefaction happens by steam inertization and accurate process control. Steam was supplied from the local biomass combined heat and power (CHP plant next to the pilot plant. The product quality of torrefied pellets was analysed by testing alternative local woody biomass sources, such as forest chips made from coniferous trees (spruce, pine and broadleaf (birch, as well as by-products such as veneer chips. Lower heating value as dry basis varied 18.47–20.53 MJ/kg with a moisture content of 4.41-8.60% for torrefied pellets. All raw materials were suitable for torrefied pellet production without binder addition. Noteworthy was good results also with hardwood species. The potential Finnish customers are CHP plants aiming to replace coal with pellets. In 2013 coal use was 31.2 TWh, where condensing was 15.3 TWh, CHP 14.2 TWh, and separate heat 1.6 TWh in Finland. If half of the current coal use in CHP would be replaced by biocoal, then Finnish potential bio-coal markets would be 7 TWh or 1.2 million tonnes of pellets/year. Aided by the results of this demonstration study and modelling of logistics it is possible to evaluate the competitiveness of torrefied pellets based on the local circumstances.

  11. Micro-CHP Systems for Residential Applications

    Energy Technology Data Exchange (ETDEWEB)

    Timothy DeValve; Benoit Olsommer

    2007-09-30

    Integrated micro-CHP (Cooling, Heating and Power) system solutions represent an opportunity to address all of the following requirements at once: conservation of scarce energy resources, moderation of pollutant release into our environment, and assured comfort for home-owners. The objective of this effort was to establish strategies for development, demonstration, and sustainable commercialization of cost-effective integrated CHP systems for residential applications. A unified approach to market and opportunity identification, technology assessment, specific system designs, adaptation to modular product platform component conceptual designs was employed. UTRC's recommendation to U.S. Department of Energy is to go ahead with the execution of the proposed product development and commercialization strategy plan under Phase II of this effort. Recent indicators show the emergence of micro-CHP. More than 12,000 micro-CHP systems have been sold worldwide so far, around 7,500 in 2004. Market projections predict a world-wide market growth over 35% per year. In 2004 the installations were mainly in Europe (73.5%) and in Japan (26.4%). The market in North-America is almost non-existent (0.1%). High energy consumption, high energy expenditure, large spark-spread (i.e., difference between electricity and fuel costs), big square footage, and high income are the key conditions for market acceptance. Today, these conditions are best found in the states of New York, Pennsylvania, New Jersey, Wisconsin, Illinois, Indiana, Michigan, Ohio, New England states. A multiple stage development plan is proposed to address risk mitigation. These stages include concept development and supplier engagement, component development, system integration, system demonstration, and field trials. A two stage commercialization strategy is suggested based on two product versions. The first version--a heat and power system named Micro-Cogen, provides the heat and essential electrical power to the

  12. Alternative depreciation policies for promoting combined heat and power (CHP) development in Brazil

    International Nuclear Information System (INIS)

    This paper assessed the economic impact of alternative depreciation methods on the development of combined heat-and-power (CHP) systems in the Brazilian industrial sector. Alternative depreciation methods were proposed and the case study of a Brazilian chemical plant showed that the most effective depreciation method for the promotion of CHP plants in Brazil was the Matheson method with an accelerated depreciation schedule of 7 years. This alternative method was then applied to the Brazilian chemical industry as a whole, increasing its installed capacity in CHP systems by 24%. Therefore, fiscal incentives can be an interesting tool for promoting energy efficiency in the Brazilian industrial sector, promoting the expansion of CHP plants. It reduces government fiscal revenues, but it also induces the technological reposition and improves the feasibility of ventures that are not installed without this kind of incentive. (author)

  13. Alternative depreciation policies for promoting combined heat and power (CHP) development in Brazil

    International Nuclear Information System (INIS)

    This paper assessed the economic impact of alternative depreciation methods on the development of combined heat-and-power (CHP) systems in the Brazilian industrial sector. Alternative depreciation methods were proposed and the case study of a Brazilian chemical plant showed that the most effective depreciation method for the promotion of CHP plants in Brazil was the Matheson method with an accelerated depreciation schedule of 7 years. This alternative method was then applied to the Brazilian chemical industry as a whole, increasing its installed capacity in CHP systems by 24%. Therefore, fiscal incentives can be an interesting tool for promoting energy efficiency in the Brazilian industrial sector, promoting the expansion of CHP plants. It reduces government fiscal revenues, but it also induces the technological reposition and improves the feasibility of ventures that are not installed without this kind of incentive

  14. Evaluation of the impact of the liberalisation of the European electricity market on the CHP, District heating and cooling sector; 'Save CHP/DHC'. Final report

    International Nuclear Information System (INIS)

    Improved energy efficiency will play a key role in meeting the EU Kyoto target economically. In addition to a significant positive environmental impact, improved energy efficiency will lead to a more sustainable energy policy and enhanced security of supply. The study: 1) Identifies and evaluates parameters and conditions which in relation to the liberalisation of the electricity market will have an impact on the CHP/DHC sector in EU15 and Poland. 2) Establishes an information base on CHP/DHC systems in EU15 and Poland. 3) Analyses the CHP/DHC sector and its ability to meet changing market conditions. 4) Assesses the effect of the liberalised electricity market on electricity production in relation to CHP/district heating and cooling. 5) Identifies threats for the viability of CHP/DHC in a liberalised market and evaluates means and measures to overcome such threats. The study brings forward the goals and commitments in respect of European energy and environmental policy and gives an overview of the present and expected future framework in which CHP/DHC is to operate. The study evaluates the viability of the sector at an overall level and for different groups/categories of CHP/DHC systems in different countries. The effects of existing or proposed national public measures are analysed. The analyses are essential to decision makers in the transition process towards a fully liberalised market. Recognised uncertainties in the market during the transition period may cause either a temporary or a permanent recession for the CHP/DHC sector. Improved understanding and recognition of threats and opportunities is important to all actors just now. The study can be considered a first step of a process to create a market situation, where the energy customers can make their choices under competition rules and where environmentally friendly and efficient CHP and DHC is considered an attractive business opportunity in competition with other energy supplies. (EHS)

  15. Dicty_cDB: CHP859 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP859 (Link to dictyBase) - - - Contig-U16586-1 - (Link to Original site) ... ete sequence. 46 0.13 1 DD062477 |DD062477.1 HUMAN SCHIZOPHRENIA ... GENE. 46 0.13 1 DD021122 |DD021122.1 HUMAN SCHIZOP ...

  16. CHP Integrated with Burners for Packaged Boilers

    Energy Technology Data Exchange (ETDEWEB)

    Castaldini, Carlo; Darby, Eric

    2013-09-30

    The objective of this project was to engineer, design, fabricate, and field demonstrate a Boiler Burner Energy System Technology (BBEST) that integrates a low-cost, clean burning, gas-fired simple-cycle (unrecuperated) 100 kWe (net) microturbine (SCMT) with a new ultra low-NOx gas-fired burner (ULNB) into one compact Combined Heat and Power (CHP) product that can be retrofit on new and existing industrial and commercial boilers in place of conventional burners. The Scope of Work for this project was segmented into two principal phases: (Phase I) Hardware development, assembly and pre-test and (Phase II) Field installation and demonstration testing. Phase I was divided into five technical tasks (Task 2 to 6). These tasks covered the engineering, design, fabrication, testing and optimization of each key component of the CHP system principally, ULNB, SCMT, assembly BBEST CHP package, and integrated controls. Phase I work culminated with the laboratory testing of the completed BBEST assembly prior to shipment for field installation and demonstration. Phase II consisted of two remaining technical tasks (Task 7 and 8), which focused on the installation, startup, and field verification tests at a pre-selected industrial plant to document performance and attainment of all project objectives. Technical direction and administration was under the management of CMCE, Inc. Altex Technologies Corporation lead the design, assembly and testing of the system. Field demonstration was supported by Leva Energy, the commercialization firm founded by executives at CMCE and Altex. Leva Energy has applied for patent protection on the BBEST process under the trade name of Power Burner and holds the license for the burner currently used in the product. The commercial term Power Burner is used throughout this report to refer to the BBEST technology proposed for this project. The project was co-funded by the California Energy Commission and the Southern California Gas Company (SCG), a

  17. DEVELOPMENT OF THE CHP-THERMAL SCHEMES IN CONTEXTS OF THE CONSOLIDATED ENERGY SYSTEM OF BELARUS

    Directory of Open Access Journals (Sweden)

    V. N. Romaniuk

    2015-01-01

    Full Text Available The paper deals with the structural specifics of the Belarus Consolidated Energy System capacities in view of their ongoing transfer to the combined-cycle technology, building the nuclear power plant and necessity for the generating capacity regulation in compliance with the load diagram. With the country’s economic complex energy utilization pattern being preserved, the generating capacities are subject to restructuring and the CHP characteristics undergo enhancement inter alia a well-known increase of the specific electricity production based on the heat consumption. Because of this the steam-turbine condensation units which are the traditional capacity regulators for the energy systems with heat power plants dominance are being pushed out of operation. In consequence of this complex of changes the issue of load diagram provision gains momentum which in evidence is relevant to the Consolidated Energy System of Belarus. One of the ways to alleviate acuteness of the problem could be the specific electric energy production cut on the CHP heat consumption with preserving the heat loads and without their handover to the heat generating capacities of direct combustion i.e. without fuel over-burning. The solution lies in integrating the absorption bromous-lithium heat pump units into the CHP thermal scheme. Through their agency low-temperature heat streams of the generator cooling, the lubrication and condensation heat-extraction of steam minimal passing to the condenser systems are utilized. As a case study the authors choose one of the CHPs in the conditions of which the corresponding employment of the said pumps leads to diminution of the fuel-equivalent specific flow-rate by 20−25 g for 1 kW⋅h production and conjoined electric energy generation capacity lowering. The latter will be handed over to other generating capacities, and the choice of them affects economic expediency of the absorption bromous-lithium heat pump-units installation

  18. Review of CHP projections tp 2010

    Energy Technology Data Exchange (ETDEWEB)

    Choudhury, W.

    2003-07-01

    This report summarises the findings of a study examining market conditions for combined heat and power since 2000 and assessing the commercial position of cogeneration (CHP) in order to provide advice on likely distributed generation in relation to technology, location and commissioning timetables. Details are given of the modelling of the development of 'good quality' CHP by Cambridge Econometrics (CE), and the work carried out by ILEX updating the CE study. Modelling assumptions, market conditions for CHP since the CE study, the effect of market conditions on CE modelling assumptions, justified changes in assumptions, and evaluation of likely CHP capacity to 2010 are discussed.

  19. Elimination of restraints on the propagation of combined heat and power (CHP) generation systems in Switzerland

    International Nuclear Information System (INIS)

    This report for the Swiss Federal Office of Energy (SFOE) discusses the results of study initiated by the SFOE that was to investigate the reasons for the low level of proliferation of CHP technology in Switzerland. The two main questions asked - which factors inhibit the use of CHP in particular application areas and which energy-policy measures can remove such obstacles - are discussed. The use of CHP in various areas of application from waste incineration plants through to units used in residential buildings is analysed and commented on. Recommendations on measures that can be taken to enhance the use of CHP are discussed. Three strategy variants available to the public services area are presented and discussed. It is noted that a consensus between players in the technical and political areas is necessary

  20. Optimal placement of combined heat and power scheme (cogeneration): application to an ethylbenzene plant

    International Nuclear Information System (INIS)

    Combined heat and power (CHP) scheme, also known as cogeneration is widely accepted as a highly efficient energy saving measure, particularly in medium to large scale chemical process plants. To date, CHP application is well established in the developed countries. The advantage of a CHP scheme for a chemical plant is two-fold: (i) drastically cut down on the electricity bill from on-site power generation (ii) to save the fuel bills through recovery of the quality waste heat from power generation for process heating. In order to be effective, a CHP scheme must be placed at the right temperature level in the context of the overall process. Failure to do so might render a CHP venture worthless. This paper discusses the procedure for an effective implementation of a CHP scheme. An ethylbenzene process is used as a case study. A key visualization tool known as the grand composite curves is used to provide an overall picture of the process heat source and heat sink profiles. The grand composite curve, which is generated based on the first principles of Pinch Analysis enables the CHP scheme to be optimally placed within the overall process scenario. (Author)

  1. CHP Gorzow - first Polish gas-steam CHP with GT8C turbine; EC Gorzow SA - pierwsza w Polsce elektrocieplownia gazowo-parowa z turbina GT8C

    Energy Technology Data Exchange (ETDEWEB)

    Woloncewicz, Z. [Elektrocieplownia Gorzow S.A., Gorzow Wielkopolski, (Poland); Rudny, S. [Energoprojekt Gliwice S.A., Gliwice (Poland); Wronkowski, H.; Dzierzgowski, J. [ABB Zamech Ltd., Elblag, (Poland)

    1996-06-01

    Combined-cycle power plant Gorzow generates heat and electric power for the needs of Gorzow Wielkopolski town and local industry. Old part of the plant with 4 coal-fired units will be replaced by gas-steam CHP in 1998. The basic technical data of CHP are given and GT8C turbine is described. The consequences for environment such as elimination of dust as well as substantial abatement of SO{sub 2} and NO{sub x} emission are stressed. A way of noise abatement is also presented. 7 figs.

  2. Omakotitalokokoluokan mikro-CHP-laitokset

    OpenAIRE

    Kyllönen, Matias

    2015-01-01

    Työ tehtiin Oulun yliopiston Oulun Eteläisen instituutin Tulevaisuuden tuotantoteknologiat (FMT) -tutkimusryhmälle. Työn aiheena on tulevaisuuden energiaratkaisu omakotitalokokoluokassa. Tavoitteena opinnäytetyössä on miettiä konsepti mikro-CHP-laitokselle, jossa höyrykone on lämpövoimakoneena pyörittämässä generaattoriin liitettyä akselia. Tavoitteena on tehdä mahdollisimman kompakti hyvin eristetty laitos tulevaisuuden omakotitalon energiatarpeen tyydyttämiseksi. Työn on tehty tiedonha...

  3. Increasing the flexibility of operational scheduling for a large-scale CHP plant used for generating district heat and electricity in order to meet the varying market demands; Steigerung der Einsatzflexibilitaet einer grossen KWK-Anlage zur Fernwaerme- und Stromerzeugung gemaess aktueller Marktanforderungen

    Energy Technology Data Exchange (ETDEWEB)

    Meierer, Matthias; Krupp, Roland; Stork, Rolf [Grosskraftwerk Mannheim AG, Mannheim (Germany)

    2015-07-01

    The substantial changes in the structure of German power supply plants pose high demands on the flexibility of the operational scheduling of conventional thermal power plants. Grosskraftwerk Mannheim AG is a power plant company that is operating a plant for combined power and district heat generation. The paper describes some measures which have been taken to improve the plant's operational flexibility. In addition, the associated technical systems and their functions, as well as the state of ongoing projects are outlined. Special focus is placed on topics related to issues such as ''district-heat storage unit of the new unit 9, flexibility of operational scheduling, and efficient CHP plant operation''.

  4. Putney Basketville Site Biomass CHP Analysis

    Energy Technology Data Exchange (ETDEWEB)

    Hunsberger, Randolph [National Renewable Energy Lab. (NREL), Golden, CO (United States); Mosey, Gail [National Renewable Energy Lab. (NREL), Golden, CO (United States)

    2013-10-01

    The U.S. Environmental Protection Agency (EPA) Office of Solid Waste and Emergency Response Center for Program Analysis developed the RE-Powering America's Land initiative to reuse contaminated sites for renewable energy generation when aligned with the community's vision for the site. The Putney, Vermont, Basketville site, formerly the location of a basket-making facility and a paper mill andwoolen mill, was selected for a feasibility study under the program. Biomass was chosen as the renewable energy resource based on abundant woody-biomass resources available in the area. Biomass combined heat and power (CHP) was selected as the technology due to nearby loads, including Putney Paper and Landmark College.

  5. Investigation of the prospect of energy self-sufficiency and technical performance of an integrated PEMFC (proton exchange membrane fuel cell), dairy farm and biogas plant system

    International Nuclear Information System (INIS)

    Highlights: • A PEMFC stack with a 40% of electrical efficiency will make the integrated PEMFC-CHP, biogas plant and dairy farm self-sufficient. • The quality of the reformate gas is good enough to support normal operation of the PEMFC-CHP. • The methane conversion rate and the content of the CH4 in the biogas need to be balanced in order to obtain the best system performance. • Compared with a coal-fired CHP plant, the integrated system can avoid coal consumption and CO2 emissions. - Abstract: A PEMFC fuelled with hydrogen is known for its high efficiency and low local emissions. However, the generation of hydrogen is always a controversial issue for the application of the PEMFC due to the use of fossil fuel and the possible carbon dioxide emissions. Presently, the PEMFC-CHP fed with renewable fuels, such as biogas, appears to be the most attractive energy converter–fuel combination. In this paper, an integrated PEMFC-CHP, a dairy farm and a biogas plant are studied. A PEMFC-CHP fed with reformate gas from the biogas plant generates electricity and heat to a dairy farm and a biogas plant, while the dairy farm delivers wet manure to the biogas plant as the feedstock for biogas production. This integrated system has been modelled for steady-state conditions by using Aspen Plus®. The results indicate that the wet manure production of a dairy farm with 300 milked cows can support a biogas plant to give 1280 MW h of biogas annually. Based on the biogas production, a PEMFC-CHP with a stack having an electrical efficiency of 40% generates 360 MW h electricity and 680 MW h heat per year, which is enough to cover the energy demand of the whole system while the total efficiency of the PEMFC-CHP system is 82%. The integrated PEMFC-CHP, dairy farm and biogas plant could make the dairy farm and the biogas plant self-sufficient in a sustainable way provided the PEMFC-CHP has the electrical efficiency stated above. The effect of the methane conversion rate and the

  6. Energy efficiency analysis and impact evaluation of the application of thermoelectric power cycle to today's CHP systems

    DEFF Research Database (Denmark)

    Chen, Min; Lund, Henrik; Rosendahl, Lasse;

    2010-01-01

    High efficiency thermoelectric generators (TEG) can recover waste heat from both industrial and private sectors. Thus, the development and deployment of TEG may represent one of the main drives for technological change and fuel substitution. This paper will present an analysis of system efficiency...... related to the integration of TEG into thermal energy systems, especially Combined Heat and Power production (CHP). Representative implementations of installing TEG in CHP plants to utilize waste heat, wherein electricity can be generated in situ as a by-product, will be described to show advantageous...... configurations for combustion systems. The feasible deployment of TEG in various CHP plants will be examined in terms of heat source temperature range, influences on CHP power specification and thermal environment, as well as potential benefits. The overall conversion efficiency improvements and economic...

  7. Risk analysis for CHP decision making within the conditions of an open electricity market

    International Nuclear Information System (INIS)

    Decision making under uncertainty is a difficult task in most areas. Investment decisions for combined heat and power production (CHP) are certainly one of the areas where it is difficult to find an optimal solution since the payback period is several years and parameters change due to different perturbing factors of economic and mostly political nature. CHP is one of the most effective measures for saving primary energy and reduction of greenhouse gas emissions. The implementation of EU directives on the promotion of cogeneration based on useful heat demand in the internal energy market will accelerate CHP installation. The expected number of small CHP installations will be very high in the near future. A quick, reliable and simple tool for economic evaluation of small CHP systems is required. Since evaluation is normally made by sophisticated economic computer models which are rather expensive, a simple point estimate economic model was developed which was later upgraded by risk methodology to give more informative results for better decision making. This paper presents a reliable computer model entitled ''Computer program for economic evaluation analysis of CHP'' as a tool for analysis and economic evaluation of small CHP systems with the aim of helping the decision maker. The paper describes two methods for calculation of the sensitivity of the economic results to changes of input parameters and the uncertainty of the results: the classic/static method and the risk method. The computer program uses risk methodology by applying rate at RISK software on an existing conventional economic model. The use of risk methodology for economic evaluation can improve decisions by incorporating all possible information (knowledge), which cannot be done in the conventional economic model due to its limitations. The methodology was tested on the case of a CHP used in a smaller hospital. (author)

  8. Risk analysis for CHP decision making within the conditions of an open electricity market

    International Nuclear Information System (INIS)

    Decision making under uncertainty is a difficult task in most areas. Investment decisions for combined heat and power production (CHP) are certainly one of the areas where it is difficult to find an optimal solution since the payback period is several years and parameters change due to different perturbing factors of economic and mostly political nature. CHP is one of the most effective measures for saving primary energy and reduction of greenhouse gas emissions. The implementation of EU directives on the promotion of cogeneration based on useful heat demand in the internal energy market will accelerate CHP installation. The expected number of small CHP installations will be very high in the near future. A quick, reliable and simple tool for economic evaluation of small CHP systems is required. Since evaluation is normally made by sophisticated economic computer models which are rather expensive, a simple point estimate economic model was developed which was later upgraded by risk methodology to give more informative results for better decision making. This paper presents a reliable computer model entitled 'Computer program for economic evaluation analysis of CHP' as a tool for analysis and economic evaluation of small CHP systems with the aim of helping the decision maker. The paper describes two methods for calculation of the sensitivity of the economic results to changes of input parameters and the uncertainty of the results: the classic/static method and the risk method. The computer program uses risk methodology by applying RISK software on an existing conventional economic model. The use of risk methodology for economic evaluation can improve decisions by incorporating all possible information (knowledge), which cannot be done in the conventional economic model due to its limitations. The methodology was tested on the case of a CHP used in a smaller hospital

  9. Dicty_cDB: CHP584 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP584 (Link to dictyBase) - - - Contig-U15547-1 - (Link to Original site) ... Value BC047807_1( BC047807 |pid:none) Danio rerio hypoxia ... up-regulated 1... 105 9e-22 BC071372_1( BC071372 | ... pid:none) Danio rerio hypoxia ... up-regulated 1... 105 9e-22 BC043837_1( BC043837 | ...

  10. Dicty_cDB: CHP635 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP635 (Link to dictyBase) - - - Contig-U16371-1 - (Link to Original site) ... Oryzias latipes DNA, clone: ola1-178O04.F, genomic survey ... sequence. 54 0.003 1 DE078411 |DE078411.1 Oryzias ... latipes DNA, clone: ola1-200D13.F, genomic survey ... sequence. 54 0.003 1 DE067405 |DE067405.1 Oryzias ...

  11. Demand Response With Micro-CHP Systems

    OpenAIRE

    Houwing M.; Negenborn R.R.; De Schutter B.

    2011-01-01

    With the increasing application of distributed energy resources and novel information technologies in the electricity infrastructure, innovative possibilities to incorporate the demand side more actively in power system operation are enabled. A promising, controllable, residential distributed generation technology is a microcombined heat and power system (micro-CHP). Micro-CHP is an energy-efficient technology that simultaneously provides heat and electricity to households. In this paper, we ...

  12. Dicty_cDB: CHP695 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 267 |AC117267.2 Dictyostelium discoideum chromosome 2 map 5836255-5862024 strain AX4, complete seq...iol.tsukuba.ac.jp/CSM/CH/CHP6-D/CHP695Q.Seq.d/ Representative seq. ID - (Link to Original site) Represe...ntative DNA sequence >CHP695 (CHP695Q) /CSM/CH/CHP6-D/CHP695Q.Seq.d/ CTGTTGGCCTACTGGNA...GGTGGTACATCAGGTAGTTCATCAAGTGGTAGTTCATCAGGTGGXXXXXXXXXX sequence update 2002.10.25 Translated Amino Acid sequ...SGGTSGGSSSGGTSGGSSSGGTSGSSSSGSSSG--- Translated Amino Acid sequence (All Frames) Frame A: llaywxfyf*siqikkkt

  13. Screening of CHP Potential at Federal Sites in Select Regions of the U.S.

    Energy Technology Data Exchange (ETDEWEB)

    Energy Nexus Group, . .

    2002-02-25

    sizing CHP to thermal and electrical estimates. The table below is a summary of findings of CHP potential for those federal facilities that chose to participate in the screening process. The study focused on three U.S. regions: California, Texas, and New York/New England. All federal facilities in these three regions with reported building space greater than 100,000 square feet were initial targets to contact and offer CHP screening services. Ranking criteria were developed to screen sites for near term CHP potential. The potential site list was pared down for a variety of reasons including site- specific and agency wide decisions not to participate, desk audit assessments, and untraceable contact information. The results are based upon the voluntary participation of those sites we were able to contact, so they reflect a fraction of the total potential CHP opportunities at federal government facilities.

  14. Ecological assessment of new CHP systems and their combination; Oekologische Bewertung neuer WKK-Systeme und Systemkombinationen - Schlussbericht

    Energy Technology Data Exchange (ETDEWEB)

    Primas, A.

    2007-07-01

    This final report for the Swiss Federal Office of Energy (SFOE) reports on new developments in the Combined Heat and Power (CHP) generation area. The objective of this study is an ecological and technical evaluation of various CHP systems and system combinations. These also include suitable combinations with other technologies. Systems for five different temperature levels are quantified according to their environmental impact. Various possible applications are compared with a highly efficient reference system using separate heat and power generation - a combined-cycle plant and a heat pump. For chilled water production a combination of the CHP system with an absorption chiller is investigated. The results of the investigations are presented and commented on. Also, advantageous applications of CHP systems are noted.

  15. Sustaining Rainforest Plants, People and Global Health: A Model for Learning from Traditions in Holistic Health Promotion and Community Based Conservation as Implemented by Q’eqchi’ Maya Healers, Maya Mountains, Belize

    Directory of Open Access Journals (Sweden)

    Pablo Sanchez-Vindas

    2010-10-01

    Full Text Available The present work showcases a model for holistic, sustainable healthcare in indigenous communities worldwide through the implementation of traditional healing practices. The implementation of this model promotes public health and community wellness while addressing crucially important themes such as in situ and ex situ conservation of medicinal plant resources and associated biodiversity, generational transmission of knowledge, and the preservation of biological and cultural diversity for future generations. Being envisaged and implemented by Q’eqchi’ Maya traditional healers of the southern Maya Mountains, Belize, this model can be replicated in other communities worldwide. A ethnobotany study in collaboration with these healers led to collection of 102 medicinal species from Itzama, their traditional healing cultural center and medicinal garden. Of these 102 species, 40 of prior reported 106 consensus study plants were present in the garden. There were 62 plants not previously reported growing in the garden as well. A general comparison of these plants was also made in relation to species reported in TRAMIL network, Caribbean Herbal Pharmacopoeia (CHP, the largest regional medicinal pharmacopoeia. A relative few species reported here were found in the CHP. However, the majority of the CHP plants are common in Belize and many are used by the nearby Mopan and Yucatec Maya. Since these 102 species are relied upon heavily in local primary healthcare, this Q’eqchi’ Maya medicinal garden represents possibilities toward novel sustainable, culturally relative holistic health promotion and community based conservation practices.

  16. Micro-CHP systems for residential applications

    International Nuclear Information System (INIS)

    Micro-CHP systems are now emerging on the market. In this paper, a thorough analysis is made of the operational parameters of 3 types of micro-CHP systems for residential use. Two types of houses (detached and terraced) are compared with a two storey apartment. For each building type, the energy demands for electricity and heat are dynamically determined. Using these load profiles, several CHP systems are designed for each building type. Data were obtained for two commercially available gas engines, two Stirling engines and a fuel cell. Using a dynamic simulation, including start up times, these five system types are compared to the separate energy system of a natural gas boiler and buying electricity from the grid. All CHP systems, if well sized, result in a reduction of primary energy use, though different technologies have very different impacts. Gas engines seem to have the best performance. The economic analysis shows that fuel cells are still too expensive and that even the gas engines only have a small internal rate of return (<5%), and this only occurs in favourable economic circumstances. It can, therefore, be concluded that although the different technologies are technically mature, installation costs should at least be reduced by 50% before CHP systems become interesting for residential use. Condensing gas boilers, now very popular in new homes, prove to be economically more interesting and also have a modest effect on primary energy consumption

  17. 330 kWe Packaged CHP System with Reduced Emissions

    Energy Technology Data Exchange (ETDEWEB)

    Plahn, Paul [Cummins Power Generation, Minneapolis, MN (United States); Keene, Kevin [Cummins Power Generation, Minneapolis, MN (United States); Pendray, John [Cummins Power Generation, Minneapolis, MN (United States)

    2015-03-31

    The objective of this project was to develop a flexible, 330 kWe packaged Combined Heat and Power (CHP) system that can be deployed to commercial and light industrial applications at a lower total cost of ownership than current CHP solutions. The project resulted in a CHP system that is easy to use and inexpensive to install, offering world class customer support, while providing a low-emissions, higher-efficiency internal combustion engine for a CHP system of this size.

  18. Small-Scale CHP Potential in Latvia and Estonia

    OpenAIRE

    Volkova, A.; Latosev, E; Siirde, A

    2009-01-01

    In the research the small-scale CHP potential of Latvia and Estonia has been defined. Factors, which influence the CHP development, were analyzed in this paper, including political, geographic, climatological, legislative and technological factors. For the small-scale CHP potential assessment the three alternatives were chosen. The first alternative is the case, when only the hot water is taken into account. In this case the CHP can work with full load during the whole year because the heat l...

  19. Regulatory Compliance and Environmental Benefit Analysis of Combined Heat and Power (CHP Systems in Taiwan

    Directory of Open Access Journals (Sweden)

    Wen-Tien Tsai

    2013-01-01

    Full Text Available The energy conservation achieved by utilizing waste heat in the energy and industrial sectors has became more and more important after the energy crisis in the 1970s because it plays a vital role in the potential energy-efficiency improvement. In this regard, cogeneration (combined heat and power, CHP systems are thus becoming attractive due to the energy, economic, and environmental policies for pursuing stable electricity supply, sustainable development and environmental pollution mitigation in Taiwan. The objective of this paper is to present an updated analysis of CHP systems in Taiwan during the period from 1990 to 2010. The description in the paper is thus based on an analysis of electricity supply/consumption and its sources from CHP systems during the past two decades, and centered on two important regulations in compliance with CHP systems (i.e., Energy Management Law and Environmental Impact Assessment Act. Based on the total net power generation from CHP systems (i.e., 35,626 GWh in 2011, it was found that the carbon dioxide reduction benefits were estimated to be around 20,000 Gg.

  20. Deployment of FlexCHP System

    Energy Technology Data Exchange (ETDEWEB)

    Cygan, David [Gas Technology Inst., Des Plaines, IL (United States)

    2015-11-01

    The Gas Technology Institute (GTI), along with its partner Integrated CHP Systems Corporation, has developed and demonstrated an Ultra-Low-Nitrogen Oxide (ULN) Flexible Combined Heat and Power (FlexCHP) system that packages a state-of-the-art Capstone C65 gas microturbine and Johnston PFXX100 boiler with an innovative natural gas-fired supplemental burner. Supplemental burners add heat as needed in response to facility demand, which increases energy efficiency, but typically raises exhaust NOx levels, degrading local air quality unless a costly and complicated catalytic treatment system is added. The FlexCHP system increases energy efficiency and achieves the 2007 California Air Resource Board (CARB) distributed generation emissions standards for Nitrogen oxides (NOx), Carbon Monoxide (CO), and Total Hydrocarbons (THC) without catalytic exhaust gas treatment. The key to this breakthrough performance is a simple and reliable burner design which utilizes staged combustion with engineered internal recirculation. This ULN burner system successfully uses turbine exhaust as an oxidizer, while achieving high efficiencies and low emissions. In tests at its laboratory facilities in Des Plaines, Illinois, GTI validated the ability of the system to achieve emissions of NOx, CO, and THC below the CARB criteria of 0.07, 0.10, and 0.02 lb/MW-h respectively. The FlexCHP system was installed at the field demonstration site, Inland Empire Foods, in Riverside, California to verify performance of the technology in an applied environment. The resulting Combined Heat and Power (CHP) package promises to make CHP implementation more attractive, mitigate greenhouse gas emissions, and improve the reliability of electricity supply.

  1. Comparison of district heating CHP and distributed generation CHP with energy, environmental and economic criteria for Northern Italy

    International Nuclear Information System (INIS)

    Highlights: • District heating CHP and distributed generation CHP are compared. • Energy, environmental and economic aspects are considered. • Analysed prime movers: internal combustion engines, microturbines, fuel cells. • Two scenario are discussed: maximum energy saving and maximum present value saving. • The trend of all the savings versus the CHP-size is also analysed. - Abstract: District heating CHP (combined heat and power) and distributed generation CHP have been compared in this paper on the basis of energy, environmental and economic criteria, and a deviation index has been proposed to establish, in aggregate form, what the improvement margins are for a given design choice. Three technologies that are suitable for both district heating and distributed generation have been chosen: a mature market technology, internal combustion engines, and recent entry market technologies, that is, microturbines, and fuel cells. The calculations have been based on the real heating load curve of a town in Northern Italy at the current market conditions: power and fuel prices, tax exemptions relative to cogeneration, white certificates, etc. Two scenarios have been considered: maximum energy saving and maximum present value saving. In the first scenario, district heating obtained better energy and CO2 savings than distributed generation, but critical values have been observed for local nitrogen oxides (NOx) and particulate matter emissions, when internal combustion engines are adopted. In the second scenario, all the options offer positive energy, environmental and economic savings, and the payback times are significantly reduced compared to the previous scenario. The district heating options show the best present value savings and payback times, while distributed generation is only economically viable when internal combustion engines are adopted. Microturbines leads to the best NOx savings. Finally, the comparison with an alternative separate production of heat

  2. Dicty_cDB: CHP896 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sequence; segment 4/5. 38 6e-04 16 DD041861 |DD041861.1 Light-driven energy generation using proteorhodopsin...lnln*yhvhfqlhhllhhfqlvvvaavvvfhlkvv*lkniknhldhqdmeiikil lkdf*nalie*lkfikni...AM270196 |pid:none) Aspergillus niger contig An09c007... 35 7.5 AE010299_2657( AE010299 |pid:none) Methanosa...D CHP896 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16351-1 Original site URL ht...equence (All Frames) Frame A: tvgllxftlkcrttityhli**l*ivviisl*elhylqfinkkikk*iikkiknnqkdfy fsyrvinky*yr***sil*ggeahlcdf*qqinni

  3. Development of a CHP/DH system for the new town of Parand: An opportunity to mitigate global warming in Middle East

    International Nuclear Information System (INIS)

    As a result of the worldwide concern about global warming, projects that target reduction of greenhouse gas emissions have gained a lot of interest. The idea of this paper is to recover exhaust hot gases of an existing gas turbine power plant to meet dynamic thermal energy requirements of a residential area (the new town of Parand) situated in the suburb of Tehran, and also use the rest of the heat source potential to feed a steam turbine cycle. In close proximity to this town, there are two GT plants: Parand (954 MWe) and Rudeshur (790 MWe). For handling the CHP/STC/DH plant, two methods are considered along with thermal load following operation strategy: maximum power generation (MPG) and minimum fuel consumption (MFC). Then, the alternatives are compared in terms of annual PES, CO2 abatement and NPV. For the best design from environmental viewpoint (Parand CHP-B), PES, CO2 abatement and NPV are calculated to be 27.31%, 2.56 million tons and 1491 million dollar, respectively. -- Highlights: • To propose a technical and financial methodology to evaluate CHP/DH projects. • To address environmental advantages of CHPs with conventional plants. • To present practical operation strategies to increase benefits of CHP/DH plants. • To report/compare benefits of various CHP/DH alternatives for a case study in Iran. • To conduct a comprehensive energy analysis of proposed CHP/DH design options

  4. Exergy analysis of a combined heat and power plant with integrated lignocellulosic ethanol production

    International Nuclear Information System (INIS)

    Highlights: • We model a system where lignocellulosic ethanol production is integrated with a combined heat and power (CHP) plant. • We conduct an exergy analysis for the ethanol production in six different system operation points. • Integrated operation, district heating (DH) production and low CHP loads all increase the exergy efficiency. • Separate operation has the largest negative impact on the exergy efficiency. • Operation is found to have a significant impact on the exergy efficiency of the ethanol production. - Abstract: Lignocellulosic ethanol production is often assumed integrated in polygeneration systems because of its energy intensive nature. The objective of this study is to investigate potential irreversibilities from such integration, and what impact it has on the efficiency of the integrated ethanol production. An exergy analysis is carried out for a modelled polygeneration system in which lignocellulosic ethanol production based on hydrothermal pretreatment is integrated in an existing combined heat and power (CHP) plant. The ethanol facility is driven by steam extracted from the CHP unit when feasible, and a gas boiler is used as back-up when integration is not possible. The system was evaluated according to six operation points that alternate on the following three different operation parameters: Load in the CHP unit, integrated versus separate operation, and inclusion of district heating production in the ethanol facility. The calculated standard exergy efficiency of the ethanol facility varied from 0.564 to 0.855, of which the highest was obtained for integrated operation at reduced CHP load and full district heating production in the ethanol facility, and the lowest for separate operation with zero district heating production in the ethanol facility. The results suggest that the efficiency of integrating lignocellulosic ethanol production in CHP plants is highly dependent on operation, and it is therefore suggested that the

  5. Exergy analysis of a combined heat and power plant with integrated lignocellulosic ethanol production

    DEFF Research Database (Denmark)

    Lythcke-Jørgensen, Christoffer Ernst; Haglind, Fredrik; Clausen, Lasse Røngaard

    2014-01-01

    Lignocellulosic ethanol production is often assumed integrated in polygeneration systems because of its energy intensive nature. The objective of this study is to investigate potential irreversibilities from such integration, and what impact it has on the efficiency of the integrated ethanol...... production. An exergy analysis is carried out for a modelled polygeneration system in which lignocellulosic ethanol production based on hydrothermal pretreatment is integrated in an existing combined heat and power (CHP) plant. The ethanol facility is driven by steam extracted from the CHP unit when feasible...... with zero district heating production in the ethanol facility. The results suggest that the efficiency of integrating lignocellulosic ethanol production in CHP plants is highly dependent on operation, and it is therefore suggested that the expected operation pattern of such polygeneration system is...

  6. MICRO-CHP System for Residential Applications

    Energy Technology Data Exchange (ETDEWEB)

    Joseph Gerstmann

    2009-01-31

    This is the final report of progress under Phase I of a project to develop and commercialize a micro-CHP system for residential applications that provides electrical power, heating, and cooling for the home. This is the first phase of a three-phase effort in which the residential micro-CHP system will be designed (Phase I), developed and tested in the laboratory (Phase II); and further developed and field tested (Phase III). The project team consists of Advanced Mechanical Technology, Inc. (AMTI), responsible for system design and integration; Marathon Engine Systems, Inc. (MES), responsible for design of the engine-generator subsystem; AO Smith, responsible for design of the thermal storage and water heating subsystems; Trane, a business of American Standard Companies, responsible for design of the HVAC subsystem; and AirXchange, Inc., responsible for design of the mechanical ventilation and dehumidification subsystem.

  7. A dynamic regrouping based sequential dynamic programming algorithm for unit commitment of combined heat and power systems

    DEFF Research Database (Denmark)

    Rong, Aiying; Hakonen, Henri; Lahdelma, Risto

    2009-01-01

    This paper addresses the unit commitment (UC) in multi-period combined heat and power (CHP) production planning under the deregulated power market. In CHP plants (units), generation of heat and power follows joint characteristics, which implies that it is difficult to determine the relative cost...... efficiency of the plants. We introduce in this paper the DRDP-RSC algorithm, which is a dynamic regrouping based dynamic programming (DP) algorithm based on linear relaxation of the ON/OFF states of the units, sequential commitment of units in small groups. Relaxed states of the plants are used to reduce the...

  8. DEVELOPMENT OF THE CHP-THERMAL SCHEMES IN CONTEXTS OF THE CONSOLIDATED ENERGY SYSTEM OF BELARUS

    OpenAIRE

    V. N. Romaniuk; A. A. Bobich

    2015-01-01

    The paper deals with the structural specifics of the Belarus Consolidated Energy System capacities in view of their ongoing transfer to the combined-cycle technology, building the nuclear power plant and necessity for the generating capacity regulation in compliance with the load diagram. With the country’s economic complex energy utilization pattern being preserved, the generating capacities are subject to restructuring and the CHP characteristics undergo enhancement inter alia a well-known ...

  9. Gasification for power, CHP and polygeneration Biomass Gasification for Combined Heat Power (CHP) Applications: the GAMECO Project

    OpenAIRE

    Authier, O; Khalfi, Az-Eddine; Sanchez, L.; Aleman, Y; Delebarre, A; Mauviel, G; Dufour, A; Rogaume, Y; Poirier, J.; Kerhoas, J

    2014-01-01

    International audience Air-blown fluidised bed biomass gasification is a well adapted technology for Combined Heat Power (CHP) applications with syngas valorisation in a gas engine. However, it is not mature yet. Despite promising prototypes, CHP gasification needs further improvements to become the reference technology in the medium-size CHP market. This is the purpose of the GAMECO project, which aims at improving an existing technology by optimising its operation, increasing its feedsto...

  10. Elimination of restraints on the propagation of combined heat and power (CHP) generation systems in Switzerland; Beseitigung von Hemmnissen bei der Verbreitung von Waermekraftkopplung (WKK) in der Schweiz

    Energy Technology Data Exchange (ETDEWEB)

    Rieder, S.; Landis, F. [Interface Politikstudien Forschung Beratung, Luzern (Switzerland); Lienhard, A.; Marti Locher, F. [Universitaet Bern, Kompetenzzentrum fuer Public Management (KPM), Bern (Switzerland); Krummenacher, S. [Enerprice Partners AG, Technopark Luzern, Root Laengenbold (Switzerland)

    2009-04-15

    This report for the Swiss Federal Office of Energy (SFOE) discusses the results of study initiated by the SFOE that was to investigate the reasons for the low level of proliferation of CHP technology in Switzerland. The two main questions asked - which factors inhibit the use of CHP in particular application areas and which energy-policy measures can remove such obstacles - are discussed. The use of CHP in various areas of application from waste incineration plants through to units used in residential buildings is analysed and commented on. Recommendations on measures that can be taken to enhance the use of CHP are discussed. Three strategy variants available to the public services area are presented and discussed. It is noted that a consensus between players in the technical and political areas is necessary

  11. Large Combined Heat and Power Plants for Sustainable Energy System

    DEFF Research Database (Denmark)

    Lund, Rasmus Søgaard; Mathiesen, Brian Vad

    . CHP (combined heat and power) plants in Denmark will change their role from base load production to balancing the fluctuation in renewable energy supply, such as wind power and at the same time they have to change to renewable energy sources. Some solutions are already being planned by utilities in...... Denmark; conversion of pulverised fuel plants from coal to wood pellets and a circulating fluidised bed (CFB) plant for wood chips. From scientific research projects another solution is suggested as the most feasible; the combined cycle gas turbine (CCGT) plant. In this study a four scenarios are....... The scenarios are assessed on their total socioeconomic costs and the biomass consumption. The CCGT CHP plant is concluded to be the most feasible of the assessed types considering both a technical analysis and a market economic analysis with electricity exchange. It is also concluded that the current...

  12. Comparison and Research of Standards for CHP Energy Efifciency%我国热电联产能效标准对比研究

    Institute of Scientific and Technical Information of China (English)

    齐为; 马娜

    2013-01-01

    Based on China’s standards on Combined Heating&Power (CHP) energy efifciency, this paper compares and researches the local energy efifciency standards on CHP, analyzes the local policies and industrial characters of CHP, as well as summarizes the conclusions of the comparison.%在梳理我国热电联产能效标准现状的基础上,对比研究我国地方热电联产能效标准,分析地方热电联产制度环境和产业特点,总结相应对比结论。

  13. The bases of plant introduction

    OpenAIRE

    Karpun Yu N

    2004-01-01

    The main problems of plintroduction are presented as theses. The plants introduction is suggested to regard as process of their cultivation, which has several stages: the mobilization of plant's material, primary test, sec- ond test. The basic terms are offered: introduction point, introduction search, collection number, introduction situation, etc. The peculiarities of plants introduction process are presented. The relationship between native flora and introduction plants are con...

  14. Energy efficiency analysis and impact evaluation of the application of thermoelectric power cycle to today's CHP systems

    International Nuclear Information System (INIS)

    High efficiency thermoelectric generators (TEG) can recover waste heat from both industrial and private sectors. Thus, the development and deployment of TEG may represent one of the main drives for technological change and fuel substitution. This paper will present an analysis of system efficiency related to the integration of TEG into thermal energy systems, especially Combined Heat and Power production (CHP). Representative implementations of installing TEG in CHP plants to utilize waste heat, wherein electricity can be generated in situ as a by-product, will be described to show advantageous configurations for combustion systems. The feasible deployment of TEG in various CHP plants will be examined in terms of heat source temperature range, influences on CHP power specification and thermal environment, as well as potential benefits. The overall conversion efficiency improvements and economic benefits, together with the environmental impact of this deployment, will then be estimated. By using the Danish thermal energy system as a paradigm, this paper will consider the TEG application to district heating systems and power plants through the EnergyPLAN model, which has been created to design suitable energy strategies for the integration of electricity production into the overall energy system.

  15. Evaluation of Combined Heat and Power (CHP Systems Using Fuzzy Shannon Entropy and Fuzzy TOPSIS

    Directory of Open Access Journals (Sweden)

    Fausto Cavallaro

    2016-06-01

    Full Text Available Combined heat and power (CHP or cogeneration can play a strategic role in addressing environmental issues and climate change. CHP systems require less fuel than separate heat and power systems in order to produce the same amount of energy saving primary energy, improving the security of the supply. Because less fuel is combusted, greenhouse gas emissions and other air pollutants are reduced. If we are to consider the CHP system as “sustainable”, we must include in its assessment not only energetic performance but also environmental and economic aspects, presenting a multicriteria issue. The purpose of the paper is to apply a fuzzy multicriteria methodology to the assessment of five CHP commercial technologies. Specifically, the combination of the fuzzy Shannon’s entropy and the fuzzy Technique for Order of Preference by Similarity to Ideal Solution (TOPSIS approach will be tested for this purpose. Shannon’s entropy concept, using interval data such as the α-cut, is a particularly suitable technique for assigning weights to criteria—it does not require a decision-making (DM to assign a weight to the criteria. To rank the proposed alternatives, a fuzzy TOPSIS method has been applied. It is based on the principle that the chosen alternative should be as close as possible to the positive ideal solution and be as far as possible from the negative ideal solution. The proposed approach provides a useful technical–scientific decision-making tool that can effectively support, in a consistent and transparent way, the assessment of various CHP technologies from a sustainable point of view.

  16. SOFC/TEG hybrid mCHP system. Final report

    Energy Technology Data Exchange (ETDEWEB)

    2012-03-15

    The starting point for this project have been the challenge has been to develop a cost effective solution with long term stability. This is where a focused effort in a strong consortium covering material research, module development and manufacture as well as device design and optimization can make a real difference. In March 2010 the SOFTEG phase II project was initiated and a cooperation organization was established to implement the project as a development and demonstration project involving the staff from all project partners. The project is now completed with excellent and documented outcome. The final results by Alpcon have been demonstration as a TEG-based mCHP system calls CHP Dual Engine Power System, which will be applicable as both a standalone TEG-CHP hybrid system, but also as an auxiliary power unit and power booster for the SOFC system. However the SOFC system cannot cover the household's heat demand alone so it is necessary to combine a SOFC system together with a water heater/boiler system to cover the peak heat demand of a residential house or a complex building. The SOFTEG project partners achieved significant results that mainly can be outlined as following: 1) University of Aarhus has improved the thermal stability of ZnSb by optimizing the concentration of Nano composite material. 2) The grain size and its influence on the sintering process by spark plasma method are investigated by Aarhus University, but further work seems to be necessary. 3) The TE material is going to commercialization by Aarhus University. 4) Aalborg University has prepared simulation tools for complex thermoelectric simulation in non-steady state condition. 5) The new type DCDC interleaved converter using the MPPT system for optimal power tracing is designed, build and tested by Aalborg University in cooperation with Alpcon. This task is included overall system design, control system implementation and power electronic control design. 6) Full scale practical

  17. Dicty_cDB: CHP795 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP795 (Link to dictyBase) - - - Contig-U16524-1 - (Link to Original site) ... .1 Influenza A virus (swine/Cotes d'Armor/1515/99 (H1N1 )) partial N1NA gene for Neuraminidase, genomic RNA ... .1 Influenza A virus (swine/Cotes d'Armor/1482/99 (H1N1 )) partial N1NA gene for Neuraminidase, genomic RNA ... Influenza A virus (swine/Ille et Vilaine/1455/99 (H1N1 )) partial N1NA gene for Neuraminidase, genomic RNA ... .1 Influenza A virus (swine/Cotes d'Armor/1488/99 (H1N1 )) partial N1NA gene for Neuraminidase, genomic RNA ...

  18. Cost targets for domestic fuel cell CHP

    Science.gov (United States)

    Staffell, I.; Green, R.; Kendall, K.

    Fuel cells have the potential to reduce domestic energy bills by providing both heat and power at the point of use, generating high value electricity from a low cost fuel. However, the cost of installing the fuel cell must be sufficiently low to be recovered by the savings made over its lifetime. A computer simulation is used to estimate the savings and cost targets for fuel cell CHP systems. Two pitfalls of this kind of simulation are addressed: the selection of representative performance figures for fuel cells, and the range of houses from which energy demand data was taken. A meta-study of the current state of the art is presented, and used with 102 house-years of demand to simulate the range of economic performance expected from four fuel cell technologies within the UK domestic CHP market. Annual savings relative to a condensing boiler are estimated at €170-300 for a 1 kWe fuel cell, giving a target cost of €350-625 kW -1 for any fuel cell technology that can demonstrate a 2.5-year lifetime. Increasing lifetime and reducing fuel cell capacity are identified as routes to accelerated market entry. The importance of energy demand is seen to outweigh both economic and technical performance assumptions, while manufacture cost and system lifetime are highlighted as the only significant differences between the technologies considered. SOFC are considered to have the greatest potential, but uncertainty in the assumptions used precludes any clear-cut judgement.

  19. Mapping and disruption of the chpB locus in Escherichia coli.

    OpenAIRE

    Masuda, Y; Ohtsubo, E

    1994-01-01

    The chpB locus is a chromosomal homolog of the pem locus, which is responsible for stable maintenance of plasmid R100 within the host cells. Like pem, chpB codes for two genes, chpBK and chpBI, encoding a growth inhibitor and a suppressor for the killing action of the ChpBK protein, respectively. Here, we determined the precise location of the chpB locus, which is linked to ileR and ppa in the order ileR-chpB-ppa, at 95.7 min on the map of Escherichia coli. We then constructed mutants with an...

  20. Plant-based remediation processes

    Energy Technology Data Exchange (ETDEWEB)

    Gupta, Dharmendra Kumar (ed.) [Belgian Nuclear Research Centre (SCK.CEN), Mol (Belgium). Radiological Impact and Performance Assessment Division

    2013-11-01

    A valuable source of information for scientists in the field of environmental pollution and remediation. Describes the latest biotechnological methods for the treatment of contaminated soils. Includes case studies and protocols. Phytoremediation is an emerging technology that employs higher plants for the clean-up of contaminated environments. Basic and applied research have unequivocally demonstrated that selected plant species possess the genetic potential to accumulate, degrade, metabolize and immobilize a wide range of contaminants. The main focus of this volume is on the recent advances of technologies using green plants for remediation of various metals and metalloids. Topics include biomonitoring of heavy metal pollution, amendments of higher uptake of toxic metals, transport of heavy metals in plants, and toxicity mechanisms. Further chapters discuss agro-technological methods for minimizing pollution while improving soil quality, transgenic approaches to heavy metal remediation and present protocols for metal remediation via in vitro root cultures.

  1. Rho family GTPase Chp/RhoV induces PC12 apoptotic cell death via JNK activation

    OpenAIRE

    Shepelev, Mikhail V; Chernoff, Jonathan; Korobko, Igor V

    2011-01-01

    Rho GTPases regulate numerous cellular processes including apoptosis. Chp/RhoV is an atypical Rho GTPase which functions are poorly understood. Here we investigated the role of Chp in regulation of cell viability using PC12 cells with inducible expression of Chp as a model. We found that expression of Chp results in apoptosis in PC12 cells. Chp-induced apoptosis was accompanied by activation of JNK signaling and both death receptor-mediated and mitochondrial apoptotic pathways as justified by...

  2. Growing pioneer plants for a lunar base

    Science.gov (United States)

    Kozyrovska, N. O.; Lutvynenko, T. L.; Korniichuk, O. S.; Kovalchuk, M. V.; Voznyuk, T. M.; Kononuchenko, O.; Zaetz, I.; Rogutskyy, I. S.; Mytrokhyn, O. V.; Mashkovska, S. P.; Foing, B. H.; Kordyum, V. A.

    A precursory scenario of cultivating the first plants in a lunar greenhouse was elaborated in frames of a conceptual study to grow plants for a permanently manned lunar base. A prototype plant growth system represents an ornamental plant Tagetes patula L. for growing in a lunar rock anorthosite as a substrate. Microbial community anticipated to be in use to support a growth and development of the plant in a substrate of low bioavailability and provide an acceptable growth and blossoming of T. patula under growth limiting conditions.

  3. Impact of carbon tax on internal combustion engine size selection in a medium scale CHP system

    International Nuclear Information System (INIS)

    Highlights: → We study sizing of internal combustion engines as the prime movers of a CHP system. → We study carbon tax impact on the economics of the system. → Diesel engine based systems is not economical regardless of the operational mode. → HDF is the only mode in which gas engine based systems is uneconomical. → Carbon price considerably affects the system payback period. -- Abstract: Combined heat and power (CHP) systems due to their high efficiency compared to the conventional power generation systems have received considerable attention as they have less harmful impact on the environment. Recently, the serious concern with reducing the greenhouse gas emissions has focussed the attention on the possibility of a carbon tax in some countries. Here, we address the impact of such tax on the sizing and economics of a CHP system. Optimum sizing of CHP systems is of great importance to maximize the benefits of these systems. To select the optimum prime mover of a CHP system, performance characteristics of engine as well as economic parameters should be taken into consideration. A general thermo-economic approach to optimum sizing of internal combustion engines as the prime movers (any type and size) of a medium scale CHP system (500-5000 kW) and planning their operational strategy is developed. Net Annual Cost (NAC) as the criterion for making decision is introduced and appropriate equations for estimating thermodynamic and economic parameters as well as greenhouse gas emissions are presented. We consider three modes of operation: one-way connection (OWC) mode, two-way connection (TWC) mode, and heat demand following (HDF) mode. The proposed method has been used for a case study where data is available in the literature and the optimum nominal powers using gas engines are 3.3 MW, 3.2 MW, and 1.2 MW and in the case of using diesel engines are 3.4 MW, 3.4 MW, and 1.4 MW for TWC, OWC, and HDF modes, respectively. To determine the sensitivity of results to

  4. Micro Cooling, Heating, and Power (Micro-CHP) and Bio-Fuel Center, Mississippi State University

    Energy Technology Data Exchange (ETDEWEB)

    Louay Chamra

    2008-09-26

    Initially, most micro-CHP systems will likely be designed as constant-power output or base-load systems. This implies that at some point the power requirement will not be met, or that the requirement will be exceeded. Realistically, both cases will occur within a 24-hour period. For example, in the United States, the base electrical load for the average home is approximately 2 kW while the peak electrical demand is slightly over 4 kW. If a 3 kWe micro- CHP system were installed in this situation, part of the time more energy will be provided than could be used and for a portion of the time more energy will be required than could be provided. Jalalzadeh-Azar [6] investigated this situation and presented a comparison of electrical- and thermal-load-following CHP systems. In his investigation he included in a parametric analysis addressing the influence of the subsystem efficiencies on the total primary energy consumption as well as an economic analysis of these systems. He found that an increase in the efficiencies of the on-site power generation and electrical equipment reduced the total monthly import of electricity. A methodology for calculating performance characteristics of different micro-CHP system components will be introduced in this article. Thermodynamic cycles are used to model each individual prime mover. The prime movers modeled in this article are a spark-ignition internal combustion engine (Otto cycle) and a diesel engine (Diesel cycle). Calculations for heat exchanger, absorption chiller, and boiler modeling are also presented. The individual component models are then linked together to calculate total system performance values. Performance characteristics that will be observed for each system include maximum fuel flow rate, total monthly fuel consumption, and system energy (electrical, thermal, and total) efficiencies. Also, whether or not both the required electrical and thermal loads can sufficiently be accounted for within the system

  5. Nanotechnology based surface treatments for corrosion protection and deposit control of power plant equipment. Phase 1

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2009-05-15

    Nanotechnology can provide possibilities for obtaining new valuable information regarding performance and corrosion protection in power plants. In general the desired performance of the contact surfaces is an easy-to-release effect. This is in order to prolong the time interval between cleaning periods or make the cleaning procedures easier and less expensive. Corrosion protection is also desired in order to extend the life time of various parts in the power plants and thus optimize the energy output and overall efficiency of the plant. Functional sol-gel coating based on nanotechnology is tested in a variety of conditions. Applications of functional sol-gel coatings were performed in the condenser and on seven air preheaters at Fynsvaerket, Odense, with corrosion protection as the main issue. Coatings with easy-to-clean effects were tested in the Flue Gas Desulphurization plant at Nordjyllandsvaerket, Aalborg, with the aim of reducing gipsum deposit. Thermo stabilized coatings were tested on tube bundles between in the passage from the 1st to 2end pass and on the wall between 1st and 2end pass at Amagervaerket, Copenhagen, and in the boiler at Haderslev CHP plant. The objective of this test were reducing deposits and increasing corrosion protection. The tested coatings were commercial available coatings and coatings developed in this project. Visual inspections have been performed of all applications except at Nordjyllandsvaerket. Corrosion assessment has been done at DTU - Mechanical Engineering. The results range from no difference between coated and uncoated areas to some improvements. At Amagervaerket the visual assessment showed in general a positive effect with a sol-gel hybrid system and a commercial system regarding removal of deposits. The visual assessment of the air preheaters at Fynsvaerket indicates reduced deposits on a sol-gel nanocomposite coated air preheater compared to an uncoated air preheater. (Author)

  6. Optimal scheduling of industrial combined heat and power plants under time-sensitive electricity prices

    International Nuclear Information System (INIS)

    Combined heat and power (CHP) plants are widely used in industrial applications. In the aftermath of the recession, many of the associated production processes are under-utilized, which challenges the competitiveness of chemical companies. However, under-utilization can be a chance for tighter interaction with the power grid, which is in transition to the so-called smart grid, if the CHP plant can dynamically react to time-sensitive electricity prices. In this paper, we describe a generalized mode model on a component basis that addresses the operational optimization of industrial CHP plants. The mode formulation tracks the state of each plant component in a detailed manner and can account for different operating modes, e.g. fuel-switching for boilers and supplementary firing for gas turbines, and transitional behavior. Transitional behavior such as warm and cold start-ups, shutdowns and pre-computed start-up trajectories is modeled with modes as well. The feasible region of operation for each component is described based on input–output relationships that are thermodynamically sound, such as the Willans line for steam turbines. Furthermore, we emphasize the use of mathematically efficient logic constraints that allow solving the large-scale models fast. We provide an industrial case study and study the impact of different scenarios for under-utilization. - Highlights: • Unified representation for CHP plant components to capture flexibility in terms of thermodynamics and transitional behavior. • Efficient mathematical formulation for logic constraints that allows solving real-world case study in reasonable time. • Industrial case study shows economic benefit of 5–20% depending on level of utilization. • CHP plant's operating data allows readers to reproduce results and comparison with other model formulations

  7. Research, Development and Demonstration of Micro-CHP System for Residential Applications

    Energy Technology Data Exchange (ETDEWEB)

    Karl Mayer

    2010-03-31

    challenge to the development of a long life LIC system is the development of a reliable and efficient steam generator. The steam generator and support equipment development is described in Section 7. Just one year ago, ECR International announced through its joint venture company, Climate Energy, that it was introducing to the USA market a new class of Micro-CHP product using the state-of-the-art Honda MCHP gas fired internal combustion (IC) engine platform. We now have installed Climate Energy Micro-CHP systems in 20 pilot demonstration sites for the 2005/2006 heating season. This breakthrough success with IC engine based systems paves the way for future advanced steam cycle Micro-CHP systems to be introduced.

  8. Micro CHP module with Stirling engine: tests and market introduction; Mikro-KWK-Modul mit Stirlingmotor

    Energy Technology Data Exchange (ETDEWEB)

    Baumueller, A.

    2002-07-01

    This article describes a small combined heat and power (CHP) module based on a stationary Stirling engine with a 2 - 9 kW electrical and a 8 - 24 kW thermal rating. Its associated gas burner is also described. The article reviews the history of the development of this CHP module and describes how the Stirling engine works. The advantages offered by the Stirling engine in comparison with conventional engines in terms of low maintenance requirements and low emissions of pollutants are discussed. The design of the module and its integration into heating systems are examined. Tests with 30 units providing a total of 150,000 hours of operation are discussed. Production facilities and market introduction activities are briefly described.

  9. Model-based explanation of plant knowledge

    Energy Technology Data Exchange (ETDEWEB)

    Huuskonen, P.J. [VTT Electronics, Oulu (Finland). Embedded Software

    1997-12-31

    This thesis deals with computer explanation of knowledge related to design and operation of industrial plants. The needs for explanation are motivated through case studies and literature reviews. A general framework for analysing plant explanations is presented. Prototypes demonstrate key mechanisms for implementing parts of the framework. Power plants, steel mills, paper factories, and high energy physics control systems are studied to set requirements for explanation. The main problems are seen to be either lack or abundance of information. Design knowledge in particular is found missing at plants. Support systems and automation should be enhanced with ways to explain plant knowledge to the plant staff. A framework is formulated for analysing explanations of plant knowledge. It consists of three parts: 1. a typology of explanation, organised by the class of knowledge (factual, functional, or strategic) and by the target of explanation (processes, automation, or support systems), 2. an identification of explanation tasks generic for the plant domain, and 3. an identification of essential model types for explanation (structural, behavioural, functional, and teleological). The tasks use the models to create the explanations of the given classes. Key mechanisms are discussed to implement the generic explanation tasks. Knowledge representations based on objects and their relations form a vocabulary to model and present plant knowledge. A particular class of models, means-end models, are used to explain plant knowledge. Explanations are generated through searches in the models. Hypertext is adopted to communicate explanations over dialogue based on context. The results are demonstrated in prototypes. The VICE prototype explains the reasoning of an expert system for diagnosis of rotating machines at power plants. The Justifier prototype explains design knowledge obtained from an object-oriented plant design tool. Enhanced access mechanisms into on-line documentation are

  10. Optimization of Gas Supply of CHP Sources of Energy

    OpenAIRE

    Odiņeca, T; Zēbergs, V

    2008-01-01

    The article contains reviews the method of optimization of gas supply of CHP sources of energy - the method of calculation of permissible IRR. It is effective for analyzing the projects of CHP plants’ gasification (also in reconstruction of existing boiler houses). IRR is an effective criterion of profitability of gasification, if the forecast of the consumption of gas is precise. Using the method of calculation of permissible IRR it is possible to find the load limits in which CH...

  11. Expanders for micro-CHP systems with organic Rankine cycle

    OpenAIRE

    Qiu, Guoquan; Liu, Hao; Riffat, Saffa

    2011-01-01

    Abstract The continual increases in global energy demand and greenhouse gas emissions call for more and more utilisation of sustainable energy sources, such as solar energy, biomass energy, and waste heat. Solar thermal energy, the heat of biomass combustion and waste heat may be used to drive a combined heat and power (CHP) system. In recent years, several micro-CHP systems with organic Rankine cycle (ORC) suitable for domestic applications (1-10kWe) driven by solar thermal, bioma...

  12. Hybrid Solid Oxide Fuel Cell and Thermoelectric Generator for Maximum Power Output in Micro-CHP Systems

    Science.gov (United States)

    Rosendahl, L. A.; Mortensen, Paw V.; Enkeshafi, Ali A.

    2011-05-01

    One of the most obvious early market applications for thermoelectric generators (TEG) is decentralized micro combined heat and power (CHP) installations of 0.5 kWe to 5 kWe based on fuel cell technology. Through the use of TEG technology for waste heat recovery it is possible to increase the electricity production in micro-CHP systems by more than 15%, corresponding to system electrical efficiency increases of some 4 to 5 percentage points. This will make fuel cell-based micro-CHP systems very competitive and profitable and will also open opportunities in a number of other potential business and market segments which are not yet quantified. This paper quantifies a micro-CHP system based on a solid oxide fuel cell (SOFC) and a high-performance TE generator. Based on a 3 kW fuel input, the hybrid SOFC implementation boosts electrical output from 945 W to 1085 W, with 1794 W available for heating purposes.

  13. Hybrid Solid Oxide Fuel Cell and Thermoelectric Generator for Maximum Power Output in Micro-CHP Systems

    DEFF Research Database (Denmark)

    Rosendahl, Lasse; Mortensen, Paw Vestergård; Enkeshafi, Ali A.

    2011-01-01

    market segments which are not yet quantified. This paper quantifies a micro-CHP system based on a solid oxide fuel cell (SOFC) and a high-performance TE generator. Based on a 3 kW fuel input, the hybrid SOFC implementation boosts electrical output from 945 W to 1085 W, with 1794 W available for heating...... electricity production in micro-CHP systems by more than 15%, corresponding to system electrical efficiency increases of some 4 to 5 percentage points. This will make fuel cell-based micro-CHP systems very competitive and profitable and will also open opportunities in a number of other potential business and......One of the most obvious early market applications for thermoelectric generators (TEG) is decentralized micro combined heat and power (CHP) installations of 0.5 kWe to 5 kWe based on fuel cell technology. Through the use of TEG technology for waste heat recovery it is possible to increase the...

  14. Optimization of a High Temperature PEMFC micro-CHP System by Formulation and Application of a Process Integration Methodology

    DEFF Research Database (Denmark)

    Arsalis, Alexandros; Nielsen, Mads Pagh; Kær, Søren Knudsen

    2013-01-01

    A 1 kWe micro combined heat and power (CHP) system based on high temperature proton exchange membrane fuel cell (PEMFC) technology is modeled and optimized by formulation and application of a process integration methodology. The system can provide heat and electricity for a singlefamily household...

  15. Conceptual design of nuclear CHP using absorption cycle

    International Nuclear Information System (INIS)

    This paper aims at providing a conceptual idea on the combined heat and power (CHP) using the absorption cycle to simultaneously generate both electricity and useful heat, which is applicable to the conventional nuclear power plants (NPPs). The originality of the scheme is 1) it does not change the operation strategy of the NSSS, 2) the thermal energy of waste heat can be transferred to a long distance, and 3) the thermal energy can be used for cooling as well. As it is expected that the number and the share of NPPs increases soon, the necessity of a partial load operation was raised in argument in case of South Korea. This means the surplus of nuclear energy. In order to make the best of nuclear fuels loaded once, we proposed a combined cycle instead of cutting back reactor power to meet a partial load demand. Figure 1 shows the schematic drawing of the proposal. Since a steam demand in the turbine cycle is equivalent even though an electricity demand is different, the operation strategy of the NSSS does not need to be changed. When a partial load demand is triggered off, turbine power is cut back and a bypass path is open. The bypass path is used for transferring waste heat to an absorption cycle. The CHP using absorption principles was initially developed over 100 years ago. The absorption cycle is a process by which heating and/or cooling effect is produced through the use of two fluids and some quantity of heat input. The absorption cycles accomplish heat transferring through the evaporation of a refrigerant at a low pressure and the rejection of heat through the condensation of the refrigerant at a higher pressure. In the absorption cycles, a secondary fluid or absorbent is used to circulate the refrigerant. Absorption cycles are commercially available today in two basic configurations; lithium bromide/water and water/ammonia (respectively absorbent/ refrigerant). We can have several advantages in this idea. This principle can design a heat transfer mechanism

  16. CHP from Updraft Gasifier and Stirling Engine

    OpenAIRE

    Jensen, N; Werling, J.; Carlsen, Henrik; Henriksen, Ulrik Birk

    2002-01-01

    The combination of thermal gasification with a Stirling engine is an interesting concept for use in small combined heat and power plants based on biomass. By combining the two technologies a synergism can potentially be achieved. Technical problems, e.g. gas cleaning and fouling of the Stirling engine heat exchanger, can be eliminated and the overall electric efficiency of the system can be improved. At the Technical University of Denmark a Stirling engine fueled by gasification gas has been ...

  17. Simulation of micro-CHP diffusion by means of System Dynamics

    International Nuclear Information System (INIS)

    This paper presents a simulation analysis with System Dynamics of the possible diffusion of micro-systems for combined heat-power generation (μ-CHP) as a substitute for centralised electricity generation and local boilers in the residential sector. Decentralised energy production is an important challenge in the 21st century to respond to the threats of exhaustion of non-renewable resources, and of global pollution. The purpose of the System Dynamics modelling is to show the difficulties μ-CHP faces, like most innovative technologies, mainly due to its high investment costs. Feedbacks are important in modelling the diffusion process of this technology and the fundamental aspect of learning effects on the cost decrease. The consumer model is based on the replacement of traditional boilers by μ-CHP installations using the Bass diffusion model. It is shown that natural economic forces are probably not sufficient to achieve a sustained growth. Several incentive schemes to be implemented by the regulatory authorities are investigated to promote this technology

  18. CHP efficiency of a 2000 × CPV system with reflective optics

    Science.gov (United States)

    Bonsignore, Gaetano; Gallitto, Aurelio Agliolo; Agnello, Simonpietro; Barbera, Marco; Gelardi, Franco M.; Sciortino, Luisa; Collura, Alfonso; Cicero, Ugo Lo; Milone, Sergio; Montagnino, Fabio M.; Paredes, Filippo; Cannas, Marco

    2015-09-01

    In this work we have developed a combined heat and power (CHP) prototype that operates at 2000 × concentration based on reflective optics. The receiver consists of a InGaP/InGaAs/Ge triple-junction solar cell in thermal contact with an aluminium heat sink driving a forced water flow. This CHP system was tested both indoor (DNI of 650 W/m2) and outdoor (DNI of 900 W/m2) under different conditions of fluid parameters as the flow rate (ranging from 0.2 liters/min to 1.2 liters/min) and temperature (ranging from 25 °C to 60 °C). Electrical and thermal power were determined by acquiring IV curves and by measuring the heat subtracted from the cell while it delivered the maximum electrical power, respectively. The obtained results demonstrate that this CHP system achieves a total efficiency of about 80%, shared between the electrical (30%) and the thermal one (50%).

  19. Controlling design bases inputs to plant modifications

    International Nuclear Information System (INIS)

    The concept of configuration management involves first establishing a baseline where plant design documents are consistent with well-defined design bases and where design documents represent actual plant configuration. From that baseline forward, the design change process assures consistency between design bases, design documents, and as-built configuration. Although the details of the design change procedures vary from utility to utility, that industry consensus is to use some form of design change document or package to effect the change. Although the Final Safety Analysis Reprot(FSAR) and plant technical specification bases are typically changed by the change process, most of the useful design bases information remains only in the archived change package or supporting calculations. This paper discusses several utility programs conceived to document and update their design bases and relates their finished product to improvements in the design modification process

  20. Micro CHP as a new business model. Trianel distribution system decentralised production; Mikro-BHKW als neues Geschaeftsmodell. Trianel-Netzwerk Dezentrale Erzeugung

    Energy Technology Data Exchange (ETDEWEB)

    Nicolai, Michel [Trianel GmbH, Aachen (Germany)

    2013-04-29

    About four years ago, an energy distribution company in Hamburg (Federal Republic of Germany) reported on mini and micro CHP in the media. When it comes to a decentralized production of electricity and heat, however public utilities are the perfect partner: the decentralized power generation in flexible adjustable combined heat and power plants offers the opportunity to provide highly efficient heat and power directly at the place of consumption. In addition, regional and municipal utilities score with the theme mini and micro CHP for their customers due to the support on the way to more energy efficiency.

  1. Lunar base agriculture: Soils for plant growth

    Science.gov (United States)

    Ming, Douglas W. (Editor); Henninger, Donald L. (Editor)

    1989-01-01

    This work provides information on research and experimentation concerning various aspects of food production in space and particularly on the moon. Options for human settlement of the moon and Mars and strategies for a lunar base are discussed. The lunar environment, including the mineralogical and chemical properties of lunar regolith are investigated and chemical and physical considerations for a lunar-derived soil are considered. It is noted that biological considerations for such a soil include controlled-environment crop production, both hydroponic and lunar regolith-based; microorganisms and the growth of higher plants in lunar-derived soils; and the role of microbes to condition lunar regolith for plant cultivation. Current research in the controlled ecological life support system (CELSS) project is presented in detail and future research areas, such as the growth of higher research plants in CELSS are considered. Optimum plant and microbiological considerations for lunar derived soils are examined.

  2. CHP Fuel Cell Durability Demonstration - Final Report

    Energy Technology Data Exchange (ETDEWEB)

    Petrecky, James; Ashley, Christopher J

    2014-07-21

    Plug Power has managed a demonstration project that has tested multiple units of its high-temperature, PEM fuel cell system in micro-combined heat and power (μ-CHP) applications in California. The specific objective of the demonstration project was to substantiate the durability of GenSys Blue, and, thereby, verify its technology and commercial readiness for the marketplace. In the demonstration project, Plug Power, in partnership with the National Fuel Cell Research Center (NFCRC) at the University of California, Irvine (UCI), and Sempra, will execute two major tasks: • Task 1: Internal durability/reliability fleet testing. Six GenSys Blue units will be built and will undergo an internal test regimen to estimate failure rates. This task was modified to include 3 GenSys Blue units installed in a lab at UCI. • Task 2: External customer testing. Combined heat and power units will be installed and tested in real-world residential and/or light commercial end user locations in California.

  3. CHP from Updraft Gasifier and Stirling Engine

    DEFF Research Database (Denmark)

    Jensen, N.; Werling, J.; Carlsen, Henrik;

    2002-01-01

    The combination of thermal gasification with a Stirling engine is an interesting concept for use in small combined heat and power plants based on biomass. By combining the two technologies a synergism can potentially be achieved. Technical problems, e.g. gas cleaning and fouling of the Stirling...... engine heat exchanger, can be eliminated and the overall electric efficiency of the system can be improved. At the Technical University of Denmark a Stirling engine fueled by gasification gas has been developed. In this engine the combustion system and the geometry of the hot heat exchanger...... of the Stirling engine has been adapted to the use of a gas with a low specific energy content and a high content of tar and particles. In the spring of 2001 a demonstration plant has been built in the western part of Denmark where this Stirling engine is combined with an updraft gasifier. A mathematical...

  4. Thermodynamic analysis of two micro CHP systems operating with geothermal and solar energy

    International Nuclear Information System (INIS)

    Highlights: ► Two micro CHP ORC plants using solar and low temperature geothermal are presented. ► Three different fluids (R134a, R236fa, R245fa) are investigated. ► R245fa shows the best cycle efficiency; R134a releases the highest heat. ► Solar collectors accounts for nearly 50% of the system exergy destruction. ► Preliminary analysis of CHP performance with R134a in heating season is carried out. -- Abstract: Micro combined heat and power (CHP) plants operating through an organic Rankine cycle (ORC) using renewable energy are analyzed. The reference system is designed to produce 50 kWe. The heat sources of the system are geothermal energy at low temperature (80–100 °C) and solar energy. Two different system layouts, a single and a double stage arrangement, are presented. The first uses a solar field composed only by evacuated solar collectors, and work is produced by a single turbine. In the double-stage system, a field of evacuated solar collectors heats the working fluid up to an intermediate temperature. After this first stage, only a part of the working fluid flow rate is heated in a second solar field, composed of direct-steam parabolic through collectors (PTCs), up to the maximum temperature of the cycle. The mechanical work is then produced in two turbo-expanders arranged in series. For the investigations, different working fluids (e.g. R134a, R236fa, R245fa) are considered. The results of the simulation in terms of efficiencies, heat and electricity production and the main characteristics of the system (i.e. heat exchanger surface, solar collector area) are presented and discussed.

  5. Model-Based Power Plant Master Control

    Energy Technology Data Exchange (ETDEWEB)

    Boman, Katarina; Thomas, Jean; Funkquist, Jonas

    2010-08-15

    The main goal of the project has been to evaluate the potential of a coordinated master control for a solid fuel power plant in terms of tracking capability, stability and robustness. The control strategy has been model-based predictive control (MPC) and the plant used in the case study has been the Vattenfall power plant Idbaecken in Nykoeping. A dynamic plant model based on nonlinear physical models was used to imitate the true plant in MATLAB/SIMULINK simulations. The basis for this model was already developed in previous Vattenfall internal projects, along with a simulation model of the existing control implementation with traditional PID controllers. The existing PID control is used as a reference performance, and it has been thoroughly studied and tuned in these previous Vattenfall internal projects. A turbine model was developed with characteristics based on the results of steady-state simulations of the plant using the software EBSILON. Using the derived model as a representative for the actual process, an MPC control strategy was developed using linearization and gain-scheduling. The control signal constraints (rate of change) and constraints on outputs were implemented to comply with plant constraints. After tuning the MPC control parameters, a number of simulation scenarios were performed to compare the MPC strategy with the existing PID control structure. The simulation scenarios also included cases highlighting the robustness properties of the MPC strategy. From the study, the main conclusions are: - The proposed Master MPC controller shows excellent set-point tracking performance even though the plant has strong interactions and non-linearity, and the controls and their rate of change are bounded. - The proposed Master MPC controller is robust, stable in the presence of disturbances and parameter variations. Even though the current study only considered a very small number of the possible disturbances and modelling errors, the considered cases are

  6. Monitoring and Commissioning Verification Algorithms for CHP Systems

    Energy Technology Data Exchange (ETDEWEB)

    Brambley, Michael R.; Katipamula, Srinivas; Jiang, Wei

    2008-03-31

    This document provides the algorithms for CHP system performance monitoring and commissioning verification (CxV). It starts by presenting system-level and component-level performance metrics, followed by descriptions of algorithms for performance monitoring and commissioning verification, using the metric presented earlier. Verification of commissioning is accomplished essentially by comparing actual measured performance to benchmarks for performance provided by the system integrator and/or component manufacturers. The results of these comparisons are then automatically interpreted to provide conclusions regarding whether the CHP system and its components have been properly commissioned and where problems are found, guidance is provided for corrections. A discussion of uncertainty handling is then provided, which is followed by a description of how simulations models can be used to generate data for testing the algorithms. A model is described for simulating a CHP system consisting of a micro-turbine, an exhaust-gas heat recovery unit that produces hot water, a absorption chiller and a cooling tower. The process for using this model for generating data for testing the algorithms for a selected set of faults is described. The next section applies the algorithms developed to CHP laboratory and field data to illustrate their use. The report then concludes with a discussion of the need for laboratory testing of the algorithms on a physical CHP systems and identification of the recommended next steps.

  7. Optimizing the plant-based diet.

    Science.gov (United States)

    Mann, J I

    2000-09-01

    Any attempt to optimize a plant-based diet necessitates an identification of the features of the diet which confer benefit as well as any which may be associated with detrimental effects. The former task is more difficult than might be assumed as there is no doubt that some of the apparent health benefits observed amongst vegetarians are a consequence of environmental determinants of health which characterize groups of people who choose vegetarian diets, rather than dietary practices. This review will consider the major health benefits of plant-based diets, the specific foods or nutrients which confer the benefits as far as can be ascertained from present knowledge, potential nutrient deficiencies associated with a plant-based diet and nutritional strategies that can be employed to prevent any such deficiencies. PMID:24398280

  8. CHP and District Cooling: An Assessment of Market and Policy Potential in India

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2008-07-01

    This report contains an assessment of India's CHP/DC status and recommendations for addressing barriers to allow India to meet its energy efficiency targets. Such barriers include a lack of governmental emphasis on CHP, the absence of a clear methodology for calculating CO2 emission reductions from CHP/DHC, and a tax and duty structure for CHP capital equipment that is not as attractive as for other renewable energy technologies.

  9. Development and evaluation of a biomass-fired micro-scale CHP with organic rankine cycle

    OpenAIRE

    Shao, Yingjuan

    2011-01-01

    Combined Heat and Power Generation (CHP) or cogeneration has been considered worldwide as the major alternative to traditional energy systems in terms of signi ticant energy saving and environmental conservation. A renewable energy resource-fuelled CHP would deliver even more environmental benefits than a fossil tuel-driven CHP. Biomass is one of the renewable energy resources that plays an important role to the world primary energy supplies and can be used to fuel CHP systems. Many medium- a...

  10. Optimal design of integrated CHP systems for housing complexes

    International Nuclear Information System (INIS)

    Highlights: • An optimization formulation for designing domestic CHP systems is presented. • The operating scheme, prime mover and thermal storage system are optimized. • Weather conditions and behavior demands are considered. • Simultaneously economic and environmental objectives are considered. • Two case studies from Mexico are presented. - Abstract: This paper presents a multi-objective optimization approach for designing residential cogeneration systems based on a new superstructure that allows satisfying the demands of hot water and electricity at the minimum cost and the minimum environmental impact. The optimization involves the selection of technologies, size of required units and operating modes of equipment. Two residential complexes in different cities of the State of Michoacán in Mexico were considered as case studies. One is located on the west coast and the other one is in the mountainous area. The results show that the implementation of the proposed optimization method yields significant economic and environmental benefits due to the simultaneous reduction in the total annual cost and overall greenhouse gas emissions

  11. Hazard identification based on plant functional modelling

    International Nuclear Information System (INIS)

    A major objective of the present work is to provide means for representing a process plant as a socio-technical system, so as to allow hazard identification at a high level. The method includes technical, human and organisational aspects and is intended to be used for plant level hazard identification so as to identify critical areas and the need for further analysis using existing methods. The first part of the method is the preparation of a plant functional model where a set of plant functions link together hardware, software, operations, work organisation and other safety related aspects of the plant. The basic principle of the functional modelling is that any aspect of the plant can be represented by an object (in the sense that this term is used in computer science) based upon an Intent (or goal); associated with each Intent are Methods, by which the Intent is realized, and Constraints, which limit the Intent. The Methods and Constraints can themselves be treated as objects and decomposed into lower-level Intents (hence the procedure is known as functional decomposition) so giving rise to a hierarchical, object-oriented structure. The plant level hazard identification is carried out on the plant functional model using the Concept Hazard Analysis method. In this, the user will be supported by checklists and keywords and the analysis is structured by pre-defined worksheets. The preparation of the plant functional model and the performance of the hazard identification can be carried out manually or with computer support. (au) (4 tabs., 10 ills., 7 refs.)

  12. Plant-Based Vaccines: Production and Challenges

    Directory of Open Access Journals (Sweden)

    Erna Laere

    2016-01-01

    Full Text Available Plant-based vaccine technologies involve the integration of the desired genes encoding the antigen protein for specific disease into the genome of plant tissues by various methods. Agrobacterium-mediated gene transfer and transformation via genetically modified plant virus are the common methods that have been used to produce effective vaccines. Nevertheless, with the advancement of science and technology, new approaches have been developed to increase the efficiency of former methods such as biolistic, electroporation, agroinfiltration, sonication, and polyethylene glycol treatment. Even though plant-based vaccines provide many benefits to the vaccine industry, there are still challenges that limit the rate of successful production of these third-generation vaccines. Even with all the limitations, continuous efforts are still ongoing in order to produce efficient vaccine for many human and animals related diseases owing to its great potentials. This paper reviews the existing conventional methods as well as the development efforts by researchers in order to improve the production of plant-based vaccines. Several challenges encountered during and after the production process were also discussed.

  13. Techno-economic analysis of CHP system supplied by waste forest biomass.

    Science.gov (United States)

    Borsukiewicz-Gozdur, A; Klonowicz, P; Król, D; Wiśniewski, S; Zwarycz-Makles, K

    2015-08-01

    Poland, as for Europe, is a country with an average forest cover of approximately 30%. In these forests, more than 37M m3 of wood, mostly coniferous (over 80%), is harvested per year. In 2012, 4.2M m3 of sawn timber was produced (sawn timber without factory lumber). At the same time, in Poland there are over 8000 sawmills, whereas only about 700 of them saw over 90% of the harvested timber. So much fragmentation is a major cause of low sawmills innovation, particularly of those small ones. However, in recent years, a trend of development in this sector is noticeable, and it is through rationalisation of material and energy economy. One of the methods to increase the technical and economic effectiveness of enterprises involved in woodworking is to build in the combined heat and power system (CHP) plant with the ORC system into the existing infrastructure, which will be matched to the needs of the company. This article presents an analysis of the profitability of the investment based on the example of a medium-sized company sawing approximately 50,000 m3 of timber per year, and the economic analysis was performed for prices and costs valid in Poland. The analysis made for the 1650 kW(el) organic Rankine cycle (ORC) system, has resulted in a profitability index PI = 1.3, on the assumptions that the ORC system operates for 6000 h y(-1), will be purchased at the price of 4500 € kW(el)(-1) and at the price of electricity sales of 130 € MWh(-1). PMID:26142426

  14. Molecular Characterization of a Bacteriophage (Chp2) from Chlamydia psittaci

    OpenAIRE

    Liu, B. L.; Everson, J. S.; Fane, B.; Giannikopoulou, P.; Vretou, E.; Lambden, P R; Clarke, I N

    2000-01-01

    Comparisons of the proteome of abortifacient Chlamydia psittaci isolates from sheep by two-dimensional gel electrophoresis identified a novel abundant protein with a molecular mass of 61.4 kDa and an isoelectric point of 6.41. C-terminal sequence analysis of this protein yielded a short peptide sequence that had an identical match to the viral coat protein (VP1) of the avian chlamydiaphage Chp1. Electron microscope studies revealed the presence of a 25-nm-diameter bacteriophage (Chp2) with no...

  15. Modelling the Italian household sector at the municipal scale: Micro-CHP, renewables and energy efficiency

    International Nuclear Information System (INIS)

    This study investigates the potential of energy efficiency, renewables, and micro-cogeneration to reduce household consumption in a medium Italian town and analyses the scope for municipal local policies. The study also investigates the effects of tourist flows on town's energy consumption by modelling energy scenarios for permanent and summer homes. Two long-term energy scenarios (to 2030) were modelled using the MarkAL-TIMES generator model: BAU (business as usual), which is the reference scenario, and EHS (exemplary household sector), which involves targets of penetration for renewables and micro-cogeneration. The analysis demonstrated the critical role of end-use energy efficiency in curbing residential consumption. Cogeneration and renewables (PV (photovoltaic) and solar thermal panels) were proven to be valuable solutions to reduce the energetic and environmental burden of the household sector (−20% in 2030). Because most of household energy demand is ascribable to space-heating or hot water production, this study finds that micro-CHP technologies with lower power-to-heat ratios (mainly, Stirling engines and microturbines) show a higher diffusion, as do solar thermal devices. The spread of micro-cogeneration implies a global reduction of primary energy but involves the internalisation of the primary energy, and consequently CO2 emissions, previously consumed in a centralised power plant within the municipality boundaries. - Highlights: • Energy consumption in permanent homes can be reduced by 20% in 2030. • High efficiency appliances have different effect according to their market penetration. • Use of electrical heat pumps shift consumption from natural gas to electricity. • Micro-CHP entails a global reduction of energy consumption but greater local emissions. • The main CHP technologies entering the residential market are Stirling and μ-turbines

  16. Anuário Investigação CHP 2008

    OpenAIRE

    DEFI

    2011-01-01

    Documenta-se a produção científica do Centro Hospitalar do Porto (CHP) apresentando os artigos da autoria ou co-autoria dos profissionais das três instituições nele integradas (Hospital de Santo António, HSA; Hospital Maria Pia, HMP; Maternidade Júlio Dinis, MJD) publicados em revistas científicas, durante o ano 2008.1 A listagem foi elaborada pelo Departamento de Ensino, Formação e Investigação (DEFI), com base em pesquisas em bases de dados bibliográficos. Consideram-se se...

  17. Toxin-antitoxin loci as stress-response-elements: ChpAK/MazF and ChpBK cleave translated RNAs and are counteracted by tmRNA

    DEFF Research Database (Denmark)

    Christensen, S.K.; Pedersen, K.; Hansen, Flemming G.;

    2003-01-01

    Prokaryotic chromosomes encode toxin-antitoxin loci, often in multiple copies. In most cases, the function of these genes is not known. The chpA (mazEF) locus of Escherichia coli has been described as a cell killing module that induces bacterial apoptosis during nutritional stress. However, we...... found recently that ChpAK (MazF) does not confer cell killing but rather, induces a bacteriostatic condition from which the cells could be resuscitated. Results presented here yield a mechanistic explanation for the detrimental effect on cell growth exerted by ChpAK and the homologous ChpBK protein of E....... coli. We show that both proteins inhibit translation by inducing cleavage of translated mRNAs. Consistently, the inhibitory effect of the proteins was counteracted by tmRNA. Amino acid starvation induced strong transcription of chpA that depended on Lon protease but not on ppGpp. Simultaneously, Chp...

  18. Licensed bases management for advanced nuclear plants

    International Nuclear Information System (INIS)

    Prospective Advanced Nuclear Plant (ANP) owners must have high confidence that the integrity of the licensed bases (LB) of a plant will be effectively maintained over its life cycle. Currently, licensing engineers use text retrieval systems, database managers, and checklists to access, update, and maintain vast and disparate licensing information libraries. This paper describes the demonstration of a ''twin-engine'' approach that integrates a program from the emerging class of concept searching tools with a modern Product Data Management System (PDMS) to enhance the management of LB information for an example ANP design. (author)

  19. 3D-animaation käyttö CHP-voimalan visualisoinnissa : esimerkkinä GASEK CHP

    OpenAIRE

    Muilu, Jaakko

    2012-01-01

    Opinnäytetyön tavoitteena oli suunnitella ja toteuttaa GASEK Oy:lle animaatio kolmiulotteisella grafiikalla. Animaation tarkoitus oli esitellä GASEK Oy:n CHP-voimalaitosta, jossa sekapuuhakkeesta tuotetaan lämpöä ja sähköä. Työn pääpainona oli visualisoida CHP-voimalassa tapahtuva kaasutusprosessi ja puukaasun virtaus laitteistossa. Opinnäytetyön käytännön osuuksiin kuuluivat animaation suunnittelu, toteutus ja videon luominen. The aim of the thesis was to plan and produce an animatio...

  20. Results from tests of a Stirling engine and wood chips gasifier plant

    DEFF Research Database (Denmark)

    Carlsen, Henrik; Bovin, Jonas Kabell; Werling, J.;

    2002-01-01

    The combination of thermal gasification and a Stirling engine is an interesting concept for use in small Combined Heat and Power (CHP) plants based on biomass, because the need for gas cleaning is eliminated and problems with fouling of the Stirling engine heater are considerably reduced....... Furthermore, the overall electric efficiency of the system can be improved. At the Technical University of Denmark a small CHP plant based on a Stirling engine and an updraft gasifier has been developed and tested successfully. The advantages of updraft gasifiers are the simplicity and that the amount...... of the Stirling engine reduces the problems with tar to a minor problem in the design of the burner. The Stirling engine, which has an electric power output of 35 kW, is specifically designed for utilisation of fuels with a content of particles. The gas burner for the engine is designed for low specific energy...

  1. Influence of Maintenance Intervals on Performance and Emissions of a 192 kWel Biogas Gas Otto CHP Unit and Results of Lubricating Oil Quality Tests—Outcome from a Continuous Two-Year Measuring Campaign

    Directory of Open Access Journals (Sweden)

    Thomas Jungbluth

    2013-06-01

    Full Text Available In the present work, we focus on long-term and permanent measurements of approximately two years on a 192 kWel Gas Otto CHP (combined heat and power unit at a full-scale research biogas plant. In detail the influence of 600 h and 1800 h maintenance intervals on electrical efficiency consumption and exhaust gas emissions such as NOx and CO have been studied under real life conditions. Lubricating oil quality analyses throughout the CHP operation time are presented to show the destructive changes in property and its influence on condition based maintenance. The results confirm the well-known fact that after readjustment of the air-fuel ratio after 1800 h maintenance the emission values for NOx decline while CO increases. The emission-optimized operation mode leads to lower engine efficiency. The maintenance tasks carried out at 600 h intervals lead to lower NOx emissions in nine cases while in 14 cases the emissions remained unchanged. The permanent measurements proved their legitimacy showing various emission deviations from the limiting values prior and post maintenance. The results show that by monitoring the lubricating oil quality, the oil change intervals can be maximized while ensuring that engine performance is not endangered, and a longer engine lifespan can be expected. The oil analyses allow the operator to reduce maintenance expenditures while minimizing wear.

  2. Optimal Design and Operation of A Syngas-fuelled SOFC Micro-CHP System for Residential Applications in Different Climate Zones in China

    DEFF Research Database (Denmark)

    Yang, Wenyuan; Liso, Vincenzo; Zhao, Yingru

    2013-01-01

    Energy consumption in residential sector can be considerably reduced by enhancing the efficiency of energy supply. Fuel cell-based residential micro-CHP systems are expected to be one of the most promising technologies because of their high efficiency and low environmental impact. Since the design...... of a 70m2 single-family household with an average number of occupants of 3 is evaluated. Detailed model of the micro-CHP unit coupled with a hot water storage tank and an auxiliary boiler is developed. A transient model of the hot water storage tank is used to take into account the effect of peak...

  3. Optimal design and operation of a syngas-fuelled SOFC micro CHP system for residential applications in different climate zones in China

    OpenAIRE

    Yang, Wenyuan; Zhao, Yingru; Liso, Vincenzo; BRANDON, Nigel

    2014-01-01

    Fuel cell based micro-CHP systems are expected to be one of the most promising technologies for implementation in the residential sector. Since the design and operation of such CHP systems are greatly dependent upon the seasonal atmospheric conditions, it is important to evaluate their performance under difference climate conditions to ensure that it is well matched with the local heat-to-power ratio. The aim of this study is to investigate the optimal design and operation of a syngas-fuelled...

  4. CHP-II: The Carnegie Hubble Program to Measure Ho to 3% Using Population II

    Science.gov (United States)

    Rich, Jeffrey; Freedman, Wendy L.; Madore, Barry F.; Monson, Andy; Scowcroft, Victoria; Beaton, Rachael; Kollmeier, Juna A.; Seibert, Mark; Bono, Giuseppe; Clementini, Gisella; Yang, Soung-Chul; Lee, Myung Gyoon; Jang, In Sung

    2015-01-01

    There has been great progress in the measurement of cosmological parameters in recent years, but controversy has arisen over the Planck/WMAP versus the direct measurement of the Hubble constant. The goal of our Carnegie Hubble Program (CHP) is to obtain a direct measure of Ho to 3%. In CHP I, we used Cepheid variables to calibrate the extragalactic distance scale. In the second phase, CHP II, we are establishing a completely independent route to Ho using RR Lyrae variables, the tip of the red giant branch (TRGB) and Type Ia supernovae (SNe Ia). Not only is the RR Lyrae route independent of the Cepheids, but its PL relation has a scatter that is a factor of 2 smaller. Unlike the Cepheids, the RR Lyrae / TRGB distance scale can be applied to both elliptical and spiral galaxies. This is a great systematic advantage, given the small number of galaxies (9 in total) close enough to have measured Cepheid calibrators within the SNIa hosts. By providing a new calibration using a Pop II distance scale, we will immediately double the number of SN Ia distances based on geometry, linking to over 200 SNe in the pure Hubble flow out to z = 0.7. Four calibrators containing both Cepheids and TRGB stars provide an important cross-check on systematics. Initially, the accuracy of our value of Ho will be set by four galactic RR Lyrae calibrators with HST/FGS parallaxes. With Gaia, both the RR Lyrae zero point and TRGB method will be independently calibrated with at least an order of magnitude more calibrators, each having precisions of 1% or better. This will allow the highest accuracy measurement of Ho to date using the "Distance Ladder" method.

  5. Feasibility study of a Thermo-Photo-Voltaic system for CHP application in residential buildings

    International Nuclear Information System (INIS)

    Highlights: ► The profitability of Thermo-Photo-Voltaic generator systems for a single-family dwelling is analyzed. ► Heat and electricity load profiles depending on hour of the day are considered for an entire year. ► The effect of Thermo-Photo-Voltaic generator size is evaluated for different household utilities. ► Results allow to identify the conditions for the energetic and economic convenience of Thermo-Photo-Voltaic system. -- Abstract: The growing demand of energy coupled with an increasing attention to the environmental impact have forced, in the last decades, toward the study and the development of new strategies in order to reduce primary energy consumptions. The cogeneration (CHP) and the on-site generation (also known as distributed generation) could be the key strategy to achieve this goal; CHP systems allow to reduce the fuel consumption and pollutant emissions (in particular the greenhouse gases) compared to separate generation; moreover on-site-generation contributes to the reduction of the energy which is lost in electricity transmission, and increases the security in the energy supply. In this scenario the Thermo-Photo-Voltaic generation (TPV) is obtaining an increasing attention; TPV is a system to convert into electrical energy the radiation emitted from an artificial heat source (i.e. the combustion of fuel) by the use of photovoltaic cells. A domestic gas furnace based on this technology can provide the entire thermal need of an apartment and can also contributes to satisfy the electrical demand. The aim of this study is the understanding of the behavior of a TPV in CHP application in case of residential buildings, under both the energetic and economical point of view; in particular a parametrical analysis is developed and discussed varying the TPV electrical efficiency, the thermal request and the apartment typology.

  6. Plant-based Rasayana drugs from Ayurveda.

    Science.gov (United States)

    Balasubramani, Subramani Paranthaman; Venkatasubramanian, Padma; Kukkupuni, Subrahmanya Kumar; Patwardhan, Bhushan

    2011-02-01

    Rasayana tantra is one of the eight specialties of Ayurveda. It is a specialized practice in the form of rejuvenative recipes, dietary regimen, special health promoting behaviour and drugs. Properly administered Rasayana can bestow the human being with several benefits like longevity, memory, intelligence, freedom from diseases, youthful age, excellence of luster, complexion and voice, optimum strength of physique and sense organs, respectability and brilliance. Various types of plant based Rasayana recipes are mentioned in Ayurveda. Review of the current literature available on Rasayanas indicates that anti-oxidant and immunomodulation are the most studied activities of the Rasayana drugs. Querying in Pubmed database on Rasayanas reveals that single plants as well as poly herbal formulations have been researched on. This article reviews the basics of Rasayana therapy and the published research on different Rasayana drugs for specific health conditions. It also provides the possible directions for future research. PMID:21390573

  7. [Transgenics - Plant-Based Drugs (PBD)].

    Science.gov (United States)

    Rocha, Daniele Rachidi da; Marin, Victor Augustus

    2011-07-01

    Plant-Based Drugs - PBD - represent the 4(th) generation of genetically-modified plants and in this case the technology is used to develop and produce pharmaceuticals vaccines and/or products from transgenic seeds. This technology, like all scientific innovations, has inherent risks. However, the current knowledge available about the use of this technology means that no firm conclusions can be drawn about the nature of the risks involved, as well as their significance and the likelihood of causing serious damage or not. Risk analysis should be the starting premise prior to any implementation of techno-scientific innovations. The parameters must be evaluated and precautions taken and research must be conducted in a detailed and broad-ranging manner with respect to the potential risks of any innovation. This article analyzed the applicability of this new technology, as well as risk management and containment in order to guarantee safe use, handling and consumption by human beings. PMID:21808921

  8. Risk-based plant performance indicators

    International Nuclear Information System (INIS)

    Tasked by the 1979 President's Commission on the Accident at Three Mile Island, the U.S. nuclear power industry has put into place a performance indicator program as one means for showing a demonstrable record of achievement. Largely through the efforts of the Institute of Nuclear Power Operations (INPO), plant performance data has, since 1983, been collected and analyzed to aid utility management in measuring their plants' performance progress. The U.S. Nuclear Regulatory Commission (NRC) has also developed a set of performance indicators. This program, conducted by NRC's Office for the Analysis and Evaluation of Operational Data (AEOD), is structured to present information on plant operational performance in a manner that could enhance the staff's ability to recognize changes in the safety performance. Both organizations recognized that performance indicators have limitations and could be subject to misinterpretation and misuse with the potential for an adverse impact on safety. This paper reports on performance indicators presently in use, e.g., unplanned automatic scrams, unplanned safety system actuation, safety system failures, etc., which are logically related to safety. But, a reliability/risk-based method for evaluating either individual indicators or an aggregated set of indicators is not yet available

  9. Contribution to a Danish action plan for development and demonstration of CHP from solid biomass; Oplaeg til en national handlingsplan for udvikling og demonstration indenfor kraftvarme fra fast biomasse

    Energy Technology Data Exchange (ETDEWEB)

    Hansen, Morten Tony

    2011-01-15

    The report is the contribution from the industry to an action plan for development and demonstration of CHP technology for solid biomass. The report aims to serve as inspiration and basis for administrators and applicants of Danish funding schemes for development and demonstration in future tenders. Although Danish-based cogeneration technologies for solid biofuels are advanced compared to the competitors in many areas there is a large need to continuously improve the technology by sustained development and demonstration activities. The aim is to overcome the technological barriers that this project has identified and thus maintain competitiveness. The industry currently has very strong focus on market deployment of especially technologies for cogeneration in small scale (up to 15 MW thermal power) and on the overall economy of these plants. Reference installations that displays many operational hours with a reasonable economy, are crucial for investors. Currently, no companies market commercial plants that have sufficiently low costs to operate under Danish conditions and few do for the conditions found internationally. Thus, from the industry perspective there is still a need for development and demonstration of CHP technology below 15 MW thermal. The analysis does not exclude any technology tracks, but the development and demonstration efforts should lead to improvements in conditions such as availability, efficiencies and operating and maintenance costs. Also technologies for large plants and systems need to be improved with respect to availability and efficiency and reduced operating and maintenance costs. For all technologies, there is a need to develop the use of special solid biofuels that on the one hand may have troublesome characteristics but on the other may help lower operating costs. The Danish-based companies have good opportunities to find support for the development and demonstration effort. A number of support programs and pools are in place and

  10. Cost-benefit analysis for combined heat and power plant

    International Nuclear Information System (INIS)

    The paper presents a methodology and practical application of Cost-Benefit Analysis for Combined Heat and Power Plant (Cogeneration facility). Methodology include up-to-date and real data for cogeneration plant in accordance with the trends ill development of the CHP technology. As a case study a CHP plant that could be built-up in Republic of Macedonia is analyzed. The main economic parameters for project evaluation, such as NPV and IRR are calculated for a number of possible scenarios. The analyze present the economic outputs that could be used as a decision for CHP project acceptance for investment. (Author)

  11. Dicty_cDB: CHP418 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available genome. 32 0.013 27 CJ482405 |CJ482405.1 Macaca fascicularis mRNA, clone: QtrA-18375, 5' end, expressed in brain tem...HRP ESIEVDKGLQTVNRLMDLTDAVFRMHNSIVSATPYNDCKTSAFI--- ---wmhwlnkltlkelkprrni*rmvliwmmllnvnywlplkplkmlqthywpqnqrelq rrrvihqmllrqslrll...d pieces. 40 0.86 5 dna update 2005. 9.28 Homology vs Protein Score E Sequences producing significant ali...1( AB023655 |pid:none) Dictyostelium discoideum talB mRNA... 152 4e-35 ( P54633 ) RecName: Full=Talin-A; AltName: Full=Filopo...brane 4.0 %: vesicles of secretory system >> prediction for CHP418 is nuc 5' end seq. ID CHP41

  12. Trial operation of a phosphoric acid fuel cell (PC25) for CHP applications in Europe

    Energy Technology Data Exchange (ETDEWEB)

    Uhrig, M.; Droste, W.; Wolf, D. [Ruhrgas AG, Dorsten (Germany)

    1996-12-31

    In Europe, ten 200 kW phosphoric acid fuel cells (PAFCs) produced by ONSI (PC25) are currently in operation. Their operators collaborate closely in the European Fuel Cell Users Group (EFCUG). The experience gained from trial operation by the four German operators - HEAG, HGW/HEW, Thyssengas and Ruhrgas - coincides with that of the other European operators. This experience can generally be regarded as favourable. With a view to using fuel cells in combined heat and power generation (CHP), the project described in this report, which was carried out in cooperation with the municipal utility of Bochum and Gasunie of the Netherlands, aimed at gaining experience with the PC 25 in field operation under the specific operating conditions prevailing in Europe. The work packages included heat-controlled operation, examination of plant behavior with varying gas properties and measurement of emissions under dynamic load conditions. The project received EU funding under the JOULE programme.

  13. Multiple Sequence Elements Facilitate Chp Rho GTPase Subcellular Location, Membrane Association, and Transforming Activity

    OpenAIRE

    Chenette, Emily J.; Mitin, Natalia Y.; Der, Channing J.

    2006-01-01

    Cdc42 homologous protein (Chp) is a member of the Rho family of small GTPases and shares significant sequence and functional similarity with Cdc42. However, unlike classical Rho GTPases, we recently found that Chp depends on palmitoylation, rather than prenylation, for association with cellular membranes. Because palmitoylation alone is typically not sufficient to promote membrane association, we evaluated the possibility that other carboxy-terminal residues facilitate Chp subcellular associa...

  14. Translating Hardware Process Algebras into Standard Process Algebras : Illustration with CHP and LOTOS

    OpenAIRE

    Salaün, Gwen; Serwe, Wendelin

    2005-01-01

    A natural approach for the description of asynchronous hardware designs are hardware process algebras, such as Martin's CHP (Communicating Hardware Processes), Tangram, or BALSA, which are extensions of standard process algebras with particular operators exploiting the implementation of synchronisation using handshake protocols. In this research report, we give a structural operational semantics for value-passing CHP. Compared to existing semantics of CHP defined by translation into Petri net...

  15. CHP2 gene expression and quantitation in Egyptian patients with acute leukemia

    OpenAIRE

    Amira Ahmed Hammam; Hisham Hasan Eissa; Mohamed Roshdy El Masry; Sarah Mahmoud

    2014-01-01

    Aim: CHP2 (calcineurin B homologous protein 2) is identified as a tumor-associated antigen highly expressed in different malignancies. It plays a critical role in cancer cell development, proliferation, motility and survival. It is suggested that the human tumor related gene CHP2 expression in leukemia primary cells and leukemia cell lines significantly increase, which may play an important role in growth process of leukemia cells. Methods: In this study, the expression of CHP2 gene was an...

  16. A chromodomain protein, Chp1, is required for the establishment of heterochromatin in fission yeast

    OpenAIRE

    Sadaie, Mahito; Iida, Tetsushi; URANO, TAKESHI; Nakayama, Jun-ichi

    2004-01-01

    The chromodomain is a conserved motif that functions in the epigenetic control of gene expression. Here, we report the functional characterization of a chromodomain protein, Chp1, in the heterochromatin assembly in fission yeast. We show that Chp1 is a structural component of three heterochromatic regions—centromeres, the mating-type region, and telomeres—and that its localization in these regions is dependent on the histone methyltransferase Clr4. Although deletion of the chp1+ gene causes c...

  17. Preparation of Yeast Hydrolysate Enriched in Cyclo-His-Pro (CHP) by Enzymatic Hydrolysis and Evaluation of Its Functionality

    OpenAIRE

    Lee, Hyun Jung; Son, Heung Soo; Park, Chung; Suh, Hyung Joo

    2015-01-01

    In this study, we attempted to enrich cyclo-His-Pro (CHP) using enzymatic hydrolysis of yeast and to evaluate the functionality of yeast hydrolysate (YH)-enriched CHP. Flavourzyme offered a better performance in enhancing CHP content than other proteases. The CHP enrichment conditions were optimized as follows: addition of 1% Flavourzyme, 48-h incubation at 60°C, and pH 6.0. The CHP content significantly increased by 20-fold after ultra-filtration (UF). Maximal CHP translation was obtained af...

  18. Developing a Model for a CHP System with Storage

    Directory of Open Access Journals (Sweden)

    M. Abunku

    2016-04-01

    Full Text Available A model for a Combined Heat and Power (CHP system developed using Matlab is presented in this project. The model developed includes sub-models of Internal Combustion Engine (ICE and generator, electrical and thermal storage systems, and power converters (rectifier and inverter. The model developed is able to simulate the performance of a CHP system when supplying user load. The battery electrical storage system is modelled and used as the electrical storage for this project, and the water storage tank is modelled and used as thermal storage. The project presents the model developed, and the results of the analysis done on the model. The model considered only heat from engine cooling, which is used to heat water to supply the DHW (District Hot Water needs of the user. The results show that by the addition of storage to the CHP system, the overall system efficiency is increased by 32% indicating that the model developed is reliable, and the project is a feasible one

  19. Space Heating Load Estimation Procedure for CHP Systems sizing

    Science.gov (United States)

    Vocale, P.; Pagliarini, G.; Rainieri, S.

    2015-11-01

    Due to its environmental and energy benefits, the Combined Heat and Power (CHP) represents certainly an important measure to improve energy efficiency of buildings. Since the energy performance of the CHP systems strongly depends on the fraction of the useful cogenerated heat (i.e. the cogenerated heat that is actually used to meet building thermal demand), in building applications of CHP, it is necessary to know the space heating and cooling loads profile to optimise the system efficiency. When the heating load profile is unknown or difficult to calculate with a sufficient accuracy, as may occur for existing buildings, it can be estimated from the cumulated energy uses by adopting the loads estimation procedure (h-LEP). With the aim to evaluate the useful fraction of the cogenerated heat for different operating conditions in terms of buildings characteristics, weather data and system capacity, the h-LEP is here implemented with a single climate variable: the hourly average dry- bulb temperature. The proposed procedure have been validated resorting to the TRNSYS simulation tool. The results, obtained by considering a building for hospital use, reveal that the useful fraction of the cogenerated heat can be estimated with an average accuracy of ± 3%, within the range of operative conditions considered in the present study.

  20. Analysis of gas turbine integrated cogeneration plant: Process integration approach

    International Nuclear Information System (INIS)

    Cogeneration is defined as generation of two forms of energy viz. heat and work using single primary fuel. Cogeneration or combined heat and power (CHP) is important in improving energy efficiency of the overall plant and in reducing environmental pollution. A methodology, based on pinch analysis, is proposed in this paper to integrate gas turbine and regenerator with a process plant to minimize fuel consumption. Thermodynamic analysis of gas turbine integrated CHP plant is presented on gas turbine pressure ratio versus power to heat ratio diagram. On this novel diagram, limits of integration are identified and various regions of integration are represented. Additionally, contour plots of energy utilization factors and fuel energy saving ratios are represented on this diagram for optimal integration of gas turbine with a process plant. It is interesting to note that though the contour plots of energy utilization factors and fuel energy saving ratios differ significantly, loci of the maximal energy utilization factor and the maximal fuel energy saving ratio are identical. Optimum sizing of gas turbine integrated cogeneration plant for grassroots design and retrofitting are performed based on these diagrams. - Highlights: • Methodology for direct integration of gas turbine, regenerator, and process plant. • Integrated system analysis plotted on turbine pressure ratio vs. power to heat ratio. • Regions of integration are identified on this new diagram. • Variations of energy utilization factor and fuel energy saving ratio are indicated. • Optimal sizing of integrated gas turbine for retrofitting and grassroots design

  1. Global GPP based on Plant Functional Types

    Science.gov (United States)

    Veroustraete, Frank; Balzarolo, Manuela

    2016-04-01

    Vegetation variables like Gross Primary productivity (GPP) and the Normalized Difference Vegetation Index (NDVI) are key variables in vegetation carbon exchange studies. Field measurements of the NDVI are time consuming due to landscape heterogeneity across time. Typically a sampling protocol adopted during field campaigns is based on the VALERI protocol in that case toe estimate LAI. Field campaign GPP or NDVI measurements can be scaled up to using in-situ FLUXNET radiation raster maps. Regression analysis can then be applied to construct transfer functions for the determination of GPP raster maps raster imagery from Normalized Difference Vegetation Index (NDVI) raster maps derived from in-situ FLUXNET radiation raster maps. Subsequently, in the VALERI approach the scaling up of raster maps is performed by aggregation of high resolution in-situ FLUXNET radiation raster maps data into high resolution raster maps and subsequently aggregating these to 1x1 km MODIS NDVI raster maps by calculating average NDVI values for the low resolution data. The up-scaled 1x1 km pixels are then used to validate the MODIS GPP and NVI products. Hence up scaling based on in-situ FLUXNET radiation measurements are not a luxury for large and heterogeneous sites. Therefore this paper tackles the problem of up scaling using in-situ FLUXNET radiation measurements. Key Words: FLUXNET, GPP, Plant Functional Types, Up-scaling

  2. A Pilot Evaluation of Small Group Challenging Horizons Program (CHP): A Randomized Trial

    Science.gov (United States)

    Langberg, Joshua M.; Smith, Bradley H.; Bogle, Kristin E.; Schmidt, Jonathan D.; Cole, Wesley R.; Pender, Carolyn A. S.

    2007-01-01

    This study examined the efficacy of an after-school program, the Challenging Horizons Program (CHP), that met four days a week and focused on improving organization, academic skills, and classroom behavior. The CHP was compared with a community control that included involvement in a district-run after-school program that met one to three days a…

  3. A closed-form expression for the optimal capacity of CHP

    OpenAIRE

    Arie ten Cate

    2009-01-01

    In this memorandum the optimal capacity of Combined Heat and Power (CHP) is derived, using a simple model with an analytical solution. The solution is expressed as the fraction of the time during which the heat demand exceeds the optimal CHP heat production capacity.

  4. Mississippi State University Cooling, Heating, and Power (Micro-CHP) and Bio-Fuel Center

    Energy Technology Data Exchange (ETDEWEB)

    Mago, Pedro [Mississippi State Univ., Mississippi State, MS (United States); Newell, LeLe [Mississippi State Univ., Mississippi State, MS (United States)

    2014-01-31

    Between 2008 and 2014, the U.S. Department of Energy funded the MSU Micro-CHP and Bio-Fuel Center located at Mississippi State University. The overall objective of this project was to enable micro-CHP (micro-combined heat and power) utilization, to facilitate and promote the use of CHP systems and to educate architects, engineers, and agricultural producers and scientists on the benefits of CHP systems. Therefore, the work of the Center focused on the three areas: CHP system modeling and optimization, outreach, and research. In general, the results obtained from this project demonstrated that CHP systems are attractive because they can provide energy, environmental, and economic benefits. Some of these benefits include the potential to reduce operational cost, carbon dioxide emissions, primary energy consumption, and power reliability during electric grid disruptions. The knowledge disseminated in numerous journal and conference papers from the outcomes of this project is beneficial to engineers, architects, agricultural producers, scientists and the public in general who are interested in CHP technology and applications. In addition, more than 48 graduate students and 23 undergraduate students, benefited from the training and research performed in the MSU Micro-CHP and Bio-Fuel Center.

  5. Image-Based Modeling of Plants and Trees

    CERN Document Server

    Kang, Sing Bang

    2009-01-01

    Plants and trees are among the most complex natural objects. Much work has been done attempting to model them, with varying degrees of success. In this book, we review the various approaches in computer graphics, which we categorize as rule-based, image-based, and sketch-based methods. We describe our approaches for modeling plants and trees using images. Image-based approaches have the distinct advantage that the resulting model inherits the realistic shape and complexity of a real plant or tree. We use different techniques for modeling plants (with relatively large leaves) and trees (with re

  6. Savukaasujen hiilidioksidin talteenottoprosessin vaikutukset olemassa olevaan monipolttoaine-CHP-voimalaitokseen

    OpenAIRE

    Keskitalo, E. (Esa)

    2013-01-01

    Kasvihuonepäästöjen rajoittaminen on yksi tämän hetken suurista haasteista. Suomi on EU:n jäsenmaana sitoutunut vähentämään kasvihuonepäästöjä 20 % vuoteen 2020 mennessä. Tästä osuudesta on tavoitteena saada talteen 10 % hiilen talteenotto- ja varastointimenetelmien (CCS) avulla. Diplomityön tarkoituksena oli tutkia, mitä teknisiä ratkaisuja on olemassa hiilidioksidin talteenotolle monipolttoaine-CHP-voimalaitoksen savukaasuista. Teoriaosiossa käytiin ensin läpi yleisellä tasolla CO2:n ta...

  7. Fast Visual Modeling for Plant Based on Real Images

    Institute of Scientific and Technical Information of China (English)

    LI Yun-feng; ZHU Qing-sheng; CAO Yu-kun; LIU Yin-bin; HE Xi-ping

    2004-01-01

    Structures of natural plants are complex and difficult to model. This paper proposes a fast visual modeling for plants based on a small set of images, and establishes a reasonable plant model.Based on knowledge about growth patterns of the plant, image segmentation and 3D reconstruction are first performed to construct the plant skeleton (trunk and major branches), from which the remainder of the plant grows. Then the system produces the realistic plant model images based on image synthesis and validation. It is unnecessary to acquire the complex structure (such as the complex production rules of L-systems). The method provides a high degree of control over the final shape by image validation,resulting in realistic reconstruction.

  8. Fast Construction of Plant Architectural Models Based on Substructure Decomposition

    Institute of Scientific and Technical Information of China (English)

    YAN HongPing (严红平); Philippe de Reffye; PAN ChunHong (潘春洪); HU BaoGang (胡包钢)

    2003-01-01

    Plant structure, representing the physical link among different organs, includes many similar substructures. In this paper, a new method is presented to construct plant architectural models of most plant species. The plant structure is decomposed into a stem, a set of lateral substructures and a terminal substructure, which is called substructure decomposition; then based on substructure decomposition, the plant structures are expressed in an iterative way; and further the derivative formula is employed to compute the number of organs in plant structures to get the geometrical sizes of 3D plant organs by borrowing Hydraulic Model. Using 3D organs, a substructure library is built. Based on the substructures stored in substructure library, one can construct 3D plant structure according to certain topological and geometrical rules. The experiments with different plant species are included in this paper to demonstrate the validity of the new method for constructing plant structures. The experimental results show that the approach follows botanical knowledge with high efficiency in constructing plant structures of most plant species. In addition,this method enables users to check the detail information of plant structure.

  9. Identification of Ornamental Plant Functioned as Medicinal Plant Based on Redundant Discrete Wavelet Transformation

    Directory of Open Access Journals (Sweden)

    Kohei Arai

    2013-03-01

    Full Text Available Human has a duty to preserve the nature. One of the examples is preserving the ornamental plant. Huge economic value of plant trading, escalating esthetical value of one space and medicine efficacy that contained in a plant are some positive values from this plant. However, only few people know about its medicine efficacy. Considering the easiness to obtain and the medicine efficacy, this plant should be an initial treatment of a simple disease or option towards chemical based medicines. In order to let people get acquaint, we need a system that can proper identify this plant. Therefore, we propose to build a system based on Redundant Discrete Wavelet Transformation (RDWT through its leaf. Since its character is translation invariant that able to produce some robust features to identify ornamental plant. This system was successfully resulting 95.83% of correct classification rate.

  10. COMPARISON OF MATHEMATICAL MODELS FOR HEAT EXCHANGERS OF UNCONVENTIONAL CHP UNITS

    Directory of Open Access Journals (Sweden)

    Peter Durcansky

    2015-08-01

    Full Text Available An unconventional CHP unit with a hot air engine is designed as the primary energy source with fuel in the form of biomass. The heat source is a furnace designed for combustion of biomass, whether in the form of wood logs or pellets. The transport of energy generated by the biomass combustion to the working medium of a hot-air engine is ensured by a special heat exchanger connected to this resource. The correct operation of the hot-air engine is largely dependent on an appropriate design of the exchanger. The paper deals with the calculation of the heat exchanger for the applicationsmentioned, using criterion equations, and based on CFD simulations.

  11. Validation of a HT-PEMFC stack for CHP applications

    Energy Technology Data Exchange (ETDEWEB)

    Pasupathi, S.; Ulleberg, Oe. [Western Cape Univ. (South Africa). HySA Systems, SAIAMC; Bujlo, P. [Western Cape Univ. (South Africa). HySA Systems, SAIAMC; Electrotechnical Institute Wroclaw Division (Poland); Scholta, J. [Centre for Solar Energy and Hydrogen Research (ZSW) (Germany)

    2010-07-01

    Fuel cell systems are very attractive for stationary co-generation applications as they can produce heat and electricity efficiently in a decentralized and environmentally friendly manner. PEMFC stacks operating at temperatures above 120 C, specifically in the range of 140-180 C, are ideal for co-generation purposes. In this study, preliminary results from a HTPEMFC stack designed for CHP applications is presented and discussed. A short, five-cell, HT-PEMFC stack was assembled with Celtec- P-2100 MEAs and validated in terms of electrical performance. The stack was operated with hydrogen and air at 160 C and the utilization curves for anode and cathode were recorded for a wide range of gas utilization at a current density of 0.52 A/cm{sup 2}. The current voltage characteristic was measured at optimal utilization values at 160 C. A 1kW stack is assembled and is currently being validated for its performance under various operating conditions for use in CHP applications. (orig.)

  12. The research on Virtual Plants Growth Based on DLA Model

    Science.gov (United States)

    Zou, YunLan; Chai, Bencheng

    This article summarizes the separated Evolutionary Algorithm in fractal algorithm of Diffusion Limited Aggregation model (i.e. DLA model) and put forward the virtual plant growth realization in computer based on DLA model. The method is carried out in the VB6.0 environment to achieve and verify the plant growth based on DLA model.

  13. The economic performance of combined heat and power from biogas produced from manure in Sweden – A comparison of different CHP technologies

    International Nuclear Information System (INIS)

    Highlights: ► Interest in biogas from manure is increasing rapidly due to its climate benefits. ► Farm-scale production of CHP from manure-based biogas is not profitable in Sweden. ► Minor changes in energy prices or suggested production subsidies will make it profitable. ► Profitability is also affected by efficiency of scale and introduction of thermophilic conditions. -- Abstract: Interest in the generation of biogas from agricultural residues is increasing rapidly due to its climate benefits. In this study, an evaluation of the economic feasibility of various technologies, also on different scales, for the production of combined heat and power from manure-based biogas in Sweden is presented. The overall conclusion is that such production is not profitable under current conditions. Thus, the gap between the calculated biogas production cost and the acceptable cost for break-even must be bridged by, for example, different policy instruments. In general, efficiency of scale favors large-scale plants compared to individual farm-scale ones. However, a large, centralized biogas plant, using manure from numerous farms, is not always more cost efficient than a large, farm-scale plant treating manure from a few neighboring farms. The utilization of the produced heat, electricity prices, and political incentives, all have a significant impact on the economic outcome, whereas the value of the digestate as fertilizer is currently having a minor impact. Utilization of heat is, however, often limited by the lack of local heat sinks, in which case the implementation of a biogas process operating under thermophilic conditions could increase the profitability due to a more efficient utilization of reactor volume by using more process heat. The results from this study could be utilized by policy makers when implementing policy instruments considering biogas production from manure as well as companies involved in production and utilization of biogas.

  14. CHP expansion strategy in North Rhine-Westphalia. A blueprint for other regions

    International Nuclear Information System (INIS)

    The North Rhine-Westphalian state government intends to increase the share of combined heat and power (CHP) generation to at least 25 % by 2020. Since 2013, the campaign ''CHP.NRW - Power Meets Heat'' (''KWK.NRW - Strom trifft Waerme'') of the EnergyAgency.NRW, is has been running on behalf of the NRW Climate Protection Ministry, to publicise this technology and to promote its expansion. The campaign accompanies the State Government's CHP Stimulus Programme. The EnergyAgency.NRW has organised companies and research institutions, associations and interest groups under the umbrella of ''CHP.NRW - Power Meets Heat'', aiming at co-ordinated and intensified activities in the field of combined heat and power generation. The target of the initial-project ''roadmap/CHP.NRW'' of the ''Virtual Institute / CHP.NRW'' is to develop a guideline for the application and optimisation of CHP-systems.

  15. [Plant Spectral Discrimination Based on Phenological Features].

    Science.gov (United States)

    Zhang, Lei; Zhao, Jian-long; Jia, Kun; Li, Xiao-song

    2015-10-01

    Spectral analysis plays a significant role onplant characteristic identification and mechanism recognition, there were many papers published on the aspects of absorption features in the spectra of chlorophyll and moisture, spectral analysis onvegetation red edge effect, spectra profile feature extraction, spectra profile conversion, vegetation leaf structure and chemical composition impacts on the spectra in past years. However, fewer researches issued on spectral changes caused by plant seasonal changes of life form, chlorophyll, leaf area index. This paper studied on spectral observation of 11 plants of various life form, plant leaf structure and its size, phenological characteristics, they include deciduous forest with broad vertical leaf, needle leaf evergreen forest, needle leaf deciduous forest, deciduous forest with broadflat leaf, high shrub with big leaf, high shrub with little leaf, deciduous forest with broad little leaf, short shrub, meadow, steppe and grass. Field spectral data were observed with SVC-HR768 (Spectra Vista company, USA), the band width covers 350-2 500 nm, spectral resolution reaches 1-4 nm. The features of NDVI, spectral maximum absorption depth in green band, and spectral maximum absorption depth in red band were measured after continuum removal processing, the mean, amplitude and gradient of these features on seasonal change profile were analyzed, meanwhile, separability research on plant spectral feature of growth period and maturation period were compared. The paper presents a calculation method of separability of vegetation spectra which consider feature spatial distances. This index is carried on analysis of the vegetation discrimination. The results show that: the spectral features during plant growth period are easier to distinguish than them during maturation period. With the same features comparison, plant separability of growth period is 3 points higher than it during maturation period. The overall separabilityof vegetation

  16. Allocating resources and products in multi-hybrid multi-cogeneration: What fractions of heat and power are renewable in hybrid fossil-solar CHP?

    International Nuclear Information System (INIS)

    A general method for the allocation of resources and products in multi-resource/multi-product facilities is developed with particular reference to the important two-resource/two-product case of hybrid fossil and solar/heat and power cogeneration. For a realistic case study, we show how the method allows to assess what fractions of the power and heat should be considered as produced from the solar resource and hence identified as renewable. In the present scenario where the hybridization of fossil power plants by solar-integration is gaining increasing attention, such assessment is of great importance in the fair and balanced development of local energy policies based on granting incentives to renewables resources. The paper extends to the case of two-resource/two-product hybrid cogeneration, as well as to general multi-resource/multi-generation, three of the allocation methods already available for single-resource/two-product cogeneration and for two-resource/single-product hybrid facilities, namely, the ExRR (Exergy-based Reversible-Reference) method, the SRSPR (Single Resource Separate Production Reference) method, and the STALPR (Self-Tuned-Average-Local-Productions-Reference) method. For the case study considered we show that, unless the SRSPR reference efficiencies are constantly updated, the differences between the STALPR and SRSPR methods become important as hybrid and cogeneration plants take up large shares of the local energy production portfolio. - Highlights: • How much of the heat and power in hybrid solar-fossil cogeneration are renewable? • We define and compare three allocation methods for hybrid cogeneration. • Classical and exergy allocation are based on prescribed reference efficiencies. • Adaptive allocation is based on the actual average efficiencies in the local area. • Differences among methods grow as hybrid CHP (heat and power cogeneration) gains large market fractions

  17. The prediction of the LWR plant accident based on the measured plant data

    International Nuclear Information System (INIS)

    In case of accident affecting a nuclear reactor, it is essential to anticipate the possible development of the situation to efficiently succeed in emergency response actions, i.e. firstly to be early warned, to get sufficient information on the plant: and as far as possible. The ASTRID (Assessment of Source Term for Emergency Response based on Installation Data) project consists in developing a methodology: of expertise to; structure the work of technical teams and to facilitate cross competence communications among EP players and a qualified computer tool that could be commonly used by the European countries to reliably predict source term in case of an accident in a light water reactor, using the information available on the plant. In many accident conditions the team of analysts may be located far away from the plant experiencing the accident and their decision making is based on the on-line plant data transmitted into the crisis centre in an interval of 30 - 600 seconds. The plant condition has to be diagnosed based on this information, In the ASTRID project the plant status diagnostics has been studied for the European reactor types including BWR, PWR and VVER plants. The directly measured plant data may be used for estimations of the break size from the primary system and its locations. The break size prediction may be based on the pressurizer level, reactor vessel level, primary pressure and steam generator level in the case of the steam generator tube rupture. In the ASTRID project the break predictions concept was developed and its validity for different plant types and is presented in the paper, when the plant data has been created with the plant specific thermohydraulic simulation model. The tracking simulator attempts to follow the plant behavior on-line based on the measured plant data for the main process parameters and most important boundary conditions. When the plant state tracking fails, the plant may be experiencing an accident, and the tracking

  18. Production Planning with Respect to Uncertainties. Simulator Based Production Planning of Average Sized Combined Heat and Power Production Plants; Produktionsplanering under osaekerhet. Simulatorbaserad produktionsplanering av medelstora kraftvaermeanlaeggningar

    Energy Technology Data Exchange (ETDEWEB)

    Haeggstaahl, Daniel [Maelardalen Univ., Vaesteraas (Sweden); Dotzauer, Erik [AB Fortum, Stockholm (Sweden)

    2004-12-01

    Production planning in Combined Heat and Power (CHP) systems is considered. The focus is on development and use of mathematical models and methods. Different aspects on production planning are discussed, including weather and load predictions. Questions relevant on the different planning horizons are illuminated. The main purpose with short-term (one week) planning is to decide when to start and stop the production units, and to decide how to use the heat storage. The main conclusion from the outline of pros and cons of commercial planning software are that several are using Mixed Integer Programming (MIP). In that sense they are similar. Building a production planning model means that the planning problem is formulated as a mathematical optimization problem. The accuracy of the input data determines the practical detail level of the model. Two alternatives to the methods used in today's commercial programs are proposed: stochastic optimization and simulator-based optimization. The basic concepts of mathematical optimization are outlined. A simulator-based model for short-term planning is developed. The purpose is to minimize the production costs, depending on the heat demand in the district heating system, prices of electricity and fuels, emission taxes and fees, etc. The problem is simplified by not including any time-linking conditions. The process model is developed in IPSEpro, a heat and mass-balance software from SimTech Simulation Technology. TOMLAB, an optimization toolbox in MATLAB, is used as optimizer. Three different solvers are applied: glcFast, glcCluster and SNOPT. The link between TOMLAB and IPSEpro is accomplished using the Microsoft COM technology. MATLAB is the automation client and contains the control of IPSEpro and TOMLAB. The simulator-based model is applied to the CHP plant in Eskilstuna. Two days are chosen and analyzed. The optimized production is compared to the measured. A sensitivity analysis on how variations in outdoor

  19. The Chp1-Tas3 core is a multifunctional platform critical for gene silencing by RITS

    OpenAIRE

    Schalch, Thomas; Job, Godwin; Shanker, Sreenath; Partridge, Janet F.; Joshua-Tor, Leemor

    2011-01-01

    RNA interference (RNAi) is critical for the assembly of heterochromatin at fission yeast centromeres. Central to this process is the RNA-induced Initiation of Transcriptional gene Silencing (RITS) complex, which physically anchors small non-coding RNAs to chromatin. RITS includes Ago1, the chromodomain protein Chp1, and Tas3, which bridges between Chp1 and Ago1. Chp1 is a large protein with, apart from its chromodomain, no recognizable domains. Here we describe how the structured C-terminal h...

  20. Systems Analysis Of Advanced Coal-Based Power Plants

    Science.gov (United States)

    Ferrall, Joseph F.; Jennings, Charles N.; Pappano, Alfred W.

    1988-01-01

    Report presents appraisal of integrated coal-gasification/fuel-cell power plants. Based on study comparing fuel-cell technologies with each other and with coal-based alternatives and recommends most promising ones for research and development. Evaluates capital cost, cost of electricity, fuel consumption, and conformance with environmental standards. Analyzes sensitivity of cost of electricity to changes in fuel cost, to economic assumptions, and to level of technology. Recommends further evaluation of integrated coal-gasification/fuel-cell integrated coal-gasification/combined-cycle, and pulverized-coal-fired plants. Concludes with appendixes detailing plant-performance models, subsystem-performance parameters, performance goals, cost bases, plant-cost data sheets, and plant sensitivity to fuel-cell performance.

  1. Knowledge based system for fouling assessment of power plant boiler

    International Nuclear Information System (INIS)

    The paper presents the design of an expert system for fouling assessment in power plant boilers. It is an on-line expert system based on selected criteria for the fouling assessment. Using criteria for fouling assessment based on 'clean' and 'not-clean' radiation heat flux measurements, the diagnostic variable are defined for the boiler heat transfer surface. The development of the prototype knowledge-based system for fouling assessment in power plants boiler comprise the integrations of the elements including knowledge base, inference procedure and prototype configuration. Demonstration of the prototype knowledge-based system for fouling assessment was performed on the Sines power plant. It is a 300 MW coal fired power plant. 12 fields are used with 3 on each side of boiler

  2. Supporting plant operation through computer-based procedures

    International Nuclear Information System (INIS)

    Digital Systems are becoming more important in controlling and monitoring nuclear power plant operations. The capabilities of these systems provide additional functions as well as support operators in making decisions and avoiding errors. Regarding Operation Support Systems, an important way of taking advantage of these features is using computer-based procedures (CBPs) tools that enhance the plant operation. Integrating digital systems in analogue controls at nuclear power plants in operation becomes an extra challenge, in contrast to the integration of Digital Control Systems in new nuclear power plants. Considering the potential advantages of using this technology, Tecnatom has designed and developed a CBP platform taking currently operating nuclear power plants as its design basis. The result is a powerful tool which combines the advantages of CBPs and the conventional analogue control systems minimizing negative effects during plant operation and integrating operation aid-systems to support operators. (authors)

  3. Possible Future SOFC - ST Based Power Plants

    DEFF Research Database (Denmark)

    Rokni, Masoud; Scappin, Fabio

    2009-01-01

    Hybrid systems consisting Solid Oxide Fuel Cell (SOFC) on the top of a Steam Turbine (ST) are investigated. The plants are fired by natural gas. A desulfurization reactor removes the sulfur content in the NG while a pre-reformer break down the heavier hydrocarbons. The pre-treated fuel enters then...... into the anode side of the SOFC. The gases from the SOFC stacks enter into a burner to burn the rest of the fuel. The off-gases now enter into a heat recovery steam generator to produce steam for a Rankine cycle. Different system setups are considered. Cyclic efficiencies up to 67% are achieved which...

  4. Development of a Packaged and Integrated Microturbine/ Chiller Combined Heat and Power (CHP) System

    Energy Technology Data Exchange (ETDEWEB)

    None

    2009-03-01

    This factsheet describes a research project whose goal is to define, develop, integrate, and validate at full scale the technology for a 1 MWe, microturbine-driven CHP packaged system for industrial or large commercial applications.

  5. Connection of small RES and CHP power generation units to the electricity systems

    International Nuclear Information System (INIS)

    The EU member states have to ensure to the producers of 'green' electricity guaranteed access to the electrical grid including for small installations - Directive (2001/77/EC) of EC. For this reason the European Commission (EC) supports the project 'Production of Electricity with RES and CHP for Homeowners' - PERCH, in the framework of the program 'Intelligent Energy - Europe'. In the report the issues of connection (technical, contractual, tariff and metering) are investigated for small installations using RES and micro CHP, which are owned by individual family houses, small enterprises, etc. It is pointed out that small installations, mainly PV-systems, wind generators and small CHP, as well as combination of these technologies are rapidly applied on the European market. In Bulgaria the application of small PV-systems and wind generators, as well as CHP at present is limited. The elements for encouragement of such systems are defined, as well as the barriers for their wider application. (author)

  6. Simulation Based Data Reconciliation for Monitoring Power Plant Efficiency

    International Nuclear Information System (INIS)

    Power plant efficiency is analyzed by using measured values, mass/energy balance principles, and several correlations. Since the measured values can have uncertainty depending on the accuracy of instrumentation, the results of plant efficiency should definitely have uncertainty. The certainty may occur due to either the randomness or the malfunctions of a process. In order to improve the accuracy of efficiency analysis, the data reconciliation (DR) is expected as a good candidate because the mathematical algorithm of the DR is based on the first principles such as mass and energy balance considering the uncertainty of instrumentation. It should be noted that the mass and energy balance model for analyzing power plant efficiency is equivalent to a steady-state simulation of a plant system. Therefore the DR for efficiency analysis necessitates the simulation which can deal with the uncertainty of instrumentation. This study will propose the algorithm of the simulation based DR which is applicable to power plant efficiency monitoring

  7. Performance-based pricing for nuclear power plants

    International Nuclear Information System (INIS)

    State public utility commissions in the United States have implemented incentive regulations to promote the operating efficiency of nuclear power plants. This paper surveys these incentive programs, focusing on the performance-based pricing approach. Our findings suggest that the performance-based price should be set between the electric utility's avoided cost and the marginal cost of generating electricity at the nuclear power plant. 18 refs., 1 fig., 1 tab

  8. Energie-Cites opinion on the directive project of CHP. To meet urban energy requirements with optimal energy efficiency and production closer to residents

    International Nuclear Information System (INIS)

    The Directive on ''the promotion of cogeneration based on a useful heat demand in the internal energy market'' should be adopted very soon. The initial aim of the Directive is to strengthen existing measures to promote CHP in line with the Community target of doubling the share of CHP in EU electricity generation from 9% in 1994 to 18% by 2010. But no target has been mentioned. Energie-Cites states, in this document, its opinion of this draft proposal. Cogeneration is a well-tried and proven technology which has achieved tangible results and is one of the more efficient ways for the EU to fulfill the commitments it made under the Kyoto Protocol. (A.L.B.)

  9. Air CHP, a new concept in small-scale space heating

    Energy Technology Data Exchange (ETDEWEB)

    Mullins, P.

    1996-10-01

    A new type of combined heat and power (CHP) system claimed to be capable of providing electrical and thermal power with efficiencies in the region of 95% is being marketed by Aircogen Ltd, a company launched by turbine and compressor manufacturer Peter Brotherhood. Power generation capabilities range from 50 to 1500 kW. VarityPerkins has played a large part in supplying spark-ignited gas engines for the first installations of this new system from the group`s plants in Stafford and Shrewsbury, U.K. Aircogen has developed a system in which the air for heating the building is heated direct from the gen-set. This provides a further source of extracted heat and contributes to the extremely high thermal efficiencies. The system lends itself particularly to swimming pools, supermarkets, leisure centers, or any building where large spaces need to be heated for prolonged periods and where normally low-pressure hot water heating would be used. This paper describes briefly the design, specifications and typical applications.

  10. Thermodynamic Analysis of a Ship Power Plant Operating with Waste Heat Recovery through Combined Heat and Power Production

    OpenAIRE

    Mirko Grljušić; Vladimir Medica; Nikola Račić

    2014-01-01

    The goal of this research is to study a cogeneration plant for combined heat & power (CHP) production that utilises the low-temperature waste energy in the power plant of a Suezmax-size oil tanker for all heating and electricity requirements during navigation. After considering various configurations, a standard propulsion engine operating at maximum efficiency and a CHP Plant with R245fa fluid using a supercritical organic Rankine cycle (ORC) is selected. All the ship heat requirements ...

  11. Metal-based nanotoxicity and detoxification pathways in higher plants.

    Science.gov (United States)

    Ma, Chuanxin; White, Jason C; Dhankher, Om Parkash; Xing, Baoshan

    2015-06-16

    The potential risks from metal-based nanoparticles (NPs) in the environment have increased with the rapidly rising demand for and use of nanoenabled consumer products. Plant's central roles in ecosystem function and food chain integrity ensure intimate contact with water and soil systems, both of which are considered sinks for NPs accumulation. In this review, we document phytotoxicity caused by metal-based NPs exposure at physiological, biochemical, and molecular levels. Although the exact mechanisms of plant defense against nanotoxicity are unclear, several relevant studies have been recently published. Possible detoxification pathways that might enable plant resistance to oxidative stress and facilitate NPs detoxification are reviewed herein. Given the importance of understanding the effects and implications of metal-based NPs on plants, future research should focus on the following: (1) addressing key knowledge gaps in understanding molecular and biochemical responses of plants to NPs stress through global transcriptome, proteome, and metablome assays; (2) designing long-term experiments under field conditions at realistic exposure concentrations to investigate the impact of metal-based NPs on edible crops and the resulting implications to the food chain and to human health; and (3) establishing an impact assessment to evaluate the effects of metal-based NPs on plants with regard to ecosystem structure and function. PMID:25974388

  12. Knowledge based diagnostics in nuclear power plants

    International Nuclear Information System (INIS)

    In the paper to be given a special process diagnostic system (PDS) will be presented, taking into account corresponding user experiences. It must be seen the result of a long term work on computerized process surveillance and control on NPP; it includes a model based system for noise analysis of mechanical vibrations, which has been enhanced by using of knowledge based technique (expert systems). The paper will discuss the process diagnostic frame concept and emphasize the vibration analysis expertsystem RADEX, with the parts modelling (building a knowledge base), man-machine communication aspects, implementation. (author). 5 refs, 5 figs

  13. Modelling a Combined Heat and Power Plant based on Gasification, Micro Gas Turbine and Solid Oxide Fuel Cells

    DEFF Research Database (Denmark)

    Bang-Møller, Christian; Rokni, Masoud

    A system level modelling study on two combined heat and power (CHP) systems both based on biomass gasification. One system converts the product gas in a micro gas turbine (MGT) and the other in a combined solid oxide fuel cell (SOFC) and MGT arrangement. An electrochemical model of the SOFC has...... more efficient than the MGT reflected in the electrical efficiency of the gasifier and MGT system in opposition to the gasifier and SOFC-MGT configuration - η_el=28.1% versus η_el=50.3%....

  14. Optimized raw material usage and utilization degree in a polygeneration plant for heat, electricity, biofuel and market fuel; Optimal raavaruinsats och utnyttjandegrad i energikombinat foer vaerme, el, biodrivmedel och avsalubraensle

    Energy Technology Data Exchange (ETDEWEB)

    Jennie Rodin; Olle Wennberg; Mikael Berntsson; Rolf Njurell; Ola Thorson

    2012-01-15

    Energy and economic efficiency for six different types of energy combines which include heat, electricity, pellets and fuel production have been studied. The basic case is a conventional power plant, which subsequently is expanded with various additional facilities (dryer, pellets and/or fuel). Maximum exploitation of the product against inserted biofuel was obtained in case 6, pulp mills that use waste heat for district heating supply and drying of bark. Case 6 had also the lowest payoff period; two years. Of the CHP [combined heat and power] based energy combines 'the big combine' with four different products generally showed best marginal efficiency and economy. The results indicate that drying may be an economical way to extend the operating season and increase the production of electricity in a CHP based energy combine.

  15. Multimedia-based Medicinal Plants Sustainability Management System

    CERN Document Server

    Omogbadegun, Zacchaeus; Ayo, Charles; Mbarika, Victor; Omoregbe, Nicholas; Otofia, Efe; Chieze, Frank

    2011-01-01

    Medicinal plants are increasingly recognized worldwide as an alternative source of efficacious and inexpensive medications to synthetic chemo-therapeutic compound. Rapid declining wild stocks of medicinal plants accompanied by adulteration and species substitutions reduce their efficacy, quality and safety. Consequently, the low accessibility to and non-affordability of orthodox medicine costs by rural dwellers to be healthy and economically productive further threaten their life expectancy. Finding comprehensive information on medicinal plants of conservation concern at a global level has been difficult. This has created a gap between computing technologies' promises and expectations in the healing process under complementary and alternative medicine. This paper presents the design and implementation of a Multimedia-based Medicinal Plants Sustainability Management System addressing these concerns. Medicinal plants' details for designing the system were collected through semi-structured interviews and databas...

  16. Operation reliability analysis of independent power plants of gas-transmission system distant production facilities

    OpenAIRE

    Piskunov Maksim V.; Voytkov Ivan S.; Vysokomornaya Olga V.; Vysokomorny Vladimir S.

    2015-01-01

    The new approach was developed to analyze the failure causes in operation of linear facilities independent power supply sources (mini-CHP-plants) of gas-transmission system in Eastern part of Russia. Triggering conditions of ceiling operation substance temperature at condenser output were determined with mathematical simulation use of unsteady heat and mass transfer processes in condenser of mini-CHP-plants. Under these conditions the failure probability in operation of independent power supp...

  17. Maintenance of Ni-based alloy at PWR plant

    International Nuclear Information System (INIS)

    Kansai Electric owns 11 PWR plants. At our PWR plants, we are taking various preventive maintenance measures on Ni-based alloy according to the prediction of possible trouble while past trouble occurred at overseas plants due to Primary Water Stress Corrosion Cracking (PWSCC) being considered. In addition, we are making an effort to put new maintenance techniques into practical use by conducting demonstration tests to confirm their applicability to actual plants. We have replaced reactor vessel heads at 7 plants with new ones. At the other 4 plants, we took, measures to reduce the temperature of reactor vessel head top to delay the timing of PWSCC occurrence. We are carrying out the constant load tests to predict the timing of PWSCC occurrence at these 4 plants. It is planned to conduct non-destructive inspections at an appropriate timing based on the result of the prediction. Based on the prediction of the timing of PWSCC occurrence at bottom-mounted instrumentation (BMI), we have developed water jet peening (WJP) technique to reduce residual stress and applied the technique to our plants successively. Meanwhile, a technique to cut and eliminate cracking has been developed. In addition, capping technique, which covers overall the concerned nozzle on the outer surface of the reactor vessel, has been also established. For alloy 132/82 weld metal for the connection, we are conducting ultrasonic inspection at our plants successively. In order to prepare against PWSCC occurrence, we have also established a technique to replace the entire section of concerned short piping with new one. (author)

  18. Satellite combined heat and power plants and their legal autonomy

    International Nuclear Information System (INIS)

    Since the landmark decision by the German Court of Justice concerning the term ''plant'' in the context of biogas plants it should be clear beyond doubt that satellite combined heat and power plants (CHPs) are legally autonomous plants pursuant to Para. 3 No. 1 of the Renewable Energy Law (EEG). What has yet to be finally resolved are the conditions under which satellite CHPs are to be regarded as autonomous. This will be a question of distance on the one hand and of operation autonomy on the other. In the individual case both these factors will have to be assessed from the perspective of an average objective, informed citizen. To the extent that its heat and electricity are being utilised in a meaningful manner, the plant's autonomy will be beyond doubt, at least in operational terms. Regarding the remuneration to be paid for satellite CHPs the only case requiring special consideration is when a CHP falls under the EEG of 2012. In this case Para. 1 Section 1 Sentence 2 EEG provides that the remuneration for the CHP in question is to be calculated as if there was a single overall plant. To the extent that none of the CHPs fall under the EEG of 2012, the ruling remains that there is a separate entitlement to remuneration for each satellite CHP. This also holds in cases where satellite CHPs that were commissioned after 1 January 2012 are relocated. When a satellite CHP is replaced by a new one, the rate and duration of remuneration remain unchanged. However, when a new satellite CHP is added to an existing satellite CHP via a gas collector line it is to be treated according to the decisions of the Federal Court of Justice concerning biogas plant extensions: It falls under the law that applies to the existing CHP and has an entitlement to a new minimum remuneration period, albeit subject to the degression rate provided by the EEG version in question.

  19. Crystal structure of CHP2 complexed with NHE1-cytosolic region and an implication for pH regulation

    OpenAIRE

    Ammar, Youssef Ben; Takeda, Soichi; Hisamitsu, Takashi; Mori, Hidezo; Wakabayashi, Shigeo

    2006-01-01

    The plasma membrane Na+/H+ exchangers (NHE) require calcineurin B homologous protein (CHP) as an obligatory binding partner for ion transport. Here, we report the first crystal structure of CHP (CHP2 isoform) in complex with its binding domain in NHE1. We show that the cytoplasmic α-helix of NHE1 is inserted into the hydrophobic cleft formed by N- and C-lobes of CHP2 and that the size and shape of this crevice together with hydrogen bond formation at multiple positions assure a high degree of...

  20. Toxicity of a plant based mosquito repellent/killer

    OpenAIRE

    Singh, Bhoopendra; Singh, Prakash Raj; Mohanty, Manoj Kumar

    2012-01-01

    The mission to make humans less attractive to mosquitoes has fuelled decades of scientific research on mosquito behaviour and control. The search for the perfect topical insect repellent/killer continues. This analysis was conducted to review and explore the scientific information on toxicity produced by the ingredients/contents of a herbal product. In this process of systemic review the following methodology was applied. By doing a MEDLINE search with key words of selected plants, plant base...

  1. New Candidates for Plant-Based Repellents Against Aedes aegypti.

    Science.gov (United States)

    Misni, Norashiqin; Nor, Zurainee Mohamed; Ahmad, Rohani

    2016-06-01

    Based on an ethnobotanical study on use for plant species against mosquito bites in the Kota Tinggi District, Johor State, Malaysia, 3 plants selected for study, Citrus aurantifolia (leaves), Citrus grandis (fruit peel), and Alpinia galanga (rhizome), were extracted using hydrodistillation to produce essential oils. These essential oils were then formulated as a lotion using a microencapsulation process and then tested for their repellent effect against Aedes aegypti. N,N-diethyl-m-toluamide (deet) was also prepared in the same formulation and tested for repellency as controls. Four commercial plant-based repellent (KAPS(®), MozAway(®), BioZ Natural(®), and Mosiquard(®)) also were incorporated in the bioassay for comparison purposes. Bioassays revealed that at 20% concentration all repellent formulations demonstrated complete protection for 2 h and >90% for 4 h post-application. The A. galanga-based formulation provided the greatest level of protection (98.91%), which extended for 4 h post-application and was not significantly different from deet at similar concentration. When compared with commercial plant-based repellents (KAPS(®), MozAway(®), and BioZ Natural(®)), the 3 lotion formulations showed significantly better protection against Ae. aegypti bites, providing >90% protection for 4 h. In conclusion, our 3 plant-based lotion formulations provided acceptable levels of protection against host-seeking Ae. aegypti and should be developed. PMID:27280349

  2. Fault Diagnosis Strategies for SOFC-Based Power Generation Plants

    Directory of Open Access Journals (Sweden)

    Paola Costamagna

    2016-08-01

    Full Text Available The success of distributed power generation by plants based on solid oxide fuel cells (SOFCs is hindered by reliability problems that can be mitigated through an effective fault detection and isolation (FDI system. However, the numerous operating conditions under which such plants can operate and the random size of the possible faults make identifying damaged plant components starting from the physical variables measured in the plant very difficult. In this context, we assess two classical FDI strategies (model-based with fault signature matrix and data-driven with statistical classification and the combination of them. For this assessment, a quantitative model of the SOFC-based plant, which is able to simulate regular and faulty conditions, is used. Moreover, a hybrid approach based on the random forest (RF classification method is introduced to address the discrimination of regular and faulty situations due to its practical advantages. Working with a common dataset, the FDI performances obtained using the aforementioned strategies, with different sets of monitored variables, are observed and compared. We conclude that the hybrid FDI strategy, realized by combining a model-based scheme with a statistical classifier, outperforms the other strategies. In addition, the inclusion of two physical variables that should be measured inside the SOFCs can significantly improve the FDI performance, despite the actual difficulty in performing such measurements.

  3. 76 FR 65165 - Importation of Plants for Planting; Risk-Based Sampling and Inspection Approach and Propagative...

    Science.gov (United States)

    2011-10-20

    ..., to be planted or replanted. The definition of plant in that section includes any plant (including any... October 17, 2011. The risk-based sampling will be implemented following further analysis of the sampling... planting infested with quarantine pests do not enter the United States, while providing a...

  4. [Frost-resistance of subtropical evergreen woody plants: an evaluation based on plant functional traits].

    Science.gov (United States)

    Xu, Yi-Lu; Yang, Xiao-Dong; Xu, Yue; Xie, Yi-Ming; Wang, Liang-Yan; Yan, En-Rong

    2012-12-01

    Evaluating the frost-resistance of evergreen woody plants is of significance in guiding the species selection in forest management in subtropical region. In this paper, an investigation was made on the functional traits (including specific leaf area, stem wood density, leaf area, leaf dry matter content, leaf relative electrical conductance, and twig wood density) of 64 common evergreen broad-leaved and coniferous woody plant species in the Ningbo region of Zhejiang Province, East China, after a severe snowstorm in early 2008, aimed to select the evergreen woody plants with high ability of freeze-tolerance, and to establish a related evaluation system. By using a hierarchy analysis approach, the weight values of the functional traits of each species were determined, and an index system for evaluating the plants tolerance ability against freeze and mechanical damage was established. Based on this system, 23 evergreen plant species with high tolerance ability against freeze and mechanical damage, such as Cyclobalanopsis gilva, Cyclobalanopsis nubium, Neolitsea aurata, and Vacciniuim mandarinorum, were selected. In the meantime, on the basis of the ordering with each of the functional traits, the ordering of the tolerance ability of the 64 plant species against freeze and mechanical damage was made, and a list for the frost-resistance ability of the subtropical evergreen woody plant species in Ningbo region was constituted. PMID:23479868

  5. Fracture mechanics based life assessment in petrochemical plants

    International Nuclear Information System (INIS)

    The increasing use of thick walled pressure vessels in petrochemical plants operating at high pressure under severe service conditions could lead to catastrophic failure. In the Malaysian Institute for Nuclear Technology Research (MINT), initial efforts are underway to apply fracture mechanics approach for assessment of significance of defects detected during periodic in service inspection (ISI) of industrial plants. This paper outlines the integrity management strategy based on fracture mechanics and proposes a new procedure for life assessment of petrochemical plants based on ASME Boiler and Pressure Vessel Code, Section XI, BSI PD 6493:1991, BSI 6539:1994, BSI Standard 7910:1999 and API 579:2000. Essential relevant data required for the assessment is listed. Several methods available for determination of fracture toughness are reviewed with limitations in their application to petrochemical plants. A new non destructive method for determination of fracture toughness based on hardness testing and normalized key roughness curve is given. Results of fracture mechanics based life assessment conducted for 100 mm thick ammonia converter of Ni r o steel and 70 mm thick plat forming reactor vessel of ASTM A 38 7 grade B steel in operational fertilizer and petroleum refining plants are presented. (Author)

  6. Physics-based Prognostics for Optimizing Plant Operation

    International Nuclear Information System (INIS)

    Scientists at the Pacific Northwest National Laboratory (PNNL) have examined the necessity for optimization of energy plant operation using ?DSOM? ? Decision Support Operation and Maintenance and this has been deployed at several sites. This approach has been expanded to include a prognostics component and tested on a pilot scale service water system, modeled on the design employed in a nuclear power plant. A key element in plant optimization is understanding and controlling the aging process of both safety-specific nuclear plant components and the infrastructure that supports these processes. This paper reports the development and demonstration of a physics-based approach to prognostic analysis that combines distributed computing, RF data links, the measurement of aging precursor metrics and their correlation with degradation rate and projected machine failure

  7. Photoprotection in Plants Optical Screening-based Mechanisms

    CERN Document Server

    Solovchenko, Alexei

    2010-01-01

    Optical screening of excessive and potentially harmful solar radiation is an important photoprotective mechanism, though it has received much less attention in comparison with other systems preventing photooxidative damage to photoautotrophic organisms. This photoprotection in the form of screening appears to be especially important for juvenile and senescing plants as well as under environmental stresses—i.e. in situations where the efficiency of enzymatic ROS elimination, DNA repair and other ‘classical’ photoprotective systems could be impaired. This book represents an attempt to develop an integral view of optical screening-based photoprotection in microalgae and higher plants. Towards this end, the key groups of pigments involved in the screening of ultraviolet and visible components of solar radiation in microalgae and higher plants, and the patterns of their accumulation and distribution within plant cells and tissues, are described. Special attention is paid to the manifestations of screening pi...

  8. Manufactured soils for plant growth at a lunar base

    Science.gov (United States)

    Ming, Douglas W.

    1989-01-01

    Advantages and disadvantages of synthetic soils are discussed. It is pointed out that synthetic soils may provide the proper physical and chemical properties necessary to maximize plant growth, such as a toxic-free composition and cation exchange capacities. The importance of nutrient retention, aeration, moisture retention, and mechanical support as qualities for synthetic soils are stressed. Zeoponics, or the cultivation of plants in zeolite substrates that both contain essential plant-growth cations on their exchange sites and have minor amounts of mineral phases and/or anion-exchange resins that supply essential plant growth ions, is discussed. It is suggested that synthetic zeolites at lunar bases could provide adsorption media for separation of various gases, act as catalysts and as molecular sieves, and serve as cation exchangers in sewage-effluent treatment, radioactive-waste disposal, and pollution control. A flow chart of a potential zeoponics system illustrates this process.

  9. Physics-Based Prognostics for Optimizing Plant Operation

    Energy Technology Data Exchange (ETDEWEB)

    Leonard J. Bond; Don B. Jarrell

    2005-03-01

    Scientists at the Pacific Northwest National Laboratory (PNNL) have examined the necessity for optimization of energy plant operation using 'DSOM{reg_sign}'--Decision Support Operation and Maintenance and this has been deployed at several sites. This approach has been expanded to include a prognostics components and tested on a pilot scale service water system, modeled on the design employed in a nuclear power plant. A key element in plant optimization is understanding and controlling the aging process of safety-specific nuclear plant components. This paper reports the development and demonstration of a physics-based approach to prognostic analysis that combines distributed computing, RF data links, the measurement of aging precursor metrics and their correlation with degradation rate and projected machine failure.

  10. AI-based alarm processing for a nuclear power plant

    International Nuclear Information System (INIS)

    A real-time expert system is implemented using artificial intelligence and object-oriented technology for alarm processing and presentation in a nuclear power plant. The knowledge base is constructed based on some schemes to process and display alarms to the plant operators. The activated alarms are dynamically prioritized by the reasoning rules, and then, presented on the process mimic overview and by some other means. To demonstrate the proposed system, the alarm processing and presentation is carried out in a simulated environment of the TMI-2 accident

  11. Desiccant HVAC system driven by a micro-CHP: Experimental analysis

    Energy Technology Data Exchange (ETDEWEB)

    Angrisani, Giovanni; Roselli, Carlo; Sasso, Maurizio [Universita degli Studi del Sannio, Dipartimento di Ingegneria, Piazza Roma 21, Benevento, 82100 (Italy); Minichiello, Francesco [Universita degli Studi di Napoli Federico II, DETEC, P.le Tecchio 80, Napoli, 80125 (Italy)

    2010-11-15

    In the Mediterranean area, there is increase in demand for summer cooling satisfied by electrically driven units in domestic and small commercial sectors; this involves electric peak loads and black-outs. Consequently, there is an increasing interest in small scale polygeneration systems fuelled by natural gas. In this paper, attention is paid to a test facility, located in Southern Italy, to carry out experimental analysis on a small scale polygeneration system based on a natural gas-fired Micro-CHP and a desiccant HVAC system. The MCHP provides thermal power, recovered from engine cooling and exhaust gas, for the regeneration of the desiccant wheel and electric power for the chiller, the auxiliaries and the external units (computers, lights, etc.). The HVAC system can also operate in traditional way, by interacting with electric grid and gas-fired boiler. An overview of the main experimental results is shown, considering both the desiccant wheel and the global polygeneration system. The experimental results confirm that the performances of the desiccant wheel are strongly influenced by outdoor thermal-hygrometric air properties and regeneration temperature. The polygeneration system guarantees primary energy savings up to 21.2% and greenhouse-gas emissions reductions up to 38.6% with respect to conventional HVAC systems based on separate energy ''production''. (author)

  12. Techno-economic analysis of using corn stover to supply heat and power to a corn ethanol plant - Part 2: Cost of heat and power generation systems

    Energy Technology Data Exchange (ETDEWEB)

    Mani, Sudhagar [University of Georgia; Sokhansanj, Shahabaddine [ORNL; Togore, Sam [U.S. Department of Energy; Turhollow Jr, Anthony F [ORNL

    2010-03-01

    This paper presents a techno-economic analysis of corn stover fired process heating (PH) and the combined heat and power (CHP) generation systems for a typical corn ethanol plant (ethanol production capacity of 170 dam3). Discounted cash flow method was used to estimate both the capital and operating costs of each system and compared with the existing natural gas fired heating system. Environmental impact assessment of using corn stover, coal and natural gas in the heat and/or power generation systems was also evaluated. Coal fired process heating (PH) system had the lowest annual operating cost due to the low fuel cost, but had the highest environmental and human toxicity impacts. The proposed combined heat and power (CHP) generation system required about 137 Gg of corn stover to generate 9.5 MW of electricity and 52.3 MW of process heat with an overall CHP efficiency of 83.3%. Stover fired CHP system would generate an annual savings of 3.6 M$ with an payback period of 6 y. Economics of the coal fired CHP system was very attractive compared to the stover fired CHP system due to lower fuel cost. But the greenhouse gas emissions per Mg of fuel for the coal fired CHP system was 32 times higher than that of stover fired CHP system. Corn stover fired heat and power generation system for a corn ethanol plant can improve the net energy balance and add environmental benefits to the corn to ethanol biorefinery.

  13. Techno-economic analysis of using corn stover to supply heat and power to a corn ethanol plant - Part 2: Cost of heat and power generation systems

    Energy Technology Data Exchange (ETDEWEB)

    Mani, S. [Biological and Agricultural Engineering, Driftmier Engineering Center, University of Georgia, Athens, GA 30602 (United States); Sokhansanj, S.; Turhollow, A.F. [Environmental Sciences Division, Oak Ridge National Laboratory, P. O. Box 2008, Oak Ridge, TN 37831 (United States); Tagore, S. [Office of Biomass Program, U.S. Department of Energy, Washington, DC 20585 (United States)

    2010-03-15

    This paper presents a techno-economic analysis of corn stover fired process heating (PH) and the combined heat and power (CHP) generation systems for a typical corn ethanol plant (ethanol production capacity of 170 dam{sup 3}). Discounted cash flow method was used to estimate both the capital and operating costs of each system and compared with the existing natural gas fired heating system. Environmental impact assessment of using corn stover, coal and natural gas in the heat and/or power generation systems was also evaluated. Coal fired process heating (PH) system had the lowest annual operating cost due to the low fuel cost, but had the highest environmental and human toxicity impacts. The proposed combined heat and power (CHP) generation system required about 137 Gg of corn stover to generate 9.5 MW of electricity and 52.3 MW of process heat with an overall CHP efficiency of 83.3%. Stover fired CHP system would generate an annual savings of 3.6 M$ with an payback period of 6 y. Economics of the coal fired CHP system was very attractive compared to the stover fired CHP system due to lower fuel cost. But the greenhouse gas emissions per Mg of fuel for the coal fired CHP system was 32 times higher than that of stover fired CHP system. Corn stover fired heat and power generation system for a corn ethanol plant can improve the net energy balance and add environmental benefits to the corn to ethanol biorefinery. (author)

  14. Techno-economic analysis of using corn stover to supply heat and power to a corn ethanol plant - Part 2: Cost of heat and power generation systems

    International Nuclear Information System (INIS)

    This paper presents a techno-economic analysis of corn stover fired process heating (PH) and the combined heat and power (CHP) generation systems for a typical corn ethanol plant (ethanol production capacity of 170 dam3). Discounted cash flow method was used to estimate both the capital and operating costs of each system and compared with the existing natural gas fired heating system. Environmental impact assessment of using corn stover, coal and natural gas in the heat and/or power generation systems was also evaluated. Coal fired process heating (PH) system had the lowest annual operating cost due to the low fuel cost, but had the highest environmental and human toxicity impacts. The proposed combined heat and power (CHP) generation system required about 137 Gg of corn stover to generate 9.5 MW of electricity and 52.3 MW of process heat with an overall CHP efficiency of 83.3%. Stover fired CHP system would generate an annual savings of 3.6 M$ with an payback period of 6 y. Economics of the coal fired CHP system was very attractive compared to the stover fired CHP system due to lower fuel cost. But the greenhouse gas emissions per Mg of fuel for the coal fired CHP system was 32 times higher than that of stover fired CHP system. Corn stover fired heat and power generation system for a corn ethanol plant can improve the net energy balance and add environmental benefits to the corn to ethanol biorefinery.

  15. PlantID – DNA-based identification of multiple medicinal plants in complex mixtures

    Directory of Open Access Journals (Sweden)

    Howard Caroline

    2012-07-01

    Full Text Available Abstract Background An efficient method for the identification of medicinal plant products is now a priority as the global demand increases. This study aims to develop a DNA-based method for the identification and authentication of plant species that can be implemented in the industry to aid compliance with regulations, based upon the economically important Hypericum perforatum L. (St John’s Wort or Guan ye Lian Qiao. Methods The ITS regions of several Hypericum species were analysed to identify the most divergent regions and PCR primers were designed to anneal specifically to these regions in the different Hypericum species. Candidate primers were selected such that the amplicon produced by each species-specific reaction differed in size. The use of fluorescently labelled primers enabled these products to be resolved by capillary electrophoresis. Results Four closely related Hypericum species were detected simultaneously and independently in one reaction. Each species could be identified individually and in any combination. The introduction of three more closely related species to the test had no effect on the results. Highly processed commercial plant material was identified, despite the potential complications of DNA degradation in such samples. Conclusion This technique can detect the presence of an expected plant material and adulterant materials in one reaction. The method could be simply applied to other medicinal plants and their problem adulterants.

  16. PlantGL: A Python-based geometric library for 3D plant modelling at different scales

    OpenAIRE

    Pradal, Christophe; Boudon, Frédéric; Nouguier, Christophe; Chopard, Jérôme; Godin, Christophe

    2009-01-01

    International audience In this paper, we present PlantGL, an open-source graphic toolkit for the creation, simulation and analysis of 3D virtual plants. This C++ geometric library is embedded in the Python language which makes it a powerful user-interactive platform for plant modeling in various biological application domains. PlantGL makes it possible to build and manipulate geometric models of plants or plant parts, ranging from tissues and organs to plant populations. Based on a scene g...

  17. Small Nuclear Co-generation Plants Based on Shipbuilding Technology

    International Nuclear Information System (INIS)

    The development of nuclear cogeneration plants and power desalination complexes of relatively small power, using proven shipbuilding technology, becomes more and more attractive for solving the power supply problems of remote districts of the Extreme North and the Far East with small and medium power grids and for removing the shortage of fresh water in different world regions. The idea of transportation of the power unit with high degree of readiness to the place of its location with minimum construction and mounting activities at the site is very attractive. Compactness typical of RP based on shipbuilding technology allows to develop floating or ground-based plants at minimum use of water area and territory. Small construction scope at the site under conditions of minimum anthropogenic loads and high ecological indices are important arguments in favor of floating nuclear cogeneration plant based on ship power units against the alternative fossil sources. At present, the activities on floating nuclear cogeneration plant design, which is developed on the basis of floating power unit with two KLT-40S reactor plant, which is a modified option of standard KLT-40-type ship plant for icebreaker fleet in Russia are the most advanced. To date, a detailed design of reactor plant has been developed and approved, design activities on floating power unit are in the stage of completion, the site for its location has been selected and licensing by GAN, Russia, is in progress. Besides OKBM has developed some designs of nuclear cogeneration plants of different power on the basis of integral reactor plants, using the experience of transport and stationary power plants designing. Nuclear cogeneration plant investment analysis showed acceptable social and economical efficiency of the design that creates conditions for commercial construction of floating power units with KLT-40S reactor plan. At the same time the reduction of the design recovering terms, increase of budget income and

  18. A methodology for sizing a trigeneration plant in mediterranean areas

    International Nuclear Information System (INIS)

    Combined heat and power production is an old and well-known technique for the rational use of energy and, thanks to more than fifty years of experience, the state of art can be considered very advanced from a technological point of view. Trigeneration, that is combined electric, heat and cooling energy production, is however a quite recent technology and is becoming economically viable thanks to the commercial spread of absorption chillers. In fact, a well-projected trigeneration plant can achieve better results than a cogenerative one. The CHCP plant benefits over CHP will be underlined, showing the effects of regularisation of annual thermal load curves generated by consumption for feeding the absorption chiller, that leads to a more effective choice of the prime mover. Traditional evaluations of CHP or CHCP plants are finalized to calculate thermodynamic efficiency, and not to examine the primary energy savings that is possible to obtain. However, lack of considerations on the methodology used for plant management can deeply influence the obtained results. It is furthermore recognised that a cogeneration or trigenerative plant must be managed in order to strictly follow thermal demand, since it is possible to sell to the public grid the excess electric energy. This study starts from the results on a energetic consumption research in the hotel sector, and in particular from the complete data on thermal and cooling consumption in several European hotels. The authors propose a general and innovative criterion on plant management and determine, on the base of the examined case-studies, some correlations which allow to size the main components of the plant, using only few data which are easy to obtain

  19. Shaking table test on base isolated FBR plant model, 1

    International Nuclear Information System (INIS)

    Shaking table test on seismically isolated FBR plant model is carried out. The model is three story steel frame structure supported by nine laminated rubber bearings which are reduced to a scale of 1/15. The effectiveness of base isolation system is verified through this study. (author)

  20. Effects of plant-based diets on plasma lipids.

    Science.gov (United States)

    Ferdowsian, Hope R; Barnard, Neal D

    2009-10-01

    Dyslipidemia is a primary risk factor for cardiovascular disease, peripheral vascular disease, and stroke. Current guidelines recommend diet as first-line therapy for patients with elevated plasma cholesterol concentrations. However, what constitutes an optimal dietary regimen remains a matter of controversy. Large prospective trials have demonstrated that populations following plant-based diets, particularly vegetarian and vegan diets, are at lower risk for ischemic heart disease mortality. The investigators therefore reviewed the published scientific research to determine the effectiveness of plant-based diets in modifying plasma lipid concentrations. Twenty-seven randomized controlled and observational trials were included. Of the 4 types of plant-based diets considered, interventions testing a combination diet (a vegetarian or vegan diet combined with nuts, soy, and/or fiber) demonstrated the greatest effects (up to 35% plasma low-density lipoprotein cholesterol reduction), followed by vegan and ovolactovegetarian diets. Interventions allowing small amounts of lean meat demonstrated less dramatic reductions in total cholesterol and low-density lipoprotein levels. In conclusion, plant-based dietary interventions are effective in lowering plasma cholesterol concentrations. PMID:19766762

  1. Procuring Stationary Fuel Cells For CHP: A Guide for Federal Facility Decision Makers

    Energy Technology Data Exchange (ETDEWEB)

    Stinton, David P [ORNL; McGervey, Joseph [SRA International, Inc.; Curran, Scott [ORNL

    2011-11-01

    Federal agency leaders are expressing growing interest in using innovative fuel cell combined heat and power (CHP) technology at their sites, motivated by both executive branch sustainability targets and a desire to lead by example in the transition to a clean energy economy. Fuel cell CHP can deliver reliable electricity and heat with 70% to 85% efficiency. Implementing this technology can be a high efficiency, clean energy solution for agencies striving to meet ambitious sustainability requirements with limited budgets. Fuel cell CHP systems can use natural gas or renewable fuels, such as biogas. Procuring Stationary Fuel Cells for CHP: A Guide for Federal Facility Decision Makers presents an overview of the process for planning and implementing a fuel cell CHP project in a concise, step-by-step format. This guide is designed to help agency leaders turn their interest in fuel cell technology into successful installations. This guide concentrates on larger (100 kW and greater) fuel cell CHP systems and does not consider other fuel cell applications such as cars, forklifts, backup power supplies or small generators (<100 kW). Because fuel cell technologies are rapidly evolving and have high up front costs, their deployment poses unique challenges. The electrical and thermal output of the CHP system must be integrated with the building s energy systems. Innovative financing mechanisms allow agencies to make a make versus buy decision to maximize savings. This guide outlines methods that federal agencies may use to procure fuel cell CHP systems with little or no capital investment. Each agency and division, however, has its own set of procurement procedures. This guide was written as a starting point, and it defers to the reader s set of rules if differences exist. The fuel cell industry is maturing, and project developers are gaining experience in working with federal agencies. Technology improvements, cost reductions, and experienced project developers are making

  2. Modeling of non-linear CHP efficiency curves in distributed energy systems

    DEFF Research Database (Denmark)

    Milan, Christian; Stadler, Michael; Cardoso, Gonçalo;

    2015-01-01

    Distributed energy resources gain an increased importance in commercial and industrial building design. Combined heat and power (CHP) units are considered as one of the key technologies for cost and emission reduction in buildings. In order to make optimal decisions on investment and operation for...... approaches are formulated using binary and Special-Ordered-Set (SOS) variables. Both suggestions have been implemented into the optimization model DER–CAM to simulate investment decisions of CHP micro-turbines and CHP fuel cells with variable efficiencies. The approaches have further been applied...... promising method to model variable efficiencies in terms of computational costs and results. It should especially be considered for specific fuel cell technologies. Further investigation on the impacts of this approach on the prediction of fuel cell and micro-turbine performance is suggested....

  3. Modeling work of a small scale gasifier/SOFC CHP system

    Energy Technology Data Exchange (ETDEWEB)

    Liu, M.; Aravind, P.V.; Qu, Z.; Woudstra, N.; Verkooijen, A.H.M. [Delft University of Technology (Netherlands). Dept. of Mechanical Engineering], Emails: ming.liu@tudelft.nl, p.v.aravind@tudelft.nl, z.qu@tudelft.nl, n.woudstra@tudelft.nl, a. h. m. verkooijen@tudelft.nl; Cobas, V.R.M. [Federal University of Itajuba (UNIFEI), Pinheirinhos, MG (Brazil). Dept. of Mechanical Engineering], E-mail: vlad@unifei.edu.br

    2009-07-01

    For a highly efficient biomass gasification/Solid Oxide Fuel Cell (SOFC) Combined Heat and Power (CHP) generation system, the gasifier, the accompanying gas cleaning technologies and the CHP unit must be carefully designed as an integrated unit. This paper describes such a system involving a two-stage fixed-bed down draft gasifier, a SOFC CHP unit and a gas cleaning system. A gas cleaning system with both low temperature and high temperature sections is proposed for coupling the gasifier and the SOFC. Thermodynamic modeling was carried out for the gasifier/SOFC system with the proposed gas cleaning system. The net AC electrical efficiency of this system is around 30% and the overall system efficiency is around 60%. This paper also describes various exergy losses in the system and the future plans for integrated gasifier-GCU-SOFC experiments from which the results will be used to validate the modeling results of this system. (author)

  4. Model-based reasoning and the control of process plants

    International Nuclear Information System (INIS)

    In addition to feedback control, safe and economic operation of industrial process plants requires discrete-event type logic control like for example automatic control sequences, interlocks, etc. A lot of complex routine reasoning is involved in the design and verification and validation (VandV) of such automatics. Similar reasoning tasks are encountered during plant operation in action planning and fault diagnosis. The low-level part of the required problem solving is so straightforward that it could be accomplished by a computer if only there were plant models which allow versatile mechanised reasoning. Such plant models and corresponding inference algorithms are the main subject of this report. Deep knowledge and qualitative modelling play an essential role in this work. Deep knowledge refers to mechanised reasoning based on the first principles of the phenomena in the problem domain. Qualitative modelling refers to knowledge representation formalism and related reasoning methods which allow solving problems on an abstraction level higher than for example traditional simulation and optimisation. Prolog is a commonly used platform for artificial intelligence (Al) applications. Constraint logic languages like CLP(R) and Prolog-III extend the scope of logic programming to numeric problem solving. In addition they allow a programming style which often reduces the computational complexity significantly. An approach to model-based reasoning implemented in constraint logic programming language CLP(R) is presented. The approach is based on some of the principles of QSIM, an algorithm for qualitative simulation. It is discussed how model-based reasoning can be applied in the design and VandV of plant automatics and in action planning during plant operation. A prototype tool called ISIR is discussed and some initial results obtained during the development of the tool are presented. The results presented originate from preliminary test results of the prototype obtained

  5. Plant-based fertilizers for organic vegetable production

    DEFF Research Database (Denmark)

    Sørensen, Jørn Nygaard; Thorup-Kristensen, Kristian

    2011-01-01

    To ensure high yield and quality in organic vegetable production, crops often require additional fertilizer applied during the season. Due to the risk of contamination of edible plant products from slurry, plant-based fertilizers may be used as an alternative. The purpose of our work was to develop...... fertility, the term “mobile green manures” is used for green-manure crops that are harvested in one field and then moved as a whole and used as fertilizer in other fields. To further investigate mobile-green-manure crops for use as efficient fertilizers, pot and field experiments were conducted with...

  6. Large combined heat and power plants in sustainable energy systems

    DEFF Research Database (Denmark)

    Lund, Rasmus Søgaard; Mathiesen, Brian Vad

    2015-01-01

    In many countries, the electricity supply and power plant operation are challenged by increasing amounts of fluctuating renewable energy sources. A smart energy system should be developed to integrate as much energy supply from fluctuating renewable sources and to utilise the scarce biomass...... resources as efficiently as possible. Using the advanced energy systems analysis tool EnergyPLAN and Denmark as a case, this analysis defines which of the three assessed types of CHP plants connected to district heating systems is most feasible in terms of total socioeconomic costs and biomass consumption....... It is concluded that the CCGT CHP plant is the most feasible both from a technical analysis and a market economic analysis with electricity exchange. It is found that the current economic framework for large CHP plants in Denmark generates a mismatch between socio economy and business economy as well...

  7. Laser Vision-Based Plant Geometries Computation in Greenhouses

    Directory of Open Access Journals (Sweden)

    Yu Zhang

    2014-04-01

    Full Text Available Plant growth statuses are important parameters in the greenhouse environment control system. It is time-consumed and less accuracy that measuring the plant geometries manually in greenhouses. To find a portable method to measure the growth parameters of plants portably and automatically, a laser vision-based measurement system was developed in this paper, consisting of a camera and a laser sheet that scanned the plant vertically. All equipments were mounted on a metal shelf in size of 30cm*40cm*100cm. The 3D point cloud was obtained with the laser sheet scanning the plant vertically, while the camera videoing the laser lines which projected on the plant. The calibration was conducted by a two solid boards standing together in an angle of 90. The camera’s internal and external parameters were calibrated by Image toolbox in MatLab®. It is useful to take a reference image without laser light and to use difference images to obtain the laser line. Laser line centers were extracted by improved centroid method. Thus, we obtained the 3D point cloud structure of the sample plant. For leaf length measurement, iteration method for point clouds was used to extract the axis of the leaf point cloud set. Start point was selected at the end of the leaf point cloud set as the first point of the leaf axis. The points in a radian of certain distance around the start point were chosen as the subset. The centroid of the subset of points was calculated and taken as the next axis point. Iteration was continued until all points in the leaf point cloud set were selected. Leaf length was calculated by curve fitting on these axis points. In order to increase the accuracy of curve fitting, bi-directional start point selection was useful. For leaf area estimation, exponential regression model was used to describe the grown leaves for sampled plant (water spinach in this paper. To evaluate the method in a sample of 18 water spinaches, planted in the greenhouse (length 16

  8. A price mechanism for supply demand matching in local grid of households with micro-CHP

    Science.gov (United States)

    Larsen, G. K. H.; van Foreest, N. D.; Scherpen, J. M. A.

    2012-10-01

    This paper describes a dynamic price mechanism to coordinate eletric power generation from micro Combined Heat and Power (micro-CHP) systems in a network of households. It is assumed that the households are prosumers, i.e. both producers and consumers of electricity. The control is done on household level in a completely distributed manner. Avoiding a centralized controller both eases computation complexity and preserves communication structure in the network. Local information is used to decide to turn on or off the micro-CHP, but through price signals between the prosumers the network as a whole operates in a cooperative way.

  9. A price mechanism for supply demand matching in local grid of households with micro-CHP

    Directory of Open Access Journals (Sweden)

    Scherpen J. M. A.

    2012-10-01

    Full Text Available This paper describes a dynamic price mechanism to coordinate eletric power generation from micro Combined Heat and Power (micro-CHP systems in a network of households. It is assumed that the households are prosumers, i.e. both producers and consumers of electricity. The control is done on household level in a completely distributed manner. Avoiding a centralized controller both eases computation complexity and preserves communication structure in the network. Local information is used to decide to turn on or off the micro-CHP, but through price signals between the prosumers the network as a whole operates in a cooperative way.

  10. Introduction of nuclear power plant based on reliability centered maintenance

    International Nuclear Information System (INIS)

    A maintenance program based on RCM (reliability centered maintenance) is used by many countries and increased safety, reliability and economy of plants. RCM and its application conditions to the nuclear power plants in USA and introduction conditions for Japan are explained. The present situation of maintenance and change of maintenance technologies in the world is stated. RCM is the best tool for working out the maintenance program. The basic approach is selection of system and the sphere of activity, identification of accident mode and causes by the FFA (functional failure analysis) and the FMEA (failure modes and effects analysis), and selection of the effective maintenance method for accident mode by the LTA (logic tree analysis) and optimization of maintenance. The maintenance of nuclear power plants and an on-side inspection of RCM in USA are described. The system for maintenance program and construction of the system for keeping the electric power joint technologies in Japan are illustrated. (S.Y.)

  11. Multimedia-based Medicinal Plants Sustainability Management System

    Directory of Open Access Journals (Sweden)

    Zacchaeus Omogbadegun

    2011-09-01

    Full Text Available Medicinal plants are increasingly recognized worldwide as an alternative source of efficacious and inexpensive medications to synthetic chemo-therapeutic compound. Rapid declining wild stocks of medicinal plants accompanied by adulteration and species substitutions reduce their efficacy, quality and safety. Consequently, the low accessibility to and non-affordability of orthodox medicine costs by rural dwellers to be healthy and economically productive further threaten their life expectancy. Finding comprehensive information on medicinal plants of conservation concern at a global level has been difficult. This has created a gap between computing technologies' promises and expectations in the healing process under complementary and alternative medicine. This paper presents the design and implementation of a Multimedia-based Medicinal Plants Sustainability Management System addressing these concerns. Medicinal plants' details for designing the system were collected through semi-structured interviews and databases. Unified Modelling Language, Microsoft-Visual-Studio.Net, C#3.0, Microsoft-Jet-Engine4.0, MySQL, Loquendo Multilingual Text-to-Speech Software, YouTube, and VLC Media Player were used.

  12. Survey of modern power plants driven by diesel and gas engines

    Energy Technology Data Exchange (ETDEWEB)

    Niemi, S. [Turku Polytechnic, Turku (Finland)

    1997-12-31

    This report surveys the latest technology of power plants driven by reciprocating internal combustion (IC) engines, from information collected from publications made mainly during the 1990`s. Diesel and gas engines are considered competitive prime movers in power production due mainly to their high full- and part-load brake thermal efficiency, ability to burn different fuels, short construction time and fast start-ups. The market for engine power plants has grown rapidly, with estimated total orders for reciprocating engines of 1 MW output and more reaching the 5000 unit level, (10 GW), between June 1995 and May 1996. Industrialized countries much prefer combined heat and power (CHP) production. Intense interest has been shown in recent years in alternative gas fuels; natural gas appears to be the most promising, but liquid petroleum gas, gas from sewage disposal plants, landfill gas and other biogases, as well as wood gas have also been recognized as other alternatives. Liquid alternatives such as fuels and pyrolysis oil have also been mentioned, in addition to information on coal burning engines. The percentage of gas engines used has increased and different ones are being developed, based on either the traditional spark ignition (SI), dual-fuel technology or the more recent high pressure gas injection system. In cold climates, energy production is largely based on CHP plants. Waste heat is utilized for local, regional or district heating or for industrial uses like drying, heating, cooling etc. Even radiative and convective heat from gen-set surfaces are employed, and boilers are used with exhaust outlet temperatures of below dew point. Combined cycle schemes, including turbo compound systems and steam turbines, are also incorporated into engine power plants in order to increase output and efficiency. Two-stroke, low-speed diesel engine plants show the highest electric efficiencies, with combined cycle plants reaching up to 54 %, while gas engine plants achieved

  13. Strategies to control pollution from coal based thermal power plants

    Energy Technology Data Exchange (ETDEWEB)

    Sengupta, B.; Paliwal, S.K. [Central Pollution Control Board, Delhi (India)

    1997-12-31

    In India, coal based thermal power plants contribute a prime source of energy supply. It has become necessary to adopt an integrated strategy with emphasis on waste minimisation in addition to control at source. Use of clean process technologies such as Fluidised Bed Combustion (FBC, PFBC and AFBC) boilers which not only provide higher combustion efficiency but also emit less amount of pollutants. In order to improve performance of existing power stations and to reduce emission of fly ash, the power plants should use beneficiated coal. Besides the savings in transportation cost and reduction in ash generation, the Plant Load Factor (PLF) of power stations will also be increased considerably after using beneficiated coal. To promote use of flyash for various useful purposes, it is necessary to a adopt dry flyash collection system. Fiscal incentives on equipment and machineries, exemption on excise and custom duties and free availability of land and electricity to the entrepreneur are among the measures required for reducing the problems caused by flyash. The paper provides an overview of the pollution problems in coal based power plants and possible options for waste minimisation and pollution control. 4 tabs.

  14. Plant operator performance evaluation based on cognitive process analysis experiment

    International Nuclear Information System (INIS)

    This paper reports on an experiment to clarify plant operators' cognitive processes that has been performed, to improve the man-machine interface which supports their diagnoses and decisions. The cognitive processes under abnormal conditions were evaluated by protocol analyses interviews, etc. in the experiment using a plant training simulator. A cognitive process model is represented by a stochastic network, based on Rasmussen's decision making model. Each node of the network corresponds to an element of the cognitive process, such as observation, interpretation, execution, etc. Some observations were obtained as follows, by comparison of Monte Carlo simulation results with the experiment results: A process to reconfirm the plant parameters after execution of a task and feedback paths from this process to the observation and the task definition of next task were observed. The feedback probability average and standard deviation should be determined for each incident type to explain correctly the individual differences in the cognitive processes. The tendency for the operator's cognitive level to change from skill-based to knowledge-based via rule-based behavior was observed during the feedback process

  15. Micro-CHP for self-supply in the housing industry. Profitability and system integration; Mikro-BHKW zur Eigenversorgung in der Wohnungswirtschaft. Wirtschaftlichkeit und Systemintegration

    Energy Technology Data Exchange (ETDEWEB)

    Hollinger, Raphael; Buettner, Markus; Erge, Thomas; Wille-Haussmann, Bernhard; Wittwer, Christof [Fraunhofer-Institut fuer Solare Energiesysteme ISE, Freiburg (Germany)

    2011-07-01

    The use of micro-CHP units in multifamily buildings is particularly profitable if the produced electricity - coupled with the thermal energy production - is used directly by the operator or sold locally. To maximize the share of own consumption the use of thermal storages to operate the CHP at times of high electrical demand is necessary. By conducting a field test it is shown that the share of own consumption can be increased by predictive control of CHP with thermal storages. The approach increases the profitability of the CHP operation under today's conditions as well as the system integration of the CHP electricity. (orig.)

  16. Thermoeconomic Analysis of Hybrid Power Plant Concepts for Geothermal Combined Heat and Power Generation

    OpenAIRE

    Florian Heberle; Dieter Brüggemann

    2014-01-01

    We present a thermo-economic analysis for a low-temperature Organic Rankine Cycle (ORC) in a combined heat and power generation (CHP) case. For the hybrid power plant, thermal energy input is provided by a geothermal resource coupled with the exhaust gases of a biogas engine. A comparison to alternative geothermal CHP concepts is performed by considering variable parameters like ORC working fluid, supply temperature of the heating network or geothermal water temperature. Second law efficiency...

  17. Analysis of axial-induction-based wind plant control using an engineering and a high-order wind plant model

    Energy Technology Data Exchange (ETDEWEB)

    Annoni, Jennifer [Univ. of Minnesota, Minneapolis, MN (United States). Dept. of Aerospace Engineering and Mechanics; Gebraad, Pieter M. O. [National Renewable Energy Laboratory, Golden CO (United States); Scholbrock, Andrew K. [National Renewable Energy Laboratory, Golden CO (United States); Fleming, Paul A. [National Renewable Energy Laboratory, Golden CO (United States); Wingerden, Jan-Willem van [Delft Center for Systems and Control, Delft University of Technology, Delft (Netherlands)

    2015-08-14

    Wind turbines are typically operated to maximize their performance without considering the impact of wake effects on nearby turbines. Wind plant control concepts aim to increase overall wind plant performance by coordinating the operation of the turbines. This paper focuses on axial-induction-based wind plant control techniques, in which the generator torque or blade pitch degrees of freedom of the wind turbines are adjusted. The paper addresses discrepancies between a high-order wind plant model and an engineering wind plant model. Changes in the engineering model are proposed to better capture the effects of axial-induction-based control shown in the high-order model.

  18. Optimum power yield for bio fuel fired combined heat and power plants

    Energy Technology Data Exchange (ETDEWEB)

    Broden, Henrik; Nystroem, Olle; Joensson, Mikael

    2012-05-15

    Plant owners, suppliers, research institutions, industry representatives and (supporting) authorities are continuing to question the viability of what can be expected by increasing the steam data and the efficiency of cogeneration plants. In recent years, the overall conditions for investment in CHP have changed. Today, there is access to new materials that allow for more advanced steam data while maintaining availability. Although the financial environment with rising prices of electricity, heating and fuel along with the introduction of energy certificates and the interest in broadening the base of fuel has changed the situation. At the same time as the increased interest in renewable energy production creates competition among energy enterprises to find suppliers, increased prices for materials and labor costs have also resulted in increased investment and maintenance costs. Research on advanced steam data for biomass-fired power cogeneration plants has mainly emphasized on technical aspects of material selection and corrosion mechanisms based on performance at 100 % load looking at single years. Reporting has rarely been dealing with the overall economic perspective based on profitability of the CHP installations throughout their entire depreciation period. In the present report studies have been performed on how the choice of steam data affects the performance and economy in biomass-fired cogeneration plants with boilers of drum type and capacities at 30, 80 and 160 MWth with varied steam data and different feed water system configurations. Profitability is assessed on the basis of internal rate of return (IRR) throughout the amortization period of the plants. In addition, sensitivity analyses based on the most essential parameters have been carried out. The target group for the project is plant owners, contractors, research institutions, industry representatives, (supporting) authorities and others who are faced with concerns regarding the viability of what

  19. Applying computer-based procedures in nuclear power plants

    International Nuclear Information System (INIS)

    Plant operation procedures are used to guide operators in coping with normal, abnormal or emergency situations in a process control system. Historically, the plant procedures have been paper-based (PBP), with the digitalisation trend in these complex systems computer-based procedures (CBPs) are being developed to support procedure use. This work shows briefly the research on CBPs at the Human-System Interface Laboratory (LABIHS). The emergency operation procedure EOP-0 of the LABIHS NPP simulator was implemented in the ImPRO CBP system. The ImPRO system was chosen for test because it is available for download in the Internet. A preliminary operation test using the implemented procedure in the CBP system was realized and the results were compared to the operation through PBP use. (author)

  20. Condition Based and Risk Informed Management for Power Plant Efficiency

    International Nuclear Information System (INIS)

    The efficiency management of power plants is an obvious and tedious topic, but it is still one of the most important pending issues. Efficiency management is not a difficult discipline in terms of academic standard. However, we can realize how we are lack of knowledge from the viewpoint of field practice. Nowadays, utilities are trying to strictly manage plant efficiency because of cost competitiveness with other energy resources. Efficiency management can be widely characterized from the replacement of hardware to the optimization of operation and maintenance using the advanced IT technologies. In this paper, we will overview the advanced efficiency management strategy, which is based on the IT technologies. We named the strategy as condition-based risk-informed efficiency management. This strategy aims at the implementation of predictive as well as proactive maintenance considering the risk in terms of cost

  1. Exergy efficiency graphs for thermal power plants

    International Nuclear Information System (INIS)

    Despite the strong support for exergy in thermodynamics, the industry still relies on energy based power plant efficiencies. The paper exposes errors with energy based efficiencies and improves the graphical representation of plants efficiencies. Among others, energy efficiencies cannot recognised that Combined Heat and Power (CHP) plant may be less efficient than condensing plants or that fossil fuel based plants should always be more efficient than any biomass plants because irreversibilities from biomass spontaneous thermo-chemical reactions are much higher than with coal or natural gas. Profitability equations fail to distinguish the true technical efficiency so exergy must be used, if only to enhance power plants understanding. Two novel graphs are introduced. Graph #1 combines all in a single graph; total, electrical and thermal exergy efficiencies. Graph #2 splits thermal exergy efficiency into two components related to; plant thermal losses and useful heat output quality. Data from 24 existing and design plants is used to support the graphs. Graph #1 shows different rankings of efficiencies than what is typically understood by the industry. Graph #2 shows that achieving further higher thermal energy efficiency barely increases the total exergy efficiency. If possible, it is better to increase the useful heat output quality. - Highlights: • Paper identifies weaknesses of industrial approach for power plant efficiencies. • Two exergy efficiency graphs are introduced to improve graphical representation. • Graph 1 combines electrical, thermal and total exergy efficiencies. • Graph 2 splits thermal exergy efficiency into its energy efficiency and useful heat output quality. • Graphs use typical data from 24 power plants of various technologies and fuels

  2. Economic Study of Solar Thermal Plant based on Gas Turbines

    OpenAIRE

    Cabané Fernández, Albert

    2012-01-01

    The goal of this thesis is to carry out an economic analysis of solar thermal plant based on gas turbines. Throughout the project , there is a brief overview of different technologies used today in CSP without going into greater depth in most of them, but emphasizing solar tower technology with solar hybrid gas turbines. Having explained the reason why this technology has been chosen, possible configurations currently found in the solar panorama will be considered. Then, ...

  3. Sustainability of plant-based diets: back to the future.

    Science.gov (United States)

    Sabaté, Joan; Soret, Sam

    2014-07-01

    Plant-based diets in comparison to diets rich in animal products are more sustainable because they use many fewer natural resources and are less taxing on the environment. Given the global population explosion and increase in wealth, there is an increased demand for foods of animal origin. Environmental data are rapidly accumulating on the unsustainability of current worldwide food consumption practices that are high in meat and dairy products. Natural nonrenewable resources are becoming scarce, and environmental degradation is rapidly increasing. At the current trends of food consumption and environmental changes, food security and food sustainability are on a collision course. Changing course (to avoid the collision) will require extreme downward shifts in meat and dairy consumption by large segments of the world's population. Other approaches such as food waste reduction and precision agriculture and/or other technological advances have to be simultaneously pursued; however, they are insufficient to make the global food system sustainable. For millennia, meatless diets have been advocated on the basis of values, and large segments of the world population have thrived on plant-based diets. "Going back" to plant-based diets worldwide seems to be a reasonable alternative for a sustainable future. Policies in favor of the global adoption of plant-based diets will simultaneously optimize the food supply, health, environmental, and social justice outcomes for the world's population. Implementing such nutrition policy is perhaps one of the most rational and moral paths for a sustainable future of the human race and other living creatures of the biosphere that we share. PMID:24898222

  4. Life management of power plant based on structural damage testing

    Energy Technology Data Exchange (ETDEWEB)

    Tallermo, H.; Klevtsov, I. [Thermal Engineering Department of Tallinn Technical University, Tallinn (Estonia); Arras, V. [Eesti Energia, Tallinn (Estonia)

    1998-12-31

    Life management system is based on the valid nowadays in Estonian power plants regulation documentation. The system allows to estimate stress distribution in components, find computational assessment of cumulated creep damage, determine when and where it is necessary to cut off the particular number of microsamples or take replicas. Finally, the real metal condition may be assessed on the basis of metallographic specimen research and reasonable 3-R decision - run, repair, replacement - made on further component use. (orig.) 6 refs.

  5. Siplab, a spatial individual-based plant modelling system

    OpenAIRE

    Oscar Garcia

    2014-01-01

    Spatially-explicit individual-based models are important tools in forestry and plant ecology. They are commonly implemented through custom computer coding that is time-consuming, may cause compatibility and availability problems, and makes difficult the evaluation, comparison and re-use of model components. Siplab is an R package that aims at improving this situation with a flexible computing environment that can handle a variety of model forms, and without requiring advanced programming know...

  6. Adaptive model based control for wastewater treatment plants

    OpenAIRE

    Niet, de, A.; Vrugt, van de, Noëlle Maria; Korving, Hans; Boucherie, Richard J.; Savic, D.A.; Kapelan, Z.; Butler, D.

    2011-01-01

    In biological wastewater treatment, nitrogen and phosphorous are removed by activated sludge. The process requires oxygen input via aeration of the activated sludge tank. Aeration is responsible for about 60% of the energy consumption of a treatment plant. Hence optimization of aeration can contribute considerably to the increase of energy-efficiency in wastewater treatment. To this end, we introduce an adaptive model based control strategy for aeration called adaptive WOMBAT. The strategy is...

  7. Utilization of Low Temperature Heat in Coal based Power Plants

    OpenAIRE

    Sisic, Elmir

    2013-01-01

    Carbon Capture and Storage aims at capturing and storing carbon emissions from large point sources underground. One of three main ways of implementing CCS is in coal based power plants is the pressurized oxy-combustion, an advanced form of oxy-combustion. There are different approaches in designing the heat cycle with CCS. Included in the design is the acid condenser, a heat exchanger which utilizes the low temperature and latent heat of the flue gas for preheating purposes. The objective of ...

  8. Advanced coal based power plants for the next millennium

    Energy Technology Data Exchange (ETDEWEB)

    Liere, J. van; Burgt, M.J. van der [KEMA, Arnhem (Netherlands)

    1997-12-31

    The global electric power generation demand from the year 2000 to 2015 is estimated to approach 1700 GWe. The global market share of coal is projected to be 38% - a significant market to penetrate for new clean coal technologies. Coal-based power generation has shown continued and steady growth during recent decades, despite drastic changes in political and general economic conditions. This is due to the abundance of global coal resources, their geographical dispersion and a comparatively low price for extraction, transportation and conversion. Demands for reduction of the environmental impact of power generation have so far been met by appropriate technological development, and efforts are made to face the latest challenge - the reduction of CO{sub 2} - emissions. This report presents a utility view on various advanced coal-based technologies for the next millennium: the pulverized coal-fired plant with advanced steam data (PF-USC), the integrated coal gasification/combined cycle plant (IGCC), and the pressurized fluid-bed combustion combined cycle plant (PFBC-CC). Furthermore, the longer-term perspectives of new coal-based technologies are addressed. Key topics are: energy efficiency, economy and ecology. 14 refs., 5 figs., 4 tabs.

  9. Large-scale integration of off-shore wind power and regulation strategies of cogeneration plants in the Danish electricity system

    DEFF Research Database (Denmark)

    Østergaard, Poul Alberg

    2005-01-01

    The article analyses how the amount of a small-scale CHP plants and heat pumps and the regulation strategies of these affect the quantity of off-shore wind power that may be integrated into Danish electricity supply......The article analyses how the amount of a small-scale CHP plants and heat pumps and the regulation strategies of these affect the quantity of off-shore wind power that may be integrated into Danish electricity supply...

  10. Changes of the thermodynamic parameters in failure conditions of the micro-CHP cycle

    Directory of Open Access Journals (Sweden)

    Matysko Robert

    2014-03-01

    Full Text Available The paper presents the calculations for the failure conditions of the ORC (organic Rankine cycle cycle in the electrical power system. It analyses the possible reasons of breakdown, such as the electrical power loss or the automatic safety valve failure. The micro-CHP (combined heat and power system should have maintenance-free configuration, which means that the user does not have to be acquainted with all the details of the ORC system operation. However, the system should always be equipped with the safety control systems allowing for the immediate turn off of the ORC cycle in case of any failure. In case of emergency, the control system should take over the safety tasks and protect the micro-CHP system from damaging. Although, the control systems are able to respond quickly to the CHP system equipped with the inertial systems, the negative effects of failure are unavoidable and always remain for some time. Moreover, the paper presents the results of calculations determining the inertia for the micro-CHP system of the circulating ORC pump, heat removal pump (cooling condenser and the heat supply pump in failure conditions.

  11. A thermodynamic criterion for selection of working fluid for subcritical and supercritical domestic micro CHP

    OpenAIRE

    Mikielewicz, Dariusz; Mikielewicz, Jarosław

    2010-01-01

    Abstract A thermodynamic criterion for selection of a fluid both for subcritical and supercritical organic Rankine cycle has been proposed. Theoretical performances of few fluids have been comparatively assessed for use in low-temperature domestic organic Rankine cycle micro systems. Of 20 fluids investigated, ethanol, R123 and R141b appear as the most suitable for small scale domestic CHP applications.

  12. A thermodynamic criterion for selection of working fluid for subcritical and supercritical domestic micro CHP

    International Nuclear Information System (INIS)

    A thermodynamic criterion for selection of a fluid both for subcritical and supercritical organic Rankine cycle has been proposed. Theoretical performances of few fluids have been comparatively assessed for use in low-temperature domestic organic Rankine cycle micro systems. Of the 20 fluids investigated, ethanol, R123 and R141b appear as the most suitable for small scale domestic CHP applications.

  13. Changes of the thermodynamic parameters in failure conditions of the micro-CHP cycle

    Science.gov (United States)

    Matysko, Robert; Mikielewicz, Jarosław; Ihnatowicz, Eugeniusz

    2014-03-01

    The paper presents the calculations for the failure conditions of the ORC (organic Rankine cycle) cycle in the electrical power system. It analyses the possible reasons of breakdown, such as the electrical power loss or the automatic safety valve failure. The micro-CHP (combined heat and power) system should have maintenance-free configuration, which means that the user does not have to be acquainted with all the details of the ORC system operation. However, the system should always be equipped with the safety control systems allowing for the immediate turn off of the ORC cycle in case of any failure. In case of emergency, the control system should take over the safety tasks and protect the micro-CHP system from damaging. Although, the control systems are able to respond quickly to the CHP system equipped with the inertial systems, the negative effects of failure are unavoidable and always remain for some time. Moreover, the paper presents the results of calculations determining the inertia for the micro-CHP system of the circulating ORC pump, heat removal pump (cooling condenser) and the heat supply pump in failure conditions.

  14. A Compound Herbal Preparation (CHP) in the Treatment of Children with ADHD: A Randomized Controlled Trial

    Science.gov (United States)

    Katz, M.; Adar Levine, A.; Kol-Degani, H.; Kav-Venaki, L.

    2010-01-01

    Objective: Evaluation of the efficacy of a patented, compound herbal preparation (CHP) in improving attention, cognition, and impulse control in children with ADHD. Method: Design: A randomized, double-blind, placebo-controlled trial. Setting: University-affiliated tertiary medical center. Participants: 120 children newly diagnosed with ADHD,…

  15. Adaptive Regulation of the Boiler-Turbine Unit of a Combined Heat and Power (CHP) System

    OpenAIRE

    Karrari, M.; Nicholson, H.

    1990-01-01

    A simplified nonlinear model of a CHP system is used to investigate the steady state errors, hunting phenomena and high interactions produced in the linear regulators currently employed in industry. A gain-scheduling regulator is designed to overcome these shortcomings.

  16. Electricity supply scenarios in Lithuania after closure of the existing nuclear power plant

    International Nuclear Information System (INIS)

    Total installed capacity of the Lithuanian power plants is 6547 MW, including Ignalina Nuclear Power Plant (INPP) with 3000 MW installed capacity and the Lithuanian Thermal Power Plants (Lithuanian TPP) with 1800 MW. Combined Heat and Power plants (CHP) installations account for 780 MW, Kruonis Hydro Pumped Storage Power Plant (Kruonis HPSPP) for 800 MW and other hydro and thermal power plants for 167 MW. Maximal domestic electricity demand in 2002 was 1977 MW. Presently INPP generates up to 85% of total electricity in Lithuania. However, the first unit of the INPP has to be closed before 2005 and the second one before 2010. This will lead to very significant changes in the Lithuanian power system and in the whole energy sector if dynamics of electricity production, energy balance and emissions into atmosphere are concern. This paper describes assumptions and main results of energy system development scenarios, analysed in the project Energy Supply Options for Lithuania: A Detailed Multi sectoral Integrated Energy Demand, Supply and Environmental Analysis completed in 2003 in collaboration with the International Atomic Energy Agency. The main attention is paid to the project results related to power sector development during time period until 2025. In order to find future structure of the Lithuanian energy system, as well as to estimate future energy balance a set of possible technological options was analysed: modernization of Lithuanian TPP and existing CHP, including flue gas desulphurization measures; construction of new nuclear power plant(s) (including a small modular design), construction of new Combined Cycle Gas Turbine (CCGT) units at different sites (of the Lithuanian TPP, the INPP, as well as at new site); construction of new middle and small scale CHP, operating on natural gas and renewable; conversion of boiler-houses into CHP; construction of new hydro power plants on Nemunas and Neris rivers, new gas turbines and wind power plants; changing of fuel

  17. Application of condition based maintenance to nuclear power plants

    International Nuclear Information System (INIS)

    Device Karte management system which supports application of condition based maintenance to nuclear power plants has been developed. The purpose of this system is to support maintenance personnel in device inspection scheduling based on operating condition monitoring and maintenance histories. There are four functions: field database, degradation estimation, inspection time decision and maintenance planning. The authors have been applying this system to dozens of devices of Onagawa Nuclear Power Station Unit No. 1 for one year. This paper represents the system concept and its application experiences. (author)

  18. Genetic Analysis of the Regulation of Type IV Pilus Function by the Chp Chemosensory System of Pseudomonas aeruginosa▿

    OpenAIRE

    Bertrand, Jacob J.; West, Joyce T.; Engel, Joanne N.

    2009-01-01

    The virulence of the opportunistic pathogen Pseudomonas aeruginosa involves the coordinate expression of many virulence factors, including type IV pili, which are required for colonization of host tissues and for twitching motility. Type IV pilus function is controlled in part by the Chp chemosensory system, which includes a histidine kinase, ChpA, and two CheY-like response regulators, PilG and PilH. How the Chp components interface with the type IV pilus motor proteins PilB, PilT, and PilU ...

  19. Nuclear-localized Calcineurin Homologous Protein CHP1 Interacts with Upstream Binding Factor and Inhibits Ribosomal RNA Synthesis*

    OpenAIRE

    Jiménez-Vidal, Maite; Srivastava, Jyoti; Putney, Luanna K; Barber, Diane L.

    2010-01-01

    Calcineurin homologous protein 1 (CHP1) is a widely expressed, 22-kDa myristoylated EF-hand Ca2+-binding protein that shares a high degree of similarity with the regulatory B subunit of calcineurin (65%) and with calmodulin (59%). CHP1 localizes to the plasma membrane, the Golgi apparatus, and the nucleus and functions to regulate trafficking of early secretory vesicles, activation of T cells, and expression and transport of the Na-H exchanger NHE1. Although CHP1 contains nuclear export signa...

  20. Structural insights into ChpT, an essential dimeric histidine phosphotransferase regulating the cell cycle in Caulobacter crescentus

    OpenAIRE

    Fioravanti, Antonella; Clantin, Bernard; Dewitte, Frédérique; Lens, Zoé; Verger, Alexis; Biondi, Emanuele G; Villeret, Vincent

    2012-01-01

    Two-component and phosphorelay signal-transduction proteins are crucial for bacterial cell-cycle regulation in Caulobacter crescentus. ChpT is an essential histidine phosphotransferase that controls the activity of the master cell-cycle regulator CtrA by phosphorylation. Here, the 2.2 Å resolution crystal structure of ChpT is reported. ChpT is a homodimer and adopts the domain architecture of the intracellular part of class I histidine kinases. Each subunit consists of two distinct domains: a...

  1. Plant-based raw material: Improved food quality for better nutrition via plant genomics

    NARCIS (Netherlands)

    Meer, van der I.M.; Bovy, A.G.; Bosch, H.J.

    2001-01-01

    Plants form the basis of the human food chain. Characteristics of plants are therefore crucial to the quantity and quality of human food. In this review, it is discussed how technological developments in the area of plant genomics and plant genetics help to mobilise the potential of plants to improv

  2. Nuclear Power Plant Operator Reliability Research Based on Fuzzy Math

    International Nuclear Information System (INIS)

    This paper makes use of the concept and theory of fuzzy number in fuzzy mathematics, to research for the response time of operator in accident of Chinese nuclear power plant. Through the quantitative analysis for the performance shape factors (PSFs) which influence the response time of operators, the formula of the operator response time is obtained based on the possibilistic fuzzy linear regression model which is used for the first time in this kind of research. The research result shows that the correct research method can be achieved through the analysis of the information from a small sample. This method breaks through the traditional research method and can be used not only for the reference to the safe operation of nuclear power plant, but also in other areas.

  3. Anthropometric data base for power plant design. Special report

    International Nuclear Information System (INIS)

    The primary study objective is to develop anthropometric data based upon the men and women who operate and maintain nuclear power plants. Age, stature, and weight information were obtained by a questionnaire survey of current operator and maintenance personnel, and the data extracted from the questionnaires were analyzed to derive body-size information for a number of anthropometric variables of interest to designers. Body-size information was developed separately for both men and women. Results achieved for the male population can be utilized by designers with a high level of confidence for the design of general workplaces. While the number of women respondents in the sample proved to be too small to derive results to which a similarly high level of reliability could be attached, the data can nevertheless be used as reasonable indicators of the probable body-size variability to be found among female power plant employees

  4. Concept of laser fusion power plant based on fast ignition

    International Nuclear Information System (INIS)

    Recent progress on fast ignition (FI) and cooled Yb:YAG ceramic laser enable us to design an IFE power plant with a 1MJ-class, compact laser whose output energy is 1/4 of previous central ignition scheme. Basing on the FI scheme, we conceptually designed a laser fusion power plant driven with cooled-Yb:YAG, ceramic lasers. The cooled Yb-YAG ceramic was newly chosen as the laser material. We found that the heating laser for ignition could be constructed with the cooled Yb:YAG ceramics as well as the compression laser with acceptable electricity-laser conversion efficiencies including the electric power for the cooling system. A new reactor scheme for a liquid wall reactor that has no stagnation point of ablated gas was proposed. (author)

  5. Plant-based solutions for veterinary immunotherapeutics and prophylactics.

    Science.gov (United States)

    Kolotilin, Igor; Topp, Ed; Cox, Eric; Devriendt, Bert; Conrad, Udo; Joensuu, Jussi; Stöger, Eva; Warzecha, Heribert; McAllister, Tim; Potter, Andrew; McLean, Michael D; Hall, J Christopher; Menassa, Rima

    2014-01-01

    An alarming increase in emergence of antibiotic resistance among pathogens worldwide has become a serious threat to our ability to treat infectious diseases according to the World Health Organization. Extensive use of antibiotics by livestock producers promotes the spread of new resistant strains, some of zoonotic concern, which increases food-borne illness in humans and causes significant economic burden on healthcare systems. Furthermore, consumer preferences for meat/poultry/fish produced without the use of antibiotics shape today's market demand. So, it is viewed as inevitable by the One Health Initiative that humans need to reduce the use of antibiotics and turn to alternative, improved means to control disease: vaccination and prophylactics. Besides the intense research focused on novel therapeutic molecules, both these strategies rely heavily on the availability of cost-effective, efficient and scalable production platforms which will allow large-volume manufacturing for vaccines, antibodies and other biopharmaceuticals. Within this context, plant-based platforms for production of recombinant therapeutic proteins offer significant advantages over conventional expression systems, including lack of animal pathogens, low production costs, fast turnaround and response times and rapid, nearly-unlimited scalability. Also, because dried leaves and seeds can be stored at room temperature for lengthy periods without loss of recombinant proteins, plant expression systems have the potential to offer lucrative benefits from the development of edible vaccines and prophylactics, as these would not require "cold chain" storage and transportation, and could be administered in mass volumes with minimal processing. Several biotechnology companies currently have developed and adopted plant-based platforms for commercial production of recombinant protein therapeutics. In this manuscript, we outline the challenges in the process of livestock immunization as well as the current

  6. Scheduling of Multiple Chillers in Trigeneration Plants

    OpenAIRE

    Chris Underwood; Bobo Ng; Francis Yik

    2015-01-01

    The scheduling of both absorption cycle and vapour compression cycle chillers in trigeneration plants is investigated in this work. Many trigeneration plants use absorption cycle chillers only but there are potential performance advantages to be gained by using a combination of absorption and compression chillers especially in situations where the building electrical demand to be met by the combined heat and power (CHP) plant is variable. Simulation models of both types of chillers are develo...

  7. A knowledge based method for nuclear plant loading pattern determination

    International Nuclear Information System (INIS)

    This paper deals with the design of a knowledge based system for solving an industrial problem which occurs in nuclear fuel management. The problem lies in determining satisfactory loading patterns for nuclear plants. Its primary feature consists in the huge search space involved. Conventional resolution processes are formally defined and analyzed: there is no general algorithm which guarantees to always provide a reasonable solution in each situation. We propose a new approach to solve this constrained search problem using domain-specific knowledge and general constraint-based heuristics. During a preprocessing step, a problem dependent search algorithm is designed. This procedure is then automatically implemented in FORTRAN. The generated routines have proved to be very efficient finding solutions which could not have been provided using logic programming. A prototype expert system has already been applied to actual reload pattern searches. While combining efficiency and flexibility, this knowledge based system enables human experts to rapidly match new constraints and requirements

  8. ECOLOGICAL BASES OF SIMBIOGENIC DEVELOPMENT OF PLANT AT COMPLEX SOWINGS

    Directory of Open Access Journals (Sweden)

    Belyuchenko I. S.

    2015-03-01

    Full Text Available Development of plants in mixed or combined sowings is based on the symbiotic association in the basis of which we have decreased sexual process and its mechanism of genetic exchange among endosymbionts and stimulating of genetic exchange and expansion of the diversity of species among exosymbionts. The exception is the symbiosis of orchids and fungi - activators of orchids mycorrhiza with developed micellar system easily passing on saprophytic option. Coevolution of plant organisms with fungi indicates the specifics symbiogenic conjugate evolution, showing an example of the evolution of a small community with different contact with the external environment. The phenomenon of symbiogenesis has a long history and was manifested in a variety of different types of organisms. Today, some dependence of existence of one species from other organisms is observed at approximately 75% of higher plants and 90% of the animals in varying degrees of symbiogenic dependence from other species and taxa. Originality of symbiogenesis was analyzed by Academician A.A. Takhtadzhyan (1973 during its consideration of origin of eukaryotic cells as process of "assembly" of a complex system. Different approaches to determining the biological essence of symbiosis are known in the history of study of this phenomenon. On the whole phenomenon of symbiosis belongs to the category mutual relations of organisms of different phylogenetic groups

  9. PSA based plant modifications and back-fits

    International Nuclear Information System (INIS)

    The mandate of Principal Working Group No. 5 - Risk Assessment states that 'The group should deal with the technology and methods for identifying contributors to risk and assessing their importance, and appropriate exchanges of information on current research'. Since being formulated in 1982, along with this mandate, the group has also endeavored to develop a common understanding of the different approaches taken in risk assessment. The focus of this report is to provide knowledge to experts on the role Probabilistic Safety Assessment (PSA) has had in safety decision making. PSA is a powerful tool for improving Nuclear Power Plant safety by identifying weaknesses in design or operation and setting priorities for plant modifications and back-fits. While the use is well recognised, it is also true that any safety decision is generally based on several elements, both probabilistic and deterministic. This document provides a general overview of insights gained from the representative set of examples collected from Member countries (Finland, France, Germany, Japan, Korea, Netherlands, Spain, Sweden, Switzerland, United Kingdom, United States). The report starts with basic types of plant modifications which were carried out (e.g. hardware or software, important or minor, etc.) and the characteristics of the PSAs used in the examples (e.g. level and scope, specific or generic, on-going or terminated, etc.). The insights gained from this small collection are then reviewed. The appendix gives a full text version of the Member country contributions

  10. Hypertext-based integration for nuclear plant maintenance and operations

    International Nuclear Information System (INIS)

    A methodology is presented that uses fuzzy graphs in the emerging paradigm of hypertext for the purpose of integrating data, information and multifaceted knowledge resources abounding in power plant operations and maintenance. A hypertext system is viewed as a set of nodes and links where with each link we associate membership functions embodying context-dependent criteria for navigating large information spaces. A general framework for navigation is outlined and graph-theory navigational tools are developed. A numerical example and a HyperCard-based prototype for monitoring special material in the MHTGR-NPR are included. 10 refs., 12 figs

  11. Data warehouse based decision support system in nuclear power plants

    International Nuclear Information System (INIS)

    Safety is an important element in business decision making processes in nuclear power plants. Information about component reliability, structures and systems, data recorded during the nuclear power plant's operation and outage periods, as well as experiences from other power plants are located in different database systems throughout the power plant. It would be possible to create a decision support system which would collect data, transform it into a standardized form and store it in a single location in a format more suitable for analyses and knowledge discovery. This single location where the data would be stored would be a data warehouse. Such data warehouse based decision support system could help make decision making processes more efficient by providing more information about business processes and predicting possible consequences of different decisions. Two main functionalities in this decision support system would be an OLAP (On Line Analytical Processing) and a data mining system. An OLAP system would enable the users to perform fast, simple and efficient multidimensional analysis of existing data and identify trends. Data mining techniques and algorithms would help discover new, previously unknown information from the data as well as hidden dependencies between various parameters. Data mining would also enable analysts to create relevant prediction models that could predict behaviour of different systems during operation and inspection results during outages. The basic characteristics and theoretical foundations of such decision support system are described and the reasons for choosing a data warehouse as the underlying structure are explained. The article analyzes obvious business benefits of such system as well as potential uses of OLAP and data mining technologies. Possible implementation methodologies and problems that may arise, especially in the field of data integration, are discussed and analyzed.(author)

  12. ITER Fast Plant System Controller prototype based on PXIe platform

    Energy Technology Data Exchange (ETDEWEB)

    Ruiz, M., E-mail: mariano.ruiz@upm.es [Grupo de Investigacion en Instrumentacion y Acustica Aplicada, CAEND CSIC-UPM Universidad Politecnica de Madrid, Crta. Valencia Km-7, Madrid 28031 (Spain); Vega, J.; Castro, R. [Asociacion EURATOM/CIEMAT para Fusion, Madrid (Spain); Sanz, D.; Lopez, J.M.; Arcas, G. de; Barrera, E.; Nieto, J. [Grupo de Investigacion en Instrumentacion y Acustica Aplicada, CAEND CSIC-UPM Universidad Politecnica de Madrid, Crta. Valencia Km-7, Madrid 28031 (Spain); Goncalves, B.; Sousa, J.; Carvalho, B. [Associacao EURATOM/IST, Lisbon (Portugal); Utzel, N.; Makijarvi, P. [ITER Organization, CS 90 046, 13067 St. Paul lez Durance Cedex (France)

    2012-12-15

    Highlights: Black-Right-Pointing-Pointer Implementation of Fast Plant System Controller (FPSC) for ITER CODAC. Black-Right-Pointing-Pointer Efficient data acquisition and data movement using EPICS. Black-Right-Pointing-Pointer Performance of PCIe technologies in the implementation of FPSC. - Abstract: The ITER Fast Plant System Controller (FPSC) is based on embedded technologies. The FPSC will be devoted to both data acquisition tasks (sampling rates higher than 1 kHz) and control purposes (feedback loop actuators). Some of the essential requirements of these systems are: (a) data acquisition and data preprocessing; (b) interfacing with different networks and high speed links (Plant Operation Network, timing network based on IEEE1588, synchronous data transference and streaming/archiving networks); and (c) system setup and operation using EPICS (Experimental Physics and Industrial Control System) process variables. CIEMAT and UPM have implemented a prototype of FPSC using a PXIe (PCI eXtension for Instrumentation) form factor in a R and D project developed in two phases. The paper presents the main features of the two prototypes developed that have been named alpha and beta. The former was implemented using LabVIEW development tools as it was focused on modeling the FPSC software modules, using the graphical features of LabVIEW applications, and measuring the basic performance in the system. The alpha version prototype implements data acquisition with time-stamping, EPICS monitoring using waveform process variables (PVs), and archiving. The beta version prototype is a complete IOC implemented using EPICS with different software functional blocks. These functional blocks are integrated and managed using an ASYN driver solution and provide the basic functionalities required by ITER FPSC such as data acquisition, data archiving, data pre-processing (using both CPU and GPU) and streaming.

  13. Combined heat and power production based on gas turbine operation with biomass by gasification or powder firing; Kraftvaermeproduktion baserad paa gasturbindrift med biobraensle genom foergasning alternativt pulvereldning

    Energy Technology Data Exchange (ETDEWEB)

    Marbe, Aasa; Colmsjoe, Linda

    2006-12-15

    Combined heat and power (CHP) technique is relatively less extended in the Swedish energy system. There is a production of 56,2 TWh in district heating meanwhile only 7,6 TWh electricity comes from CHP. This only corresponds to 6 % of all electricity produced in Sweden (132 TWh). Based on the existing district heating system the amount of electricity produced in CHP-plants could rise from today 7,6 to 20 TWh. The Swedish government has decided to reduce the amount of CO{sub 2} released to atmosphere with 4 % by the year 2012. Furthermore there is a government decision that the nuclear power in a long time perspective will be phased out, so the amount of biofuelled heat and power plants has a huge potential to increase. To be competitive, the technique is to be efficient; hence the amount electricity produced should be as high as possible. Gasification of biofuel where the gas is used in a combined-cycle provides a higher efficiency compared to the traditional steam-cycle technique. To increase the electrical efficiency, an alternative method such as integration of a gas turbine with combustion of powder shape bio fuel in an external combustion chamber could be used. The concept is known as PFBC- technique in which the coal powder is combusted in a pressurised fluidised bed, the warm flue gases are cleaned up and expanded in a gas turbine. The objectives of this project have been to investigate the technical and economical conditions for gasification of bio fuel and for powder combustion in gas turbine for production of heat and power in different districts heat systems. Respectively technique has been studied in two different cases, Boraas Energi AB and ENA Energi AB. In Boraas the existing CHP-plant has been replaced by a bio fuelled gasification plant (IGCC) meanwhile at ENA Energi the existing CHP-plant has been complemented white a powder fuelled (bio) gas turbine. The task group for this report are decision makers of Energy Companies and the report will help

  14. Planning for rate base treatment of large power plants

    International Nuclear Information System (INIS)

    This paper addresses two related areas of planning for inclusion in rate base of large generating stations. First, the paper discusses the range of options available as to how the plant is to go into rate base, e.g., phase-in plans. In this connection the process of generating the entire range of options that may be available is described and examined. Second, the paper examines innovative ways of using procedures (e.g., accounting proceedings, settlement procedures, cost caps, and other ideas short of a full-blown rate case) and the resources available in the ratemaking arena, to obtain, in the least painful way possible, the necessary ratemaking orders. The thesis is that there must be better alternatives to the many proceedings that have either begun as, or seem to be leading to, endless retrospective examinations of multiple questions (from load forecasting to construction management to continuation-of-construction decisions) under the label of prudence inquiries

  15. Development of staged gasification plant for heat and power production based on wood pellers. Final report; Udvikling af trinopdelt forgasningsanlaeg til kraftvarmeproduktion paa traepiller (Castoranlaegget i Graested). Afsluttende rapport

    Energy Technology Data Exchange (ETDEWEB)

    Houmann Jakobsen, H.

    2009-11-15

    The present project is associated to the EU Concerto project Green Solar Cities, contract no. TREN07/FP6EN/S07.70755/038573. The scope of the EU Concerto project is demonstration of efficient supply of solar energy and biomass in areas of the cities Salzburg in Austria and Copenhagen in Denmark. Further information about the EU project is available at www.greensolarcities.com. As a development task in this project BioSynergi Proces ApS has worked with development and test of a fixed bed down draft gasification pilot plant with the purpose of conducting small scale combined heat and power production based on wood pellets. The development and test activities has taken place and utilised the resources at an already existing complete forest wood chips fired gasification plant in the town of Graested, Denmark. This plant has already shown good long term operational results. The heart of this plant is air staged open core down draft gasifier covered by an international patent. During the development task the gasification process has been tested in about 750 hours running at wood pellets. Of these 130 hours has been with engine operation and combined heat and power production. Stable gas production from the gasifier has been obtained, while the stability of gas engine operation not fulfilled the expectations of long term stable operation. Due to another size distribution of the dust particles in the raw producer gas from the gasifier, the gas cleaning stage of the plant did not work as satisfying with wood pellet as commonly experienced with wood chips. This matter resulted in a negative impact at the stability of the gas engine operation. A changed design of the gas cleaning stage may solve this matter. In the EU Concerto project the planned new bio gasification plant in Valby area is based on the present project results and experiences from the already implemented biomass CHP plant in Graested north of Copenhagen. However, impact from rising wood pellets prices during

  16. Liposome-Based Delivery Systems in Plant Polysaccharides

    OpenAIRE

    Yitao Wang; Xinsheng Peng; Ping Zhu; Yanfang Zhou; Jingjing Huang; Meiwan Chen

    2012-01-01

    Plant polysaccharides consist of many monosaccharide by α- or β-glycosidic bond which can be extracted by the water, alcohol, lipophile liquid from a variety of plants including Cordyceps sinensis, astragalus, and mushrooms. Recently, many evidences illustrate that natural plant polysaccharides possess various biological activities including strengthening immunity, lowering blood sugar, regulating lipid metabolism, antioxidation, antiaging, and antitumour. Plant polysaccharides have been wide...

  17. The design of future central receiver power plants based on lessons learned from the Solar One Pilot Plant

    Science.gov (United States)

    Kolb, G. J.

    The 10-MW(sub e) Solar One Pilot Plant was the world's largest solar central receiver power plant. During its power production years it delivered over 37,000 MWhrs (net) to the utility grid. In this type of electric power generating plant, large sun-tracking mirrors called heliostats reflect and concentrate sunlight onto a receiver mounted on top of a tower. The receiver transforms the solar energy into thermal energy that heats water, turning it into superheated steam that drives a turbine to generate electricity. The Solar One Pilot Plant successfully demonstrated the feasibility of generating electricity with a solar central receiver power plant. During the initial 2 years the plant was tested and 4 years the plant was operated as a power plant, a great deal of data was collected relating to the efficiency and reliability of the plant's various systems. This paper summarizes these statistics and compares them to goals developed by the U.S. Department of Energy. Based on this comparison, improvements in the design and operation of future central receiver plants are recommended. Research at Sandia National Laboratories and the U.S. utility industry suggests that the next generation of central receiver power plants will use a molten salt heat transfer fluid rather than water/steam. Sandia has recently completed the development of the hardware needed in a molten salt power plant. Use of this new technology is expected to solve many of the performance problems encountered at Solar One. Projections for the energy costs from these future central receiver plants are also presented. For reference, these projections are compared to the current energy costs from the SEGS parabolic trough plants now operating in Southern California.

  18. The design of future central receiver power plants based on lessons learned from the Solar One Pilot Plant

    Energy Technology Data Exchange (ETDEWEB)

    Kolb, G.J.

    1991-01-01

    The 10-MW{sub e} Solar One Pilot Plant was the world's largest solar central receiver power plant. During its power production years it delivered over 37,000 MWhrs (net) to the utility grid. In this type of electric power generating plant, large sun-tracking mirrors called heliostats reflect and concentrate sunlight onto a receiver mounted on top a of a tower. The receiver transforms the solar energy into thermal energy that heats water, turning it into superheated steam that drives a turbine to generate electricity. The Solar One Pilot Plant successfully demonstrated the feasibility of generating electricity with a solar central receiver power plant. During the initial 2 years the plant was tested and 4 years the plant was operated as a power plant, a great deal of data was collected relating to the efficiency and reliability of the plant's various systems. This paper summarizes these statistics and compares them to goals developed by the US Department of Energy. Based on this comparison, improvements in the design and operation of future central receiver plants are recommended. Research at Sandia National Laboratories and the US utility industry suggests that the next generation of central receiver power plants will use a molten salt heat transfer fluid rather than water/steam. Sandia has recently completed the development of the hardware needed in a molten salt power plant. Use of this new technology is expected to solve many of the performance problems encountered at Solar One. Projections for the energy costs from these future central receiver plants are also presented. For reference, these projections are compared to the current energy costs from the SEGS parabolic trough plants now operating in Southern California.

  19. Crystallization and preliminary crystallographic analysis of the human calcineurin homologous protein CHP2 bound to the cytoplasmic region of the Na+/H+ exchanger NHE1

    International Nuclear Information System (INIS)

    Crystallization of the human CHP2–NHE1 binding domain complex. Calcineurin homologous protein (CHP) is a Ca2+-binding protein that directly interacts with and regulates the activity of all plasma-membrane Na+/H+-exchanger (NHE) family members. In contrast to the ubiquitous isoform CHP1, CHP2 is highly expressed in cancer cells. To understand the regulatory mechanism of NHE1 by CHP2, the complex CHP2–NHE1 (amino acids 503–545) has been crystallized by the sitting-drop vapour-diffusion method using PEG 3350 as precipitant. The crystals diffract to 2.7 Å and belong to a tetragonal space group, with unit-cell parameters a = b = 49.96, c = 103.20 Å

  20. Diesel power plants based on biomass gasification. Final report

    Energy Technology Data Exchange (ETDEWEB)

    Kurkela, E.; Staahlberg, P.; Solantausta, Y.; Wilen, C.

    1996-12-31

    The aim of the project was to assess the competitiveness and market potential of small-scale power plant concepts based on biomass gasification and on diesel/gas engines, and to study the effect of process parameters on the efficiency of the circulating fluidized-bed gasifier and on the formation of tarry impurities. Alternative diesel/gas engine power plant concepts based on gasification in scale 6-50 MW{sub e} were assessed. In the basic version, where the electricity is generated only by the a diesel/gas engine, the efficiency level of 37 % is achieved in power generation. When steam cycle is added to the process the efficiency of power generation increases to 44-48 %. The efficiencies achieved in the process are very high compared with those of biomass power plant processes on a commercial level or under development. The most significant potential of biomass-based power generation is made up by wastes of sugar industries in south and Central America and in Asia. There are also very extensive growth potentials of bioenergy use in the NAFTA countries (USA, Canada and Mexico) and in Europe. In Europe, the bioenergy use is expected to grow most sharply in Italy, Spain, Germany and Poland. Carbon conversion obtained in the gasifier was in the range of 99.0-99.9 % for sawdust and 96-98 % for forest residue chips. The tar content of the product gas 10-15 g/m- m{sup 3}{sub n}, for sawdust in the gasification temperature of 830-930 deg C and with sand as circulating fluid-bed. When dolomite was used as circulating fluid-bed, the tar contents were 2-3 g/m{sup 3}{sub n} at as low temperatures as 880-890 deg C. The tar content of gas can be reduced sharply by phasing of gasification air and by using catalytic circulating fluid-bed material Bioenergy Research Programme; LIEKKI 2 Research Programme. 26 refs., 40 figs.

  1. Dynamics of Plant Growth; A Theory Based on Riemannian Geometry

    CERN Document Server

    Pulwicki, Julia

    2016-01-01

    In this work, a new model for macroscopic plant tissue growth based on dynamical Riemannian geometry is presented. We treat 1D and 2D tissues as continuous, deformable, growing geometries for sizes larger than 1mm. The dynamics of the growing tissue are described by a set of coupled tensor equations in non-Euclidean (curved) space. These coupled equations represent a novel feedback mechanism between growth and curvature dynamics. For 1D growth, numerical simulations are compared to two measures of root growth. First, modular growth along the simulated root shows an elongation zone common to many species of plant roots. Second, the relative elemental growth rate (REGR) calculated in silico exhibits temporal dynamics recently characterized in high-resolution root growth studies but which thus far lack a biological hypothesis to explain them. Namely, the REGR can evolve from a single peak localized near the root tip to a double-peak structure. In our model, this is a direct consequence of considering growth as b...

  2. Changes of the thermodynamic parameters in failure conditions of the micro-CHP cycle

    OpenAIRE

    Matysko Robert; Mikielewicz Jarosław; Ihnatowicz Eugeniusz

    2014-01-01

    The paper presents the calculations for the failure conditions of the ORC (organic Rankine cycle) cycle in the electrical power system. It analyses the possible reasons of breakdown, such as the electrical power loss or the automatic safety valve failure. The micro-CHP (combined heat and power) system should have maintenance-free configuration, which means that the user does not have to be acquainted with all the details of the ORC system operation. However, the system should always be equipp...

  3. A Comparative Technological Review of Hybrid CSP-Biomass CHP Systems in Europe

    OpenAIRE

    Hussain, C. M. Iftekhar; Duffy, Aidan; Norton, Brian

    2015-01-01

    This paper aims to explore different solar technologies and its suitability for hybridization with biomass for combined heat and power (CHP) generation in Europe. Although hybrid solar-biomass research and demonstration is in its infancy, it has the potential to provide dispatchable renewable energy at a significant scale over many areas in Europe. Therefore, this review examines the technical and economic reported performances on hybrid systems in order to assess the technical and economic v...

  4. Regulatory Compliance and Environmental Benefit Analysis of Combined Heat and Power (CHP) Systems in Taiwan

    OpenAIRE

    Wen-Tien Tsai

    2013-01-01

    The energy conservation achieved by utilizing waste heat in the energy and industrial sectors has became more and more important after the energy crisis in the 1970s because it plays a vital role in the potential energy-efficiency improvement. In this regard, cogeneration (combined heat and power, CHP) systems are thus becoming attractive due to the energy, economic, and environmental policies for pursuing stable electricity supply, sustainable development and environmental pollution mitigati...

  5. A Simplified Nonlinear Model For A Combined Heat and Power (CHP) System

    OpenAIRE

    Karrari, M.; Nicholson, H

    1990-01-01

    Steady state errors, hunting and high interactions have been reported in the operation of combined heat and power (CHP) systems working with steam turbines. The design of currently employed regulators in industry is usually absed on a linear model of the system. An improved system regulation can only be achieved if a more accurate mathematical model is available. In this paper, a simplified nonlinear model is derived which can be used to investigate the present problems and evaluate new contr...

  6. Implementation of a TPV integrated boiler for micro-CHP in residential buildings

    International Nuclear Information System (INIS)

    Highlights: • A TPV integrated boiler for micro-CHP application is designed, tested and demonstrated. • Thermal radiation was emitted by a porous emitter in the TPV unit. • The electric output of four TPV cell modules connected in series is measured and characterized under various conditions. • 246.4 Electricity is generated at the emitter temperature of 1265 °C. • This study shows that TPV generation in boilers/furnaces is feasible for micro-CHP application in residential buildings. - Abstract: There is a growing interest in direct thermal-to-electric energy conversion using solid state devices such as thermophotovoltaic (TPV) generators. TPV devices convert thermal radiation from heat sources into electricity without involving any moving parts. TPV opens up possibility for efficient and stand-alone power generation in boilers and furnaces. In this paper, a TPV integrated boiler was designed, built and investigated for micro combined heat and power (micro-CHP) application in residential buildings. A full size gas fired residential boiler was used as a precursor for integration with TPV devices. Experiments were conducted with the prototype TPV boiler so as to evaluate various issues related to this new technology. The electric output of TPV modules installed in the boiler was characterized under different operating conditions. The TPV cell modules generated 246.4 W at an emitter temperature of 1265 °C, which would be enough to power the electrical components of the whole heating system. Moreover, such a TPV integrated boiler could be employed to form a micro-CHP system in residential homes, providing an effective means for primary energy savings, on-site power and energy security

  7. Cultivable endophytic bacteria from leaf bases of Agave tequilana and their role as plant growth promoters

    OpenAIRE

    Julia del C. Martínez-Rodríguez; Marcela De la Mora-Amutio; Plascencia-Correa, Luis A.; Esmeralda Audelo-Regalado; Francisco R. Guardado; Elías Hernández-Sánchez; Peña-Ramírez, Yuri J.; Adelfo Escalante; Miguel J. Beltrán-García; Tetsuya Ogura

    2015-01-01

    Agave tequilana Weber var. 'Azul' is grown for the production of tequila, inulin and syrup. Diverse bacteria inhabit plant tissues and play a crucial role for plant health and growth. In this study culturable endophytic bacteria were extracted from leaf bases of 100 healthy Agave tequilana plants. In plant tissue bacteria occurred at mean population densities of 3 million CFU/g of fresh plant tissue. Three hundred endophytic strains were isolated and 16s rDNA sequences grouped the bacteria in...

  8. TVA coal-gasification commercial demonstration plant project. Volume 5. Plant based on Koppers-Totzek gasifier. Final report

    Energy Technology Data Exchange (ETDEWEB)

    1980-11-01

    This volume presents a technical description of a coal gasification plant, based on Koppers-Totzek gasifiers, producing a medium Btu fuel gas product. Foster Wheeler carried out a conceptual design and cost estimate of a nominal 20,000 TPSD plant based on TVA design criteria and information supplied by Krupp-Koppers concerning the Koppers-Totzek coal gasification process. Technical description of the design is given in this volume.

  9. Performance Based Failure Criteria of the Base Isolation System for Nuclear Power Plants

    International Nuclear Information System (INIS)

    The realistic approach to evaluate the failure state of the base isolation system is necessary. From this point of view, several concerns are reviewed and discussed in this study. This is the preliminary study for the performance based risk assessment of a base isolated nuclear power plant. The items to evaluate the capacity and response of an individual base isolator and a base isolation system were briefly outlined. However, the methodology to evaluate the realistic fragility of a base isolation system still needs to be specified. For the quantification of the seismic risk for a nuclear power plant structure, the failure probabilities of the structural component for the various seismic intensity levels need to be calculated. The failure probability is evaluated as the probability when the seismic response of a structure exceeds the failure criteria. Accordingly, the failure mode of the structural system caused by an earthquake vibration should be defined first. The type of a base isolator appropriate for a nuclear power plant structure is regarded as an elastometric rubber bearing with a lead core. The failure limit of the lead-rubber bearing (LRB) is not easy to be predicted because of its high nonlinearity and a complex loading condition by an earthquake excitation. Furthermore, the failure mode of the LRB system installed below the nuclear island cannot be simply determined because the basemat can be sufficiently supported if the number of damaged isolator is not much

  10. [Peculicidal activity of plant essential oils and their based preparations].

    Science.gov (United States)

    Lopatina, Iu V; Eremina, O Iu

    2014-01-01

    The peculicidal activity of eight plant essential oils in 75% isopropyl alcohol was in vitro investigated. Of them, the substances that were most active against lice were tea tree (Melaleuca), eucalyptus, neem, citronella (Cymbopogon nardus), and clove (Syzygium aromaticum) oils; KT50 was not more than 3 minutes on average; KT95 was 4 minutes. After evaporating the solvent, only five (tea tree, cassia, clove, anise (Anisum vulgare), and Japanese star anise (Illicium anisatum) oils) of the eight test botanical substances were active against lice. At the same time, KT50 and KT95 showed 1.5-5-fold increases. Citronella and anise oils had incomplete ovicidal activity. Since the lice were permethrin-resistant, the efficacy of preparations based on essential oils was much higher than permethrin. PMID:25296426

  11. Simulation-based biagnostics and control for nuclar power plants

    International Nuclear Information System (INIS)

    Advanced simulation-based diagnostics and control guidance systems for the identification and management of off-normal transient events in nuclear power plants is currently under investigation. To date a great deal of progress has been made in effectively and efficiently combining information obtained through fuzzy pattern recognition and macroscopic mass and energy inventory analysis for use in multiple failure diagnostics. Work has also begun on the unique problem of diagnostics and surveillance methodologies for advanced passively-safe reactors systems utilizing both statistical and fuzzy information. Plans are also being formulated for the development of deterministic optimal control algorithms combined with Monte Carlo incremental learning algorithms to be used for the flexible and efficient control of reactor transients

  12. Plant oil-based shape memory polymer using acrylic monolith

    Directory of Open Access Journals (Sweden)

    T. Tsujimoto

    2015-09-01

    Full Text Available This article deals with the synthesis of a plant oil-based material using acrylic monolith. An acrylic monolith bearing oxirane groups was prepared via simple technique that involved the dissolution of poly(glycidyl methacrylate-comethyl methacrylate (PGMA in ethanolic – aqueous solution by heating and subsequent cooling. The PGMA monolith had topologically porous structure, which was attributed to the phase separation of the polymer solution. The PGMA monolith was impregnated by epoxidized soybean oil (ESO containing thermally-latent catalyst, and the subsequent curing produced a crosslinked material with relatively good transparency. The Young’s modulus and the tensile strength of polyESO/PGMA increased compared with the ESO homopolymer. The strain at break of polyESO/PGMA was larger than that of the ESO homopolymer and crosslinked PGMA. Furthermore, polyESO/PGMA exhibited good shape memory-recovery behavior.

  13. Power Plant with CO2 Capture based on PSA Cycle

    OpenAIRE

    Stene, Henrik Sørskår; Moen, Ole Marius

    2014-01-01

    Two coal-fired power plants with CO2 capture by Pressure Swing Adsorption (PSA) havebeen modeled and simulated. The two power plants considered were IntegratedGasification Combined Cycle (IGCC) and conventional Pulverized Coal Combustion (PCC). Amathematical model of the PSA process for each of the power plants was developed and thegoal was to evaluate the feasibility of PSA as a technology for decarbonisation. Theperformance with CO2 capture by PSA was compared to a reference plant without C...

  14. Bio-based composites that mimic the plant cell wall

    OpenAIRE

    Li, Zhuo

    2009-01-01

    Nature creates high performance materials under modest conditions, i.e., neutral pH and ambient temperature and pressure. One of the most significant materials is the plant cell wall. The plant cell wall is a composite of oriented cellulose microfibrils reinforcing a lignin/hemicellulose matrix. In principle, the plant cell wall composite is designed much like a synthetic fiber-reinforced polymer composite. Unlike synthetic composites, the plant cell wall has an excellent combination of h...

  15. Decision support system based on knowledge base in Guangdong nuclear power plant

    International Nuclear Information System (INIS)

    The decision support system is one of the assistant decision tools to the decision-makers, and it is a complex systematic project to found the decision support system. This paper introduces the establishing process of the decision support system in Guangdong Nuclear Power Plant based on knowledge base. The main method includes three steps. First is organizing, mining and getting the knowledge. Second is constructing the knowledge base based on RDBMS. Third is setting up the decision support system. Practice shows that this method has certain practical value. (authors)

  16. Effect of plant-based feed ingredients on osmoregulation in the Atlantic salmon lens

    OpenAIRE

    Tröβe, C; Rhodes, JD; Sanderson, J; Breck, O; Waagbø, R.

    2010-01-01

    Lenses of adult Atlantic salmon fed with a plant oil and plant protein-based diet (plant diet) were compared to lenses of fish fed a diet based on traditional marine ingredients (marine diet) with respect to biochemical composition and functionality ex vivo. After 12 months of feeding, plant diet-fed fish had smaller lenses with higher water contents and lower concentrations of histidine (His) and N-acetylhistidine (NAH) than fish fed with the marine diet. Cataract development in both dietary...

  17. LEAF COLOR, AREA AND EDGE FEATURES BASED APPROACH FOR IDENTIFICATION OF INDIAN MEDICINAL PLANTS

    OpenAIRE

    Sandeep Kumar.E

    2012-01-01

    This paper presents a method for identification of medicinal plants based on some important features extracted from its leaf images. Medicinal plants are the essential aspects of ayurvedic system of medicine. The leaf extracts of many medicinal plants can cure various diseases and have become alternate for allopathic medicinal system now a days. Hence this paper presents an approach where the plant isidentified based on its leaf features such as area, color histogram and edge histogram. Exper...

  18. Role of land-based prototype plants in propulsion nuclear power plants engineering

    Energy Technology Data Exchange (ETDEWEB)

    Voronin, V.E.; Prokhorov, Yu.A.

    1993-12-31

    Prototype plants provide a powerful tool for accomplishing tasks of development and construction of newly designed new power plants (NPPs). Leaving aside momentary political or economical considerations, one should admit that the use of prototype plants in testing of new NPPs is quite a necessity. To make the most of prototype plant, its commissioning should precede lead plant construction by 2-3 years. To make good use of prototype plants, a set of basic requirements should be fulfilled: greatest possible identity beteen the facility under test and a new series NPP; provision of high performance data acquisitoin, processing and storage firmware and a modelling system using update computer technique; and developed science infrastructure, engineering support and adequate maintenance. Prototype plants should comply with safety requirements to meet environmental protection standards.

  19. Plant cyclins: a unified nomenclature for plant A-, B- and D-type cyclins based on sequence organization.

    Science.gov (United States)

    Renaudin, J P; Doonan, J H; Freeman, D; Hashimoto, J; Hirt, H; Inzé, D; Jacobs, T; Kouchi, H; Rouzé, P; Sauter, M; Savouré, A; Sorrell, D A; Sundaresan, V; Murray, J A

    1996-12-01

    The comparative analysis of a large number of plant cyclins of the A/B family has recently revealed that plants possess two distinct B-type groups and three distinct A-type groups of cyclins. Despite earlier uncertainties, this large-scale comparative analysis has allowed an unequivocal definition of plant cyclins into either A or B classes. We present here the most important results obtained in this study, and extend them to the case of plant D-type cyclins, in which three groups are identified. For each of the plant cyclin groups, consensus sequences have been established and a new, rational, plant-wide naming system is proposed in accordance with the guidelines of the Commission on Plant Gene Nomenclature. This nomenclature is based on the animal system indicating cyclin classes by an upper-case roman letter, and distinct groups within these classes by an arabic numeral suffix. The naming of plant cyclin classes is chosen to indicate homology to their closest animal class. The revised nomenclature of all described plant cyclins is presented, with their classification into groups CycA1, CycA2, CycA3, CycB1, CycB2, CycD1, CycD2 and CycD3. PMID:9002599

  20. Determination and evaluation of the operation characteristics for two configurations of combined heat and power systems depending on the heating plant parameters in low-temperature geothermal applications

    International Nuclear Information System (INIS)

    Highlights: • We analyzed the performances of two CHP plants versus the heating plant parameters. • ORC performance is destructed when raising the heat demand and return temperature. • The low return temperatures enhance the power productivity in the both plants. • The high supply temperature has no impact on ORC in the parallel CHP integration. • The increasing heat demand optimizes the heat source utilization. - Abstract: This paper analyzes impact of the required heating plant parameters on the Organic Rankine Cycle (ORC) power plant and the total plant behavior for two connections of CHP systems; they are the parallel plant and CHP integration according to Glewe-plant, Germany. And also, degree of utilizing the geothermal heat source will be discussed, and all CHP systems presented in the literature will be compared under the same conditions. R134a as working fluid in power plant will be employed. Exergy efficiency, net output power of ORC, irreversibility especially with exhausted geothermal water and the total heat exchange areas will be evaluated. From the calculations, it could be concluded that when operating the power plant in the both aforementioned CHP connections, its performances will be destructed at high heating plant parameters. So the compromised values of the low return temperatures and the heat exchange areas will enhance the power production and the performance of the total CHP systems at unchanged heat demand and supply temperature. The supply temperature does not have any effects on the power generation in case of the parallel connection, while the high values of this temperature affect negatively the other integration. The analysis also proved that the increasing heat demand will reduce the ORC productivity, but it will enhance the heat source utilization. The comparison between the CHP plants showed that the parallel connection is more economical and the series connection is energetically more efficient, while the integration

  1. Reducing imbalances with virtual power plant operation

    OpenAIRE

    Zapata Riveros, Juliana; D'HAESELEER, William; Vandewalle, Jeroen

    2013-01-01

    The penetration of a large amount of distributed generation technologies with intermittent output, such as photovoltaic installations and wind turbines, yields an important challenge to the electric grid. This work illustrates the case of a virtual power plant that consists of several Cogeneration devices (CHP) systems and photovoltaic (PV) installations. The virtual power plant (VPP) operator bids electricity to the day-ahead market using the forecast for solar irradiation. In real time,...

  2. A plant resource and experiment management system based on the Golm Plant Database as a basic tool for omics research

    Directory of Open Access Journals (Sweden)

    Selbig Joachim

    2008-05-01

    Full Text Available Abstract Background For omics experiments, detailed characterisation of experimental material with respect to its genetic features, its cultivation history and its treatment history is a requirement for analyses by bioinformatics tools and for publication needs. Furthermore, meta-analysis of several experiments in systems biology based approaches make it necessary to store this information in a standardised manner, preferentially in relational databases. In the Golm Plant Database System, we devised a data management system based on a classical Laboratory Information Management System combined with web-based user interfaces for data entry and retrieval to collect this information in an academic environment. Results The database system contains modules representing the genetic features of the germplasm, the experimental conditions and the sampling details. In the germplasm module, genetically identical lines of biological material are generated by defined workflows, starting with the import workflow, followed by further workflows like genetic modification (transformation, vegetative or sexual reproduction. The latter workflows link lines and thus create pedigrees. For experiments, plant objects are generated from plant lines and united in so-called cultures, to which the cultivation conditions are linked. Materials and methods for each cultivation step are stored in a separate ACCESS database of the plant cultivation unit. For all cultures and thus every plant object, each cultivation site and the culture's arrival time at a site are logged by a barcode-scanner based system. Thus, for each plant object, all site-related parameters, e.g. automatically logged climate data, are available. These life history data and genetic information for the plant objects are linked to analytical results by the sampling module, which links sample components to plant object identifiers. This workflow uses controlled vocabulary for organs and treatments. Unique

  3. Fail-safe computer-based plant protection systems

    International Nuclear Information System (INIS)

    A fail-safe mode of operation for computers used in nuclear reactor protection systems was first evolved in the UK for application to a sodium cooled fast reactor. The fail-safe properties of both the hardware and the software were achieved by permanently connecting test signals to some of the multiplexed inputs. This results in an unambiguous data pattern, each time the inputs are sequentially scanned by the multiplexer. The ''test inputs'' simulate transient excursions beyond defined safe limits. The alternating response of the trip algorithms to the ''out-of-limits'' test signals and the normal plant measurements is recognised by hardwired pattern recognition logic external to the computer system. For more general application to plant protection systems, a ''Test Signal Generator'' (TSG) is used to compute and generate test signals derived from prevailing operational conditions. The TSG, from its knowledge of the sensitivity of the trip algorithm to each of the input variables, generates a ''test disturbance'' which is superimposed upon each variable in turn, to simulate a transient excursion beyond the safe limits. The ''tripped'' status yielded by the trip algorithm when using data from a ''disturbed'' input forms part of a pattern determined by the order in which the disturbances are applied to the multiplexer inputs. The data pattern formed by the interleaved test disturbances is again recognised by logic external to the protection system's computers. This fail-safe mode of operation of computer-based protection systems provides a powerful defence against common-mode failure. It also reduces the importance of software verification in the licensing procedure. (author)

  4. Computer based aids for operator support in nuclear power plants

    International Nuclear Information System (INIS)

    In the framework of the Agency's programme on nuclear safety a survey was carried out based on a questionnaire to collect information on computer based aids for operator support in nuclear power plants in Member States. The intention was to put together a state-of-the-art report where different systems under development or already implemented would be described. This activity was also supported by an INSAG (International Nuclear Safety Advisory Group) recommendation. Two consultant's meetings were convened and their work is reflected in the two sections of the technical document. The first section, produced during the first meeting, is devoted to provide some general background material on the overall usability of Computerized Operator Decision Aids (CODAs), their advantages and shortcomings. During this first meeting, the first draft of the questionnaire was also produced. The second section presents the evaluation of the 40 questionnaires received from 11 Member States and comprises a short description of each system and some statistical and comparative observations. The ultimate goal of this activity was to inform Member States, particularly those who are considering implementation of a CODA, on the status of related developments elsewhere. 8 refs, 10 figs, 4 tabs

  5. Game-based training environment for nuclear plant control room

    International Nuclear Information System (INIS)

    Nuclear power plant's safety is very important problem. In this very conscientious environment if operator has a little mistake, they may threaten with many people influence their safety. Therefore, operating training of control room is very important. However, the operator training is in limited space and time. Each operator must go to simulative control room do some training. If we can let each trainee having more time to do training and does not go to simulative control room. It may have some advantages for trainee. Moreover, in the traditional training ways, each operator may through the video, teaching manual or through the experienced instructor to learn the knowledge. This training way may let operator feel bored and stressful. So, in this paper aims, we hope utilizing virtual reality technology developing a game-based virtual training environment of control room. Finally, we will use presence questionnaire evaluating realism and feasibility of our virtual training environment. Expecting this initial concept of game-based virtual training environment can attract trainees having more learning motivation to do training in off-hour. (author)

  6. Practical application of risk based management in thermal power plant

    International Nuclear Information System (INIS)

    The paper provides the audience with an insight into the practical application of risk based management at a thermal power station. The paper includes data collection, methodologies to identify and determine the potential impact of risks resulting in the recommendations of practical solutions in order to reduce/eliminate risk within the plants management structure and boiler units. Identification of the risks, potential impact and recommendations for risk reduction within the management structure has been shown to be achievable by reviewing the data collected and comparing the findings with industrial best practices/guidelines such as statutory environmental regulations, knowledge of industry experts and published literature. Implementation risk assessment within the boiler units has been successfully carried out by reviewing the components history, condition assessment, operating conditions/parameters, knowledge of industry experts and compliance with industry guidelines such as the safety of pressure systems ACOP (approved code of practice). The risks have been evaluated to give an output in terms of compliance risk scores using a risk based management template which was developed for ETD's RBM Procedure known as 'RISKFIT'. The ranking of the risk scores has been represented in a spider chart. (orig.)

  7. ITER fast plant system controller prototype based on ATCA platform

    Energy Technology Data Exchange (ETDEWEB)

    Goncalves, B., E-mail: bruno@ipfn.ist.utl.pt [Instituto de Plasmas e Fusao Nuclear - Laboratorio Associado, Instituto Superior Tecnico, Universidade Tecnica de Lisboa, P-1049-001 Lisboa (Portugal); Sousa, J.; Carvalho, B.B.; Batista, A.; Neto, A.; Santos, B.; Duarte, A.; Valcarcel, D.; Alves, D.; Correia, M.; Rodrigues, A.P.; Carvalho, P.F. [Instituto de Plasmas e Fusao Nuclear - Laboratorio Associado, Instituto Superior Tecnico, Universidade Tecnica de Lisboa, P-1049-001 Lisboa (Portugal); Ruiz, M. [Grupo de Investigacion en Instrumentacion y Acustica Aplicada, Universidad Politecnica de Madrid (Spain); Vega, J.; Castro, R. [Centro de Investigaciones Energeticas, Medioambientales y Tecnologicas, CIEMAT, Av. Complutense, Madrid (Spain); Lopez, J.M. [Grupo de Investigacion en Instrumentacion y Acustica Aplicada, Universidad Politecnica de Madrid (Spain); Utzel, N.; Makijarvi, P. [ITER Organization, CS 90 046, 13067 St. Paul lez Durance Cedex (France)

    2012-12-15

    The ITER fast plan system controllers (FPSC) are based on embedded technologies. The FPSCs [1] will be devoted to data acquisition tasks (sampling rates >1 kSPS) and control purposes in closed-control loops whose cycle times are below 1 ms. Fast controllers will be dedicated industrial controllers with the ability to supervise other fast and/or slow controllers and interface to actuators, sensors and high performance networks. This contribution presents an FPSC prototype, specialized for data acquisition, based on the ATCA (Advanced Telecommunications Computing Architecture) standard. This prototyping activity contributes to the ITER Plant Control Design Handbook (PCDH) effort of standardization, specifically regarding fast controller characteristics. For the prototype, IPFN has developed a new family of ATCA modules targeting ITER requirements. This family of modules comprises an AMC (Advanced Mezzanine Card) carrier/data hub/timing hub, compliant with the upcoming ATCA extensions for Physics, and a multi-channel galvanically isolated PnP digitizer, designed for serviceability. The design and test of a peer-to-peer communications layer for the implementation of a reflective memory over PCI Express and the design and test of an IEEE-1588 transport layer over an high performance serial link were also performed. In this contribution, a complete description of the solution is presented as well as the integration of the controller into the standard CODAC environment. The most relevant test results will be addressed, focusing in the benefits and limitations of the applied technologies.

  8. ITER fast plant system controller prototype based on ATCA platform

    International Nuclear Information System (INIS)

    The ITER fast plan system controllers (FPSC) are based on embedded technologies. The FPSCs [1] will be devoted to data acquisition tasks (sampling rates >1 kSPS) and control purposes in closed-control loops whose cycle times are below 1 ms. Fast controllers will be dedicated industrial controllers with the ability to supervise other fast and/or slow controllers and interface to actuators, sensors and high performance networks. This contribution presents an FPSC prototype, specialized for data acquisition, based on the ATCA (Advanced Telecommunications Computing Architecture) standard. This prototyping activity contributes to the ITER Plant Control Design Handbook (PCDH) effort of standardization, specifically regarding fast controller characteristics. For the prototype, IPFN has developed a new family of ATCA modules targeting ITER requirements. This family of modules comprises an AMC (Advanced Mezzanine Card) carrier/data hub/timing hub, compliant with the upcoming ATCA extensions for Physics, and a multi-channel galvanically isolated PnP digitizer, designed for serviceability. The design and test of a peer-to-peer communications layer for the implementation of a reflective memory over PCI Express and the design and test of an IEEE-1588 transport layer over an high performance serial link were also performed. In this contribution, a complete description of the solution is presented as well as the integration of the controller into the standard CODAC environment. The most relevant test results will be addressed, focusing in the benefits and limitations of the applied technologies.

  9. Evaluation of the environmental sustainability of a micro CHP system fueled by low-temperature geothermal and solar energy

    International Nuclear Information System (INIS)

    Highlights: • Binary, ORC technology avoids CO2, but raises questions about environmental impact. • We proposed a micro-size system that combines geothermal energy with solar energy. • The small scale and the solar energy input edges the energy profitability. • The system’s performance is appreciable if applied to existing wells. • The feasibility of exploiting abandoned wells is preliminarily evaluated. - Abstract: In this paper we evaluate the environmental sustainability of a small combined heat and power (CHP) plant operating through an Organic Rankine Cycle (ORC). The heat sources of the system are from geothermal energy at low temperature (90–95 °C) and solar energy. The designed system uses a solar field composed only of evacuated, non-concentrating solar collectors, and work is produced by a single turbine of 50 kW. The project addresses an area of Tuscany, but it could be reproduced in areas where geothermal energy is extensively developed. Therefore, the aim is to exploit existing wells that are either unfit for high-enthalpy technology, abandoned or never fully developed. Furthermore, this project aims to aid in downsizing the geothermal technology in order to reduce the environmental impact and better tailor the production system to the local demand of combined electric and thermal energy. The environmental impact assessment was performed through a Life Cycle Analysis and an Exergy Life Cycle Analysis. According to our findings the reservoir is suitable for a long-term exploitation of the designed system, however, the sustainability and the energy return of this latter is edged by the surface of the heat exchanger and the limited running hours due to the solar plant. Therefore, in order to be comparable to other renewable resources or geothermal systems, the system needs to develop existing wells, previously abandoned

  10. Economic evaluation of IGCC plants with hot gas cleaning

    International Nuclear Information System (INIS)

    Highlights: ► Techno-economic evaluation of hot gas cleaning IGCC power plants in Germany. ► Scenario analysis in light of nuclear phase-out and outdated coal-fired power plants. ► Consideration of Enhanced Oil Recovery (EOR) and combined heat and power (CHP). ► Economic viability is sensitive to heat-to-power ratio, CHP subsidy, and CO2 price. ► Least-cost investment is not necessarily the one with the lowest GHG emissions. -- Abstract: This paper investigates whether coal-fired Integrated Gasification Combined-Cycle (IGCC) power plants can be an economically viable future technology for providing less carbon-intensive electricity and heat energy in Germany than today. In the context of CO2 emission mitigation in power generation, energy conversion technologies enabling the implementation of Carbon Capture and Storage (CCS) need to be considered. IGCC is such a technology, as it utilizes coal but does not necessarily emit CO2. In our study we investigate, from an economic perspective, whether IGCC plants can be an alternative to nuclear and/or conventional coal-fired power plants. The research is based on scenario analysis. The starting point is the expected shut-down of nuclear power stations and outdated coal-fired power plants, as well as the projected evolution of the CO2 price. The hot gas cleaning option in IGCC plants is of particular interest, as it allows a significant enhancement of the efficiency of the IGCC technology and the use of combined heat and power production (CHP). Corresponding supplementary earnings (incl. subsidies) are compared with an increase in specific investment costs. Besides hot gas cleaning, we also investigate the economic impact of injecting pure CO2 (separated from the IGCC process) into oilfields, as Enhanced Oil Recovery (EOR) can help to reduce the costs of CO2 transport and storage. Based on the results from our analysis we find that the replacement of currently operating power plants by IGCC facilities is only

  11. Developing Virtual Power Plant for Optimized Distributed Energy Resources Operation and Integration

    DEFF Research Database (Denmark)

    You, Shi

    units in the electric power system  Efficient electricity market participation to benefit both power system operation and DER owners To address these issues, an innovative concept Virtual Power Plant (VPP) is investigated in this PhD study. Based on a comprehensive overview of the state of the art of...... VPP, the Market-Based VPP (MBVPP) concept is proposed. The function-based MBVPP provides a generic and flexible solution for the DER integration by connecting the DER to the bulk power system operation via market participation. Two schemes for managing the DER generation and trading portfolios, direct...... based on forecasted market and demand information. For the proposed price signal scheme, an Artificial Neural Network (ANN) is developed to characterize and estimate the price responsiveness of a μCHP group. It is found that although the prognosis result is relatively good, the price signal controlled...

  12. Model based optimization of biogas production at SNJ plant

    OpenAIRE

    Popov, Jovan

    2010-01-01

    The main purpose of this thesis is the acquisition of knowledge and familiarization with the SNJ biogas plant and effects of codigestion. Plant operation and performance was monitored in order to understand and evaluate the factors affecting the efficiency of the sludge treatment process. The thesis also presents an overview of anaerobic digestion process, modelling of anaerobic codigestion process, and a general presentation of the Regional Wastewater Treatment Plant of Nord‐J...

  13. New approach for risk based inspection of H2S based Process Plants

    International Nuclear Information System (INIS)

    Highlights: • Study looks into improving the consequence evaluation in risk based inspection. • Ways to revise the quantity factors used in qualitative approach. • New approach based on computational fluid dynamics along with probit mathematics. • Demonstrated this methodology along with a suitable case study for the said issue. - Abstract: Recent trend in risk informed and risk based approaches in life management issues have certainly put the focus on developing estimation methods for real risk. Idea of employing risk as an optimising measure for in-service inspection, termed as risk based inspection, was accepted in principle from late 80s. While applying risk based inspection, consequence of failure from each component needs to be assessed. Consequence evaluation in a Process Plant is a crucial task. It may be noted that, in general, the number of components to be considered for life management is very large and hence the consequence evaluation resulting from their failures (individually) is a laborious task. Screening of critical components is usually carried out using simplified qualitative approach, which primarily uses influence factors for categorisation. This necessitates logical formulation of influence factors and their ranges with a suitable technical basis for acceptance from regulators. This paper describes application of risk based inspection for H2S based Process Plant along with the approach devised for handling the influence factor related to the quantity of H2S released

  14. Development of web based performance analysis program for nuclear power plant turbine cycle

    International Nuclear Information System (INIS)

    Performance improvement of turbine cycle affects economic operation of nuclear power plant. We developed performance analysis system for nuclear power plant turbine cycle. The system is based on PTC (Performance Test Code), that is estimation standard of nuclear power plant performance. The system is developed using Java Web-Start and JSP(Java Server Page)

  15. TRADITIONAL WISDOM WITH THE FOREST DWELLERS OF GUJARAT STATE FOR PLANT BASED FISH CATCH

    Directory of Open Access Journals (Sweden)

    M. J. PARMAR*1, A. R. BADHEKA1 AND B. K. JAIN2

    2014-06-01

    Full Text Available The paper deals with the traditional wisdom of the forest dwellers on plant based fish catch. Scientific names, local names, family, plant parts used and modes of administration of 17 plant species used as fish toxicants have been discussed in the present paper. The data presented here are outcome of various field excursions made during past twenty months.

  16. Knowledge-based and model-based hybrid methodology for comprehensive waste minimization in electroplating plants

    Science.gov (United States)

    Luo, Keqin

    1999-11-01

    The electroplating industry of over 10,000 planting plants nationwide is one of the major waste generators in the industry. Large quantities of wastewater, spent solvents, spent process solutions, and sludge are the major wastes generated daily in plants, which costs the industry tremendously for waste treatment and disposal and hinders the further development of the industry. It becomes, therefore, an urgent need for the industry to identify technically most effective and economically most attractive methodologies and technologies to minimize the waste, while the production competitiveness can be still maintained. This dissertation aims at developing a novel WM methodology using artificial intelligence, fuzzy logic, and fundamental knowledge in chemical engineering, and an intelligent decision support tool. The WM methodology consists of two parts: the heuristic knowledge-based qualitative WM decision analysis and support methodology and fundamental knowledge-based quantitative process analysis methodology for waste reduction. In the former, a large number of WM strategies are represented as fuzzy rules. This becomes the main part of the knowledge base in the decision support tool, WMEP-Advisor. In the latter, various first-principles-based process dynamic models are developed. These models can characterize all three major types of operations in an electroplating plant, i.e., cleaning, rinsing, and plating. This development allows us to perform a thorough process analysis on bath efficiency, chemical consumption, wastewater generation, sludge generation, etc. Additional models are developed for quantifying drag-out and evaporation that are critical for waste reduction. The models are validated through numerous industrial experiments in a typical plating line of an industrial partner. The unique contribution of this research is that it is the first time for the electroplating industry to (i) use systematically available WM strategies, (ii) know quantitatively and

  17. Increasing of Manoeuvrability of Cogeneration Combined Cycle Power Plants Owing to the Usage of Electric Boilers

    Directory of Open Access Journals (Sweden)

    S. Kachan

    2014-09-01

    Full Text Available The paper contains the results of efficiency evaluation  of using the electric boilers to improve maneuver capabilities of the cogeneration combined cycle power plants (as an example, 230 MW combined cycle unit of Minsk CHP-3 in comparison with the traditional steam-turbine units of cogeneration power plants.

  18. Increasing of Manoeuvrability of Cogeneration Combined Cycle Power Plants Owing to the Usage of Electric Boilers

    OpenAIRE

    S. Kachan; I. Baranovski

    2014-01-01

    The paper contains the results of efficiency evaluation  of using the electric boilers to improve maneuver capabilities of the cogeneration combined cycle power plants (as an example, 230 MW combined cycle unit of Minsk CHP-3) in comparison with the traditional steam-turbine units of cogeneration power plants.

  19. Building and Researching the Bidding Model Based on the Cost of Power Plant

    Institute of Scientific and Technical Information of China (English)

    秦春申; 叶春; 赵景峰

    2004-01-01

    A bidding model of neural network was presented to pursue the largest benefit according to the policy of separating power plants from network and bidding transaction. This model bases on the cost of power plant and its research object is a power plant in the market. The market clearing price (MCP) can be predicted and an optimized load curve can be decided in this model. The model may provide technical support for the power plant.

  20. Modelling of a CHP SOFC system fed with biogas from anaerobic digestion of municipal waste integrated with solar collectors and storage unit

    Directory of Open Access Journals (Sweden)

    Domenico Borello

    2012-12-01

    Full Text Available The paradigm of the sustainable energy community is recognized as the future energy approach due to its economical, technical and environmental benefits. Future systems should integrate renewable energy systems applying a “community-scale” approach to maximize energy performances, while minimizing environmental impacts. Efforts have to be directed toward the promotion of integrated technical systems needed to expand the use of renewable energy resources, to build sustainable local and national energy networks, to guarantee distribution systems for urban facilities and to reduce pollution. In this framework poly-generation is a promising design perspective, for building and district scale applications, in particular where different types of energy demand are simultaneously present and when sufficient energy intensity justifies investments in smart grids and district heating networks. In situ anaerobic digestion of biomass and organic waste has the potential to provide sustainable distributed generation of electric power together with a viable solution for the disposal of municipal solid wastes. A thermal recovery system can provide the heat required for district-heating. The system analysed is a waste-to-energy combined heat and power (CHP generation plant that perfectly fits in the sustainable energy community paradigm. The power system is divided in the following sections: a a mesophilic - single phase anaerobic digestion of Organic Fraction of Municipal Solid Waste for biogas production; b a fuel treatment section with desulphurizer and pre-reformer units; c a Solid Oxide Fuel Cell (SOFC for CHP production; d a solar collector integrated system(integrated storage system - ISS. An integrated TRNSYS/ASPEN Plus model for simulating the power system behaviour during a typical reference period (day or year was developed and presented. The proposed ISS consists of a solar collector integrated with storage systems system designed to

  1. EWS based visual and interactive simulator for plant engineering

    International Nuclear Information System (INIS)

    The 'Plant Engineering Visual and Interactive Simulator (PLEVIS)' is a realtime plant engineering simulator and runs on a general-purpose desk-top engineering workstation with a high-resolution bit-mapped display. PLEVIS is unique in that simulation models are integrated with a control/interlock model editor. PLEVIS can be used in a wide variety of applications, some of which are: (1) Design and modification studies of a control and interlock system, (2) Plant response evaluation for plant start-up testing and troubleshooting, (3) Transient recognition and mitigation studies, and (4) Familiarization with the plant process and control/ interlock system concept. The basic features of PLEVIS in order to realize the above applications are described in the presentation. (1 ref., 6 figs.)

  2. Design of XML-based plant data model

    International Nuclear Information System (INIS)

    XML has emerged as an open standard for exchanging structured data on various platforms to handle rich, nested, complex data structures. XML with its flexible tree-like data structure allows a more natural representation as compared to traditional databases. In this paper we present data model for plant data acquisition systems captured using XML technologies. Plant data acquisition systems in a typical Nuclear Power Plant consists of embedded nodes at the first tier and operator consoles at the second tier for operator operation, interaction and display of Plant parameters. This paper discusses a generic data model that was designed to capture process, network architecture, communication/interface protocol and diagnostics aspects required for a Nuclear Power Plant. (author)

  3. Concept of laser fusion power plant based on fast ignition

    International Nuclear Information System (INIS)

    This paper introduces new concept of laser fusion that is expected to demonstrate energy generation based on inertial fusion in the near future. In the fast ignition (FI) scheme, a spherical hollow solid deuterium-tritium fuel is compressed to a high density of 1000 times solid density with tens nano-second laser pulses from a compression laser and the compressed fuel core is directly heated to 5 keV with a ten pico-second laser pulse from a heating laser. This FI scheme enables us to design an IFE power plant with a 1MJ-class, compact laser whose output energy is 1/4 of previous central ignition scheme. Recent progress on cooled Yb-YAG ceramic laser revealed that highly efficient compression and heating lasers can be constructed using this laser material with acceptable construction cost including laser diodes for pumping and the refrigerator. New reactor scheme for a liquid wall reactor that has no stagnation point of ablated gas and a rotary shutter system to protect the final optics are proposed. Current computer simulation indicates thermonuclear gain of 160 will be achieved with 1.1 MJ / 10 ns compression lasers and a 100 kJ/10 ps heating laser. A diode-pumped, cooled, Yb-YAG ceramic-laser is the prior candidate for the compression laser operated at 16 Hz rep rate. The conversion efficiencies from electricity to laser are 9.5% for the compression laser, 3.5% for the heating laser, and 6.9% in total including cooling power, respectively. The power plant consists of 4 module reactors powered by one laser system. One module reactor has 32 compression beams, one heating laser, and two target injectors as shown. Each beam port has a rotary shutter and an electro magnet to prevent the final optics from neutral vapor and ions, respectively. The panels of the first wall are tilted by 30 degree to avoid stagnation of evaporated vapor at the chamber center. The focus position is vertically off set to simplify the protection mechanism of the ceiling. (author)

  4. Combined Heat and Power (CHP) as a Compliance Option under the Clean Power Plan: A Template and Policy Options for State Regulators

    Energy Technology Data Exchange (ETDEWEB)

    None

    2015-07-30

    Combined Heat and Power (CHP) is an important option for states to consider in developing strategies to meet their emission targets under the US Environmental Protection Agency's Clean Power Plan. This Template is designed to highlight key issues that states should consider when evaluating whether CHP could be a meaningful component of their compliance plans. It demonstrates that CHP can be a valuable approach for reducing emissions and helping states achieve their targets. While the report does not endorse any particular approach for any state, and actual plans will vary dependent upon state-specific factors and determinations, it provides tools and resources that states can use to begin the process, and underscores the opportunity CHP represents for many states. . By producing both heat and electricity from a single fuel source, CHP offers significant energy savings and carbon emissions benefits over the separate generation of heat and power, with a typical unit producing electricity with half the emissions of conventional generation. These efficiency gains translate to economic savings and enhanced competitiveness for CHP hosts, and emissions reductions for the state, along with helping to lower electric bills; and creating jobs in the design, construction, installation and maintenance of equipment. In 2015, CHP represents 8 percent of electric capacity in the United States and provides 12 percent of total power generation. Projects already exist in all 50 states, but significant technical and economic potential remains. CHP offers a tested way for states to achieve their emission limits while advancing a host of ancillary benefits.

  5. Analysis of the Impact of Decreasing District Heating Supply Temperature on Combined Heat and Power Plant Operation

    Directory of Open Access Journals (Sweden)

    Bolonina Alona

    2014-12-01

    Full Text Available District heating systems are widely used to supply heat to different groups of heat consumers. The district heating system offers great opportunities for combined heat and power production. In this paper decreasing district heating supply temperature is analysed in the context of combined heat and power plant operation. A mathematical model of a CHP plant is developed using both empirical and theoretical equations. The model is used for analysis of modified CHP plant operation modes with reduced district heating supply temperature. Conclusions on the benefits of new operation modes are introduced.

  6. Analysis of the Impact of Decreasing District Heating Supply Temperature on Combined Heat and Power Plant Operation

    Science.gov (United States)

    Bolonina, Alona; Bolonins, Genadijs; Blumberga, Dagnija

    2014-12-01

    District heating systems are widely used to supply heat to different groups of heat consumers. The district heating system offers great opportunities for combined heat and power production. In this paper decreasing district heating supply temperature is analysed in the context of combined heat and power plant operation. A mathematical model of a CHP plant is developed using both empirical and theoretical equations. The model is used for analysis of modified CHP plant operation modes with reduced district heating supply temperature. Conclusions on the benefits of new operation modes are introduced.

  7. Liposome-Based Delivery Systems in Plant Polysaccharides

    International Nuclear Information System (INIS)

    Plant polysaccharides consist of many monosaccharide by α or β glycosidic bond which can be extracted by the water, alcohol, lipophile liquid from a variety of plants including Cordyceps sinensis, astragalus, and mushrooms. Recently, many evidences illustrate that natural plant polysaccharides possess various biological activities including strengthening immunity, lowering blood sugar, regulating lipid metabolism, anti oxidation, anti aging, and antitumour. Plant polysaccharides have been widely used in the medical field due to their special features and low toxicity. As an important drug delivery system, liposomes can not only encapsulate small-molecule compound but also big-molecule drug; therefore, they present great promise for the application of plant polysaccharides with unique physical and chemical properties and make remarkable successes. This paper summarized the current progress in plant polysaccharides liposomes, gave an overview on their experiment design method, preparation, and formulation, characterization and quality control, as well as in vivo and in vitro studies. Moreover, the potential application of plant polysaccharides liposomes was prospected as well.

  8. Liposome-Based Delivery Systems in Plant Polysaccharides

    Directory of Open Access Journals (Sweden)

    Meiwan Chen

    2012-01-01

    Full Text Available Plant polysaccharides consist of many monosaccharide by α- or β-glycosidic bond which can be extracted by the water, alcohol, lipophile liquid from a variety of plants including Cordyceps sinensis, astragalus, and mushrooms. Recently, many evidences illustrate that natural plant polysaccharides possess various biological activities including strengthening immunity, lowering blood sugar, regulating lipid metabolism, antioxidation, antiaging, and antitumour. Plant polysaccharides have been widely used in the medical field due to their special features and low toxicity. As an important drug delivery system, liposomes can not only encapsulate small-molecule compound but also big-molecule drug; therefore, they present great promise for the application of plant polysaccharides with unique physical and chemical properties and make remarkable successes. This paper summarized the current progress in plant polysaccharides liposomes, gave an overview on their experiment design method, preparation, and formulation, characterization and quality control, as well as in vivo and in vitro studies. Moreover, the potential application of plant polysaccharides liposomes was prospected as well.

  9. In-plant reliability data base for nuclear plant components: a feasibility study on human error information

    International Nuclear Information System (INIS)

    This report documents the procedure and final results of a feasibility study which examined the usefulness of nuclear plant maintenance work requests in the IPRDS as tools for understanding human error and its influence on component failure and repair. Developed in this study were (1) a set of criteria for judging the quality of a plant maintenance record set for studying human error; (2) a scheme for identifying human errors in the maintenance records; and (3) two taxonomies (engineering-based and psychology-based) for categorizing and coding human error-related events

  10. SOSYAL POLİTİKA AÇISINDAN CHP İLE AKP’NİN KARŞILAŞTIRILMASI

    OpenAIRE

    YURDAKUL, Nilay BAŞOK; DİNÇER, Müjde Ker; BAT, Mikail

    2012-01-01

    Bu çalışmada siyasal yelpazedeki yerini sosyal demokrat olarak tanımlayan CHP ile muhafazakâr sağ olarak tanımlayan AKP’nin, tarihsel ve betimsel araştırma yöntemleri ışığında benimsediği ekonomi anlayışının ortaya konularak, izledikleri sosyal politikaların bu çerçevede irdelenmesi amaçlanmıştır. Bu bağlamda, CHP ile AKP’nin ekonomi politikası ortaya konduktan sonra, her iki partinin ekonomi politikaları benzerlik ve farklılık bakımından karşılaştırılmıştır. Daha sonra da CHP ile AKP’nin iz...

  11. Promoter-Based Integration in Plant Defense Regulation

    DEFF Research Database (Denmark)

    Li, Baohua; Gaudinier, Allison; Tang, Michelle;

    2014-01-01

    A key unanswered question in plant biology is how a plant regulates metabolism to maximize performance across an array of biotic and abiotic environmental stresses. In this study, we addressed the potential breadth of transcriptional regulation that can alter accumulation of the defensive...... validation, we showed that >75% of tested transcription factor (TF) mutants significantly altered the accumulation of the defensive glucosinolates. These glucosinolate phenotypes were conditional upon the environment and tissue type, suggesting that these TFs may allow the plant to tune its defenses to the...

  12. Decision Support Tools for Electricity Retailers, Wind Power and CHP Plants Using Probabilistic Forecasts

    Directory of Open Access Journals (Sweden)

    Marco Zugno

    2015-06-01

    Full Text Available This paper reviews a number of applications of optimization under uncertainty in energy markets resulting from the research project ENSYMORA. A general mathematical formulation applicable to problems of optimization under uncertainty in energy markets is presented. This formulation can be effortlessly adapted to describe different approaches: the deterministic one (usable within a rolling horizon scheme, stochastic programming and robust optimization. The different features of this mathematical formulation are duly interpreted with a view to the energy applications reviewed in this paper: trading for a price-maker wind power producer, management of heat and power systems, operation for retailers in a dynamic-price market. A selection of results shows the viability and appropriateness of the presented stochastic optimization approaches for managing energy systems under uncertainty.

  13. The Role of CHP Plants in the Integration of Fluctuating Renewable Energy Sources

    DEFF Research Database (Denmark)

    Lund, Henrik

    2002-01-01

    The paper is an Expression of Interest to the European Commission about renewable energy sources and their integration in a energy system......The paper is an Expression of Interest to the European Commission about renewable energy sources and their integration in a energy system...

  14. Regional Energy Systems with Retrofitted Combined Heat and Power (CHP) Plants

    OpenAIRE

    Han, Song

    2012-01-01

    Fossil fuel depletion, economic development, urban expansion and climate change present tough challenges to municipal- and regional-scale energy systems. Regional energy system planning, including waste treatment, renewable energy supply, energy efficiency, and climate change, are considered essential to meet these challenges and move toward a sustainable society. This thesis includes studies on energy system from municipal waste, potential for a fossil fuel-independent regional energy system...

  15. Sizing of a CHP plant: a case study for Dublin City University

    OpenAIRE

    Abd-Elkarim, Tarik

    2004-01-01

    Dublin City University (DCU) occupies an 85 acre campus that includes the main academic and administrative buildings as well as residence accommodation. The university has a low-pressure hot water (LPHW) heating system fed from a central boiler house and electrical power provided by the ESB. DCU’s electrical and thermal power consumption has sharply increased in the last few years due to rapid expansion, which has lead the university to focus on the high cost of its heating and power bills. A...

  16. Renewables and CHP with District Energy in Support of Sustainable Communities

    Energy Technology Data Exchange (ETDEWEB)

    Snoek, Chris

    2010-09-15

    This paper addresses the powerful idea of connecting many energy users to environmentally optimum energy sources through integrated community energy systems. Such systems require piping networks for distributing thermal energy, i.e., district heating and cooling (DHC) systems. The possibilities and advantages of the application of integrated energy concepts are discussed, including the economic and environmental benefits of integrating localized electrical generating systems (CHP), transportation systems, industrial processes and other thermal energy requirements. Examples of a number of operating systems are provided. Some of the R and D carried out by the IEA Implementing Agreement on District Heating and Cooling is also described.

  17. Plant-based insect repellents: a review of their efficacy, development and testing.

    OpenAIRE

    Maia Marta; Moore Sarah J

    2011-01-01

    Abstract Plant-based repellents have been used for generations in traditional practice as a personal protection measure against host-seeking mosquitoes. Knowledge on traditional repellent plants obtained through ethnobotanical studies is a valuable resource for the development of new natural products. Recently, commercial repellent products containing plant-based ingredients have gained increasing popularity among consumers, as these are commonly perceived as “safe” in comparison to long-esta...

  18. Legal bases for the installation of nuclear power plants

    International Nuclear Information System (INIS)

    The process of installation of nuclear power plants in the context of the Brazilian legal system is analysed. The structure of the political and administrative system related to the matter and the correspondent legislation are discussed. (A.L.)

  19. Multimedia-based Medicinal Plants Sustainability Management System

    OpenAIRE

    Zacchaeus Omogbadegun; Charles Uwadia; Charles Ayo; Victor Mbarika; Nicholas Omoregbe; Efe Otofia; Frank Chieze

    2011-01-01

    Medicinal plants are increasingly recognized worldwide as an alternative source of efficacious and inexpensive medications to synthetic chemo-therapeutic compound. Rapid declining wild stocks of medicinal plants accompanied by adulteration and species substitutions reduce their efficacy, quality and safety. Consequently, the low accessibility to and non-affordability of orthodox medicine costs by rural dwellers to be healthy and economically productive further threaten their life expectancy. ...

  20. Bio based cogeneration plants in Sweden; Biobaserte kraftvarmeverk i Sverige

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2005-07-01

    Cogeneration plants using bio fuel need a certificate in the Swedish electricity certificate system. Since the initiation of the system in 2003 the plants have taken advantage of the possibility of switching from fossil, to bio fuel. However, there is a potential for additional bio power production, provided that there is a market for the produced heating. The certificate system may contribute to an acceleration of investments in new capacities, and the facilitation of increased bio power production.

  1. Improved plant availability by advanced condition based inspections

    International Nuclear Information System (INIS)

    An industrial plant has to operate safely, reliably and efficiently at the lowest possible cost. Plant availability plays an important role regarding economic life optimisation. Industrial installations that are under pressure and are operating at high temperatures have a limited life due to creep and fatigue. It is, therefore, of critical importance to know the location of any possible weak spots in the installation. To avoid safety risks, unplanned plant shutdown and, as a consequence, high costs for unavailability, cycling and repair, periodic inspections and strain measurements are recommended. A Speckle Image Correlation Analysis (SPICA) system enables on-stream measurement of deformation due to creep in critical areas like the heat-affected zone in welds. Plant management and operators use the strain measurements to take action when necessary and, consequently, prevent failures. In those plants that have been provided with SPICA-technology for some years plant availability has improved significantly as a result. Another important development for yielding improved availability concerns steam drums. During some 20 years, KEMA has been performing automated ultrasonic steam drum inspections from outside. The Dutch authorities accepted this methodology in this period as an alternative (rather than an addition) after several pilot projects. An advantage of this inspection methodology is the possibility to record of the inspection results and possibility of thus trending these data. The resulting reduction of through time appeared a major benefit for plant owners. Since the authorities adopted the RBI approach during the last 10 years, another advantage of the inspection methodology became apparent: complete scanning and recording of the inspection data of circumferential and longitudinal (butt and fillet) welds, inspection of nozzle welds and inner radius as well as corrosion mapping has been covering all higher risk areas in these drums. This enhanced inspection

  2. Stabilization Based Networked Predictive Controller Design for Switched Plants

    OpenAIRE

    Routh, Avijit; Das, Sourav; Das, Saptarshi; Pan, Indranil

    2012-01-01

    Stabilizing state feedback controller has been designed in this paper for a switched DC motor plant, controlled over communication network. The switched system formulation for the networked control system (NCS) with additional switching in a plant parameter along with the switching due to random packet losses, have been formulated as few set of non-strict Linear Matrix Inequalities (LMIs). In order to solve non-strict LMIs using standard LMI solver and to design the stabilizing state feedback...

  3. Plant response-based sensing for control starategies in sustainable greenhouse production

    International Nuclear Information System (INIS)

    The effect of environmental variability is one of the major concerns in experimental design for both research in plant systems and greenhouse plant production. Microclimates surrounding plants are not usually uniform. Therefore, many samples and sensors are required to obtain a true representation of the plant population. A plant monitoring system capable of reducing the required number of samples by reducing environmental variability would be more advantageous. To better understand plant-environment interaction, it is essential to study plants, microclimate surrounding the plants and the growth media. To achieve this, the monitoring system must be equipped with proper instrumentation. To achieve proper management practices and sustainable greenhouse production, it is essential first to understand plants and their interactions with their surroundings and then establish plant response-based sensing and control strategies for greenhouse processes. Therefore, an effort was conducted to review and discuss current sensing and control strategies in greenhouse research and plant production and provide recommendations on plant response-based sensing and control strategies for sustainable greenhouse production

  4. Development of a knowledge-based information management system for plant maintenance

    International Nuclear Information System (INIS)

    Recently, the importance of Plant Maintenance(PM) was highly raised to provide efficient plant operation which highly affects the productivity. For this reason, a number of engineering methodologies, such as Risk-Based Inspection(RBI), Fitness For Service guidelines(FFS), Plant Lifecycle Management(PLM), have been applied to improve the plant operation efficiency. Also, a network-based business operation system, which is called ERP(Enterprise Resource Planning), has been introduced in the field of plant maintenance. However, there was no attempt to connect engineering methodologies to the ERP PM system. In this paper, a knowledge-based information system for the plant operation of steel making company has been proposed. This system, which is named as K-VRS(Knowledge-based Virtual Reality System), provides a connection between ERP plant maintenance module and knowledge-based engineering methodologies, and thus, enables network-based highly effective plant maintenance process. The developed system is expected to play a great role for more efficient and safer plant maintenance

  5. Development of a knowledge-based information management system for plant maintenance

    Energy Technology Data Exchange (ETDEWEB)

    Yim, Hyung Sang; Park, Young Jae; Lee, Sang Min; Choi, Jae Boong; Kim, Young Jin [Sungkyunkwan Univ., Seoul (Korea, Republic of); Roh, Eun Chul; Lee, Byung Ine [Pohang Iron and Steel Company, Pohang (Korea, Republic of)

    2003-07-01

    Recently, the importance of Plant Maintenance(PM) was highly raised to provide efficient plant operation which highly affects the productivity. For this reason, a number of engineering methodologies, such as Risk-Based Inspection(RBI), Fitness For Service guidelines(FFS), Plant Lifecycle Management(PLM), have been applied to improve the plant operation efficiency. Also, a network-based business operation system, which is called ERP(Enterprise Resource Planning), has been introduced in the field of plant maintenance. However, there was no attempt to connect engineering methodologies to the ERP PM system. In this paper, a knowledge-based information system for the plant operation of steel making company has been proposed. This system, which is named as K-VRS(Knowledge-based Virtual Reality System), provides a connection between ERP plant maintenance module and knowledge-based engineering methodologies, and thus, enables network-based highly effective plant maintenance process. The developed system is expected to play a great role for more efficient and safer plant maintenance.

  6. Economic potentials of CHP connected to district heat systems in Germany. Implementation of the EU Efficiency Directive

    International Nuclear Information System (INIS)

    The EU Efficiency Directive (2012/27/EU) is requiring all member states to carry out an evaluation of the potential for highly efficient CHP and the efficient use of district heating and cooling by December 2015. The German Federal Ministry of Economic Affairs and Energy appointed this task to the Fraunhofer Institute for Manufacturing and Advanced Materials, division for Energy Systems Analysis (formerly Bremer Energie Institut) in conjunction with other partners. The results for the sector district- and communal heating with CHP, sub-sectors private households, trade and services industry, are presented in this article.

  7. Assessment of the implementation issues for fuel cells in domestic and small scale stationary power generation and CHP applications

    Energy Technology Data Exchange (ETDEWEB)

    Graham, G.; Cruden, A.; Hart, J.

    2002-07-01

    This report discusses implementation issues associated with the use of fuel cells in <10 kW domestic, small-scale power generation and combined heat and power (CHP) operations in the UK. The report examines the key issues (fuel cell system standards and certification, fuel infrastructure, commercial issues and competing CHP technologies), before discussing non-technical issues including finance, ownership, import and export configuration, pricing structure, customer acceptability, installation, operation and training of servicing and commissioning personnel. The report goes on to discuss market and technical drivers, grid connection issues and solutions, operations and maintenance. Recommendations for the future are made.

  8. Energy-optimisation of biogas-fuelled CHP units; Energetische Optimierung von Biogas-BHKW's

    Energy Technology Data Exchange (ETDEWEB)

    Soltic, P.; Edenhauser, D.; Winkler, A.

    2008-07-15

    This illustrated final report for the Swiss Federal office of Energy (SFOE) reports on the energy-related optimisation of combined heat and power (CHP) units that are fuelled with non-processed biogas. Ways of increasing the efficiency of these units as far as the production of electricity is concerned are examined and commented on. Also, ways of using the heat generated by the CHP units to produce electricity using other, exergetic means are also described. Systems such as Stirling engines and existing and new thermo-electrical elements are discussed. The economic viability of the systems is also discussed.

  9. Plant biostimulants: physiological responses induced by protein hydrolyzed-based products and humic substances in plant metabolism

    Directory of Open Access Journals (Sweden)

    Serenella Nardi

    2016-02-01

    Full Text Available ABSTRACT In recent years, the use of biostimulants in sustainable agriculture has been growing. Biostimulants can be obtained from different organic materials and include humic substances (HS, complex organic materials, beneficial chemical elements, peptides and amino acids, inorganic salts, seaweed extracts, chitin and chitosan derivatives, antitranspirants, amino acids and other N-containing substances. The application of biostimulants to plants leads to higher content of nutrients in their tissue and positive metabolic changes. For these reasons, the development of new biostimulants has become a focus of scientific interest. Among their different functions, biostimulants influence plant growth and nitrogen metabolism, especially because of their content in hormones and other signalling molecules. A significant increase in root hair length and density is often observed in plants treated with biostimulants, suggesting that these substances induce a “nutrient acquisition response” that favors nutrient uptake in plants via an increase in the absorptive surface area. Furthermore, biostimulants positively influence the activity and gene expression of enzymes functioning in the primary and secondary plant metabolism. This article reviews the current literature on two main classes of biostimulants: humic substances and protein-based biostimulants. The characteristic of these biostimulants and their effects on plants are thoroughly described.

  10. Reducing nuclear plant cost and enhancing safety by reliability based maintenance

    International Nuclear Information System (INIS)

    The nuclear power industry and the government agencies recognize that the growing maturity of nuclear plants, as well as concern for plant outages, necessitates attention to surveillance and maintenance. This paper provides an overview of reliability based maintenance which is available to reduce (optimize) plant costs while maintaining or enhancing plant safety. Categorization of the various types of nuclear plant maintenance is provided as a foundation for maintenance program definition. A technique for maintenance feasibility review is presented, using a decision logic tree to assist the engineering and maintenance staff

  11. PERFORMANCE ANALYSIS OF l kW RESIDENTIAL SOFC-CHP SYSTEM%1kW家用SOFC-CHP系统建模及性能分析

    Institute of Scientific and Technical Information of China (English)

    徐晗; 党政; 白博峰

    2011-01-01

    A combined heating and power system (CHP) driven by natrual gas was established based on solid oxide fuel cell (SOFC), relevant SOFC heat and mass transfer equations as well as electrochemical equations were deduced, and component models were built and solved by FORTRAN as a tool to predict the system performance of a 1 kW residential SOFC-CHP system. The results indicate that the system efficiency is much higher than the generating efficiency of SOFC under the design-point condition. A maximum value of electric power appears with the increase of the inlet fuel flow, fuel utilization and electric efficiency decrease, system cogeneration efficiency experiences a rising trend, and the cell temperature gradient distribution becomes growingly even. Reducing the excess air ratio could enhance the system performance.The above conclusions are very useful for the design and optimization of the residential SOFC-CHP system.%构建一个以天然气为燃料的SOFC-CHP系统,推导SOFC传热传质及电化学方程,建立各个组件的数学模型,编写计算程序,对发电功率为1kW的家用SOFC-CHP系统在设计工况下进行性能模拟并探讨不同系统参数对性能的影响.计算结果表明:在设计工况下,系统热电联供效率远高于电池单独发电的效率;此外,随着燃料入口流量的增大,系统发电功率存在一个最大值,燃料利用率与发电效率不断减小,系统热电联供效率不断增大,SOFC的温度梯度分布则越来越平缓;同时发现降低过量空气系数可以提高该CHP系统的性能.

  12. Nuclear Power Plants Fault Diagnosis Method Based on Data Fusion

    International Nuclear Information System (INIS)

    The data fusion is a method suit for complex system fault diagnosis such as nuclear power plants, which is multisource information processing technology. This paper uses data fusion information hierarchical thinking and divides nuclear power plants fault diagnosis into three levels. Data level adopts data mining method to handle data and reduction attributes. Feature level uses three parallel neural networks to deal with attributes of data level reduction and the outputs of three networks are as the basic probability assignment of Dempster-Shafer (D-S) evidence theory. The improved D-S evidence theory synthesizes the outputs of neural networks in decision level, which conquer the traditional D-S evidence theory limitation which can't dispose conflict information. The diagnosis method was tested using correlation data of literature. The test results indicate that the data fusion diagnosis system can diagnose nuclear power plants faults accurately and the method has application value. (authors)

  13. Synchrophasor Measurement-Based Wind Plant Inertia Estimation: Preprint

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Y.; Bank, J.; Wan, Y. H.; Muljadi, E.; Corbus, D.

    2013-05-01

    The total inertia stored in all rotating masses that are connected to power systems, such as synchronous generations and induction motors, is an essential force that keeps the system stable after disturbances. To ensure bulk power system stability, there is a need to estimate the equivalent inertia available from a renewable generation plant. An equivalent inertia constant analogous to that of conventional rotating machines can be used to provide a readily understandable metric. This paper explores a method that utilizes synchrophasor measurements to estimate the equivalent inertia that a wind plant provides to the system.

  14. Development of a Wood Powder Fuelled 35 kW Stirling CHP Unit

    DEFF Research Database (Denmark)

    Pålsson, M.; Carlsen, Henrik

    2003-01-01

    For biomass fuelled CHP in sizes below 100 kW, Stirling engines are the only feasible alternative today. Using wood powder as fuel, the Stirling engine can be heated directly by the flame like when using a gaseous or liquid fuel burner. However, the combustion chamber will have to be much larger...... recirculation (CGR) a smaller air preheater can be used, while system efficiency will increase compared with using excess air for flame cooling. In a three-year project, a wood powder fuelled Stirling engine CHP unit will be developed and run in field test. The project will use the double-acting four......-cylinder Stirling engine SM3D with an electric output of 35 kW. This engine is a further development of the engine SM3B that has been developed at the Technical University of Denmark. The engine heater is being adapted for use with wood powder as fuel. During a two-year period a combustion system for this engine...

  15. Economic Potential of CHP in Detroit Edison Service Area: the Customer Perspective

    Energy Technology Data Exchange (ETDEWEB)

    Kelly, J.

    2003-10-10

    can realistically be expected, based on consumer investment in combined heat and power systems (CHP) and the effect of utility applied demand response (DR). (2) Evaluate and quantify the impact on the distribution utility feeder from the perspective of customer ownership of the DE equipment. (3) Determine the distribution feeder limits and the impact DE may have on future growth. For the case study, the Gas Technology Institute analyzed a single 16-megawatt grid feeder circuit in Ann Arbor, Michigan to determine whether there are economic incentives to use small distributed power generation systems that would offset the need to increase grid circuit capacity. Increasing circuit capacity would enable the circuit to meet consumer's energy demands at all times, but it would not improve the circuit's utilization factor. The analysis spans 12 years, to a planning horizon of 2015. By 2015, the demand for power is expected to exceed the grid circuit capacity for a significant portion of the year. The analysis was to determine whether economically acceptable implementation of customer-owned DE systems would reduce the peak power demands enough to forestall the need to upgrade the capacity of the grid circuit. The analysis was based on economics and gave no financial credit for improved power reliability or mitigation of environmental impacts. Before this study was completed, the utility expanded the capacity of the circuit to 22 MW. Although this expansion will enable the circuit to meet foreseeable increases in peak demand, it also will significantly decrease the circuit's overall utilization factor. The study revealed that DE penetration on the selected feeder is not expected to forestall the need to upgrade the grid circuit capacity unless interconnection barriers are removed. Currently, a variety of technical, business practice, and regulatory barriers discourage DE interconnection in the US market.

  16. Laser-based analytical monitoring in nuclear-fuel processing plants

    Energy Technology Data Exchange (ETDEWEB)

    Hohimer, J.P.

    1978-09-01

    The use of laser-based analytical methods in nuclear-fuel processing plants is considered. The species and locations for accountability, process control, and effluent control measurements in the Coprocessing, Thorex, and reference Purex fuel processing operations are identified and the conventional analytical methods used for these measurements are summarized. The laser analytical methods based upon Raman, absorption, fluorescence, and nonlinear spectroscopy are reviewed and evaluated for their use in fuel processing plants. After a comparison of the capabilities of the laser-based and conventional analytical methods, the promising areas of application of the laser-based methods in fuel processing plants are identified.

  17. Laser-based analytical monitoring in nuclear-fuel processing plants

    International Nuclear Information System (INIS)

    The use of laser-based analytical methods in nuclear-fuel processing plants is considered. The species and locations for accountability, process control, and effluent control measurements in the Coprocessing, Thorex, and reference Purex fuel processing operations are identified and the conventional analytical methods used for these measurements are summarized. The laser analytical methods based upon Raman, absorption, fluorescence, and nonlinear spectroscopy are reviewed and evaluated for their use in fuel processing plants. After a comparison of the capabilities of the laser-based and conventional analytical methods, the promising areas of application of the laser-based methods in fuel processing plants are identified

  18. [Design and Preparation of Plant Bionic Materials Based on Optical and Infrared Features Simulation].

    Science.gov (United States)

    Jiang, Xiao-jun; Lu, Xu-liang; Pan, Jia-liang; Zhang, Shuan-qin

    2015-07-01

    Due to the life characteristics such as physiological structure and transpiration, plants have unique optical and infrared features. In the optical band, because of the common effects of chlorophyll and water, plant leafs show spectral reflectance characteristics change in 550, 680, 1400 and 1900 nm significantly. In the infrared wave band, driven by transpiration, plants could regulate temperature on their own initiative, which make the infrared characteristics of plants different from artificial materials. So palnt bionic materials were proposed to simulate optical and infrared characteristics of plants. By analyzing formation mechanism of optical and infrared features about green plants, the component design and heat-transfer process of plants bionic materials were studied, above these the heat-transfer control formulation was established. Based on water adsorption/release compound, optical pigments and other man-made materials, plant bionic materials preparation methods were designed which could simulate the optical and infrared features of green plants. By chemical casting methods plant bionic material films were prepared, which use polyvinyl alcohol as film forming and water adsorption/release compound, and use optical pigments like chrome green and macromolecule yellow as colouring materials. The research conclusions achieved by testings figured out: water adsorption/release testing showed that the plant bionic materials with a certain thickness could absorb 1.3 kg water per square meter, which could satisfy the water usage of transpiration simulation one day; the optical and infrared simulated effect tests indicated that the plant bionic materials could preferably simulate the spectral reflective performance of green plants in optical wave band (380-2500 nm, expecially in 1400 and 1900 nm which were water absorption wave band of plants), and also it had similar daily infrared radiation variations with green plants, daily average radiation temperature

  19. Biomass-fueled power plants in Finland

    Energy Technology Data Exchange (ETDEWEB)

    Raiko, M. [IVO Power Engineering Ltd., Vantaa (Finland); Hulkkonen, S. [Imatran Voima Oy, Vantaa (Finland)

    1997-07-01

    Combined heat and power production (CHP) from biomass is a commercially viable alternative when district heat or process steam is needed in small towns or in a process industry. The high nominal investment cost of a small power plant that uses local biomass fuels is compensated by the revenues from the heat. The price of the district heat or the steam generated in the CHP-plant can be valued at the same price level as the heat from a mere steam boiler. Also, the price of heat produced by a small-generation-capacity plant is local and higher, whereas electricity has a more general market price. A typical small Finnish CHP-plant consists of a bubbling fluidized bed boiler and a simplified steam turbine cycle generating 4 to 10 MW of electricity and 10 to 30 MW of district heat or process steam. There are about 10 power plants of this type in commercial operation in Finland. As a whole, biomass, which is used in more than 200 plants, provides about 20% of the primary energy consumption in Finland. Roughly half of these produce only heat but the rest are combined heat and power plants. The majority of the plants is in pulp and paper industry applications. Imatran Voima Oy (IVO) is the biggest energy producer in Finland. IVO builds, owns and operates several biomass-fired power plants and carries out active R and D work to further develop the biomass-fueled small power plant. This paper discusses the experiences of the biomass-fueled power plants. (author)

  20. Research, Development and Demonstration of Micro-CHP Systems for Residential Applications - Phase I

    Energy Technology Data Exchange (ETDEWEB)

    Robert A. Zogg

    2011-03-14

    The objective of the Micro-CHP Phase I effort was to develop a conceptual design for a Micro-CHP system including: Defining market potential; Assessing proposed technology; Developing a proof-of-principle design; and Developing a commercialization strategy. TIAX LLC assembled a team to develop a Micro-CHP system that will provide electricity and heating. TIAX, the contractor and major cost-share provider, provided proven expertise in project management, prime-mover design and development, appliance development and commercialization, analysis of residential energy loads, technology assessment, and market analysis. Kohler Company, the manufacturing partner, is a highly regarded manufacturer of standby power systems and other residential products. Kohler provides a compellingly strong brand, along with the capabilities in product development, design, manufacture, distribution, sales, support, service, and marketing that only a manufacturer of Kohler's status can provide. GAMA, an association of appliance and equipment manufacturers, provided a critical understanding of appliance commercialization issues, including regulatory requirements, large-scale market acceptance issues, and commercialization strategies. The Propane Education & Research Council, a cost-share partner, provided cost share and aided in ensuring the fuel flexibility of the conceptual design. Micro-CHP systems being commercialized in Europe and Japan are generally designed to follow the household thermal load, and generate electricity opportunistically. In many cases, any excess electricity can be sold back to the grid (net metering). These products, however, are unlikely to meet the demands of the U.S. market. First, these products generally cannot provide emergency power when grid power is lost--a critical feature to market success in the U.S. Even those that can may have insufficient electric generation capacities to meet emergency needs for many U.S. homes. Second, the extent to which net

  1. Power contracting between two different partners. Biogas combined heat and power plants; Energie-Contracting zweier unterschiedlicher Partner. Biogas-Blockheizkraftwerk

    Energy Technology Data Exchange (ETDEWEB)

    Lennartz, Marc Wilhelm

    2013-06-15

    An agricultural consortium in the Eifel (Federal Republic of Germany) has adopted a comprehensive supply of a 7,000 m{sup 2} comprising hotel complex with combined heat and power. The old oil-fired central heating plant has been replaced by a biogas-powered combined heat and power plant (CHP). The hotel was directly connected to the CHP plant by means of a new, approximately 300 m long local heating network including buffer storage. Overall, the hotel operator saves approximately 300,000 L of heating oil annually. The energy demand of the hotel operator will be covered by more than 90 % by means of CHP plants. Thus 20 % of the heating costs is saved.

  2. 3D visualization based customer experiences of nuclear plant control room

    International Nuclear Information System (INIS)

    This paper employs virtual reality (VR) technology to develop an interactive virtual nuclear plant control room in which the general public could easily walk into the 'red zone' and play with the control buttons. The VR-based approach allows deeper and richer customer experiences that the real nuclear plant control room could not offer. When people know more about the serious process control procedures enforced in the nuclear plant control room, they will appropriate more about the safety efforts imposed by the nuclear plant and become more comfortable about the nuclear plant. The virtual nuclear plant control room is built using a 3D game development tool called Unity3D. The 3D scene is connected to a nuclear plant simulation system through Windows API programs. To evaluate the usability of the virtual control room, an experiment will be conducted to see how much 'immersion' the users could feel when they played with the virtual control room. (author)

  3. Adaptive model based control for wastewater treatment plants

    NARCIS (Netherlands)

    Niet, de Arie; Vrugt, van de Maartje; Korving, Hans; Boucherie, Richard J.; Savic, D.A.; Kapelan, Z.; Butler, D.

    2011-01-01

    In biological wastewater treatment, nitrogen and phosphorous are removed by activated sludge. The process requires oxygen input via aeration of the activated sludge tank. Aeration is responsible for about 60% of the energy consumption of a treatment plant. Hence optimization of aeration can contribu

  4. Evaluation of cable aging degradation based on plant operating condition

    International Nuclear Information System (INIS)

    Extending the lifetime of nuclear power plant [(hereafter referred simply as ''NPP'')] is one of the most important concerns in the world nuclear industry. Cables are one of the long live items which have not been considered to be replaced during the design life of NPP. To extend the cable life beyond the design life, we need to prove that the design life is too conservative compared with the actual aging. Condition monitoring is one of the useful ways for evaluating the aging condition of cable. In order to simulate the natural aging in nuclear power plant, a study on accelerated aging needs to be conducted first. In this paper, evaluations of mechanical aging degradation for cable jacket were performed after accelerated aging under the continuous heating and intermittent heating. Contrary to general expectation, the intermittent heating to cable jacket showed low aging degradation, 50% break-elongation and 60% indenter modulus, compared with continuous heating. With the plant maintenance period of 1 month after every 12 or 18 months operation, we can easily deduce that the life time of cable jacket can be extended much longer than estimated through the general EQ (Environmental Qualification) test, which adopts continuous accelerated aging for determining cable life. Therefore, a systematic approach which considers the actual environment condition of nuclear power plant is required for determining the life of cables. (author)

  5. Computer based training system for nuclear plant maintenance work

    International Nuclear Information System (INIS)

    Supporting training in maintenance work for Nuclear Power Plant (NPP), we developed a training system with latest computer technology. This paper describes this system, which provides 3-D models about maintenance objects, equipments and work area of NPP so trainees can get the feeling that one is there. And for team training we connect multiple computers and share not only information of objects and work area but also trainees' input with data communication. Accessing common models on each terminal, trainees are able to practice all together. This system estimates trainees' input as learning level and shows summary about the result of estimation. Also this system extracts know-how from person of experience which is gained during real work and isn't specified in maintenance manual, and displays it to trainees as guidance while training according to need. With this system they can train maintenance work of nuclear plant anywhere, virtually and effectively. Furthermore it is also possible for trainees to verify internal parts of plant from viewpoint such as workers can not verify them on site, then they can accumulate knowledge about plant. This leads to reduce human error during maintenance work and improve safety and reliability of NPP. (author)

  6. A concept of a component based system to determine pot-plant shelf-life

    DEFF Research Database (Denmark)

    Körner, Oliver; Skou, Anne-Marie Thonning; Aaslyng, Jesper Peter Mazanti;

    2006-01-01

    calculate the expected keeping quality, or it will be able to apply the system as decision support during plant cultivation. In the latter case, the model-based system can be implemented in a greenhouse climate computer. The concept contains information on climate control strategies, controlled stress......Plant keeping quality during shelf life is next to genetic attributes also determined by plant treatment. This is attributed to inner plant quality parameters. We expect that a model including information gathered during crop cultivation could be used to predict the inner crop quality. From that......, the keeping quality of a plant after removal from the greenhouse could be estimated. A concept of a system that describes a model based knowledge system aiming at determination of the last selling date for pot plants is presented. The core of the conceptual system is a tool that can either be used to...

  7. Efficient use of green taxes in the CHP sector

    International Nuclear Information System (INIS)

    Since 1977 green taxes have been used in the Danish power and heat sector. Green taxes principally assure an efficient, market-based reduction of pollution by reducing the energy consumption or increasing the share of renewable energy in power and heat production. This report takes its point of departure in four potential barriers which prevent a marketbased, cost-effective increase of the proportion of renewable energy in power and heat production. We primarily concentrate on three policy measures. 5. green and lessgreen taxes; 6. mandatory combined heat and power production; 7. fuel restrictions. Furthermore, we analyse a fourth characteristic in the law: 8. high transactions costs connected to the enlargement of renewable energy. The purpose of the report is to describe how the four potential barriers contradict the theoretically efficient application of green taxes in the power and heat sector. We do this: 1) by clarifying how legislation in the power and heat sector affects the extension of renewable energy; and 2) by evaluating the theoretically efficient application of green taxes in the power and heat sector in relation to legislation. (au)

  8. Development of HT-PEMFC components and stack for CHP unit

    Energy Technology Data Exchange (ETDEWEB)

    Jensen, Jens Oluf; Li, Q. (Technical Univ. of Denmark, Dept. of Chemistry, Kgs. Lyngby (Denmark)); Terkelsen, C.; Rudbech, H.C.; Steenberg, T. (Danish Power System Aps, Charlottenlund (Denmark)); Thibault de Rycke (IRD Fuel Cell A/S, Svendborg (Denmark))

    2009-10-15

    The aim of the project has been to further develop components for an all Danish high temperature PEM fuel cells stack for application in combined heat and power units (CHP units). The final product aimed at was a 1.5-2 kW stack for operation at 150-200 deg. C. The project follows the previous PSO project 4760, 'High Temperature PEM Fuel Cell'. The project has addressed the HT-PEM fuel cells form a components point of view and the materials here for. The main areas were polymer and membrane development, electrode and MEA development (MEA = membrane electrode assembly, i.e. the cells.) and stack development. The membrane development begins with the polymer. The polymerization technique was improved significantly in two ways. Better understanding of the process and the critical issues has led to more reproducible results with repeated high molecular weights. The molecular weight is decisive for the membrane strength and durability. The process was also scaled up to 100-200 g polymer pr. batch in a new polymerization facility build during the project. It is dimensioned for larger batches too, but this was not verified during the project. The polymer cannot be purchased in the right quality for fuel cell membranes and it is important that it manufacture is not a limiting factor at the present state. Experiments with other membrane casting techniques were also made. The traditional PBI doped with phosphoric acid is still the state of art membrane for the HT-PEM fuel cells, but progress was also made with modified membranes. Different variants of PBI were synthesized and tested. Electrodes have been manufactured by a spray technique in contrast to the previously applied tape casting. The hand held spray gun previously led to an improvement of the electrodes, but the reproducibility was limited. Subsequently the construction of a semi automated spray machine was started and results like of the best hand sprayed electrodes were obtained. A viable way of MEA rim

  9. CHP expansion strategy in North Rhine-Westphalia. A blueprint for other regions; KWK-Ausbaustrategie in NRW. Eine Blaupause fuer andere Regionen

    Energy Technology Data Exchange (ETDEWEB)

    Holzapfel, Dominik [EnergieAgentur.NRW, Duesseldorf (Germany); Schneider, Sabine [EnergieAgentur.NRW, Wuppertal (Germany)

    2015-10-01

    The North Rhine-Westphalian state government intends to increase the share of combined heat and power (CHP) generation to at least 25 % by 2020. Since 2013, the campaign ''CHP.NRW - Power Meets Heat'' (''KWK.NRW - Strom trifft Waerme'') of the EnergyAgency.NRW, is has been running on behalf of the NRW Climate Protection Ministry, to publicise this technology and to promote its expansion. The campaign accompanies the State Government's CHP Stimulus Programme. The EnergyAgency.NRW has organised companies and research institutions, associations and interest groups under the umbrella of ''CHP.NRW - Power Meets Heat'', aiming at co-ordinated and intensified activities in the field of combined heat and power generation. The target of the initial-project ''roadmap/CHP.NRW'' of the ''Virtual Institute / CHP.NRW'' is to develop a guideline for the application and optimisation of CHP-systems.

  10. Experimental study and modelling of degradation phenomena in HTPEM fuel cell stacks for use in CHP systems

    DEFF Research Database (Denmark)

    Andreasen, Søren Juhl

    2009-01-01

    Degradation phenomena in HTPEM fuel cells for use in CHP systems were investigated experimentally and by modelling. It was found that the two main degradation mechanisms in HTPEM fuel cells are carbon corrosion and Pt agglomeration. On basis of this conclusion a mechanistic model, describing the...

  11. Modelling of a solid oxide fuel cell CHP system coupled with a hot water storage tank for a single household

    DEFF Research Database (Denmark)

    Liso, Vincenzo; Zhao, Yingru; Yang, Wenyuan;

    2015-01-01

    In this paper a solid oxide fuel cell (SOFC) system for cogeneration of heat and power integrated with a stratified heat storage tank is studied. The use of a storage tank with thermal stratification allows one to increase the annual operating hours of CHP: heat can be produced when the request is...

  12. Experimental study and modeling of degradation phenomena in HTPEM fuel cell stacks for use in CHP systems

    DEFF Research Database (Denmark)

    Nielsen, Mads Pagh; Andreasen, Søren Juhl; Rasmussen, Peder Lund;

    2009-01-01

    Degradation phenomena in HTPEM fuel cells for use in CHP systems were investigated experimentally and by modeling. It was found that the two main degradation mechanisms in HTPEM fuel cells are carbon corrosion and Pt agglomeration. On basis of this conclusion a mechanistic model, describing the...

  13. IPE Data Base: Plant design, core damage frequency and containment performance information

    International Nuclear Information System (INIS)

    This data base stores data obtained from the Individual Plant Examinations (IPEs) which licensees of nuclear power plants have conducted in response to NRC's Generic Letter GL88-20. The IPE Data Base is a collection of linked files which store information about plant design, core damage frequency, and containment performance in a uniform, structured way. The information contined in the various files is based on data contained in the IPE submittals. The information extracted from the submittals and entered into the IPE Data Base can be maniulated so that queries regarding individual or groups of plants can be answered using the IPE Data Base. The IPE Data Base supports detailed inquiries into the characteristics of individual plants or classes of plants. Progress has been made on the IPE Data Base and it is largely complete. Recent focus has been the development of a user friendly version which is menu driven and allows the user to ask queries of varying complexity easily, without the need to become familiar with particular data base formats or conventions such as those of DBase IV or Microsoft Access. The user can obtain the information he desired by quickly moving through a series of on-screen menus and ''clicking'' on appropriate choices. In this way even a first time user can benefit from the large amount of information stored in the IPE Data Base without the need of a learning period

  14. IPE Data Base: Plant design, core damage frequency and containment performance information

    Energy Technology Data Exchange (ETDEWEB)

    Lehner, J.; Lin, C.C.; Pratt, W.T. [Brookhaven National Lab., Upton, NY (United States); Su, T.; Danziger, L. [Nuclear Regulatory Commission, Rockville, MD (United States)

    1995-12-31

    This data base stores data obtained from the Individual Plant Examinations (IPEs) which licensees of nuclear power plants have conducted in response to NRC`s Generic Letter GL88-20. The IPE Data Base is a collection of linked files which store information about plant design, core damage frequency, and containment performance in a uniform, structured way. The information contined in the various files is based on data contained in the IPE submittals. The information extracted from the submittals and entered into the IPE Data Base can be maniulated so that queries regarding individual or groups of plants can be answered using the IPE Data Base. The IPE Data Base supports detailed inquiries into the characteristics of individual plants or classes of plants. Progress has been made on the IPE Data Base and it is largely complete. Recent focus has been the development of a user friendly version which is menu driven and allows the user to ask queries of varying complexity easily, without the need to become familiar with particular data base formats or conventions such as those of DBase IV or Microsoft Access. The user can obtain the information he desired by quickly moving through a series of on-screen menus and ``clicking`` on appropriate choices. In this way even a first time user can benefit from the large amount of information stored in the IPE Data Base without the need of a learning period.

  15. A biomass-fired micro-scale CHP system with organic Rankine cycle (ORC) - Thermodynamic modelling studies

    International Nuclear Information System (INIS)

    This paper presents the results of thermodynamics modelling studies of a 2 kW (e) biomass-fired CHP system with organic Rankine cycle (ORC). Three environmentally friendly refrigerants, namely HFE7000, HFE7100 and n-pentane, have been selected as the ORC fluids. The thermodynamic properties of the selected ORC fluids which have been predicted by commercial software (EES) are used to predict the thermal efficiency of ORC. The results of modelling show that under the simulated conditions (1) the ORC thermal efficiency with any selected ORC fluid is well below (roughly about 60% of) the Carnot cycle efficiency; the ORC efficiency depends on not only the modelling conditions but also the ORC fluid - the highest predicted ORC efficiency is 16.6%; the predicted ORC efficiency follows the following order: n-pentane > HFE7000 > HFE7100 (2) both superheating and sub-cooling are detrimental to the ORC efficiency (3) the electrical efficiency of the CHP system with the selected ORC fluids is predicted to be within the range of 7.5%-13.5%, mainly depending on the hot water temperature of the biomass boiler and the ORC condenser cooling water temperature as well as the ORC fluid, and corresponding to about 1.5 kW and 2.71 kW electricity output (4) the overall CHP efficiency of the CHP system is in the order of 80% for all three ORC fluids although the amount and quality of heating supplied by the CHP system depend on the ORC fluid selected and the modelling conditions. -- Highlights: → Thermodynamics modelling of a 2 kW (e) biomass-fired CHP system with ORC is presented. → ORC fluids - HFE7000, HFE7100 and n-pentane. → ORC efficiency follows the order: n-pentane >HFE7000 > HFE7100 under the modelling conditions. → Electrical efficiency of 7.5%-13.5% depending on the ORC fluid and conditions. → Amount and quality of heating depending on the ORC fluid and conditions with CHP efficiency ∼80%.

  16. Web based distance education in chemical industrial plants

    OpenAIRE

    De Giusti, Armando Eduardo; Pessacq, Raúl Adolfo

    2005-01-01

    The development of ICTs (Information and Communication Technologies) and their application in Engineering Education (in a knowledge-centered world) is one of the axes of an ongoing educative transformation. In particular, when the objective is updating professionals and training the industrial plant personnel at the work place, the use of Distance Education tools is of utmost importance. The employment of “Web Based” technologies allows using an expert’s know-how, without requiring his/her pr...

  17. Scheduling of Multiple Chillers in Trigeneration Plants

    Directory of Open Access Journals (Sweden)

    Chris Underwood

    2015-10-01

    Full Text Available The scheduling of both absorption cycle and vapour compression cycle chillers in trigeneration plants is investigated in this work. Many trigeneration plants use absorption cycle chillers only but there are potential performance advantages to be gained by using a combination of absorption and compression chillers especially in situations where the building electrical demand to be met by the combined heat and power (CHP plant is variable. Simulation models of both types of chillers are developed together with a simple model of a variable-capacity CHP engine developed by curve-fitting to supplier’s data. The models are linked to form an optimisation problem in which the contribution of both chiller types is determined at a maximum value of operating cost (or carbon emission saving. Results show that an optimum operating condition arises at moderately high air conditioning demands and moderately low power demand when the air conditioning demand is shared between both chillers, all recovered heat is utilised, and the contribution arising from the compression chiller results in an increase in CHP power generation and, hence, engine efficiency.

  18. Combined heat-and-power plants and district heating in a deregulated electricity market

    International Nuclear Information System (INIS)

    In this paper, a municipality with district heating supplied via boilers and combined heat-and-power (CHP) plants is studied. The electricity load in the municipality is provided for by the CHP plant and electricity bought from the Nordic electricity market. It is therefore desirable to produce as much electricity as possible during periods when the price of electricity is high. The variations in the price of electricity over a 24-h period are significant. The idea presented in this paper is that heat storage can be used to maximise the amount of electricity produced in the CHP plants during peak-price periods. It can also be used to minimise the use of plants with higher operational costs. For storing heat, both a hot-water accumulator at the CHP plant and storage in the building stock are suggested. The situation is analysed using a mixed integer linear-programming model and a case study is presented for the city of Linkoping, a City of approximately 130,000 inhabitants, situated 200 km south of Stockholm in Sweden. A simple model for forecasting the electricity price on the Nordic electricity market is also presented. (Author)

  19. Evaluation of Resistance of Horticultural Plants to Destabilizing Effects Based on Analysis of Leaf Reflection Spectra

    Science.gov (United States)

    Yushkov, A. N.; Borzykh, N. V.; Butenko, A. I.

    2016-05-01

    The influences of thermal effects and salinization on visible and near-IR reflection spectra of horticultural plant leaves with different drought and salt resistance are examined. An integral criterion for evaluating the susceptibility of the plants to stressors is based on measuring the distance between reflectance curves.

  20. Delivery and detection of dietary plant-based miRNAs in animal tissues

    Science.gov (United States)

    It has been proposed that genetic material, namely microRNAs (miRNAs), consumed in plant-based diets can affect animal gene expression. Though deep sequencing reveals the low-level presence of plant miRNAs in animal tissues, many groups have been thus far unable to replicate the finding that a rice ...

  1. Anomalous uptake and circulatory characteristics of the plant-based small RNA MIR2911

    Science.gov (United States)

    Yang, Jian; Hotz, Tremearne; Broadnax, LaCassidy; Yarmarkovich, Mark; Elbaz-Younes, Ismail; Hirschi, Kendal D.

    2016-01-01

    Inconsistent detection of plant-based dietary small RNAs in circulation has thwarted the use of dietary RNA therapeutics. Here we demonstrate mice consuming diets rich in vegetables displayed enhanced serum levels of the plant specific small RNA MIR2911. Differential centrifugation, size-exclusion chromatography, and proteinase K treatment of plant extracts suggest this RNA resides within a proteinase K-sensitive complex. Plant derived MIR2911 was more bioavailable than the synthetic RNA. Furthermore, MIR2911 exhibited unusual digestive stability compared with other synthetic plant microRNAs. The characteristics of circulating MIR2911 were also unusual as it was not associated with exosomes and fractionated as a soluble complex that was insensitive to proteinase K treatment, consistent with MIR2911 being stabilized by modifications conferred by the host. These results indicate that intrinsic stability and plant-based modifications orchestrate consumer uptake of this anomalous plant based small RNA and invite revisiting plant-based microRNA therapeutic approaches. PMID:27251858

  2. Adverse Effects of Plant Food Supplements and Plants Consumed as Food: Results from the Poisons Centres-Based PlantLIBRA Study.

    Science.gov (United States)

    Lüde, Saskia; Vecchio, Sarah; Sinno-Tellier, Sandra; Dopter, Aymeric; Mustonen, Harriet; Vucinic, Slavica; Jonsson, Birgitta; Müller, Dieter; Veras Gimenez Fruchtengarten, Ligia; Hruby, Karl; De Souza Nascimento, Elizabeth; Di Lorenzo, Chiara; Restani, Patrizia; Kupferschmidt, Hugo; Ceschi, Alessandro

    2016-06-01

    Plant food supplements (PFS) are products of increasing popularity and wide-spread distribution. Nevertheless, information about their risks is limited. To fill this gap, a poisons centres-based study was performed as part of the EU project PlantLIBRA. Multicentre retrospective review of data from selected European and Brazilian poisons centres, involving human cases of adverse effects due to plants consumed as food or as ingredients of food supplements recorded between 2006 and 2010. Ten poisons centres provided a total of 75 cases. In 57 cases (76%) a PFS was involved; in 18 (24%) a plant was ingested as food. The 10 most frequently reported plants were Valeriana officinalis, Camellia sinensis, Paullinia cupana, Melissa officinalis, Passiflora incarnata, Mentha piperita, Glycyrrhiza glabra, Ilex paraguariensis, Panax ginseng, and Citrus aurantium. The most frequently observed clinical effects were neurotoxicity and gastro-intestinal symptoms. Most cases showed a benign clinical course; however, five cases were severe. PFS-related adverse effects seem to be relatively infrequent issues for poisons centres. Most cases showed mild symptoms. Nevertheless, the occurrence of some severe adverse effects and the increasing popularity of PFS require continuous active surveillance, and further research is warranted. Copyright © 2016 John Wiley & Sons, Ltd. PMID:26948409

  3. Energy policy responses to the climate change challenge: The consistency of European CHP, renewables and energy efficiency policies

    International Nuclear Information System (INIS)

    This report is Volume 14 of individual reports of the Shared Analysis Project prepared for the European Commission, Directorate General for Energy. The three major objectives of the project were: to design a common framework of energy analysis that aimed to involve all Member States and the experts of industrial research groups (the shared approach to energy analysis); To analyse generic EU-wide issues important for energy policy and for future energy demand and production, putting particular emphasis on world energy market trends, strategic energy policy responses to the Kyoto process, and evaluation of response strategies to increasing energy import dependence and to climate change activities; to carry out quantitative analyses of energy trends and scenarios as an input for discussion. The present volume considers three main issues concerning energy policy responses to the climate change challenge: the penetration of CHP and renewables according to official objectives, focusing on infrastructure and institutions rather than technology; the consistency of promotion of CHP, renewables and energy savings at the same time; consumers' choices and priorities in a liberalised market. The volume describes examples of policies in several Member States for these technologies with emphasis on CHP for both large-scale and small-scale district heating systems. The penetration of CHP technologies is analysed quantitatively using a traditional optimisation model approach for stylised regions with heat markets suitable for CHP and facing a competitive European market for electricity. The Joint Final Report of the project, titled 'Economic Foundations for Energy Policy' is published as a Special Issue of Energy in Europe, December 1999. All reports are available on the Internet, www.shared-analysis.fhg.de/ The project started in January 1998, involving about 100 months of scientific labour. The project consortium consisted of nine member institutes co-ordinated by the Fraunhofer

  4. Energy policy responses to the climate change challenge: The consistency of European CHP, renewables and energy efficiency policies

    Energy Technology Data Exchange (ETDEWEB)

    Grohnheit, P.E.

    1999-09-01

    This report is Volume 14 of individual reports of the Shared Analysis Project prepared for the European Commission, Directorate General for Energy. The three major objectives of the project were: to design a common framework of energy analysis that aimed to involve all Member States and the experts of industrial research groups (the shared approach to energy analysis); To analyse generic EU-wide issues important for energy policy and for future energy demand and production, putting particular emphasis on world energy market trends, strategic energy policy responses to the Kyoto process, and evaluation of response strategies to increasing energy import dependence and to climate change activities; to carry out quantitative analyses of energy trends and scenarios as an input for discussion. The present volume considers three main issues concerning energy policy responses to the climate change challenge: the penetration of CHP and renewables according to official objectives, focusing on infrastructure and institutions rather than technology; the consistency of promotion of CHP, renewables and energy savings at the same time; consumers' choices and priorities in a liberalised market. The volume describes examples of policies in several Member States for these technologies with emphasis on CHP for both large-scale and small-scale district heating systems. The penetration of CHP technologies is analysed quantitatively using a traditional optimisation model approach for stylised regions with heat markets suitable for CHP and facing a competitive European market for electricity. The Joint Final Report of the project, titled 'Economic Foundations for Energy Policy' is published as a Special Issue of Energy in Europe, December 1999. All reports are available on the Internet, www.shared-analysis.fhg.de/ The project started in January 1998, involving about 100 months of scientific labour. The project consortium consisted of nine member institutes co-ordinated by

  5. Optimal design and operation of a syngas-fuelled SOFC micro CHP system for residential applications in different climate zones in China

    DEFF Research Database (Denmark)

    Yang, Wenyuan; Zhao, Yingru; Liso, Vincenzo;

    2014-01-01

    under difference climate conditions to ensure that it is well matched with the local heat-to-power ratio. The aim of this study is to investigate the optimal design and operation of a syngas-fuelled SOFC micro-CHP system for small households located in five different climate zones in China. The ability...... to determine the optimal match between the energy demand of the household for different climates across China and the energy supply of the micro-CHP during the whole year. Moreover, criteria for sizing the system components of the micro-CHP are specifically addressed. The developed methodology can be...

  6. Fast growing aspens in the development of a plant micropropagation system based on plant-produced ethylene action

    International Nuclear Information System (INIS)

    Representatives of the genus Populus (poplars), such as Populus tremula L. (European aspen) and its fast-growing hybrids, are recognized as being among the most suitable tree species for short rotation coppicing in Northern Europe. Several technologies have been developed for fast propagation of selected aspen genotypes, including laboratory (in vitro) micropropagation, which is usually based on the action of exogenous plant hormones. Seeking to minimize the use of the latter, the present study was designed to test if the conditions suitable for increased accumulation of plant-produced gas, including the gaseous plant hormone ethylene, inside a culture vessel could contribute to commercially desirable changes in aspen development. Shoot cultures of several European and hybrid (Populus tremuloides Michx. × P. tremula) aspen genotypes were studied using two different types of culture vessels: tightly sealed Petri dishes (15 × 54 mm) designed to provide restricted gas exchange (RGE) conditions, and capped (but not sealed) test tubes (150 × 18 mm) providing control conditions. Under RGE conditions, not only the positive impact of the ethylene precursors 1-aminocyclopropane-1-carboxylic-acid (ACC) and ethephon on shoot proliferation was demonstrated but also a several-fold increase, compared to the control conditions, in the mean shoot number per explant was recorded even on the hormone-free nutrient medium. Moreover, the shoots developed under RGE conditions were distinguished by superior rooting ability in the subsequent culture. These results suggest that a plant micropropagation system based on the action of plant-produced ethylene rather than of exogenous hormones is possible. -- Highlights: ► Aspen in vitro cultures were grown in different vessels. ► Small-volume vessels were used for restriction of gas exchange. ► Aspen explants produced most shoots in small-volume vessels. ► Shoot proliferation was increased due to explant response to ethylene.

  7. Auxiliary feedwater system risk-based inspection guide for the Virgil C. Summer Nuclear Power Plant

    International Nuclear Information System (INIS)

    In a study sponsored by the US Nuclear Regulatory Commission (NRC), Pacific Northwest Laboratory has developed and applied a methodology for deriving plant-specific risk-based inspection guidance for the emergency/auxiliary feedwater (EFW/AFW) system at press water reactors that have not undergone probabilistic risk assessment (PRA). This methodology uses costing PRA results and plant operating experience information. Existing PRA-based inspection guidance information recently developed for the NRC for various plants was used to identify genetic component failure modes. This information was then combined with plant-specific and industry-wide component information and failure data to identify failure modes and failure mechanisms for the AFW system at the selected plants. Virgil C. Summer plant was selected as one m a series of plants for study. The product of this effort is a priority listing of AFW failures which have occurred at the plant and at other PWRS. This listing is intended for use by NRC inspectors in the preparation of inspection plans addressing AFW risk-important components at Virgil C. Summer plant

  8. MedLeaf: Mobile Application for Medicinal Plant Identification Based on Leaf Image

    Directory of Open Access Journals (Sweden)

    Desta Sandya Prasvita

    2013-01-01

    Full Text Available This research proposes MedLeaf as a new mobile application for medicinal plants identification based on leaf image. The application runs on the Android operating system. MedLeaf has two main functionalities, i.e. medicinal plants identification and document searching of medicinal plant. We used Local Binary Pattern to extract leaf texture and Probabilistic Neural Network to classify the image. In this research, we used30 species of Indonesian medicinal plants and each species consists of 48 digital leaf images. To evaluate user satisfaction of the application we used questionnaire based on heuristic evaluation. The evaluation result shows that MedLeaf is promising for medicinal plants identification. MedLeaf will help botanical garden or natural reserve park management to identify medicinal plant, discover new plant species, plant taxonomy and so on. Also, it will help individual, groups and communities to find unused and undeveloped their skill to optimize the potential of medicinal plants. As the results, MedLeaf will increase of their resources, capitals, and economic wealth.

  9. Operator support architecture for monitoring abnormal symptoms of nuclear power plant based on knowledge engineering

    International Nuclear Information System (INIS)

    An architecture to support nuclear power plant operators for monitoring abnormal symptoms has been proposed based on the techniques of knowledge engineering, and the feasibility of a plant monitoring support system was investigated. The purpose of the support system is to present the operators with useful information so that they can make correct judgment at an early and subtle stage of abnormal plant conditions. In the architecture proposed, abductive reasoning is performed to search for causal events and deductive one to predict consequential events using the knowledge representing plant components as frames and those representing causal relations as production rules. A method to deal with uncertainties in each types of reasoning has been adopted, and it is used to rank several hypotheses of causal events and to assess the importance of plant parameters for monitoring. A prototype system was developed, and its usefulness was tested using a case of failure in a recirculation pump of a BWR plant. (author)

  10. Distribution System Optimization Planning Based on Plant Growth Simulation Algorithm

    Institute of Scientific and Technical Information of China (English)

    WANG Chun; CHENG Hao-zhong; HU Ze-chun; WANG Yi

    2008-01-01

    An approach for the integrated optimization of the construction/expansion capacity of high-voltage/medium-voltage (HV/MV) substations and the configuration of MV radial distribution network was presented using plant growth simulation algorithm (PGSA). In the optimization process, fixed costs correspondent to the investment in lines and substations and the variable costs associated to the operation of the system were considered under the constraints of branch capacity, substation capacity and bus voltage. The optimization variables considerably reduce the dimension of variables and speed up the process of optimizing. The effectiveness of the proposed approach was tested by a distribution system planning.

  11. Règlement des produits à base de plantes

    OpenAIRE

    Fourasté, Isabelle

    2013-01-01

    Le monde végétal est source de vie. À tout moment, l’homme et la nature sont soudés l’un à l’autre aussi bien dans les besoins les plus fondamentaux que dans les applications les plus futiles. Il est donc normal que des législations multiples et complexes régissent les domaines d’utilisation des plantes, que ce soit en tant que matériel industriel (construction, habillement, confection d’objets d’utilisation courante...), dans l’alimentation humaine et/ou animale, dans le domaine de la santé,...

  12. Study of base-isolated structures of nuclear power plants

    International Nuclear Information System (INIS)

    The buildings of a nuclear power plant are much heavier than ordinary buildings. For example, the weight of the reactor building for a 4 loops PWR in Japan is about 200,000 tons. Many bearings are needed to support it and it is therefore important to study how to arrange the bearings. The characteristics of the three types of bearings arrangements considered in this study are as follows: an arrangement of 500 ton bearings under walls, a uniformly distributed arrangement of 500 ton bearings, and an arrangement of 1000 ton bearings under walls

  13. Biomass from agriculture in small-scale combined heat and power plants - A comparative life cycle assessment

    International Nuclear Information System (INIS)

    Biomass produced on farm land is a renewable fuel that can prove suitable for small-scale combined heat and power (CHP) plants in rural areas. However, it can still be questioned if biomass-based energy generation is a good environmental choice with regards to the impact on greenhouse gas emissions, and if there are negative consequences of using of agricultural land for other purposes than food production. In this study, a simplified life cycle assessment (LCA) was conducted over four scenarios for supply of the entire demand of power and heat of a rural village. Three of the scenarios are based on utilization of biomass in 100 kW (e) combined heat and power (CHP) systems and the fourth is based on fossil fuel in a large-scale plant. The biomass systems analyzed were based on 1) biogas production with ley as substrate and the biogas combusted in a microturbine, 2) gasification of willow chips and the product gas combusted in an IC-engine and 3) combustion of willow chips for a Stirling engine. The two first scenarios also require a straw boiler. The results show that the biomass-based scenarios reduce greenhouse gas emissions considerably compared to the scenario based on fossil fuel, but have higher acidifying emissions. Scenario 1 has by far the best performance with respect to global warming potential and the advantage of utilizing a byproduct and thus not occupying extra land. Scenario 2 and 3 require less primary energy and less fossil energy input than 1, but set-aside land for willow production must be available. The low electric efficiency of scenario 3 makes it an unsuitable option.

  14. Role and chemistry of catalyst in hydrogen based heavy water plants (Paper No. 6.2)

    International Nuclear Information System (INIS)

    The chemistry of homogeneous catalyst particularly of KNH2 in ammonia, based on which a number of plants are operating, is discussed. considering its importance and complexity. (author). 10 refs., 5 figs

  15. Farming of Plant-Based Veterinary Vaccines and Their Applications for Disease Prevention in Animals

    Directory of Open Access Journals (Sweden)

    Pit Sze Liew

    2015-01-01

    Full Text Available Plants have been studied for the production of pharmaceutical compounds for more than two decades now. Ever since the plant-made poultry vaccine against Newcastle disease virus made a breakthrough and went all the way to obtain regulatory approval, research to use plants for expression and delivery of vaccine proteins for animals was intensified. Indeed, in view of the high production costs of veterinary vaccines, plants represent attractive biofactories and offer many promising advantages in the production of recombinant vaccine proteins. Furthermore, the possibility of conducting immunogenicity and challenge studies in target animals has greatly exaggerated the progress. Although there are no edible plant-produced animal vaccines in the market, plant-based vaccine technology has great potentials. In this review, development, uses, and advantages of plant-based recombinant protein production in various expression platforms are discussed. In addition, examples of plant-based veterinary vaccines showing strong indication in terms of efficacy in animal disease prevention are also described.

  16. Lagrangian relaxation based algorithm for trigeneration planning with storages

    DEFF Research Database (Denmark)

    Rong, Aiying; Lahdelma, Risto; Luh, Peter

    2008-01-01

    of three energy commodities follows a joint characteristic. This paper presents a Lagrangian relaxation (LR) based algorithm for trigeneration planning with storages based on deflected subgradient optimization method. The trigeneration planning problem is modeled as a linear programming (LP) problem....... The linear cost function poses the convergence challenge to the LR algorithm and the joint characteristic of trigeneration plants makes the operating region of trigeneration system more complicated than that of power-only generation system and that of combined heat and power (CHP) system. We develop...... an effective method for the long-term planning problem based on the proper strategy to form Lagrangian subproblems and solve the Lagrangian dual (LD) problem based on deflected subgradient optimization method. We also develop a heuristic for restoring feasibility from the LD solution. Numerical...

  17. Characterization of Carambola (Averrhoa carambola L. Plant Collection of Cibinong Plant Germplasm Garden Based on Phenotypic and Genetic Characters

    Directory of Open Access Journals (Sweden)

    Dody Priadi

    2016-04-01

    Full Text Available Indonesia as a rich biodiversity country has many superior fruit plant germplasms such as sweet star fruit or carambola (Averrhoa carambola L.. Some varieties of carambola which collected at the Germplasm Garden of Research Center for Biotechnology-LIPI have been used for parent trees of fruit plant production. Therefore, they have to be characterized both phenotypically and genetically. The objective of the study was to analyze the relationship between eight varieties of carambola i.e. Malaysia, Penang, Rawasari, Bangkok, Sembiring, Dewabaru, Demak and Dewimurni at the germplasm garden based on phenotypic and genetic characters. Phenotypic characters were observed directly in the field, whereas genetic characters were observed with RAPD markers using 10 primers. Phylogenetic analysis was done using NT-SYS software showed that there were three clusters of carambola varieties. Meanwhile, Malaysia and Penang varieties have closed relationships (96% compared with the other varieties. The result of the study would be dedicated to updating and completing the existing fruit plant collection database of Plants Germplasm Garden. 

  18. Industry based performance indicators for nuclear power plants

    International Nuclear Information System (INIS)

    This report presents the results of the first phase of a two-phase study, performed with the goal of developing indirect (leading) indicators of nuclear power plant safety, using other industries as a model. It was hypothesized that other industries with similar public safety concerns could serve as analogs to the nuclear power industry. Many process industries have many more years of operating experience, and many more plants than the nuclear power industry, and thus should have accumulated much useful safety data. In Phase 1, the investigators screened a variety of potential industry analogs and chose the chemical/petrochemical manufacturing industry as the primary analog for further study. Information was gathered on safety programs and indicators in the chemical industry, as well as in the nuclear power industry. Frameworks were selected for the development of indicators which could be transferred from the chemical to the nuclear power environment, and candidate sets of direct and indirect safety indicators were developed. Estimates were made of the availability and quality of data in the chemical industry, and plans were developed for further investigating and testing these candidate indicators against safety data in both the chemical and nuclear power industries in Phase 2. 38 refs., 4 figs., 7 tabs

  19. Assessing accuracy in citizen science-based plant phenology monitoring

    Science.gov (United States)

    Fuccillo, Kerissa K.; Crimmins, Theresa M.; de Rivera, Catherine E.; Elder, Timothy S.

    2015-07-01

    In the USA, thousands of volunteers are engaged in tracking plant and animal phenology through a variety of citizen science programs for the purpose of amassing spatially and temporally comprehensive datasets useful to scientists and resource managers. The quality of these observations and their suitability for scientific analysis, however, remains largely unevaluated. We aimed to evaluate the accuracy of plant phenology observations collected by citizen scientist volunteers following protocols designed by the USA National Phenology Network (USA-NPN). Phenology observations made by volunteers receiving several hours of formal training were compared to those collected independently by a professional ecologist. Approximately 11,000 observations were recorded by 28 volunteers over the course of one field season. Volunteers consistently identified phenophases correctly (91 % overall) for the 19 species observed. Volunteers demonstrated greatest overall accuracy identifying unfolded leaves, ripe fruits, and open flowers. Transitional accuracy decreased for some species/phenophase combinations (70 % average), and accuracy varied significantly by phenophase and species ( p training can provide reliable observations when following explicit, standardized protocols. Future studies should investigate different observation models (i.e., group/individual, online/in-person training) over subsequent seasons with multiple expert comparisons to further substantiate the ability of these monitoring programs to supply accurate broadscale datasets capable of answering pressing ecological questions about global change.

  20. Risk-based safety performance indicators for nuclear power plants

    International Nuclear Information System (INIS)

    In a Concerted Action (CA), sponsored by the European Commission within its 5th Framework Program, a consortium of eleven partners from eight countries has reviewed and evaluated the application of Safety Performance Indicators (SPIs), which - in combination with other tools - can be used to monitor and improve the safety of nuclear power plants. The project was aimed at identification of methods that can be used in a risk-informed regulatory system and environment, and to exploit PSA techniques for the development and use of meaningful additional/alternative SPIs. The CA included the review of existing indicator systems, and the collection of information on the experience from indicator systems by means of a specific questionnaire. One of the most important and challenging issues for nuclear plant owners and/or regulators is to recognize early signs of deterioration in safety performance, caused by influences from management, organization and safety culture (MOSC), before actual events and/or mishaps take place. Most of the existing SPIs as proposed by various organizations are considered as 'lagging' indicators, that is, they are expected to show an impact only when a downward trend has already started. Furthermore, most of the available indicators are at a relatively high level, such that they will not provide useful information on fundamental weaknesses causing the problem in the first place. Regulators' and utilities' views on the use of a Safety Performance Indicator System have also been a part of the development of the CA. (author)