WorldWideScience

Sample records for chooz b-1 reactor

  1. Double Chooz and Reactor Theta13 Experiments

    CERN Document Server

    ,

    2016-01-01

    This is a contribution paper from the Double Chooz experiment to the special issue of NPB on neutrino oscillations. The physics and history of the reactor theta13 experiments, as well as Double Chooz experiment and its neutrino oscillation analyses are reviewed.

  2. Chooz B; Chooz B

    Energy Technology Data Exchange (ETDEWEB)

    Barillot, Pascale; Baize, Jean-Marc [eds.] [Electricite de France (EDF), 75 - Paris (France)

    1997-11-03

    This EDF press communique give information related to the exploitation of the Chooz B NPP. A calendar of the Chooz B1 and B2 NPPs exploitation is given as well as information about the local economic impact. The exploitation of the PWR reactors of the French nuclear sector corresponds to a accumulated experience of 600 year-reactor. Significant technological evolution has been recorded, namely in the test-control system, the turbo-alternator group 'Arabelle' and in the vapor generators. The reactor safety is based on the high professionalism of the exploitation personnel, on the computer-assisted behaviour allowing the choice of operators and on the conception based upon the experience accumulated by the French nuclear power plants, equivalent to 600 year-reactor operation. EDF operates a system of continual surveillance which allows the monitoring the environmental effects caused by the NPP exploitation. The following issues concerning the environment impact are reported in this document: - The effluent releases in the environment; - Health studies conducted in the NPPs' neighbourhood; - New authorizations for waste release; - Radioactive waste management. The report also mentions the French-Belgian partnership in the PWR construction, the socio-economic regional impact of the EDF activities related with the Chooz NPP operation, and the partnership with the associated service companies. Six appendices are attached to the report containing the following information: - A general layout of Chooz NPP; - Chooz B key figures; Chooz B key data; - Security and public information; - Evolution of PWR system in France; - World's nuclear systems.

  3. Chooz B

    International Nuclear Information System (INIS)

    This EDF press communique give information related to the exploitation of the Chooz B NPP. A calendar of the Chooz B1 and B2 NPPs exploitation is given as well as information about the local economic impact. The exploitation of the PWR reactors of the French nuclear sector corresponds to a accumulated experience of 600 year-reactor. Significant technological evolution has been recorded, namely in the test-control system, the turbo-alternator group 'Arabelle' and in the vapor generators. The reactor safety is based on the high professionalism of the exploitation personnel, on the computer-assisted behaviour allowing the choice of operators and on the conception based upon the experience accumulated by the French nuclear power plants, equivalent to 600 year-reactor operation. EDF operates a system of continual surveillance which allows the monitoring the environmental effects caused by the NPP exploitation. The following issues concerning the environment impact are reported in this document: - The effluent releases in the environment; - Health studies conducted in the NPPs' neighbourhood; - New authorizations for waste release; - Radioactive waste management. The report also mentions the French-Belgian partnership in the PWR construction, the socio-economic regional impact of the EDF activities related with the Chooz NPP operation, and the partnership with the associated service companies. Six appendices are attached to the report containing the following information: - A general layout of Chooz NPP; - Chooz B key figures; Chooz B key data; - Security and public information; - Evolution of PWR system in France; - World's nuclear systems

  4. Double Chooz and a history of reactor θ13 experiments

    Science.gov (United States)

    Suekane, Fumihiko; Junqueira de Castro Bezerra, Thiago

    2016-07-01

    This is a contribution paper from the Double Chooz (DC) experiment to the special issue of Nuclear Physics B on the topics of neutrino oscillations, celebrating the recent Nobel prize to Profs. T. Kajita and A.B. McDonald. DC is a reactor neutrino experiment which measures the last neutrino mixing angle θ13. The DC group presented an indication of disappearance of the reactor neutrinos at a baseline of ∼1 km for the first time in 2011 and is improving the measurement of θ13. DC is a pioneering experiment of this research field. In accordance with the nature of this special issue, physics and history of the reactor-θ13 experiments, as well as the Double Chooz experiment and its neutrino oscillation analyses, are reviewed.

  5. The double chooz experiment: simulation of reactor antineutrino spectra

    International Nuclear Information System (INIS)

    The Double Chooz experiment aims to study the oscillations of electron antineutrinos produced by the Chooz nuclear power station, located in France, in the Ardennes region. It will lead to an unprecedented accuracy on the value of the mixing angle θ13. Improving the current knowledge on this parameter, given by the Chooz experiment, requires a reduction of both statistical and systematic errors, that is to say not only observing a large data sample, but also controlling the experimental uncertainties involved in the production and detection of electron antineutrinos. The use of two identical detectors will cancel most of the experimental systematic uncertainties limiting the sensitivity to the value of the mixing angle. We present in this thesis, simulations of reactor antineutrino spectra that were carried out in order to control the sources of systematic uncertainty related to the production of these particles by the plant. We also discuss our work on controlling the normalization error of the experiment through the precise determination of the number of target protons by a weighing measurement and through the study of the fiducial volume of the detectors which requires an accurate modeling of neutron physics. After three years of data taking with two detectors, Double Chooz will be able to disentangle an oscillation signal for sin22θ13 ≥ 0.05 (at 3σ) or, if no oscillations are observed, to put a limit of sin22θ13 ≤ 0.03 at 90% C.L. (author)

  6. Reactor electron antineutrino disappearance in the Double Chooz experiment

    CERN Document Server

    Abe, Y; Anjos, J C dos; Barriere, J C; Bergevin, M; Bernstein, A; Bezerra, T J C; Bezrukhov, L; Blucher, E; Bowden, N S; Buck, C; Busenitz, J; Cabrera, A; Caden, E; Camilleri, L; Carr, R; Cerrada, M; Chang, P -J; Chimenti, P; Classen, T; Collin, A P; Conover, E; Conrad, J M; Crespo-Anadón, J I; Crum, K; Cucoanes, A; D'Agostino, M V; Damon, E; Dawson, J V; Dazeley, S; Dietrich, D; Djurcic, Z; Dracos, M; Durand, V; Ebert, J; Efremenko, Y; Elnimr, M; Etenko, A; Fallot, M; Fechner, M; von Feilitzsch, F; Felde, J; Franco, D; Franke, A J; Franke, M; Furuta, H; Gama, R; Gil-Botella, I; Giot, L; Goger-Neff, M; Gonzalez, L F G; Goodman, M C; Goon, J TM; Greiner, D; Haag, N; Hagner, C; Hara, T; Hartmann, F X; Haser, J; Hatzikoutelis, A; Hayakawa, T; Hofmann, M; Horton-Smith, G A; Hourlier, A; Ishitsuka, M; Jochum, J; Jollet, C; Jones, C L; Kaether, F; Kalousis, L N; Kamyshkov, Y; Kaplan, D M; Kawasaki, T; Keefer, G; Kemp, E; de Kerret, H; Kibe, Y; Konno, T; Kryn, D; Kuze, M; Lachenmaier, T; Lane, C E; Langbrandtner, C; Lasserre, T; Letourneau, A; Lhuillier, D; Lima, H P; Lindner, M; López-Castanõ, J M; LoSecco, J M; Lubsandorzhiev, B K; Lucht, S; McKee, D; Maeda, J; Maesano, C N; Mariani, C; Maricic, J; Martino, J; Matsubara, T; Mention, G; Meregaglia, A; Miletic, T; Milincic, R; Miyata, H; Mueller, Th A; Nagasaka, Y; Nakajima, K; Novella, P; Obolensky, M; Oberauer, L; Onillon, A; Osborn, A; Ostrovskiy, I; Palomares, C; Pepe, I M; Perasso, S; Perrin, P; Pfahler, P; Porta, A; Potzel, W; Reichenbacher, J; Reinhold, B; Remoto, A; Rohling, M; Roncin, R; Roth, S; Sakamoto, Y; Santorelli, R; Sato, F; Schonert, S; Schoppmann, S; Schwetz, T; Shaevitz, M H; Shimojima, S; Shrestha, D; Sida, J-L; Sinev, V; Skorokhvatov, M; Smith, E; Spitz, J; Stahl, A; Stancu, I; Stokes, L F F; Strait, M; Stuken, A; Suekane, F; Sukhotin, S; Sumiyoshi, T; Sun, Y; Svoboda, R; Terao, K; Tonazzo, A; Toups, M; Thi, H H Trinh; Valdiviesso, G; Veyssiere, C; Wagner, S; Watanabe, H; White, B; Wiebusch, C; Winslow, L; Worcester, M; Wurm, M; Yermia, F; Zimmer, V

    2012-01-01

    The Double Chooz experiment has observed 8,249 candidate electron antineutrino events in 227.93 live days with 33.71 GW-ton-years (reactor power x detector mass x livetime) exposure using a 10.3 cubic meter fiducial volume detector located at 1050 m from the reactor cores of the Chooz nuclear power plant in France. The expectation in case of theta13 = 0 is 8,937 events. The deficit is interpreted as evidence of electron antineutrino disappearance. From a rate plus spectral shape analysis we find sin^2 2{\\theta}13 = 0.109 \\pm 0.030(stat) \\pm 0.025(syst). The data exclude the no-oscillation hypothesis at 99.9% CL (3.1{\\sigma}).

  7. Chooz A, First Pressurized Water Reactor to be Dismantled in France - 13445

    Energy Technology Data Exchange (ETDEWEB)

    Boucau, Joseph [Westinghouse Electric Company, 43 rue de l' Industrie, Nivelles (Belgium); Mirabella, C. [Westinghouse Electric France, Orsay (France); Nilsson, Lennart [Westinghouse Electric Sweden, Vaesteraas (Sweden); Kreitman, Paul J. [Westinghouse Electric Company, Lake Bluff, IL 60048 (United States); Obert, Estelle [EDF - DPI - CIDEN, Lyon (France)

    2013-07-01

    Nine commercial nuclear power plants have been permanently shut down in France to date, of which the Chooz A plant underwent an extensive decommissioning and dismantling program. Chooz Nuclear Power Station is located in the municipality of Chooz, Ardennes region, in the northeast part of France. Chooz B1 and B2 are 1,500 megawatt electric (MWe) pressurized water reactors (PWRs) currently in operation. Chooz A, a 305 MWe PWR implanted in two caves within a hill, began operations in 1967 and closed in 1991, and will now become the first PWR in France to be fully dismantled. EDF CIDEN (Engineering Center for Dismantling and Environment) has awarded Westinghouse a contract for the dismantling of its Chooz A reactor vessel (RV). The project began in January 2010. Westinghouse is leading the project in a consortium with Nuvia France. The project scope includes overall project management, conditioning of the reactor vessel (RV) head, RV and RV internals segmentation, reactor nozzle cutting for lifting the RV out of the pit and seal it afterwards, dismantling of the RV thermal insulation, ALARA (As Low As Reasonably Achievable) forecast to ensure acceptable doses for the personnel, complementary vacuum cleaner to catch the chips during the segmentation work, needs and facilities, waste characterization and packaging, civil work modifications, licensing documentation. The RV and RV internals will be segmented based on the mechanical cutting technology that Westinghouse applied successfully for more than 13 years. The segmentation activities cover the cutting and packaging plan, tooling design and qualification, personnel training and site implementation. Since Chooz A is located inside two caves, the project will involve waste transportation from the reactor cave through long galleries to the waste buffer area. The project will end after the entire dismantling work is completed, and the waste storage is outside the caves and ready to be shipped either to the ANDRA (French

  8. Double Chooz: Searching for theta13 with reactor neutrinos

    CERN Document Server

    Novella, P

    2011-01-01

    The Double Chooz experiment is meant to search for the neutrino mixing angle theta13 taking advantage of the neutrinos generated at the nuclear power plant of Chooz. Double Chooz relies on neutrino flux measurements at two different locations, the so-called far and near detectors, although the first phase runs only with the far detector. The commissioning of the far detector started in January 2011 and first results improving the current limit on theta13 are expected by the summer 2011. The status of the Double Chooz experiment is presented.

  9. Reactor and Antineutrino Spectrum Calculations for the Double Chooz First Phase Results

    International Nuclear Information System (INIS)

    The Double Chooz reactor oscillation experiment is designed to search for a non-vanishing value of the mixing angle θ13. For the first phase of the experiment with only the far detector running, the reactor electron antineutrino flux is normalized via reactor simulation. For this first phase and from its last results, Double Chooz observed an evidence for a reactor electron antineutrino disappearance. In 227.93 days of far detector live time, we obtained sin22θ13=0.109±0.030(stat)±0.025(syst). This result excludes the no-oscillation hypothesis at 99.8% CL

  10. Indication for the disappearance of reactor electron antineutrinos in the Double Chooz experiment

    CERN Document Server

    Abe, Y; Akiri, T; Anjos, J C dos; Ardellier, F; Barbosa, A F; Baxter, A; Bernstein, A; Bezerra, T J C; Bezrukhov, L; Blucher, E; Bongrand, M; Bowden, N S; Buck, C; Busenitz, J; Cabrera, A; Caden, E; Camilleri, L; Carr, R; Cerrada, M; Chang, P -J; Chimenti, P; Classen, T; Collin, A; Conover, E; Conrad, J M; Cormon, S; Crespo-Anadón, J I; Cribier, M; Crum, K; Cucoanes, A; D'Agostino, M V; Damon, E; Dawson, J V; Dazeley, S; Dierckxsens, M; Dietrich, D; Djurcic, Z; Dracos, M; Durand, V; Efremenko, Y; Endo, Y; Etenko, A; Falk, E; Fallot, M; Fechner, M; von Feilitzsch, F; Felde, J; Fernandes, S M; Franco, D; Franke, A; Franke, M; Furuta, H; Gama, R; Gil-Botella, I; Giot, L; Göger-Neff, M; Gonzalez, L F G; Goodman, M C; Goon, J TM; Greiner, D; Guillon, B; Haag, N; Hagner, C; Hara, T; Hartmann, F X; Hartnell, J; Haruna, T; Haser, J; Hatzikoutelis, A; Hayakawa, T; Hofmann, M; Horton-Smith, G; Ishitsuka, M; Jochum, J; Jollet, C; Jones, C L; Kaether, F; Kalousis, L; Kamyshkov, Y; Kaplan, D; Kawasaki, T; Keefer, G; Kemp, E; de Kerret, H; Kibe, Y; Konno, T; Kryn, D; Kuze, M; Lachenmaier, T; Lane, C E; Langbrandtner, C; Lasserre, T; Letourneau, A; Lhuillier, D; Lima, H P; Lindner, M; Liu, Y; López-Castanõ, J M; LoSecco, J M; Lubsandorzhiev, B K; Lucht, S; McKee, D; Maeda, J; Maesano, C N; Mariani, C; Maricic, J; Martino, J; Matsubara, T; Mention, G; Meregaglia, A; Miletic, T; Milincic, R; Milzstajn, A; Miyata, H; Motta, D; Mueller, Th A; Nagasaka, Y; Nakajima, K; Novella, P; Obolensky, M; Oberauer, L; Onillon, A; Osborn, A; Ostrovskiy, I; Palomares, C; Peeters, S J M; Pepe, I M; Perrin, P; Pfahler, P; Porta, A; Potzel, W; Queval, R; Reichenbacher, J; Reinhold, B; Remoto, A; Reyna, D; Röhling, M; Roth, S; Rubin, H A; Sakamoto, Y; Santorelli, R; Sato, F; Schönert, S; Schoppmann, S; Schwan, U; Schwetz, T; Shaevitz, M; Shrestha, D; Sida, J-L; Sinev, V; Skorokhvatov, M; Smith, E; Stahl, A; Stancu, I; Strait, M; Stüken, A; Suekane, F; Sukhotin, S; Sumiyoshi, T; Sun, Y; Sun, Z; Svoboda, R; Tabata, H; Tamura, N; Terao, K; Tonazzo, A; Toups, M; Thi, H H Trinh; Veyssiere, C; Vignaud, D; Wagner, S; Watanabe, H; White, B; Wiebusch, C; Winslow, L; Worcester, M; Wurm, M; Yanovitch, E; Yermia, F; Zbiri, K; Zimmer, V

    2011-01-01

    The Double Chooz Experiment presents an indication of reactor electron antineutrino disappearance consistent with neutrino oscillations. A ratio of 0.944 $\\pm$ 0.016 (stat) $\\pm$ 0.040 (syst) observed to predicted events was obtained in 101 days of running at the Chooz Nuclear Power Plant in France, with two 4.25 GW$_{th}$ reactors. The results were obtained from a single 10 m$^3$ fiducial volume detector located 1050 m from the two reactor cores. The reactor antineutrino flux prediction used the Bugey4 measurement as an anchor point. The deficit can be interpreted as an indication of a non-zero value of the still unmeasured neutrino mixing parameter \\sang. Analyzing both the rate of the prompt positrons and their energy spectrum we find \\sang = 0.086 $\\pm$ 0.041 (stat) $\\pm$ 0.030 (syst), or, at 90% CL, 0.015 $<$ \\sang $\\ <$ 0.16.

  11. Rate-Only analysis with reactor-off data in the Double Chooz experiment

    CERN Document Server

    Novella, P

    2013-01-01

    Among ongoing reactor-based experiments, Double Chooz is unique in obtaining data when the reactor cores are brought down for maintenance. These reactor-off data allow for a clean measurement of the backgrounds of the experiment, thus being of uppermost importance for the theta13 oscillation analysis. While the oscillation results published by the collaboration in 2011 and 2012 rely on background models derived from reactor-on data, in this talk we present an independent study based on the handle provided by 7.53 days of reactor-off data. A global fit to both theta13 and the total background is performed by analyzing the observed neutrino rate as a function of the non-oscillated expected rate for different reactor power conditions. The result presented in this talk is fully consistent with the one already published by Double Chooz. As they both yield almost the same precision, this work stands as a prove of the reliability of the background estimates and the oscillation analysis of the experiment.

  12. Measurement of the mixing leptonic parameter θ13 at the Double Chooz reactor antineutrino experiment

    International Nuclear Information System (INIS)

    The Double Chooz experiment aims at measuring the neutrino mixing parameter θ13 by studying the oscillations of de ν-bare produced by the Chooz nuclear reactors located in France. The experimental concept consists in comparing the signal of two identical 10.3 m3 detectors, allowing to cancel most of the experimental systematic uncertainties. The near detector, whose goal is the flux normalization and a measurement without oscillation, is expected to be delivered in 2013. The farthest detector from the source is taking data since April 2011 and is sensitive to θ13, which is expected to affect both the rate and the shape of the measured de ν-bare. In this thesis, are first presented the Double Chooz experiment, with its ν-bare source, its detection method, and the expected signal and backgrounds. In order to perform a selection, important quantities have to be reconstructed, calibrated, and saved in data files. The channel time offsets determination, the energy and vertex reconstruction algorithm CocoReco, the reconstruction packages of the Common Trunk, and the light trees maker Cheetah are especially presented. Concerning the data analysis, all the selection cuts and results for signal and backgrounds are discussed, particularly the multiplicity cut, the multiple off time window method, the lithium veto cut, and the cosmogenic 9Li background studies. The Double Chooz experiment observed 8,249 de -bare candidates in 227.93 days in its far detector only. The reactor antineutrino flux prediction used the Bugey 4 flux measurement after correction for differences in core composition. The expectation in case of no-oscillation is 8,937 events and this deficit is interpreted as evidence for ν-bare disappearance. From a rate and shape analysis, is found sin22θ = 0,109± 0,030 (stat) ± 0,025 (syst), with Δm231 = 2,32 x 10-3 eV2, while the no-oscillation hypothesis is even excluded at 2.9 σ. (author)

  13. Status of Double Chooz

    Energy Technology Data Exchange (ETDEWEB)

    Reyna, D., E-mail: reyna@anl.gov [Argonne National Laboratory, HEP Division, 9700 S. Cass Ave., Argonne, IL 60439 (United States)

    2011-12-15

    The Double Chooz experiment will be the next reactor based neutrino oscillation measurement. The collaboration has made significant progress toward the initiation of the experimental construction. Here, we present details of the design, testing and development that have been ongoing, as well as the expected schedule for construction and installation of the experiment. We are currently on our target path to begin data taking in 2008.

  14. Double Chooz: Latest results

    CERN Document Server

    Crespo-Anadón, J I

    2014-01-01

    The latest results from the Double Chooz experiment on the neutrino mixing angle $\\theta_{13}$ are presented. A detector located at an average distance of 1050 m from the two reactor cores of the Chooz nuclear power plant has accumulated a live time of 467.90 days, corresponding to an exposure of 66.5 GW-ton-year (reactor power $\\times$ detector mass $\\times$ live time). A revised analysis has boosted the signal efficiency and reduced the backgrounds and systematic uncertainties compared to previous publications, paving the way for the two detector phase. The measured $\\sin^2 2\\theta_{13} = 0.090^{+0.032}_{-0.029}$ is extracted from a fit to the energy spectrum. A deviation from the prediction above a visible energy of 4 MeV is found, being consistent with an unaccounted reactor flux effect, which does not affect the $\\theta_{13}$ result. A consistent value of $\\theta_{13}$ is measured in a rate-only fit to the number of observed candidates as a function of the reactor power, confirming the robustness of the ...

  15. Double Chooz and recent results

    Science.gov (United States)

    Meregaglia, A.; Double Chooz Collaboration

    2016-07-01

    The reactor bar{{ν}}e^{} disappearance experiment Double Chooz, located in France near the power plant of Chooz, has as main goal the measurement of the θ_{{13}}^{} mixing angle. For the first time, in 2011, the experimental results gave an indication for a non-zero value of such an oscillation parameter. The mixing angle was successively measured using only the far detector finding the best fit value of sin2(2 θ_{{13}}^{}) = 0.090+0.033-0.029 . The near detector started data taking in December 2014 and it will allow to reduce the systematic errors so far dominated by the reactor flux uncertainty. In this paper a review of the experiment is presented focusing on the so-called Gadolinium-III results (DOUBLE CHOOZ COLLABORATION (ABE Y. et al.), JHEP, 10 (2014) 086; 02 (2015) 074). Furthermore additional physics measurements are presented such as the capability of Double Chooz to identify the ortho-positronium state on event by event basis.

  16. Latest Double Chooz results

    Science.gov (United States)

    Lasserre, Thierry; Double Chooz Collaboration

    2016-05-01

    I report the latest results from the Double Chooz experiment on the θ13 neutrino mixing angle. Two detectors are located at distances of 400 m and 1050 m from the reactor cores of the Chooz nuclear power station (France) to measure the disappearance of electron antineutrinos. The far detector has been taking data since 2011, accumulating a live time of 467.90 days (66.5 GW-ton-year). In this article we focus on the latest measurement using neutrino-induced neutron capture on hydrogen. A new analysis improved the signal efficiency and reduced the backgrounds and systematic uncertainties, leading to sin2 2θ 13 = 0.095+0.039 -0.038. When combined with the Gadolinium-based analysis this leads to sin2 2θ13 = 0.088+0.33 -0.033. The distortion from the prediction above a visible energy of 4 MeV is confirmed. The near detector started data taking in 2014 and first results shall be reported in 2016.

  17. Double Chooz Improved Multi-Detector Measurements

    CERN Document Server

    CERN. Geneva

    2016-01-01

    The Double Chooz experiment (DC) is a reactor neutrino oscillation experiment running at Chooz nuclear power plant (2 reactors) in France. In 2011, DC first reported indication of non-zero θ13 with the far detector (FD) located at the maximum of oscillation effects (i.e. disappearance), thus challenging the CHOOZ non-observation limit. A robust observation of θ13 followed in 2012 by the Daya Bay experiments with multiple detector configurations. Since 2015 DC runs in a multi-detector configuration making thus the impact of several otherwise dominating systematics reduce strongly. DC’s unique almost "iso-flux" site, allows the near detector (ND) to become a direct accurate non-oscillation reference to the FD. Our first multi-detector results at MORIOND-2016 showed an intriguing deviation of θ13 with respect to the world average. We will address this issue in this seminar. The combined "reactor-θ13" measurement is expected to ...

  18. Precision Muon Reconstruction in Double Chooz

    CERN Document Server

    Abe, Y; Barriere, J C; Baussan, E; Bekman, I; Bergevin, M; Bezerra, T J C; Bezrukov, L; Blucher, E; Buck, C; Busenitz, J; Cabrera, A; Caden, E; Camilleri, L; Carr, R; Cerrada, M; Chang, P -J; Chauveau, E; Chimenti, P; Collin, A P; Conover, E; Conrad, J M; Crespo-Anadón, J I; Crum, K; Cucoanes, A; Damon, E; Dawson, J V; Dietrich, D; Djurcic, Z; Dracos, M; Elnimr, M; Etenko, A; Fallot, M; von Feilitzsch, F; Felde, J; Fernandes, S M; Fischer, V; Franco, D; Franke, M; Furuta, H; Gil-Botella, I; Giot, L; Göger-Neff, M; Gonzalez, L F G; Goodenough, L; Goodman, M C; Grant, C; Haag, N; Hara, T; Haser, J; Hofmann, M; Horton-Smith, G A; Hourlier, A; Ishitsuka, M; Jochum, J; Jollet, C; Kaether, F; Kalousis, L N; Kamyshkov, Y; Kaplan, D M; Kawasaki, T; Kemp, E; de Kerret, H; Kryn, D; Kuze, M; Lachenmaier, T; Lane, C E; Lasserre, T; Letourneau, A; Lhuillier, D; Lima, H P; Lindner, M; no, J M López-Casta; LoSecco, J M; Lubsandorzhiev, B; Lucht, S; Maeda, J; Mariani, C; Maricic, J; Martino, J; Matsubara, T; Mention, G; Meregaglia, A; Miletic, T; Milincic, R; Minotti, A; Nagasaka, Y; Nikitenko, Y; Novella, P; Obolensky, M; Oberauer, L; Onillon, A; Osborn, A; Palomares, C; Pepe, I M; Perasso, S; Pfahler, P; Porta, A; Pronost, G; Reichenbacher, J; Reinhold, B; Röhling, M; Roncin, R; Roth, S; Rybolt, B; Sakamoto, Y; Santorelli, R; Schilithz, A C; Schönert, S; Schoppmann, S; Shaevitz, M H; Sharankova, R; Shimojima, S; Sibille, V; Sinev, V; Skorokhvatov, M; Smith, E; Spitz, J; Stahl, A; Stancu, I; Stokes, L F F; Strait, M; Stüken, A; Suekane, F; Sukhotin, S; Sumiyoshi, T; Sun, Y; Svoboda, R; Terao, K; Tonazzo, A; Thi, H H Trinh; Valdiviesso, G; Vassilopoulos, N; Veyssiere, C; Vivier, M; Wagner, S; Watanabe, H; Wiebusch, C; Winslow, L; Wurm, M; Yang, G; Yermia, F; Zimmer, V

    2014-01-01

    We describe a muon track reconstruction algorithm for the reactor anti-neutrino experiment Double Chooz. The Double Chooz detector consists of two optically isolated volumes of liquid scintillator viewed by PMTs, and an Outer Veto above these made of crossed scintillator strips. Muons are reconstructed by their Outer Veto hit positions along with timing information from the other two detector volumes. All muons are fit under the hypothesis that they are through-going and ultrarelativistic. If the energy depositions suggest that the muon may have stopped, the reconstruction fits also for this hypothesis and chooses between the two via the relative goodness-of-fit. In the ideal case of a through-going muon intersecting the center of the detector, the resolution is ~40 mm in each transverse dimension. High quality muon reconstruction is an important tool for reducing the impact of the cosmogenic isotope background in Double Chooz.

  19. Latest nH analysis in the Double Chooz experiment

    CERN Document Server

    Yang, Guang

    2015-01-01

    Precise measurement of the neutrino mixing angle $\\theta_{13}$ is the primary goal of the Double Chooz Experiment (DC), which is located in Chooz, France. The inverse beta decay process provides a unique signature of reactor anti-neutrino interactions, giving prompt signals from positron annihilation and delayed signals from neutron capture by either Gadolinium (Gd) or Hydrogen (H). This paper is dedicated to the latest nH analysis in Double Chooz. Typically, The Gd analysis is primary since fewer background events are involved. However, with accurate estimates of backgrounds and a precise reconstruction of energy, the nH analysis gives a powerful independent measurement of $\\theta_{13}$.

  20. Design studies for the Double Chooz trigger

    Energy Technology Data Exchange (ETDEWEB)

    Cucoanes, Andi Sebastian

    2009-07-24

    The main characteristic of the neutrino mixing effect is assumed to be the coupling between the flavor and the mass eigenstates. Three mixing angles ({theta}{sub 12}, {theta}{sub 23}, {theta}{sub 13}) are describing the magnitude of this effect. Still unknown, {theta}{sub 13} is considered very small, based on the measurement done by the CHOOZ experiment. A leading experiment will be Double Chooz, placed in the Ardennes region, on the same site as used by CHOOZ. The Double Chooz goal is the exploration of {proportional_to}80% from the currently allowed {theta}{sub 13} region, by searching the disappearance of reactor antineutrinos. Double Chooz will use two similar detectors, located at different distances from the reactor cores: a near one at {proportional_to}150 m where no oscillations are expected and a far one at 1.05 km distance, close to the first minimum of the survival probability function. The measurement foresees a precise comparison of neutrino rates and spectra between both detectors. The detection mechanism is based on the inverse {beta}-decay. The Double Chooz detectors have been designed to minimize the rate of random background. In a simplified view, two optically separated regions are considered. The target, filled with Gd-doped liquid scintillator, is the main antineutrino interaction volume. Surrounding the target, the inner veto region aims to tag the cosmogenic muon background which hits the detector. Both regions are viewed by photomultipliers. The Double Chooz trigger system has to be highly efficient for antineutrino events as well as for several types of background. The trigger analyzes discriminated signals from the central region and the inner veto photomultipliers. The trigger logic is fully programmable and can combine the input signals. The trigger conditions are based on the total energy released in event and on the PMT groups multiplicity. For redundancy, two independent trigger boards will be used for the central region, each of

  1. Design studies for the Double Chooz trigger

    International Nuclear Information System (INIS)

    The main characteristic of the neutrino mixing effect is assumed to be the coupling between the flavor and the mass eigenstates. Three mixing angles (θ12, θ23, θ13) are describing the magnitude of this effect. Still unknown, θ13 is considered very small, based on the measurement done by the CHOOZ experiment. A leading experiment will be Double Chooz, placed in the Ardennes region, on the same site as used by CHOOZ. The Double Chooz goal is the exploration of ∝80% from the currently allowed θ13 region, by searching the disappearance of reactor antineutrinos. Double Chooz will use two similar detectors, located at different distances from the reactor cores: a near one at ∝150 m where no oscillations are expected and a far one at 1.05 km distance, close to the first minimum of the survival probability function. The measurement foresees a precise comparison of neutrino rates and spectra between both detectors. The detection mechanism is based on the inverse β-decay. The Double Chooz detectors have been designed to minimize the rate of random background. In a simplified view, two optically separated regions are considered. The target, filled with Gd-doped liquid scintillator, is the main antineutrino interaction volume. Surrounding the target, the inner veto region aims to tag the cosmogenic muon background which hits the detector. Both regions are viewed by photomultipliers. The Double Chooz trigger system has to be highly efficient for antineutrino events as well as for several types of background. The trigger analyzes discriminated signals from the central region and the inner veto photomultipliers. The trigger logic is fully programmable and can combine the input signals. The trigger conditions are based on the total energy released in event and on the PMT groups multiplicity. For redundancy, two independent trigger boards will be used for the central region, each of them receiving signals from half of the photomultipliers. A third trigger board will

  2. Double Chooz: optimizing the sensitivity to {theta}{sub 13} with a multi-detector setup

    Energy Technology Data Exchange (ETDEWEB)

    Novella, P. [CIEMAT, Av. Complutense 22, 28040 Madrid (Spain)

    2012-08-15

    The best upper limit to the neutrino mixing angle {theta}{sub 13} is set by the CHOOZ experiment. The eventual measurement of {theta}{sub 13} in reactor neutrino experiments relies on a reduction of the CHOOZ systematics of about 1 order of magnitude, along with a major increase of the luminosity. Provided that enough statistics are achieved, fighting the systematics becomes the key towards {theta}{sub 13}. The Double Chooz experiment engages this fight with a multi-detector set up.

  3. Improved measurements of the neutrino mixing angle $\\theta_{13}$ with the Double Chooz detector

    CERN Document Server

    Abe, Y; Barriere, J C; Baussan, E; Bekman, I; Bergevin, M; Bezerra, T J C; Bezrukov, L; Blucher, E; Buck, C; Busenitz, J; Cabrera, A; Caden, E; Camilleri, L; Carr, R; Cerrada, M; Chang, P -J; Chauveau, E; Chimenti, P; Collin, A P; Conover, E; Conrad, J M; Crespo-Anadón, J I; Crum, K; Cucoanes, A S; Damon, E; Dawson, J V; Dietrich, D; Djurcic, Z; Dracos, M; Elnimr, M; Etenko, A; Fallot, M; von Feilitzsch, F; Felde, J; Fernandes, S M; Fischer, V; Franco, D; Franke, M; Furuta, H; Gil-Botella, I; Giot, L; Göger-Neff, M; Gonzalez, L F G; Goodenough, L; Goodman, M C; Grant, C; Haag, N; Hara, T; Haser, J; Hofmann, M; Horton-Smith, G A; Hourlier, A; Ishitsuka, M; Jochum, J; Jollet, C; Kaether, F; Kalousis, L N; Kamyshkov, Y; Kaplan, D M; Kawasaki, T; Kemp, E; de Kerret, H; Kryn, D; Kuze, M; Lachenmaier, T; Lane, C E; Lasserre, T; Letourneau, A; Lhuillier, D; Lima, H P; Lindner, M; López-Castaño, J M; LoSecco, J M; Lubsandorzhiev, B; Lucht, S; Maeda, J; Mariani, C; Maricic, J; Martino, J; Matsubara, T; Mention, G; Meregaglia, A; Miletic, T; Milincic, R; Minotti, A; Nagasaka, Y; Nikitenko, Y; Novella, P; Oberauer, L; Obolensky, M; Onillon, A; Osborn, A; Palomares, C; Pepe, I M; Perasso, S; Pfahler, P; Porta, A; Pronost, G; Reichenbacher, J; Reinhold, B; Röhling, M; Roncin, R; Roth, S; Rybolt, B; Sakamoto, Y; Santorelli, R; Schilithz, A C; Schönert, S; Schoppmann, S; Shaevitz, M H; Sharankova, R; Shimojima, S; Shrestha, D; Sibille, V; Sinev, V; Skorokhvatov, M; Smith, E; Spitz, J; Stahl, A; Stancu, I; Stokes, L F F; Strait, M; Stüken, A; Suekane, F; Sukhotin, S; Sumiyoshi, T; Sun, Y; Svoboda, R; Terao, K; Tonazzo, A; Thi, H H Trinh; Valdiviesso, G; Vassilopoulos, N; Veyssiere, C; Vivier, M; Wagner, S; Watanabe, H; Wiebusch, C; Winslow, L; Wurm, M; Yang, G; Yermia, F; Zimmer, V

    2014-01-01

    The Double Chooz experiment presents improved measurements of the neutrino mixing angle $\\theta_{13}$ using the data collected in 467.90 live days from a detector positioned at an average distance of 1050 m from two reactor cores at the Chooz nuclear power plant. Several novel techniques have been developed to achieve significant reductions of the backgrounds and systematic uncertainties with respect to previous publications, whereas the efficiency of the $\\bar\

  4. Double Chooz: results towards the near detector phase

    CERN Document Server

    Novella, P

    2014-01-01

    Since the first indication in 2011 of a non-vanishing value of $\\theta_{13}$ using reactor neutrinos by Double Chooz, this collaboration has developed new analyses leading to an increased precision on $\\theta_{13}$ and different cross-checks of the oscillation results. Beyond the update of the analysis based on neutron captures on Gd in 2012, Double Chooz has also released a consistent measurement of $\\theta_{13}$ by means of neutron captures on H. The combination of the n-Gd and n-H data samples, as well as 7.23 days of reactor off data, in a global rate+shape analysis yields $\\sin^22\\theta_{13} = 0.109\\pm 0.035$. This measurement has been validated with a new background-model-independent approach, which compares the observed and expected neutrino rates as a function of reactor power. This Reactor Rate Modulation analysis yields $\\sin^22\\theta_{13} = 0.102\\pm 0.043$ when combining the n-Gd and n-H samples. The Double Chooz collaboration is currently developing a new analysis increasing the signal-to-backgrou...

  5. Background-independent measurement of $\\theta_{13}$ in Double Chooz

    CERN Document Server

    Abe, Y; Barriere, J C; Baussan, E; Bekman, I; Bergevin, M; Bezerra, T J C; Bezrukov, L; Blucher, E; Buck, C; Busenitz, J; Cabrera, A; Caden, E; Camilleri, L; Carr, R; Cerrada, M; Chang, P -J; Chauveau, E; Chimenti, P; Collin, A P; Conover, E; Conrad, J M; Crespo-Anadón, J I; Crum, K; Cucoanes, A; Damon, E; Dawson, J V; Dietrich, D; Djurcic, Z; Dracos, M; Elnimr, M; Etenko, A; Fallot, M; von Feilitzsch, F; Felde, J; Fernandes, S M; Fischer, V; Franco, D; Franke, M; Furuta, H; Gil-Botella, I; Giot, L; Göger-Neff, M; Gonzalez, L F G; Goodenough, L; Goodman, M C; Grant, C; Haag, N; Hara, T; Haser, J; Hofmann, M; Horton-Smith, G A; Hourlier, A; Ishitsuka, M; Jochum, J; Jollet, C; Kaether, F; Kalousis, L N; Kamyshkov, Y; Kaplan, D M; Kawasaki, T; Kemp, E; de Kerret, H; Konno, T; Kryn, D; Kuze, M; Lachenmaier, T; Lane, C E; Lasserre, T; Letourneau, A; Lhuillier, D; Lima, H P; Lindner, M; López-Casta\; LoSecco, J M; Lucht, S; Maeda, J; Mariani, C; Maricic, J; Martino, J; Matsubara, T; Mention, G; Meregaglia, A; Miletic, T; Milincic, R; Minotti, A; Nagasaka, Y; Nakajima, K; Nikitenko, Y; Novella, P; Obolensky, M; Oberauer, L; Onillon, A; Osborn, A; Palomares, C; Pepe, I M; Perasso, S; Pfahler, P; Porta, A; Pronost, G; Reichenbacher, J; Reinhold, B; Röhling, M; Roncin, R; Roth, S; Rybolt, B; Sakamoto, Y; Santorelli, R; Sato, F; Schilithz, A C; Schönert, S; Schoppmann, S; Shaevitz, M H; Sharankova, R; Shimojima, S; Sibille, V; Sinev, V; Skorokhvatov, M; Smith, E; Spitz, J; Stahl, A; Stancu, I; Stokes, L F F; Strait, M; Stüken, A; Suekane, F; Sukhotin, S; Sumiyoshi, T; Sun, Y; Svoboda, R; Terao, K; Tonazzo, A; Thi, H H Trinh; Valdiviesso, G; Vassilopoulos, N; Veyssiere, C; Vivier, M; Wagner, S; Watanabe, H; Wiebusch, C; Winslow, L; Wurm, M; Yang, G; Yermia, F; Zimmer, V

    2014-01-01

    The oscillation results published by the Double Chooz collaboration in 2011 and 2012 rely on background models substantiated by reactor-on data. In this analysis, we present a background-model-independent measurement of the mixing angle $\\theta_{13}$ by including 7.53 days of reactor-off data. A global fit of the observed neutrino rates for different reactor power conditions is performed, yielding a measurement of both $\\theta_{13}$ and the total background rate. The results on the mixing angle are improved significantly by including the reactor-off data in the fit, as it provides a direct measurement of the total background rate. This reactor rate modulation analysis considers antineutrino candidates with neutron captures on both Gd and H, whose combination yields $\\sin^2(2\\theta_{13})=$ 0.102 $\\pm$ 0.028(stat.) $\\pm$ 0.033(syst.). The results presented in this study are fully consistent with the ones already published by Double Chooz, achieving a competitive precision. They provide, for the first time, a de...

  6. Letter of Intent for Double-CHOOZ: a Search for the Mixing Angle Theta13

    CERN Document Server

    Ardellier, F; Barrière, J C; Bauer, M; Bezrukov, L; Buck, C; Cattadori, C; Courty, B; Cribier, Michel; Dalnoki-Veress, F; Danilov, N; Kerret, H; Vacri, A D; Etenko, A; Fallot, M; Grieb, C; Goeger, M; Guertin, A; Kirchner, T; Krylov, Y S; Kryn, D; Hagner, C; Hampel, W; Hartmann, F X; Huber, P; Jochum, J; Lachenmaier, T; Lasserre, T; Lendvai, C; Lindner, Manfred; Marie, F; Martino, J; Mention, G; Milsztajn, A; Meyer, J P; Motta, D; Oberauer, L; Obolensky, M; Pandola, L; Potzel, W; Schönert, S; Schwan, U; Schwetz, T; Scholl, S; Scola, L; Skorokhvatov, M; Sukhotin, S; Letourneau, A; Vignaud, D; Feilitzsch, F; Winter, W; Yanovich, E A; Grieb, Ch.; Lasserre, Th.; Lendvai, Ch.

    2004-01-01

    Tremendous progress has been achieved in neutrino oscillation physics during the last few years. However, the smallness of the $\\t13$ neutrino mixing angle still remains enigmatic. The current best constraint comes from the CHOOZ reactor neutrino experiment $\\s2t13 < 0.2$ (at 90% C.L., for $\\adm2=2.0 10^{-3} \\text{eV}^2$). We propose a new experiment on the same site, Double-CHOOZ, to explore the range of $\\s2t13$ from 0.2 to 0.03, within three years of data taking. The improvement of the CHOOZ result requires an increase in the statistics, a reduction of the systematic error below one percent, and a careful control of the cosmic ray induced background. Therefore, Double-CHOOZ will use two identical detectors, one at $\\sim$150 m and another at 1.05 km distance from the nuclear cores. The plan is to start data taking with two detectors in 2008, and to reach a sensitivity of 0.05 in 2009, and 0.03 in 2011.

  7. Optimierung der Fluoreszenzcharakteristik von Flüssigszintillatoren des Double Chooz Reaktorneutrinoexperiments

    OpenAIRE

    Aberle, C.

    2008-01-01

    The goal of the reactor neutrino experiment Double Chooz is to search for the last remaining unknown neutrino mixing angle 13 of the PMNS matrix. This disappearence experiment aims at detecting possible oscillations of electron antineutrinos at a distance of one kilometer. A relative measurement will be done between a far and a near detector, each of them containing several cubic meters of Gadoliniumloaded organic liquid scintillator as a neutrino target. A second unloaded scintillator surrou...

  8. Alternative approach for the measurement of θ{sub 13} using neutron capture on hydrogen in Double Chooz

    Energy Technology Data Exchange (ETDEWEB)

    Lucht, Sebastian [RWTH Aachen University (Germany); Collaboration: Double Chooz-Collaboration

    2013-07-01

    Double Chooz is a reactor antineutrino experiment built to measure neutrino mixing angle θ{sub 13}. The experiment uses two detectors at different distances (400 m and 1 km) to precisely measure the disappearance of anti ν{sub e} from the CHOOZ-B reactor cores. The neutrinos are detected by the inverse beta decay (IBD) signature which is a two-fold coincidence of a prompt positron followed by a delayed neutron capture on Gadolinium (Gd) or Hydrogen (H). All recently published results from reactor neutrino experiments are based on neutron captures on Gd. In Double Chooz an additional method based on captures on H has been developed. The H detection channel provides an independent data sample to cross-check the Gd analysis result. Furthermore, because of the different nature of the backgrounds and systematic uncertainties, a combination of the H and Gd analysis improves the measurement of θ{sub 13}. In this talk, the current results from the H analysis in Double Chooz are presented.

  9. First Measurement of \\theta_13 from Delayed Neutron Capture on Hydrogen in the Double Chooz Experiment

    CERN Document Server

    Abe, Y; Anjos, J C dos; Barriere, J C; Bergevin, M; Bernstein, A; Bezerra, T J C; Bezrukhov, L; Blucher, E; Bowden, N S; Buck, C; Busenitz, J; Cabrera, A; Caden, E; Camilleri, L; Carr, R; Cerrada, M; Chang, P -J; Chimenti, P; Classen, T; Collin, A P; Conover, E; Conrad, J M; Crespo-Anadón, J I; Crum, K; Cucoanes, A; Damon, E; Dawson, J V; Dazeley, S; Dietrich, D; Djurcic, Z; Dracos, M; Durand, V; Ebert, J; Efremenko, Y; Elnimr, M; Erickson, A; Etenko, A; Fallot, M; Fechner, M; von Feilitzsch, F; Felde, J; Fernandes, S M; Fischer, V; Franco, D; Franke, A J; Franke, M; Furuta, H; Gama, R; Gil-Botella, I; Giot, L; Göger-Neff, M; Gonzalez, L F G; Goodenough, L; Goodman, M C; Goon, J TM; Greiner, D; Haag, N; Habib, S; Hagner, C; Hara, T; Hartmann, F X; Haser, J; Hatzikoutelis, A; Hayakawa, T; Hofmann, M; Horton-Smith, G A; Hourlier, A; Ishitsuka, M; Jochum, J; Jollet, C; Jones, C L; Kaether, F; Kalousis, L N; Kamyshkov, Y; Kaplan, D M; Kawasaki, T; Keefer, G; Kemp, E; de Kerret, H; Konno, T; Kryn, D; Kuze, M; Lachenmaier, T; Lane, C E; Langbrandtner, C; Lasserre, T; Letourneau, A; Lhuillier, D; Lima, H P; Lindner, M; López-Castaño, J M; LoSecco, J M; Lubsandorzhiev, B K; Lucht, S; McKee, D; Maeda, J; Maesano, C N; Mariani, C; Maricic, J; Martino, J; Matsubara, T; Mention, G; Meregaglia, A; Meyer, M; Miletic, T; Milincic, R; Miyata, H; Mueller, Th A; Nagasaka, Y; Nakajima, K; Novella, P; Obolensky, M; Oberauer, L; Onillon, A; Osborn, A; Ostrovskiy, I; Palomares, C; Pepe, I M; Perasso, S; Perrin, P; Pfahler, P; Porta, A; Potzel, W; Pronost, G; Reichenbacher, J; Reinhold, B; Remoto, A; Röhling, M; Roncin, R; Roth, S; Rybolt, B; Sakamoto, Y; Santorelli, R; Sato, F; Schönert, S; Schoppmann, S; Schwetz, T; Shaevitz, M H; Shimojima, S; Shrestha, D; Sida, J-L; Sinev, V; Skorokhvatov, M; Smith, E; Spitz, J; Stahl, A; Stancu, I; Stokes, L F F; Strait, M; Stüken, A; Suekane, F; Sukhotin, S; Sumiyoshi, T; Sun, Y; Svoboda, R; Terao, K; Tonazzo, A; Toups, M; Thi, H H Trinh; Valdiviesso, G; Veyssiere, C; Wagner, S; Watanabe, H; White, B; Wiebusch, C; Winslow, L; Worcester, M; Wurm, M; Yermia, F; Zimmer, V

    2013-01-01

    The Double Chooz experiment has determined the value of the neutrino oscillation parameter $\\theta_{13}$ from an analysis of inverse beta decay interactions with neutron capture on hydrogen. This analysis uses a three times larger fiducial volume than the standard Double Chooz assessment, which is restricted to a region doped with gadolinium (Gd), yielding an exposure of 113.1 GW-ton-years. The data sample used in this analysis is distinct from that of the Gd analysis, and the systematic uncertainties are also largely independent, with some exceptions, such as the reactor neutrino flux prediction. A combined rate- and energy-dependent fit finds $\\sin^2 2\\theta_{13}=0.097\\pm 0.034(stat.) \\pm 0.034 (syst.)$, excluding the no-oscillation hypothesis at 2.0 \\sigma. This result is consistent with previous measurements of $\\sin^2 2\\theta_{13}$.

  10. From the measurement of the θ13 mixing angle to the search for geo-neutrinos: studying νe-bare with Double Chooz and Borexino

    International Nuclear Information System (INIS)

    Double Chooz is a reactor neutrino oscillation experiment which aims at measuring the θ13 mixing angle thanks to two identical detectors located at different distances from the two reactors of the Chooz nuclear power plant, in the French Ardennes. While the near detector will start taking data in fall 2014 to normalize the flux of the neutrinos emitted by the nuclear reactors, the far detector is running since April 2011 and allows to observe the neutrinos disappearance through the neutrino oscillation phenomenon. This thesis is also dedicated to the Borexino experiment which was designed to observe solar neutrinos. Due to its low background level as well as its position in a nuclear free country, Italy, Borexino is also sensitive to geo-neutrinos. This thesis presents both the Double Chooz and Borexino experiments, from the description of the detectors to the main results, with a special attention to the background and its rejection. Studies on the neutrino directionality with these two experiments are also detailed. In the case of Double Chooz, since the neutrinos are coming from the two nuclear reactors, the precision of the analysis method can be assessed. This thesis presents also for the first time the possibility to retrieve the initial direction of the neutrinos when the neutrons created in the inverse beta decay reactions are captured on hydrogen. In the case of Borexino, neutrino directionality information could facilitate the discrimination between geo-neutrinos and neutrinos from nuclear reactors. (author)

  11. Qualification Tests of 474 Photomultiplier Tubes for the Inner Detector of the Double Chooz Experiment

    CERN Document Server

    Bauer, C; Hofacker, R; Jänner, K; Kaether, F; Langbrandtner, C; Lindner, M; Lucht, S; Reissfelder, M; Schönert, S; Stüken, A; Wiebusch, C

    2011-01-01

    The hemispherical 10" photomultiplier tube (PMT) R7081 from Hamamatsu Photonics K.K. (HPK) is used in various experiments in particle and astroparticle physics. We describe the test and calibration of 474 PMTs for the reactor antineutrino experiment Double Chooz. The unique test setup at Max-Planck-Institut f\\"ur Kernphysik Heidelberg (MPIK) allows to calibrate 30 PMTs simultaneously and to characterize the single photo electron response, transit time spread, linear behaviour and saturation effects, photon detection efficiency and high voltage calibration.

  12. Development of a level-1 trigger and timing system for the Double Chooz neutrino experiment

    Energy Technology Data Exchange (ETDEWEB)

    Reinhold, Bernd

    2009-02-25

    The measurement of the mixing angle {theta}{sub 13} is the goal of several running and planned experiments. The experiments are either accelerator based (super)beam experiments (e.g. MINOS, T2K, Nova) or reactor anti-neutrino disappearance experiments (e.g. Daya Bay, RENO or Double Chooz). In order to measure or constrain {theta}{sub 13} with the Double Chooz experiment the overall systematic errors have to be controlled at the one-percent or sub-percent level. The limitation of the systematic errors is achieved through various means and techniques. E.g. the experiment consists of two identical detectors at different baselines, which allow to make a differential anti-neutrino flux measurement, where basically only relative normalisation errors remain. The requirements on the systematic errors put also strong constraints on the quality of all components and materials used for both detectors, most prominently on the stability and radiopurity of the scintillator, the photomultiplier tubes, the vessels containing the detector liquids and the shielding against ambient radioactivity. The readout electronics, trigger and data acquisition system have to operate reliably as an integrated and highly efficient whole over several years. The trigger is provided by the Level-1 Trigger and Timing System, which is the subject of this thesis. It has to provide a highly efficient trigger (at the 0.1% level) for neutrino-induced events as well as for several types of background events. Its decision is realized in hardware and based on energy depositions in the muon veto and the target region. The Level-1 Trigger and Timing System furthermore provides a common System Clock and an absolute timestamp for each event. The Level-1 Trigger and Timing System consists of two types of VME modules, several Trigger Boards and a Trigger Master Board, which have been custom-designed and developed in the electronics workshop of our institute for this experiment and purpose, starting in 2005. In

  13. Development of a level-1 trigger and timing system for the Double Chooz neutrino experiment

    International Nuclear Information System (INIS)

    The measurement of the mixing angle θ13 is the goal of several running and planned experiments. The experiments are either accelerator based (super)beam experiments (e.g. MINOS, T2K, Nova) or reactor anti-neutrino disappearance experiments (e.g. Daya Bay, RENO or Double Chooz). In order to measure or constrain θ13 with the Double Chooz experiment the overall systematic errors have to be controlled at the one-percent or sub-percent level. The limitation of the systematic errors is achieved through various means and techniques. E.g. the experiment consists of two identical detectors at different baselines, which allow to make a differential anti-neutrino flux measurement, where basically only relative normalisation errors remain. The requirements on the systematic errors put also strong constraints on the quality of all components and materials used for both detectors, most prominently on the stability and radiopurity of the scintillator, the photomultiplier tubes, the vessels containing the detector liquids and the shielding against ambient radioactivity. The readout electronics, trigger and data acquisition system have to operate reliably as an integrated and highly efficient whole over several years. The trigger is provided by the Level-1 Trigger and Timing System, which is the subject of this thesis. It has to provide a highly efficient trigger (at the 0.1% level) for neutrino-induced events as well as for several types of background events. Its decision is realized in hardware and based on energy depositions in the muon veto and the target region. The Level-1 Trigger and Timing System furthermore provides a common System Clock and an absolute timestamp for each event. The Level-1 Trigger and Timing System consists of two types of VME modules, several Trigger Boards and a Trigger Master Board, which have been custom-designed and developed in the electronics workshop of our institute for this experiment and purpose, starting in 2005. In this thesis all

  14. THYDE-B1/MOD1: a computer code for analysis of small-break loss-of-coolant accident of boiling water reactors

    International Nuclear Information System (INIS)

    THYDE-B1/MOD1 is a computer code to analyze thermo-hydraulic transients of the reactor cooling system of a BWR, mainly during a small-break loss-of-coolant accidnet (SB-LOCA) with a special emphasis on the behavior of pressure and mixture level in the pressure vessel. The coolant behavior is simulated with a volume-and-junction method based on assumptions of thermal equilibrium and homogeneous conditions for two-phase flow. A characteristic feature of this code is a three-region representation of the state of the coolant in a control volume, in which three regions, i.e., subcooled liquid, saturated mixture and saturated steam regions are allowed to exist. The regions are separated by moving boundaries, tracked by mass and energy balances for each region. The interior of the pressure vessel is represented by two volumes with three regions: one for inside of the shroud and the other for outside, while other portions of the system are treated with homogeneous model. This method, although it seems to be very simple, has been verified to be adequate for cases of BWR SB-LOCAs in which the hydraulic transient is relatively slow and the cooling of the core strongly depends on the mixture level behavior in the vessel. In order to simulate the system behavior, THYDE-B1 is provided with analytical models for reactor kinetics, heat generation and conduction in fuel rods and structures, heat transfer between coolant and solid surfaces, coolant injection systems, breaks and discharge systems, jet pumps, recirculation pumps, and so on. The verification of the code has been conducted. A good predictability of the code has been indicated through the comparison of calculated results with experimental data provided by ROSA-III small-break tests. This report presents the analytical models, solution method, and input data requirements of the THYDE-B1/MOD1 code. (author)

  15. Characterization of Magnetic Field Immersed Photomultipliers from Double Chooz Experiment. Design and Construction of their Magnetic Shields; Caracterizacion de los fotomultiplicadores del experimento Double Chooz bajo campo magnetico y diseno y construccion de sus blindajes magneticos

    Energy Technology Data Exchange (ETDEWEB)

    Valdivia Valero, F. J.

    2007-12-28

    Flavour oscillations of neutrinos are a quantum-mechanical effect widely demonstrated. It is explained through interferences of their mass eigenstates, therefore, belonging to the physical area beyond the Standard Model. This work deals with the CIEMAT collaboration in the neutrino experiment Double Chooz. Such an experiment aims to measure the mixture angle {theta}{sub 1}3, one of the PMNS leptonic mixture matrix, with a un reached-before sensibility by decrease of systematic errors. For this, two identical scintillator detectors, equipped with PMT's, will be sited at different distances from two reactors located in the nuclear power plant CHOOZ B (France). The electronic neutrino flux from these reactors will be compared, explaining its deficit by flavour oscillations of these particles. The identity of both detectors will be diminished by the magnetic field effects on the PMT's response. Therefore, this study serves as for quantifying such an effects as for fitting the magnetic shields design that minimize them. Shielding measurements and final design of magnetic shields as much as the effect these ones cause in the PMT's response immersed in a monitored magnetic field are presented. (Author) 85 refs.

  16. Characterization of Magnetic Field Immersed Photomultipliers from Double Chooz Experiment. Design and Construction of their Magnetic Shields

    International Nuclear Information System (INIS)

    Flavour oscillations of neutrinos are a quantum-mechanical effect widely demonstrated. It is explained through interferences of their mass eigenstates, therefore, belonging to the physical area beyond the Standard Model. This work deals with the CIEMAT collaboration in the neutrino experiment Double Chooz. Such an experiment aims to measure the mixture angle θ13, one of the PMNS leptonic mixture matrix, with a un reached-before sensibility by decrease of systematic errors. For this, two identical scintillator detectors, equipped with PMT's, will be sited at different distances from two reactors located in the nuclear power plant CHOOZ B (France). The electronic neutrino flux from these reactors will be compared, explaining its deficit by flavour oscillations of these particles. The identity of both detectors will be diminished by the magnetic field effects on the PMT's response. Therefore, this study serves as for quantifying such an effects as for fitting the magnetic shields design that minimize them. Shielding measurements and final design of magnetic shields as much as the effect these ones cause in the PMT's response immersed in a monitored magnetic field are presented. (Author) 85 refs

  17. Reactor Neutrino Physics -- An Update

    OpenAIRE

    Boehm, Felix

    1999-01-01

    We review the status and the results of reactor neutrino experiments. Long baseline oscillation experiments at Palo Verde and Chooz have provided limits for the oscillation parameters while the recently proposed Kamland experiment at a baseline of more than 100km is now in the planning stage. We also describe the status of neutrino magnetic moment experiments at reactors.

  18. Muon capture on light isotopes in Double Chooz

    CERN Document Server

    Abe, Y; Almazan, H; Alt, C; Appel, S; Barriere, J C; Baussan, E; Bekman, I; Bergevin, M; Bezerra, T J C; Bezrukov, L; Blucher, E; Brugière, T; Buck, C; Busenitz, J; Cabrera, A; Camilleri, L; Carr, R; Cerrada, M; Chauveau, E; Chimenti, P; Collin, A P; Conover, E; Conrad, J M; Crespo-Anadón, J I; Crum, K; Cucoanes, A S; Damon, E; Dawson, J V; de Kerret, H; Dhooghe, J; Dietrich, D; Djurcic, Z; Anjos, J C dos; Dracos, M; Etenko, A; Fallot, M; Felde, J; Fernandes, S M; Fischer, V; Franco, D; Franke, M; Furuta, H; Gil-Botella, I; Giot, L; Göger-Neff, M; Gomez, H; Gonzalez, L F G; Goodenough, L; Goodman, M C; Haag, N; Hara, T; Haser, J; Hellwig, D; Hofmann, M; Horton-Smith, G A; Hourlier, A; Ishitsuka, M; Jochum, J; Jollet, C; Kaether, F; Kalousis, L N; Kamyshkov, Y; Kaneda, M; Kaplan, D M; Kawasaki, T; Kemp, E; Kryn, D; Kuze, M; Lachenmaier, T; Lane, C E; Lasserre, T; Letourneau, A; Lhuillier, D; Lima, H P; Lindner, M; López-Castaño, J M; LoSecco, J M; Lubsandorzhiev, B; Lucht, S; Maeda, J; Mariani, C; Maricic, J; Martino, J; Matsubara, T; Mention, G; Meregaglia, A; Miletic, T; Milincic, R; Minotti, A; Nagasaka, Y; Navas-Nicolás, D; Novella, P; Oberauer, L; Obolensky, M; Onillon, A; Osborn, A; Palomares, C; Pepe, I M; Perasso, S; Porta, A; Pronost, G; Reichenbacher, J; Reinhold, B; Röhling, M; Roncin, R; Rybolt, B; Sakamoto, Y; Santorelli, R; Schilithz, A C; Schönert, S; Schoppmann, S; Shaevitz, M H; Sharankova, R; Shrestha, D; Sibille, V; Sinev, V; Skorokhvatov, M; Smith, E; Soiron, M; Spitz, J; Stahl, A; Stancu, I; Stokes, L F F; Strait, M; Suekane, F; Sukhotin, S; Sumiyoshi, T; Sun, Y; Svoboda, R; Terao, K; Tonazzo, A; Thi, H H Trinh; Valdiviesso, G; Vassilopoulos, N; Veyssiere, C; Vivier, M; von Feilitzsch, F; Wagner, S; Walsh, N; Watanabe, H; Wiebusch, C; Wurm, M; Yang, G; Yermia, F; Zimmer, V

    2015-01-01

    Using the Double Chooz detector, designed to measure the neutrino mixing angle $\\theta_{13}$, the products of $\\mu^-$ capture on $^{12}$C, $^{13}$C, $^{14}$N and $^{16}$O have been measured. Over a period of 489.5 days, $2.3\\times10^6$ stopping cosmic $\\mu^-$ have been collected, of which $1.8\\times10^5$ captured on carbon, nitrogen, or oxygen nuclei in the inner detector scintillator or acrylic vessels. The resulting isotopes were tagged using prompt neutron emission (when applicable), the subsequent beta decays, and, in some cases, $\\beta$-delayed neutrons. The most precise measurement of the rate of $^{12}\\mathrm C(\\mu^-,\

  19. 3D - Acquisition systems - test in Chooz B nuclear plant

    International Nuclear Information System (INIS)

    EDF needs 3D-acquisition systems to get the precise geometry of critical nuclear spaces in order to prepare computer simulations of operations in these areas. The simulations must lead to an increase of the efficiency of the operation. The acquisition of the 3-D geometry can be done using 3D-acquisition systems. To answer the needs of the Construction Division, four different systems are compared by the Research Division in Chooz B nuclear plant in order to determine the right solution for each 3D-acquisition problem

  20. Low background gamma spectroscopy and neutron activation analysis for Double Chooz

    International Nuclear Information System (INIS)

    To check the radiopurity of detector components of the reactor neutrino oscillation experiment Double Chooz, low background gamma spectroscopy measurements have been performed at the Garching underground lab using a 150% germanium counter surrounded by active and passive shielding systems. The active shielding consists of an anti-Compton veto and a muon veto. Upper limits on the activities of radioisotopes originating from the uranium and thorium decay chains, as well as potassium-40, can be given in the order of 10-10 g/g. An even higher sensitivity can be obtained by neutron activation analysis performed on the wavelength shifter PPO and the acrylics used for the detector tank. The samples were irradiated for ten minutes at the FRM2 with a thermal neutron flux of (1.63±0.05).1013 cm-2s-1. Thereafter, the spectra of the irradiated samples were recorded using the germanium counting system mentioned above, mainly focussing on the isotope potassium-42. The content of potassium-40 could be determined to be of the order of 10-11 g/g.

  1. Neutron detection uncertainties in the θ13 analysis of the Double Chooz experiment

    International Nuclear Information System (INIS)

    The reactor antineutrino experiment Double Chooz aims to provide a precise measurement of the neutrino mixing angle θ13. In the analysis with one detector, accuracy in the predicted neutrino spectrum from simulation is a necessity with regard to normalization and energy shape. The detection efficiency of neutron events, which are part of the coincidence signal created by neutrinos, introduce the largest uncertainty contribution of the normalization of the experiment related to the signal detection. In order to accomplish a matching of the efficiencies observed in data and simulation, a correction of the Monte Carlo normalization and an associated systematic uncertainty are inputs in the θ13 analysis. Calibration source deployments in the inner two detector volumes allow for a measurement of the neutron detection efficiency using 252Cf fission neutrons. New methods enable to compute the correction integrated over the whole volume and the corresponding uncertainty of the selection cut related efficiency. With these revised approaches a factor two improvement in the detection efficiency uncertainty was achieved. The correction of the neutron capture fraction - the capture fraction quantifies the proportion of captures on a particular element - is evaluated and tested for its robustness. Furthermore, a crosscheck of this quantity is discussed using neutrons produced by cosmic muon spallation. Finally, the uncertainty on border effects, emerging from neutron migration at the fiducial volume boundaries, is estimated by means of different Monte Carlo configurations with varying parameters and neutron physics modelings.

  2. Light Production in the Double Chooz Photomultiplier Tubes

    Energy Technology Data Exchange (ETDEWEB)

    Calvo, E.; Cerrada, M.; Crespo, J. I.; Gil-Botella, I.; Jimenez, S.; Lopez, M.; Novella, P.; Palomares, C.; Santorelli, R.; Verdugo, A.

    2012-09-13

    In this document we present a study of the phenomenon of light emission (called glowing) in the bases of the Hamamatsu R7081MOD-ASSY photomultiplier tubes (PMTs) used in the Double Chooz experiment. The tests have been carried out at the CIEMAT laboratories over a photomultiplier tube of the same model. We have studied the phenomenon making first a characterization of it, and then focusing on the dependence of the rate and the amount of emitted light versus voltage and temperature. In addition, we have looked for the possible existence of an ultraviolet component in the light which would be harmful for the experiment because it could be able to excite the scintillator liquid. Finally, we propose and test a method to reduce the light emission using a cover on the base of the photomultiplier tube.. (Author)

  3. Fast reactor development program in France in 1997

    International Nuclear Information System (INIS)

    The operating performance of the French nuclear plants in 1997 were again satisfactory, confirming the good 1996 results; 78% of the national electricity production was of nuclear origin (376/481 TWh); the nuclear safety indicators were even better with a slight decrease in the number of reported incidents; the availability factor was higher than 82,5%; the kWh production cost continue to decrease by about 1,7% per year; thanks to an ALARA approach, individual and collective doses are still decreasing; the liquid and gaseous releases are also still decreasing and the volume of nuclear wastes is equivalent to last year. The major event of 1997 was the confirmation for the start up of the most advanced nuclear plants, N4 type, with Chooz B1 reaching full power on May 9, 1997 and Chooz B2 following soon with first criticality on March 10 and full power on September 18. As a confirmation and enjoying the experience of Chooz B the first unit of Civaux was synchronised to the grid end of 1997 after fuel loading in Sept 1997. The status of fast reactors was deeply modified, with the governmental decision to abandon Superphenix, which led to decide to close also EFR studies in 1997, and the perspective of operating Phenix till 2004, mainly for studies on radioactive wastes incineration. Three meetings were held during the second half of the year by the > (GP - Permanent Committee) on Phenix; after reviewing all the safety aspects, they concluded to the possibility to resume operation according to the general following scheme: one cycle in 1998, about one year for works, then 6 cycles between 2000 and 2004. Of course, the main event concerning Superphenix is the decision of abandon announced in June 1997. The decree allowing operation had been cancelled in February. The works foreseen in the frame of the planned > shutdown had been conducted satisfactorily, during the first-half of the year. At the beginning of 1998, it was stated that the reactor would not operate again

  4. Realization of the low background neutrino detector Double Chooz. From the development of a high-purity liquid and gas handling concept to first neutrino data

    Energy Technology Data Exchange (ETDEWEB)

    Pfahler, Patrick

    2012-12-17

    Neutrino physics is one of the most vivid fields in particle physics. Within this field, neutrino oscillations are of special interest as they allow to determine driving oscillation parameters, which are collected as mixing angles in the leptonic mixing matrix. The exact knowledge of these parameters is the main key for the investigation of new physics beyond the currently known Standard Model of particle physics. The Double Chooz experiment is one of three reactor disappearance experiments currently taking data, which recently succeeded to discover a non-zero value for the last neutrino mixing angle {Theta}{sub 13}. As successor of the CHOOZ experiment, Double Chooz will use two detectors with improved design, each of them now composed of four concentrically nested detector vessels each filled with different detector liquid. The integrity of this multi-layered structure and the quality of the used detector liquids are essential for the success of the experiment. Within this frame, the here presented work describes the production of two detector liquids, the filling and handling of the Double Chooz far detector and the installation of all necessary hardware components therefore. In order to meet the strict requirements existing for the detector liquids, all components were individually selected in an extensive material selection process at TUM, which compared samples from different companies for their key properties: density, transparency, light yield and radio purity. Based on these measurements, the composition of muon veto scintillator and buffer liquid were determined. For the production of the detector liquids, a simple surface building close to the far detector site was upgraded into a large-scale storage and mixing facility, which allowed to separately, mix, handle and store 90 m{sup 3} of muon veto scintillator and 110 m{sup 3} of buffer liquid. For the muon veto scintillator, a master-solution composed of 4800 l LAB, 180 kg PPO and 1.8 kg of bis/MSB was

  5. Realization of the low background neutrino detector Double Chooz. From the development of a high-purity liquid and gas handling concept to first neutrino data

    International Nuclear Information System (INIS)

    Neutrino physics is one of the most vivid fields in particle physics. Within this field, neutrino oscillations are of special interest as they allow to determine driving oscillation parameters, which are collected as mixing angles in the leptonic mixing matrix. The exact knowledge of these parameters is the main key for the investigation of new physics beyond the currently known Standard Model of particle physics. The Double Chooz experiment is one of three reactor disappearance experiments currently taking data, which recently succeeded to discover a non-zero value for the last neutrino mixing angle Θ13. As successor of the CHOOZ experiment, Double Chooz will use two detectors with improved design, each of them now composed of four concentrically nested detector vessels each filled with different detector liquid. The integrity of this multi-layered structure and the quality of the used detector liquids are essential for the success of the experiment. Within this frame, the here presented work describes the production of two detector liquids, the filling and handling of the Double Chooz far detector and the installation of all necessary hardware components therefore. In order to meet the strict requirements existing for the detector liquids, all components were individually selected in an extensive material selection process at TUM, which compared samples from different companies for their key properties: density, transparency, light yield and radio purity. Based on these measurements, the composition of muon veto scintillator and buffer liquid were determined. For the production of the detector liquids, a simple surface building close to the far detector site was upgraded into a large-scale storage and mixing facility, which allowed to separately, mix, handle and store 90 m3 of muon veto scintillator and 110 m3 of buffer liquid. For the muon veto scintillator, a master-solution composed of 4800 l LAB, 180 kg PPO and 1.8 kg of bis/MSB was produced and, together

  6. Studies of Neutrino Oscillations at Reactors

    OpenAIRE

    Boehm, Felix

    2000-01-01

    Experiments with reactor neutrinos continue to shed light on our understanding of neutrino oscillations. We review some of the early decisive experiments. We then turn to the recent long baseline oscillation experiments at Palo Verde and Chooz which are leading to the conclusion that the atmospheric neutrino anomaly if attributed to oscillations does not involve an appreciable mixing with the $\\bar\

  7. Vitamin B1

    Science.gov (United States)

    ... Prize Alfred Nobel's Life and Work Teachers' Questionnaire Vitamin B1 - About The Chicken Farm educational game and ... the game window. Reading: "Christian Eijkman, Beriberi and Vitamin B1" - Who was Eijkman and why did he ...

  8. Muon background studies for shallow depth Double - Chooz near detector

    Science.gov (United States)

    Gómez, H.

    2015-08-01

    Muon events are one of the main concerns regarding background in neutrino experiments. The placement of experimental set-ups in deep underground facilities reduce considerably their impact on the research of the expected signals. But in the cases where the detector is installed on surface or at shallow depth, muon flux remains high, being necessary their precise identification for further rejection. Total flux, mean energy or angular distributions are some of the parameters that can help to characterize the muons. Empirically, the muon rate can be measured in an experiment by a number of methods. Nevertheless, the capability to determine the muons angular distribution strongly depends on the detector features, while the measurement of the muon energy is quite difficult. Also considering that on-site measurements can not be extrapolated to other sites due to the difference on the overburden and its profile, it is necessary to find an adequate solution to perform the muon characterization. The method described in this work to obtain the main features of the muons reaching the experimental set-up, is based on the muon transport simulation by the MUSIC software, combined with a dedicated sampling algorithm for shallow depth installations based on a modified Gaisser parametrization. This method provides all the required information about the muons for any shallow depth installation if the corresponding overburden profile is implemented. In this work, the method has been applied for the recently commissioned Double - Chooz near detector, which will allow the cross-check between the simulation and the experimental data, as it has been done for the far detector.

  9. Muon background studies for shallow depth Double - Chooz near detector

    Energy Technology Data Exchange (ETDEWEB)

    Gómez, H. [Laboratoire Astroparticule et Cosmologie (APC) - Université Paris 7. Paris (France)

    2015-08-17

    Muon events are one of the main concerns regarding background in neutrino experiments. The placement of experimental set-ups in deep underground facilities reduce considerably their impact on the research of the expected signals. But in the cases where the detector is installed on surface or at shallow depth, muon flux remains high, being necessary their precise identification for further rejection. Total flux, mean energy or angular distributions are some of the parameters that can help to characterize the muons. Empirically, the muon rate can be measured in an experiment by a number of methods. Nevertheless, the capability to determine the muons angular distribution strongly depends on the detector features, while the measurement of the muon energy is quite difficult. Also considering that on-site measurements can not be extrapolated to other sites due to the difference on the overburden and its profile, it is necessary to find an adequate solution to perform the muon characterization. The method described in this work to obtain the main features of the muons reaching the experimental set-up, is based on the muon transport simulation by the MUSIC software, combined with a dedicated sampling algorithm for shallow depth installations based on a modified Gaisser parametrization. This method provides all the required information about the muons for any shallow depth installation if the corresponding overburden profile is implemented. In this work, the method has been applied for the recently commissioned Double - Chooz near detector, which will allow the cross-check between the simulation and the experimental data, as it has been done for the far detector.

  10. Correlated background and impact on the measurement of θ13 with the Double Chooz detector

    International Nuclear Information System (INIS)

    The Double Chooz experiment uses antineutrinos emitted from the Chooz nuclear power plant (France) to measure the oscillation mixing parameter θ13. By using two detectors at different baselines, a precise measurement of antineutrinos disappearance is anticipated. The Far detector has been taking physics data since April 2011, while the Near detector is under construction. Data from April 13, 2011 to March 30, 2012 taken with the Far detector only have been analyzed and an indication for antineutrino disappearance, consistent with the current neutrino oscillation hypothesis, has been found. The best fit value for the neutrino mixing parameter sin2(2θ13) is 0.109 ± 0.030(stat.) ± 0.025(syst.). This thesis present an accurate description of the Double Chooz experiment, with particular emphasis on the Far detector and its acquisition system. The main focus of the thesis is the accurate study of the correlated background affecting the Double Chooz antineutrinos sample and its impact on the measurement of the mixing parameter θ13. A general overview of the current experimental scenario which aim to the characterization of the neutrino oscillation is also provided, focusing on the recent results obtained in this field. (author)

  11. Flash-ADCs test, optimization of the detector design and development of a new concept of spatial reconstruction in the double chooz neutrino oscillation experiment

    International Nuclear Information System (INIS)

    Double Chooz (DC) is a reactor neutrino oscillation experiment whose purpose is the measurement of the last unknown mixing angle θ13. It inherits from the past Chooz experiment which was limited by the statistical and systematic errors at the same extent of about 2.8%. To lower the statistical error, the DC detector target mass has been increased and a longer exposure is foreseen while the lowering of the systematic error is ensured by the use of two identical detectors. One will be located in the vicinity of the reactor cores to monitor the flux and spectrum of the ν-bare emitted whereas the other one will be located where the effect of the oscillation is expected to be maximal. They are respectively so-called 'near' and 'far' detectors. The expected errors are 0.5% (stat.) and 0.6% (syst.) for a measurement down to sin2(2*θ13) = 0.05 (θ13 6.5 degrees) at three standard deviations after three years of data taking. The far detector is expected for November 2010 while the near detector will be operational in mid-2012. This thesis presents first a hardware work consisting in testing the Flash-ADCs that are the core of the main acquisition system of the experiment. Subsequently, it presents analyses performed on Monte Carlo simulations towards the optimization of the detector design. This work was composed of analyses to choose some detector components with the appropriate natural radioactivity contamination, analyses for the best achievable energy resolution and the most stable and robust way of triggering. The work on the optimization of the detector together with the acquired knowledge on the Flash-ADCs led us to envisage the possibility of a new spatial reconstruction based on the time of flight. All these contributions to the experiment are described in details throughout this manuscript. (author)

  12. Liquid scintillators and liquefied rare gases for particle detectors. Background-determination in Double Chooz and scintillation properties of liquid argon

    Energy Technology Data Exchange (ETDEWEB)

    Hofmann, Martin Alexander

    2012-11-27

    Evidence for physics beyond the well-established standard model of particle physics is found in the sector of neutrino physics, in particular in neutrino oscillations, and in experimental hints requiring the presence of Dark Matter. Neutrino oscillations demand the neutrinos to be massive and at least four additional parameters, three mixing angles and one phase, are introduced. A non-vanishing value for the third mixing angle, {theta}{sub 13}, has only recently been found, amongst others by the reactor antineutrino disappearance experiment Double Chooz. This experiment detects anti {nu}{sub e}'s by means of the Inverse Beta Decay (IBD), which has a clear signature that can very effectively be discriminated from most of the background. However, some background still survives the selection cuts applied to the data, partly induced by radioactivity. In order to determine the amount of radioimpurities in the detector, germanium spectroscopy measurements and neutron activation analyses have been carried out for various parts of the Double Chooz far detector. A dedicated Monte-Carlo simulation was performed to obtain the singles event rate induced by the identified radioimpurities in the fiducial volume of Double Chooz. In the present thesis, parts from the outer detector systems, as well as components of the inner detector liquids were measured. In sum, a singles rate of less than 0.35 Hz above the antineutrino detection threshold of 0.7 MeV has been found. This is by far below the design goal of Double Chooz of {proportional_to} 20 Hz. The analysis of bismuth-polonium (BiPo) coincidences in the first Double Chooz data allows to directly determine the number of decays from the U- and the Th-decay chain in the active detector parts. Assuming radioactive equilibrium, concentrations of (1.71{+-}0.08).10{sup -14}(g)/(g) for uranium and (8.16{+-}0.49).10{sup -14}(g)/(g) for thorium have been found, which are also well below the design goal of Double Chooz (2.10{sup -13

  13. Liquid scintillators and liquefied rare gases for particle detectors. Background-determination in Double Chooz and scintillation properties of liquid argon

    International Nuclear Information System (INIS)

    Evidence for physics beyond the well-established standard model of particle physics is found in the sector of neutrino physics, in particular in neutrino oscillations, and in experimental hints requiring the presence of Dark Matter. Neutrino oscillations demand the neutrinos to be massive and at least four additional parameters, three mixing angles and one phase, are introduced. A non-vanishing value for the third mixing angle, θ13, has only recently been found, amongst others by the reactor antineutrino disappearance experiment Double Chooz. This experiment detects anti νe's by means of the Inverse Beta Decay (IBD), which has a clear signature that can very effectively be discriminated from most of the background. However, some background still survives the selection cuts applied to the data, partly induced by radioactivity. In order to determine the amount of radioimpurities in the detector, germanium spectroscopy measurements and neutron activation analyses have been carried out for various parts of the Double Chooz far detector. A dedicated Monte-Carlo simulation was performed to obtain the singles event rate induced by the identified radioimpurities in the fiducial volume of Double Chooz. In the present thesis, parts from the outer detector systems, as well as components of the inner detector liquids were measured. In sum, a singles rate of less than 0.35 Hz above the antineutrino detection threshold of 0.7 MeV has been found. This is by far below the design goal of Double Chooz of ∝ 20 Hz. The analysis of bismuth-polonium (BiPo) coincidences in the first Double Chooz data allows to directly determine the number of decays from the U- and the Th-decay chain in the active detector parts. Assuming radioactive equilibrium, concentrations of (1.71±0.08).10-14(g)/(g) for uranium and (8.16±0.49).10-14(g)/(g) for thorium have been found, which are also well below the design goal of Double Chooz (2.10-13(g)/(g)). Both gamma spectroscopy measurements and the Bi

  14. B1 Aerogels

    DEFF Research Database (Denmark)

    Duer, Karsten; Svendsen, Sv Aa Højgaard

    1996-01-01

    DGU that was developped during the project. B12 and B14 have measured the g-value and the U-value respectively of the aerogel DGU.Furthermore calculations of the energy saving potential by using aerogel windows in selected residential and commercial buildings under different climatic conditions were...... carried out as part of the A2/A3 project.The B1 Aerogel project has been carried out with partition of the following nations: Denmark, Finland, France, Germany, Japan, Norway, Sweden and the United Kingdom....

  15. Characterization, modelization and optimization of the Double Chooz acrylic vessels: physics impact

    International Nuclear Information System (INIS)

    Double Chooz is one of the new generation experiments designed to measure the last unknown leptonic mixing angle, θ13. Il studies the oscillations of electronic antineutrinos produced by the Chooz nuclear power plant. Our knowledge on θ13 can be improved by reducing both statistical errors (increasing both the detector size and run time) and systematic errors (using identical near and far detectors). Also, special care is dedicated to analyze backgrounds generated by natural radioactivity and cosmic ray interactions. The work presented here mostly focuses on Target and Gamma Catcher acrylic vessels, in the core of the detector. A new material designed for the experiment was developed since no pre-existing material met the required conditions. This material was characterized optically, to maximize light transmission and reduce the induced dead zone. With this in mind, a physics study of the Target vessel design was performed to identify any spectral distortion or count rate modification it could induce. As far as backgrounds are concerned, the material is radio-pure enough so that the singles rate coming from acrylic is negligible compared to the one from the photomultiplier tubes. An unknown single source is coming from the external contamination in the detector, such as dust. This is why we defined cleanliness goals for the detector fabrication and integration. These goals were met, thanks to well-defined protocols and careful team work. After three years of data taking, Double Chooz could disentangle an oscillation signal at 3α for sin22θ13 ≥ 0.05 - 0.06. If no oscillations were observed, the experiment could give an upper limit on sin22θ13 of 0.02 - 0.03 at 90 % C.L. (author)

  16. Study of the Light Emission Process from the Double Chooz Photomultipliers

    Energy Technology Data Exchange (ETDEWEB)

    Calvo, E.; Cerrada, M.; Crespo, J. I.; Gil-Botella, I.; Jimenez, S.; Lopez, M.; Novella, P.; Palomares, C.; Santorelli, R.; Verdugo, A.

    2012-09-13

    In this document we present a study of the light emitted by the base of a Hamamatsu R7081MOD-ASSY photomultiplier (PMT) of the same type used in the Double Chooz experiment. Several characteristic features of the light signal have been found in terms of amplitude, length and pulse shape. Additional investigations on the properties of the epoxy used to cover the photomultiplier base have been carried out. A possible explanation of the light emission process is discussed at the end of the study. (Author) 1 ref.

  17. Limits on nu_e and anti-nu_e disappearance from Gallium and reactor experiments

    CERN Document Server

    Acero, Mario A; Laveder, Marco

    2007-01-01

    The disappearance of electron neutrinos observed in the Gallium radioactive source experiments is analyzed in the framework of two-neutrino mixing. It is shown that there is an indication of neutrino disappearance due to neutrino oscillations with sin^2 2 theta >~ 0.04 and Delta m^2 >~ 0.1 eV^2. The compatibility of this result with the data of the Bugey and Chooz reactor short-baseline antineutrino disappearance experiments is studied. It is found that the Bugey data present a weak indication in favor of neutrino oscillations with 0.02 <~ sin^2 2 theta <~ 0.08 and Delta m^2 =~ 1.85 eV^2, which is compatible with the Gallium allowed region of the mixing parameters. This indication persists in the combined analyses of Bugey and Chooz data, of Gallium and Bugey data, and of Gallium, Bugey, and Chooz data.

  18. aflatoxina b1

    Directory of Open Access Journals (Sweden)

    A. Valdivia

    2004-01-01

    Full Text Available Con el objetivo de probar que la suplementación dietética de ácido elágico (AE o N-Acetilcisteína (NAC en pollos de engorda, atenúa los efectos de una intoxicación aguda por la aflatoxina B1 (AFB1, se intoxicaron con AFB1 pura, tres grupos de diez pollos cada uno (3.0 mb/kg pc, IP. Otros tres grupos recibieron solamente el vehículo (aceite de maíz 2.0 ml/kg pc, IP. Cuatro días antes se administró un alimento testigo, o bien, la misma dieta adicionada con AE (2.5 g/kg o NAC (200 mg/kg pc/6 h. A las 24 horas de la administración de AFB1, se cuantificaron las concentraciones hepáticas de glutatión (GSH, de actividad enzimática específica de la transferasa de glutatión (GST, alanina aminotransferasa, aspartato aminotransferasa y de proteínas hepáticas totales. Los resultados mostraron que NAC atenúa el impacto negativo de la AFB1 sobre el crecimiento corporal y al igual que AE, incrementa la GST y revierte parcialmente los efectos de AFB1 sobre GSH, lo cual sugiere que ambas sustancias pudieran conferir un efecto protector de las aves

  19. SAFIRA. Sub-project B 1.3: Development of coupled in-situ reactors and optimisation of the geochemical processes in the discharge of different in situ reactor sytems. Final report; SAFIRA. Teilprojekt B 1.3: Entwicklung von gekoppelten in situ-Reaktoren und Optimierung der geochemischen Prozesse im Abstrom von verschiedenen in situ-Reaktor-Systemen. Abschlussbericht

    Energy Technology Data Exchange (ETDEWEB)

    Dahmke, A.; Schaefer, D.; Koeber, R.; Plagentz, V.

    2002-12-01

    The Bitterfeld ground water is contaminated with many different pollutants over a large area. Long-term measures like reactive barriers for purification are required. However, groundwater contaminated with multiple contaminants cannot be purified by a single reactive material; for this reason, the effectivity of combinations of different reactive materials was investigated. Of the combinations investigated, reducing iron and activated carbon connected in series was the most effective: The iron will remove the reducible chlorinated hydrocarbons, while the rest of the contaminants are adsorbed to the activated carbon. Iron and ORC was another interesting option, but the combination of iron and activated carbon was found to be the most favourable option. Until a better method is available, it is recommended to connect iron and activated carbon in parallel for removing contaminant mixtures. Directly behind reactive iron barriers (also when combined with activated carbon), the limiting values of the Freshwater Ordinance for Fe(II) and pH are exceeded. Directly behind ORC reactors, the limiting values for Mg and pH are exceeded. Investigations in the outflow of these reactive materials showed that the high pH values are buffered by contact with the aquifer material to values typical of aquifers, which usually are below the limiting values of the Freshwater Ordinance. However, as the buffer capacity of the soil is exhausted, a zone with a higher pH starts to grow in the aquifer. The growth of this zone depends on the pH and on the aquifer material. Especially in soils as found at Bitterfeld, with a high concentration of organic matter, we find long-term desorption of pollutants from the aquifer materials which will burden the purified water leaving the water treatment system and prohibit its utilization. [German] Der Grundwasserleiter im Raum Bitterfeld ist grossraeumig mit vielen verschiedenen Substanzen kontaminiert. Aufgrund der grossraeumigen Erstreckung kommen nur

  20. The Waveform Digitiser of the Double Chooz Experiment: Performance and Quantisation Effects on PhotoMultiplier Tube Signals

    CERN Document Server

    Abe, Y; Cabrera, A; Courty, B; Dawson, J V; Gonzalez, L F G; Hourlier, A; Ishitsuka, M; de Kerret, H; Kryn, D; Novella, P; Obolensky, M; Perasso, S; Remoto, A; Roncin, R

    2013-01-01

    We present the waveform digitiser used in the Double Chooz experiment. We describe the hardware and the custom-built firmware specifically developed for the experiment. The performance of the device is tested with regards to digitising low light level signals from photomultiplier tubes and measuring pulse charge. This highlights the role of quantisation effects and leads to some general recommendations on the design and use of waveform digitisers.

  1. Results on θ13 Neutrino Oscillations from Reactor Experiments

    Directory of Open Access Journals (Sweden)

    Kim Soo-Bong

    2014-03-01

    Full Text Available Definitive measurements of the smallest neutrino mixing angle θ13 were made by Daya Bay, Double Chooz and RENO in 2012, based on the disappearance of electron antineutrinos emitted from reactors. The new generation reactor experiments have significantly improved a sensitivity for θ13 down to the sin2(2θ13~0.01 level using two identical detectors of 10 ~ 40 tons at near (300 ~ 400 m and far (1 ~ 2 km locations. The θ13 measurements by the three reactor experiments are presented with their future expected sensitivities.

  2. Characterization of the Spontaneous Light Emission of the PMTs used in the Double Chooz Experiment

    CERN Document Server

    Abe, Y; Almazan, H; Alt, C; Appel, S; Baussan, E; Bekman, I; Bergevin, M; Bezerra, T J C; Bezrukov, L; Blucher, E; Brugière, T; Buck, C; Busenitz, J; Cabrera, A; Calvo, E; Camilleri, L; Carr, R; Cerrada, M; Chauveau, E; Chimenti, P; Collin, A P; Conover, E; Conrad, J M; Crespo-Anadón, J I; Crum, K; Cucoanes, A S; Damon, E; Dawson, J V; de Kerret, H; Dhooghe, J; Dietrich, D; Djurcic, Z; Anjos, J C dos; Dracos, M; Etenko, A; Fallot, M; Felde, J; Fernandes, S M; Fischer, V; Franco, D; Franke, M; Furuta, H; Gil-Botella, I; Giot, L; Göger-Neff, M; Gomez, H; Gonzalez, L F G; Goodenough, L; Goodman, M C; Haag, N; Hara, T; Haser, J; Hellwig, D; Hofmann, M; Horton-Smith, G A; Hourlier, A; Ishitsuka, M; Jiménez, S; Jochum, J; Jollet, C; Kaether, F; Kalousis, L N; Kamyshkov, Y; Kaneda, M; Kaplan, D M; Kawasaki, T; Kemp, E; Kryn, D; Kuze, M; Lachenmaier, T; Lane, C E; Lasserre, T; Letourneau, A; Lhuillier, D; Lima, H P; Lindner, M; López-Castaño, J M; LoSecco, J M; Lubsandorzhiev, B; Lucht, S; Maeda, J; Mariani, C; Maricic, J; Martino, J; Matsubara, T; Mention, G; Meregaglia, A; Miletic, T; Milincic, R; Minotti, A; Nagasaka, Y; Navas-Nicolás, D; Novella, P; Nunokawa, H; Oberauer, L; Obolensky, M; Onillon, A; Osborn, A; Palomares, C; Pepe, I M; Perasso, S; Porta, A; Pronost, G; Reichenbacher, J; Reinhold, B; Röhling, M; Roncin, R; Rybolt, B; Sakamoto, Y; Santorelli, R; Schilithz, A C; Schönert, S; Schoppmann, S; Shaevitz, M H; Sharankova, R; Shrestha, D; Sibille, V; Sinev, V; Skorokhvatov, M; Smith, E; Soiron, M; Spitz, J; Stahl, A; Stancu, I; Stokes, L F F; Strait, M; Suekane, F; Sukhotin, S; Sumiyoshi, T; Sun, Y; Svoboda, R; Terao, K; Tonazzo, A; Thi, H H Trinh; Valdiviesso, G; Vassilopoulos, N; Veyssiere, C; Vivier, M; von Feilitzsch, F; Wagner, S; Walsh, N; Watanabe, H; Wiebusch, C; Wurm, M; Yang, G; Yermia, F; Zimmer, V

    2016-01-01

    During the commissioning of the first of the two detectors of the Double Chooz experiment, an unexpected and dominant background caused by the emission of light inside the optical volume has been observed. A specific study of the ensemble of phenomena called "Light Noise" has been carried out in-situ, and in an external laboratory, in order to characterize the signals and to identify the possible processes underlying the effect. Some mechanisms of instrumental noise originating from the PMTs were identified and it has been found that the leading one arises from the light emission localized on the photomultiplier base and produced by the combined effect of heat and high voltage across the transparent epoxy resin covering the electric components. The correlation of the rate and the amplitude of the signal with the temperature has been observed. For the first detector in operation the induced background has been mitigated using online and offline analysis selections based on timing and light pattern of the signa...

  3. Muon capture on light isotopes measured with the Double Chooz detector

    Science.gov (United States)

    Abe, Y.; Abrahão, T.; Almazan, H.; Alt, C.; Appel, S.; Barriere, J. C.; Baussan, E.; Bekman, I.; Bergevin, M.; Bezerra, T. J. C.; Bezrukov, L.; Blucher, E.; Brugière, T.; Buck, C.; Busenitz, J.; Cabrera, A.; Camilleri, L.; Carr, R.; Cerrada, M.; Chauveau, E.; Chimenti, P.; Collin, A. P.; Conover, E.; Conrad, J. M.; Crespo-Anadón, J. I.; Crum, K.; Cucoanes, A. S.; Damon, E.; Dawson, J. V.; de Kerret, H.; Dhooghe, J.; Dietrich, D.; Djurcic, Z.; dos Anjos, J. C.; Dracos, M.; Etenko, A.; Fallot, M.; Felde, J.; Fernandes, S. M.; Fischer, V.; Franco, D.; Franke, M.; Furuta, H.; Gil-Botella, I.; Giot, L.; Göger-Neff, M.; Gomez, H.; Gonzalez, L. F. G.; Goodenough, L.; Goodman, M. C.; Haag, N.; Hara, T.; Haser, J.; Hellwig, D.; Hofmann, M.; Horton-Smith, G. A.; Hourlier, A.; Ishitsuka, M.; Jochum, J.; Jollet, C.; Kaether, F.; Kalousis, L. N.; Kamyshkov, Y.; Kaneda, M.; Kaplan, D. M.; Kawasaki, T.; Kemp, E.; Kryn, D.; Kuze, M.; Lachenmaier, T.; Lane, C. E.; Lasserre, T.; Letourneau, A.; Lhuillier, D.; Lima, H. P.; Lindner, M.; López-Castaño, J. M.; LoSecco, J. M.; Lubsandorzhiev, B.; Lucht, S.; Maeda, J.; Mariani, C.; Maricic, J.; Martino, J.; Matsubara, T.; Mention, G.; Meregaglia, A.; Miletic, T.; Milincic, R.; Minotti, A.; Nagasaka, Y.; Navas-Nicolás, D.; Novella, P.; Oberauer, L.; Obolensky, M.; Onillon, A.; Osborn, A.; Palomares, C.; Pepe, I. M.; Perasso, S.; Porta, A.; Pronost, G.; Reichenbacher, J.; Reinhold, B.; Röhling, M.; Roncin, R.; Rybolt, B.; Sakamoto, Y.; Santorelli, R.; Schilithz, A. C.; Schönert, S.; Schoppmann, S.; Shaevitz, M. H.; Sharankova, R.; Shrestha, D.; Sibille, V.; Sinev, V.; Skorokhvatov, M.; Smith, E.; Soiron, M.; Spitz, J.; Stahl, A.; Stancu, I.; Stokes, L. F. F.; Strait, M.; Suekane, F.; Sukhotin, S.; Sumiyoshi, T.; Sun, Y.; Svoboda, R.; Terao, K.; Tonazzo, A.; Trinh Thi, H. H.; Valdiviesso, G.; Vassilopoulos, N.; Veyssiere, C.; Vivier, M.; von Feilitzsch, F.; Wagner, S.; Walsh, N.; Watanabe, H.; Wiebusch, C.; Wurm, M.; Yang, G.; Yermia, F.; Zimmer, V.; Double Chooz Collaboration

    2016-05-01

    Using the Double Chooz detector, designed to measure the neutrino mixing angle θ13, the products of μ- capture on 12C,13C,14N, and 16O have been measured. Over a period of 489.5 days, 2.3 ×106 stopping cosmic μ- have been collected, of which 1.8 ×105 captured on carbon, nitrogen, or oxygen nuclei in the inner detector scintillator or acrylic vessels. The resulting isotopes were tagged using prompt neutron emission (when applicable), the subsequent β decays, and, in some cases, β -delayed neutrons. The most precise measurement of the rate of 12C(μ-,ν ) 12B to date is reported: 6 .57-0.21+0.11×103s-1 , or (17 .35-0.59+0.35)% of nuclear captures. By tagging excited states emitting γ s , the ground state transition rate to 12B has been determined to be 5 .68-0.23+0.14 ×103s-1 . The heretofore unobserved reactions 12C(μ-,ν α ) 8Li,13C(μ-,ν n α ) 8Li , and 13C(μ-,ν n ) 12B are measured. Further, a population of β n decays following stopping muons is identified with 5.5 σ significance. Statistics limit our ability to identify these decays definitively. Assuming negligible production of 8He, the reaction 13C(μ-,ν α ) 9Li is found to be present at the 2.7 σ level. Limits are set on a variety of other processes.

  4. Results on θ13 neutrino oscillations from reactor experiments

    International Nuclear Information System (INIS)

    Definitive measurements of the smallest neutrino mixing angle θ13 were made by Daya Bay, Double Chooz and RENO in 2012, based on the disappearance of electron antineutrinos emitted from reactors. Averaging the results of the 3 reactor experiments with the standard Particle Data Group method, one obtains sin2(2*θ13) = 0.098 ± 0.013. The new generation reactor experiments have significantly improved sensitivity for θ13 using 2 identical detectors of 10 - 40 tons at near (300 - 400 m) and far (1 - 2 km) locations. The surprisingly large value of θ13 will strongly promote the next round of neutrino experiments to find CP violation effects and determine the neutrino mass hierarchy. More precise measurements of θ13 by the 3 reactor experiments will provide the first glimpse of the CP phase angle if accelerator beam results are combined. Based on a total of 5 years of data, the reactor experiment is expected to obtain a measured sin2(θ13) value with a precision of 7% at RENO, 4% at Daya Bay, and 10% at Double Chooz. It will also make a direct measurement of Δm312 from the energy dependent oscillation effects, and measure a precise neutrino spectrum

  5. The antineutrino energy structure in reactor experiments

    CERN Document Server

    Novella, P

    2015-01-01

    The recent observation of an energy structure in the reactor antineutrino spectrum is reviewed. The reactor experiments Daya Bay, Double Chooz and RENO have reported a consistent excess of antineutrinos deviating from the flux predictions, with a local significance of about 4$\\sigma$ between 4 and 6 MeV of the positron energy spectrum. The possible causes of the structure are analyzed in this work, along with the different experimental approaches developed to identify its origin. Considering the available data and results from the three experiments, the most likely explanation concerns the reactor flux predictions and the associated uncertainties. Therefore, the different current models are described and compared. The possible sources of incompleteness or inaccuracy of such models are discussed, as well as the experimental data required to improve their precision.

  6. On Products of Property b1

    Institute of Scientific and Technical Information of China (English)

    Jianjun WANG; Peiyong ZHU

    2012-01-01

    In this note,we present that:(1) Let X=σ{Xα:α ∈ A} be |A|-paracompact (resp.,hereditarily |A|-paracompact).If every finite subproduct of {Xα:α ∈ A} has property b1 (resp.,hereditarily property b1),then so is X.(2) Let X be a P-space and Y a metric space.Then,X × Y has property b1 iff X has property b1.(3) Let X be a strongly zero-dimensional and compact space.Then,X × Y has property b1 iff Y has property b1.

  7. A unified analysis of the reactor neutrino program towards the measurement of the {theta}{sub 13} mixing angle

    Energy Technology Data Exchange (ETDEWEB)

    Mention, G.; Motta, D. [DAPNIA/SPP, CEA Saclay, 91191 Gif sur Yvette (France); Lasserre, Th. [DAPNIA/SPP, CEA Saclay, 91191 Gif sur Yvette (France); Laboratoire Astroparticule et Cosmologie (APC), Paris (France)

    2007-04-15

    We present in this article a detailed quantitative discussion of the measurement of the leptonic mixing angle {theta}{sub 13} through currently scheduled reactor neutrino oscillation experiments. We thus focus on Double Chooz (Phase I and II), Daya Bay (Phase I and II) and RENO experiments. We perform a unified analysis, including systematics, backgrounds and accurate experimental setup in each case. Each identified systematic error and background impact has been assessed on experimental setups following published data when available and extrapolating from Double Chooz acquired knowledge otherwise. After reviewing the experiments, we present a new analysis of their sensitivities to sin{sup 2}(2{theta}{sub 13}) and study the impact of the different systematics based on the pulls approach. Through this generic statistical analysis we discuss the advantages and drawbacks of each experimental setup. (authors)

  8. Cyclin B1 Vaccine Delays Spontaneous Tumors

    Science.gov (United States)

    Laura A, Vella; Min, Yu; Amy, Phillips; Olivera J, Finn

    2012-01-01

    We previously identified cyclin B1-specific T cells and antibodies in cancer patients with cyclin B1+ tumors and also in some healthy individuals. We also demonstrated that these responses may be important in cancer immunosurveillance by showing that vaccination against cyclin B1 prevents growth of transplantable cyclin B1+ tumors in mice. Constitutive overexpression of cyclin B1 was determined to correlate with the lack of p53 function. This allowed us to use p53−/− mice as a model that better approximates human disease. p53−/− mice spontaneously develop cyclin B1+ tumors. At 5–6 weeks of age, when the mice were still healthy with no evidence of tumor, they received the cyclin B1 vaccine and were then observed for tumor growth. We demonstrate that cyclin B1 vaccination can delay spontaneous cyclin B1+ tumor growth and increases median survival of tumor bearing p53−/− mice. PMID:19769738

  9. Reactor anti-neutrinos: measurement of the θ13 leptonic mixing angle and search for potential sterile neutrinos

    International Nuclear Information System (INIS)

    The Double Chooz experiment aims to measure the θ13 mixing angle through the disappearance -induced by the oscillation phenomenon - of anti-neutrinos produced by the Chooz nuclear reactors. In order to reduce systematic uncertainties, the experiment relies on the relative comparison of detected signals in two identical liquid scintillator detectors. The near one, giving the normalization of the emitted flux, is currently being built and will be delivered in spring 2014. The far detector, sensitive to θ13, is located at about one kilometer and is taking data since 2011. In this first phase of the experiment, the far detector data are compared to a prediction of the emitted neutrino flux to estimate θ13. In this thesis, the Double Chooz experiment and its analysis are presented, especially the background studies and the rejection of parasitic signals due to light emitted by photo-multipliers. Neutron fluxes between the different detector volumes impact the definition of the fiducial volume of neutrino interactions and the efficiency of detection. Detailed studies of these effects are presented. As part of the Double Chooz experiment, studies were performed to improve the prediction of neutrino flux emitted by reactors. This work revealed a deficit of observed neutrino rates in the short baseline experiments of last decades. This deficit could be explained by an oscillation to a sterile state. The Stereo project aims to observe a typical signature of oscillations: the distortion of neutrino spectra both in energy and baseline. This thesis presents the detector concept and simulations as well as sensitivity studies. Background sources and the foreseen shielding are also discussed. (author)

  10. Chooz plant - Report on the complementary safety assessment of nuclear facilities in the light of the Fukushima accident

    International Nuclear Information System (INIS)

    This CSA (Complementary Safety Assessment) analyses the robustness of the Chooz plant to extreme situations such as those that led to the Fukushima accident and proposes a series of improvements. Robustness is the ability for the plant to withstand events beyond the level for which the plant was designed. Robustness is linked to safety margins but also to the situations leading to a sudden deterioration of the accident sequence. Safety is not only a matter of design or of engineered systems, it is also a matter of organization. So issues like EDF's crisis organization, the organization of radiation protection, and work organization via subcontracting are also taken into consideration. The creation of a nuclear rapid action force (FARN) is proposed: this will be a national emergency force made up of specialized teams equipped to intervene in less than 24 hours on a nuclear site hit by an accident. This report is divided into 8 main chapters: 1) features of the site, 2) earthquake risk, 3) flooding risk, 4) risks due to other extreme natural disasters, 5) the loss of electrical power supplies and of heat sink, 6) management of severe accidents (accidents with core melt), 7) task subcontracting policy, 8) synthesis and list of improvements. 4 following appendices review: EDF's crisis organization, the FARN, radiation protection organization and accidental event trees. (A.C.)

  11. Reactor Neutrino Flux Uncertainty Suppression on Multiple Detector Experiments

    CERN Document Server

    Cucoanes, Andi; Cabrera, Anatael; Fallot, Muriel; Onillon, Anthony; Obolensky, Michel; Yermia, Frederic

    2015-01-01

    This publication provides a coherent treatment for the reactor neutrino flux uncertainties suppression, specially focussed on the latest $\\theta_{13}$ measurement. The treatment starts with single detector in single reactor site, most relevant for all reactor experiments beyond $\\theta_{13}$. We demonstrate there is no trivial error cancellation, thus the flux systematic error can remain dominant even after the adoption of multi-detector configurations. However, three mechanisms for flux error suppression have been identified and calculated in the context of Double Chooz, Daya Bay and RENO sites. Our analysis computes the error {\\it suppression fraction} using simplified scenarios to maximise relative comparison among experiments. We have validated the only mechanism exploited so far by experiments to improve the precision of the published $\\theta_{13}$. The other two newly identified mechanisms could lead to total error flux cancellation under specific conditions and are expected to have major implications o...

  12. Determination of the thermal loadings affecting the auxiliary lines of the reactor coolant system in French PWR plants

    International Nuclear Information System (INIS)

    The various incidents, imputed to thermal fatigue, which occurred throughout the world on the auxiliary lines of Reactor Coolant System (SIS, RHR, CVC), led EDF to urge a research program in order to determine the origins and the consequences of these problems for the French nuclear power plants. In 1992, following the crossing crack discovered at Dampierre 2 on the un-isolable part of a Safety Injection System pipe, a program of instrumentation was defined and is described in this paper. Among the objectives, two of the principal goals were to determine the thermal loadings really supported by the various lines and to highlight the thermal hydraulic phenomena affecting them. Indeed, in order to explain the discovered damages, it was essential to know the real thermal loadings to compare them with those of design and to carry out mechanical calculations of resistance to thermal fatigue. The instrumentations installed on the 900 MW units enabled to check the resistance with the fatigue of all the auxiliary lines in spite of significant differences between the real loadings and those envisaged at the design. They contributed to the knowledge improvement on the local thermal hydraulic phenomena but the incidents at Dampierre 1 showed that this knowledge is still imperfect. The results of these instrumentations are also used for the design of the future units by the use of the feedback of several cycles of acquisition on the 900 MW units, but also 1300 MW and 1450 MW since similar instrumentations were installed on the auxiliary lines in Golfech 2 and Chooz B1

  13. Fungal degradation of aflatoxin B1.

    Science.gov (United States)

    Shantha, T

    1999-01-01

    A number of fungal cultures were screened to select an organism suitable to be used in the detoxification of aflatoxin B1. They were co-cultured in Czapek-Dox-Casamino acid medium with aflatoxin B1 producing Aspergillus flavus. Several fungal cultures were found to prevent synthesis of aflatoxin B1 in liquid culture medium. Among these Phoma sp., Mucor sp., Trichoderma harzianum, Trichoderma sp. 639, Rhizopus sp. 663, Rhizopus sp. 710, Rhizopus sp. 668, Alternaria sp. and some strains belonging to the Sporotrichum group (ADA IV B14(a), ADA SF VI BF (9), strain 720) could inhibit aflatoxin synthesis by > or =90%. A few fungi, namely ADA IV B1, ADA F1, ADA F8, also belonging to the Sporotrichum group, were less efficient than the Phoma sp. The Cladosporium sp. and A. terreus sp. were by far the least efficient, registering aflatoxin biosynthesis are also capable of degrading the preformed toxin. Among these, Phoma sp. was the most efficient destroying about 99% of aflatoxin B1. The cell free extract of Phoma sp. destroyed nearly 50 microg aflatoxin B1 100 ml(-1) culture medium (90% of the added toxin), and this was more effective than its own culture filtrate over 5 days incubation at 28+/-2 degrees C. The degradation was gradual: 35% at 24 h, 58% at 48 h, 65% at 72 h, 85% at 96 h and 90% at 120 h. The possibility of a heat stable enzymatic activity in the cell free extract of Phoma is proposed. PMID:10945479

  14. Observation of B-meson decays to b_1 pi and b_1 K

    CERN Document Server

    Aubert, B; Boutigny, D; Karyotakis, Yu; Lees, J P; Poireau, V; Prudent, X; Tisserand, V; Zghiche, A; Garra Tico, J; Graugès-Pous, E; López, L; Palano, A; Pappagallo, M; Eigen, G; Stugu, B; Sun, L; Abrams, G S; Battaglia, M; Brown, D N; Button-Shafer, J; Cahn, R N; Groysman, Y; Jacobsen, R G; Kadyk, J A; Kerth, L T; Kolomensky, Yu G; Kukartsev, G; Lopes-Pegna, D; Lynch, G; Mir, L M; Orimoto, T J; Osipenkov, I L; Ronan, M T; Tackmann, K; Tanabé, T; Wenzel, W A; Del Amo-Sánchez, P; Hawkes, C M; Watson, A T; Held, T; Koch, H; Pelizaeus, M; Schröder, T; Steinke, M; Walker, D; Asgeirsson, D J; Çuhadar-Dönszelmann, T; Fulsom, B G; Hearty, C; Mattison, T S; McKenna, J A; Khan, A; Saleem, M; Teodorescu, L; Blinov, V E; Bukin, A D; Druzhinin, V P; Golubev, V B; Onuchin, A P; Serednyakov, S I; Skovpen, Yu I; Solodov, E P; Todyshev, K Yu; Bondioli, M; Curry, S; Eschrich, I; Kirkby, D; Lankford, A J; Lund, P; Mandelkern, M; Martin, E C; Stoker, D P; Abachi, S; Buchanan, C; Foulkes, S D; Gary, J W; Liu, F; Long, O; Shen, B C; Zhang, L; Paar, H P; Rahatlou, S; Sharma, V; Berryhill, J W; Campagnari, C; Cunha, A; Dahmes, B; Hong, T M; Kovalskyi, D; Richman, J D; Beck, T W; Eisner, A M; Flacco, C J; Heusch, C A; Kroseberg, J; Lockman, W S; Schalk, T; Schumm, B A; Seiden, A; Wilson, M G; Winstrom, L O; Chen, E; Cheng, C H; Fang, F; Hitlin, D G; Narsky, I; Piatenko, T; Porter, F C; Andreassen, R; Mancinelli, G; Meadows, B T; Mishra, K; Sokoloff, M D; Blanc, F; Bloom, P C; Chen, S; Ford, W T; Hirschauer, J F; Kreisel, A; Nagel, M; Nauenberg, U; Olivas, A; Smith, J G; Ulmer, K A; Wagner, S R; Zhang, J; Gabareen, A M; Soffer, A; Toki, W H; Wilson, R J; Winklmeier, F; Altenburg, D D; Feltresi, E; Hauke, A; Jasper, H; Merkel, J; Petzold, A; Spaan, B; Wacker, K; Klose, V; Kobel, M J; Lacker, H M; Mader, W F; Nogowski, R; Schubert, J; Schubert, K R; Schwierz, R; Sundermann, J E; Volk, A; Bernard, D; Bonneaud, G R; Latour, E; Lombardo, V; Thiebaux, C; Verderi, M; Clark, P J; Gradl, W; Muheim, F; Playfer, S; Robertson, A I; Watson, J E; Xie, Y; Andreotti, M; Bettoni, D; Bozzi, C; Calabrese, R; Cecchi, A; Cibinetto, G; Franchini, P; Luppi, E; Negrini, M; Petrella, A; Piemontese, L; Prencipe, E; Santoro, V; Anulli, F; Baldini-Ferroli, R; Calcaterra, A; De Sangro, R; Finocchiaro, G; Pacetti, S; Patteri, P; Peruzzi, I M; Piccolo, M; Rama, M; Zallo, A; Buzzo, A; Contri, R; Lo Vetere, M; Macri, M M; Monge, M R; Passaggio, S; Patrignani, C; Robutti, E; Santroni, A; Tosi, S; Chaisanguanthum, K S; Morii, M; Wu, J; Dubitzky, R S; Marks, J; Schenk, S; Uwer, U; Bard, D J; Dauncey, P D; Flack, R L; Nash, J A; Panduro-Vazquez, W; Tibbetts, M; Behera, P K; Chai, X; Charles, M J; Mallik, U; Ziegler, V; Cochran, J; Crawley, H B; Dong, L; Eyges, V; Meyer, W T; Prell, S; Rosenberg, E I; Rubin, A E; Gao, Y Y; Gritsan, A V; Guo, Z J; Lae, C K; Denig, A G; Fritsch, M; Schott, G; Arnaud, N; Bequilleux, J; D'Orazio, A; Davier, M; Grosdidier, G; Höcker, A; Lepeltier, V; Le Diberder, F; Lutz, A M; Pruvot, S; Rodier, S; Roudeau, P; Schune, M H; Serrano, J; Sordini, V; Stocchi, A; Wang, W F; Wormser, G; Lange, D J; Wright, D M; Bingham, I; Burke, J P; Chavez, C A; Forster, I J; Fry, J R; Gabathuler, E; Gamet, R; Hutchcroft, D E; Payne, D J; Schofield, K C; Touramanis, C; Bevan, A J; George, K A; Di Lodovico, F; Menges, W; Sacco, R; Cowan, G; Flächer, H U; Hopkins, D A; Paramesvaran, S; Salvatore, F; Wren, A C; Brown, D N; Davis, C L; Allison, J; Barlow, N R; Barlow, R J; Chia, Y M; Edgar, C L; Lafferty, G D; West, T J; Yi, J I; Anderson, J; Chen, C; Jawahery, A; Roberts, D A; Simi, G; Tuggle, J M; Blaylock, G; Dallapiccola, C; Hertzbach, S S; Li, X; Moore, T B; Salvati, E; Saremi, S; Cowan, R; Dujmic, D; Fisher, P H; Koeneke, K; Sciolla, G; Sekula, S J; Spitznagel, M; Taylor, F; Yamamoto, R K; Zhao, M; Zheng, Y; Mclachlin, S E; Patel, P M; Robertson, S H; Lazzaro, A; Palombo, F; Bauer, J M; Cremaldi, L; Eschenburg, V; Godang, R; Kroeger, R; Sanders, D A; Summers, D J; Zhao, H W; Brunet, S; Côté, D; Simard, M; Taras, P; Viaud, F B; Nicholson, H; De Nardo, Gallieno; Fabozzi, F; Lista, L; Monorchio, D; Sciacca, C; Baak, M A; Raven, G; Snoek, H L; Jessop, C P; Knoepfel, K J; LoSecco, J M; Benelli, G; Corwin, L A; Honscheid, K; Kagan, H; Kass, R; Morris, J P; Rahimi, A M; Regensburger, J J; Wong, Q K; Blount, N L; Brau, J E; Frey, R; Igonkina, O; Kolb, J A; Lu, M; Rahmat, R; Sinev, N B; Strom, D; Strube, J; Torrence, E; Gagliardi, N; Gaz, A; Margoni, M; Morandin, M; Pompili, A; Posocco, M; Rotondo, M; Simonetto, F; Stroili, R; Voci, C; Ben-Haim, E; Briand, H; Calderini, G; Chauveau, J; David, P; Del Buono, L; De La Vaissière, C; Hamon, O; Leruste, P; Malcles, J; Ocariz, J; Pérez, A; Prendki, J; Gladney, L; Biasini, M; Covarelli, R; Manoni, E; Angelini, C; Batignani, G; Bettarini, S; Carpinelli, M; Cenci, R; Cervelli, A; Forti, F

    2007-01-01

    We present the results of searches for decays of B mesons to final states with a b_1 meson and a charged pion or kaon. The data, collected with the BaBar detector at the Stanford Linear Accelerator Center, represent 382 million B-Bbar pairs produced in e+e- annihilation. The results for the branching fractions are, in units of 10^{-6}, B(B+ -> b1^0 pi+) = 6.7 +/- 1.7 +/- 1.0 (4.0 sigma), B(B+ -> b1^0 K+ = 9.1+/- 1.7+/- 1.0 (5.3 sigma), B(B0 -> b1^-/+ pi^+/-) = 10.9 +/- 1.2 +/- 0.9 (8.9 sigma), and B(B0 -> b1^-K+) = 7.4 +/- 1.0 +/- 1.0 (6.1 sigma), with the assumption that B(b_1 -> omega pi)=1. We also measure charge and flavor asymmetries Ach(B+ -> b1^0 pi+) = 0.05 +/- 0.16 +/- 0.02, Ach(B+ -> b1^0 K+ = -0.46 +/- 0.20 +/- 0.02, Ach(B0 -> b1^-/+ pi^+/-) = -0.05 +/- 0.10 +/- 0.02, C(B0 -> b1^-/+ pi^+/-) = -0.22 +/- 0.23 +/- 0.05, deltaC(B0 -> b1^-/+ pi^+/-) = -1.04 +/- 0.23 +/- 0.08, and Ach(B0 -> b1^-K+) = -0.07 +/- 0.12 +/- 0.02, The first error quoted is statistical, the second systematic, and for the branch...

  15. First Test of Lorentz Violation with a Reactor-based Antineutrino Experiment

    CERN Document Server

    Abe, Y; Anjos, J C dos; Bergevin, M; Bernstein, A; Bezerra, T J C; Bezrukhov, L; Blucher, E; Bowden, N S; Buck, C; Busenitz, J; Cabrera, A; Caden, E; Camilleri, L; Carr, R; Cerrada, M; Chang, P -J; Chimenti, P; Classen, T; Collin, A P; Conover, E; Conrad, J M; Crespo-Anadón, J I; Crum, K; Cucoanes, A; D'Agostino, M V; Damon, E; Dawson, J V; Dazeley, S; Dietrich, D; Djurcic, Z; Dracos, M; Durand, V; Ebert, J; Efremenko, Y; Elnimr, M; Erickson, A; Fallot, M; Fechner, M; von Feilitzsch, F; Felde, J; Fischer, V; Franco, D; Franke, A J; Franke, M; Furuta, H; Gama, R; Gil-Botella, I; Giot, L; Göger-Neff, M; Gonzalez, L F G; Goodman, M C; Goon, J TM; Greiner, D; Haag, N; Habib, S; Hagner, C; Hara, T; Hartmann, F X; Haser, J; Hatzikoutelis, A; Hayakawa, T; Hofmann, M; Horton-Smith, G A; Ishitsuka, M; Jochum, J; Jollet, C; Jones, C L; Kaether, F; Kalousis, L N; Kamyshkov, Y; Kaplan, D M; Katori, T; Kawasaki, T; Keefer, G; Kemp, E; de Kerret, H; Konno, T; Kryn, D; Kuze, M; Lachenmaier, T; Lane, C E; Lasserre, T; Letourneau, A; Lhuillier, D; Lima, H P; Lindner, M; López-Castanõ, J M; LoSecco, J M; Lubsandorzhiev, B K; Lucht, S; McKee, D; Maeda, J; Maesano, C N; Mariani, C; Maricic, J; Martino, J; Matsubara, T; Mention, G; Meregaglia, A; Meyer, M; Miletic, T; Milincic, R; Miyata, H; Mueller, Th A; Nagasaka, Y; Nakajima, K; Novella, P; Obolensky, M; Oberauer, L; Onillon, A; Osborn, A; Ostrovskiy, I; Palomares, C; Pepe, I M; Perasso, S; Perrin, P; Pfahler, P; Porta, A; Potzel, W; Pronost, G; Reichenbacher, J; Reinhold, B; Remoto, A; Röhling, M; Roncin, R; Roth, S; Rybolt, B; Sakamoto, Y; Santorelli, R; Sato, F; Schönert, S; Schoppmann, S; Schwetz, T; Shaevitz, M H; Shrestha, D; Sida, J -L; Sinev, V; Skorokhvatov, M; Smith, E; Spitz, J; Stahl, A; Stancu, I; Stokes, L F F; Strait, M; Stüken, A; Suekane, F; Sukhotin, S; Sumiyoshi, T; Sun, Y; Terao, K; Tonazzo, A; Toups, M; Thi, H H Trinh; Valdiviesso, G; Veyssiere, C; Wagner, S; Watanabe, H; White, B; Wiebusch, C; Winslow, L; Worcester, M; Wurm, M; Yanovitch, E; Yermia, F; Zimmer, V

    2012-01-01

    We present a search for Lorentz violation with 8249 candidate electron antineutrino events taken by the Double Chooz experiment in 227.9 live days of running. This analysis, featuring a search for a sidereal time dependence of the events, is the first test of Lorentz invariance using a reactor-based antineutrino source. No sidereal variation is present in the data and the disappearance results are consistent with sidereal time independent oscillations. Under the Standard-Model Extension (SME), we set the first limits on fourteen Lorentz violating coefficients associated with transitions between electron and tau flavor, and set two competitive limits associated with transitions between electron and muon flavor.

  16. Comparative analysis between P1 and B1 equations for neutron moderation

    International Nuclear Information System (INIS)

    In order to calculate the neutron flux in nuclear reactors, B1 or P1 equations are solved by numerical methods for several groups of energy. The neutron fluxes obtained from the solutions of the B1 and P1 equations are similar when they are applied to large nuclear power reactors. However, an important difference between the two fluxes is that the system of P1 equations uses one more approximation than the B1 system and then, its flux is less precise. The present work shows the relations between both equations and analyzes for what conditions the two equations systems are equivalent. Furthermore, this equations are numerically solved in 54 groups of energy for a quadrangular arrange. (author)

  17. Nuclear developments: the DMAX advanced reactor control system

    International Nuclear Information System (INIS)

    Framatome has recently developed a new system for controlling the rod cluster control assemblies of pressurized water reactors, called the DMAX. The associated reactor control method is called 'mode X'. The DMAX system will be installed in all 'N4' model Framatome nuclear steam supply systems, the first two of which are presently under construction on the Chooz site in France. It will enable fine controlling of the reactor coolant temperature and the axial power offset, entirely automatically, due to double closed-loop regulation. The new DMAX system allows temperature control and continuous maintenance of a stable reactor core power distribution, because of an original method for controlling the movements of the control rods within the reactor. The disturbing xenon oscillations are practically eliminated and the operator is freed from the need of constantly monitoring the axial power offset, which is necessary in the commonly used 'A' or 'G' control modes. The probability of penalizing initial conditions in case an incident or accident occurs is considerably reduced in mode X, with the DMAX system, and the reactor's load-following performances are improved. In addition, the reactivity variations that must necessarily be compensated for in mode G by changing the boric acid concentration of the reactor coolant can be simply compensated for by control rod movements in mode X. This possibility yields a major reduction in the volume of liquid effluents that must subsequently be created. The system is outlined and its operation explained. (author)

  18. 维生素B1

    Institute of Scientific and Technical Information of China (English)

    郭俊生

    2007-01-01

    维生素B1又称硫胺素(thiamine)、抗脚气病因子、抗神经炎因子等,是维生素中发现最早的一种。早在公元前2697年,我国医书《内经》曾对脚气病进行过详细的论述,但发现维生素B1是一种必需的营养物质是在19世纪末和20世纪初。1897年,荷兰内科医生Eijkman发现脚气病是由于食精白米所致,用米糠或糙米可防治此病。1911年,Funk在伦敦Lister研究所从米糠中提取到这种治疗脚气病的物质,因为具有胺的性质,因此称之为“生命胺”,

  19. 118-B-1 excavation treatability test procedures

    International Nuclear Information System (INIS)

    This treatability study has two purposes: to support development of the approach to be used for burial ground remediation, and to provide specific engineering information for the design of burial grounds receiving waste generated from the 100 Area removal actions. Data generated from this test will also provide performance and cost information necessary for detailed analysis of alternatives for burial ground remediation. Further details on the test requirements, milestones and data quality objectives are described in detail in the 118-B-1 Excavation Treatability Test Plan (DOE/RL-94-43). These working procedures are intended for use by field personnel to implement the requirements of the milestone. A copy of the detailed Test Plan will be kept on file at the on-site field support trailer, and will be available for review by field personnel

  20. 118-B-1 excavation treatability test procedures

    Energy Technology Data Exchange (ETDEWEB)

    Frain, J.M.

    1994-08-01

    This treatability study has two purposes: to support development of the approach to be used for burial ground remediation, and to provide specific engineering information for the design of burial grounds receiving waste generated from the 100 Area removal actions. Data generated from this test will also provide performance and cost information necessary for detailed analysis of alternatives for burial ground remediation. Further details on the test requirements, milestones and data quality objectives are described in detail in the 118-B-1 Excavation Treatability Test Plan (DOE/RL-94-43). These working procedures are intended for use by field personnel to implement the requirements of the milestone. A copy of the detailed Test Plan will be kept on file at the on-site field support trailer, and will be available for review by field personnel.

  1. Syntheses and Bioactivity of 4"-Sulfonate-5-triphenylsilyl Avermectin B1a and Ivermectin B1a Derivatives

    Institute of Scientific and Technical Information of China (English)

    LIAO Lian-an; FANG Hong-yun; LI Zheng-ming; ZHAO Wei-guang; FAN Zhi-jin

    2004-01-01

    Fourteen new derivatives of avermectin B1a and ivermectin B1a were synthesized from C5-O-triphenylsilyl avermectin B1a and ivermectin B1a(yield from 40% to 83%). Their chemical structures were characterized by means of IR, 1H NMR, 13C NMR and FAB-MS spectrometries. Some of them show excellent insecticidal activity.

  2. Calculation of a leak in the bottom of a bwr-pressure vessel using THYDE-B1

    International Nuclear Information System (INIS)

    The present report describes the modelling of a boiling water reactor of the Gemeinschaftskraftwerk Tullnerfeld (GKT) plant type. The corresponding input data set for the Japanese computer code THYDE-B1 allows the simulation of the thermohydraulic transient within the reactor coolant system during a loss of coolant accident. The initiating event 'Leak in the Reactor Pressure Vessel Bottom' has been calculated as an application exercise. The results are discussed using graphic representation, where one should be aware that the calculated data do not correspond with any specific plant configuration of the boiling water reactor generic design. 1 ref., 7 figs. (Author)

  3. Vitamin B1 (thiamine) and dementia.

    Science.gov (United States)

    Gibson, Gary E; Hirsch, Joseph A; Fonzetti, Pasquale; Jordan, Barry D; Cirio, Rosanna T; Elder, Jessica

    2016-03-01

    The earliest and perhaps best example of an interaction between nutrition and dementia is related to thiamine (vitamin B1). Throughout the last century, research showed that thiamine deficiency is associated with neurological problems, including cognitive deficits and encephalopathy. Multiple similarities exist between classical thiamine deficiency and Alzheimer's disease (AD) in that both are associated with cognitive deficits and reductions in brain glucose metabolism. Thiamine-dependent enzymes are critical components of glucose metabolism that are reduced in the brains of AD patients and by thiamine decline, and a decrease in their levels could account for the reduction in glucose metabolism. In preclinical models, reduced thiamine can drive AD-like abnormalities, including memory deficits, neuritic plaques, and hyperphosphorylation of tau. Furthermore, excess thiamine diminishes AD-like pathologies. In addition to dietary deficits, drugs or other manipulations that interfere with thiamine absorption can cause thiamine deficiency. Elucidating the reasons why the brains of AD patients are functionally thiamine deficient and determining the effects of thiamine restoration may provide critical information to help treat patients with AD. PMID:26971083

  4. Synthesis of 5-Deoxy-5-Acyloxyiminoavermectin B1 Derivatives

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    Four 5-deoxy-5-acyloxyiminoavermectin B1 derivatives 4a~d were synthesized via three steps from avermectin B1 and their biological activities were tested against Heliothis armigera,Laphygma exigua and Musca domestica.

  5. Nuclear Reactors

    Energy Technology Data Exchange (ETDEWEB)

    Hogerton, John

    1964-01-01

    This pamphlet describes how reactors work; discusses reactor design; describes research, teaching, and materials testing reactors; production reactors; reactors for electric power generation; reactors for supply heat; reactors for propulsion; reactors for space; reactor safety; and reactors of tomorrow. The appendix discusses characteristics of U.S. civilian power reactor concepts and lists some of the U.S. reactor power projects, with location, type, capacity, owner, and startup date.

  6. Compound list: aflatoxin B1 [Open TG-GATEs

    Lifescience Database Archive (English)

    Full Text Available aflatoxin B1 AFB1 00165 ftp://ftp.biosciencedbc.jp/archive/open-tggates/LATEST/Human/in_vitro/aflat...oxin_B1.Human.in_vitro.Liver.zip ftp://ftp.biosciencedbc.jp/archive/open-tggates/LATEST/Rat/in_vivo/Liver/Single/aflatoxin_B1.Rat.in_vivo.Liver.Single.zip ...

  7. 26 CFR 48.4061(b)-1 - Imposition of tax.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 16 2010-04-01 2010-04-01 true Imposition of tax. 48.4061(b)-1 Section 48.4061(b)-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) MISCELLANEOUS... Taxable Fuel Automotive and Related Items § 48.4061(b)-1 Imposition of tax. (a) In general. Section...

  8. Aflatoxin B1: Mechanism of mutagenesis

    Directory of Open Access Journals (Sweden)

    Regina M. Santella

    2007-02-01

    Full Text Available

    Aflatoxins are a group of toxic and carcinogenic fungal metabolites that frequently contaminate corn, peanuts and other products. Aflatoxin B1 (AFB1, the most potent of these, is metabolized by the cytochrome P450 system into a number of hydroxylated metabolites and glutathione conjugates in the process of conversion to more hydrophilic forms for urinary excretion. Unfortunately, one of these metabolites is the aflatoxin-8,9-epoxide that is produced in two forms, endo and exo. Glutathione S-transferases (GST are able to conjugate and detoxify this reactive intermediate. Species differences in susceptibility to the effects of AFB1 are partially related to differences in expression of specific GSTs that are able to conjugate the epoxide to glutathione. The exo epoxide is able to intercalate into DNA and this is followed by reaction of the C8 position of the epoxide with the N7 position of guanine.

    NMR studies of oligonucleotide duplexes containing the adduct have demonstrated that the adduct exists with the aromatic portion intercalated on the 5' face of the guanine residue with Watson-Crick base pairing maintained.

    However, this covalent adduct is chemically unstable due to the charge on the ribose ring. As a result, the guanine can be released from the DNA leaving an apurinic site. This released guanine adduct can be detected in the urine and serves as a biomarker of exposure to AFB1. Alternatively, the ribose ring opens forming a stable formamidopyrimidine (FAPY adduct. This adduct somewhat stabilizes the DNA duplex. Time course studies in animals have demonstrated that the N7 adduct is rapidly removed, probably because it causes more distortion in the helix, while the FAPY adduct is more

  9. Search for B-meson decays to b1ρ and b1K*

    Science.gov (United States)

    Aubert, B.; Karyotakis, Y.; Lees, J. P.; Poireau, V.; Prencipe, E.; Prudent, X.; Tisserand, V.; Garra Tico, J.; Grauges, E.; Martinelli, M.; Palano, A.; Pappagallo, M.; Eigen, G.; Stugu, B.; Sun, L.; Battaglia, M.; Brown, D. N.; Hooberman, B.; Kerth, L. T.; Kolomensky, Yu. G.; Lynch, G.; Osipenkov, I. L.; Tackmann, K.; Tanabe, T.; Hawkes, C. M.; Soni, N.; Watson, A. T.; Koch, H.; Schroeder, T.; Asgeirsson, D. J.; Hearty, C.; Mattison, T. S.; McKenna, J. A.; Barrett, M.; Khan, A.; Randle-Conde, A.; Blinov, V. E.; Bukin, A. D.; Buzykaev, A. R.; Druzhinin, V. P.; Golubev, V. B.; Onuchin, A. P.; Serednyakov, S. I.; Skovpen, Yu. I.; Solodov, E. P.; Todyshev, K. Yu.; Bondioli, M.; Curry, S.; Eschrich, I.; Kirkby, D.; Lankford, A. J.; Lund, P.; Mandelkern, M.; Martin, E. C.; Stoker, D. P.; Atmacan, H.; Gary, J. W.; Liu, F.; Long, O.; Vitug, G. M.; Yasin, Z.; Sharma, V.; Campagnari, C.; Hong, T. M.; Kovalskyi, D.; Mazur, M. A.; Richman, J. D.; Beck, T. W.; Eisner, A. M.; Heusch, C. A.; Kroseberg, J.; Lockman, W. S.; Martinez, A. J.; Schalk, T.; Schumm, B. A.; Seiden, A.; Wang, L.; Winstrom, L. O.; Cheng, C. H.; Doll, D. A.; Echenard, B.; Fang, F.; Hitlin, D. G.; Narsky, I.; Ongmongkolkul, P.; Piatenko, T.; Porter, F. C.; Andreassen, R.; Mancinelli, G.; Meadows, B. T.; Mishra, K.; Sokoloff, M. D.; Bloom, P. C.; Chavez, A.; Ford, W. T.; Gaz, A.; Hirschauer, J. F.; Nagel, M.; Nauenberg, U.; Smith, J. G.; Wagner, S. R.; Ayad, R.; Toki, W. H.; Wilson, R. J.; Feltresi, E.; Hauke, A.; Jasper, H.; Karbach, T. M.; Merkel, J.; Petzold, A.; Spaan, B.; Wacker, K.; Kobel, M. J.; Nogowski, R.; Schubert, K. R.; Schwierz, R.; Bernard, D.; Latour, E.; Verderi, M.; Clark, P. J.; Playfer, S.; Watson, J. E.; Andreotti, M.; Bettoni, D.; Bozzi, C.; Calabrese, R.; Cecchi, A.; Cibinetto, G.; Fioravanti, E.; Franchini, P.; Luppi, E.; Munerato, M.; Negrini, M.; Petrella, A.; Piemontese, L.; Santoro, V.; Baldini-Ferroli, R.; Calcaterra, A.; de Sangro, R.; Finocchiaro, G.; Pacetti, S.; Patteri, P.; Peruzzi, I. M.; Piccolo, M.; Rama, M.; Zallo, A.; Contri, R.; Guido, E.; Lo Vetere, M.; Monge, M. R.; Passaggio, S.; Patrignani, C.; Robutti, E.; Tosi, S.; Chaisanguanthum, K. S.; Morii, M.; Adametz, A.; Marks, J.; Schenk, S.; Uwer, U.; Bernlochner, F. U.; Klose, V.; Lacker, H. M.; Lueck, T.; Volk, A.; Bard, D. J.; Dauncey, P. D.; Tibbetts, M.; Behera, P. K.; Charles, M. J.; Mallik, U.; Cochran, J.; Crawley, H. B.; Dong, L.; Eyges, V.; Meyer, W. T.; Prell, S.; Rosenberg, E. I.; Rubin, A. E.; Gao, Y. Y.; Gritsan, A. V.; Guo, Z. J.; Arnaud, N.; Béquilleux, J.; D'Orazio, A.; Davier, M.; Derkach, D.; Firmino da Costa, J.; Grosdidier, G.; Le Diberder, F.; Lepeltier, V.; Lutz, A. M.; Malaescu, B.; Pruvot, S.; Roudeau, P.; Schune, M. H.; Serrano, J.; Sordini, V.; Stocchi, A.; Wormser, G.; Lange, D. J.; Wright, D. M.; Bingham, I.; Burke, J. P.; Chavez, C. A.; Fry, J. R.; Gabathuler, E.; Gamet, R.; Hutchcroft, D. E.; Payne, D. J.; Touramanis, C.; Bevan, A. J.; Clarke, C. K.; di Lodovico, F.; Sacco, R.; Sigamani, M.; Cowan, G.; Paramesvaran, S.; Wren, A. C.; Brown, D. N.; Davis, C. L.; Denig, A. G.; Fritsch, M.; Gradl, W.; Hafner, A.; Alwyn, K. E.; Bailey, D.; Barlow, R. J.; Jackson, G.; Lafferty, G. D.; West, T. J.; Yi, J. I.; Anderson, J.; Chen, C.; Jawahery, A.; Roberts, D. A.; Simi, G.; Tuggle, J. M.; Dallapiccola, C.; Salvati, E.; Cowan, R.; Dujmic, D.; Fisher, P. H.; Henderson, S. W.; Sciolla, G.; Spitznagel, M.; Yamamoto, R. K.; Zhao, M.; Patel, P. M.; Robertson, S. H.; Schram, M.; Biassoni, P.; Lazzaro, A.; Lombardo, V.; Palombo, F.; Stracka, S.; Cremaldi, L.; Godang, R.; Kroeger, R.; Sonnek, P.; Summers, D. J.; Zhao, H. W.; Simard, M.; Taras, P.; Nicholson, H.; de Nardo, G.; Lista, L.; Monorchio, D.; Onorato, G.; Sciacca, C.; Raven, G.; Snoek, H. L.; Jessop, C. P.; Knoepfel, K. J.; Losecco, J. M.; Wang, W. F.; Corwin, L. A.; Honscheid, K.; Kagan, H.; Kass, R.; Morris, J. P.; Rahimi, A. M.; Sekula, S. J.; Wong, Q. K.; Blount, N. L.; Brau, J.; Frey, R.; Igonkina, O.; Kolb, J. A.; Lu, M.; Rahmat, R.; Sinev, N. B.; Strom, D.; Strube, J.; Torrence, E.; Castelli, G.; Gagliardi, N.; Margoni, M.; Morandin, M.; Posocco, M.; Rotondo, M.; Simonetto, F.; Stroili, R.; Voci, C.; Del Amo Sanchez, P.; Ben-Haim, E.; Bonneaud, G. R.; Briand, H.; Chauveau, J.; Hamon, O.; Leruste, Ph.; Marchiori, G.; Ocariz, J.; Perez, A.; Prendki, J.; Sitt, S.; Gladney, L.; Biasini, M.; Manoni, E.; Angelini, C.; Batignani, G.; Bettarini, S.; Calderini, G.; Carpinelli, M.; Cervelli, A.; Forti, F.; Giorgi, M. A.; Lusiani, A.; Morganti, M.; Neri, N.; Paoloni, E.; Rizzo, G.; Walsh, J. J.; Lopes Pegna, D.; Lu, C.; Olsen, J.; Smith, A. J. S.; Telnov, A. V.; Anulli, F.; Baracchini, E.; Cavoto, G.; Faccini, R.; Ferrarotto, F.; Ferroni, F.; Gaspero, M.; Jackson, P. D.; Li Gioi, L.

    2009-09-01

    We present a search for decays of B mesons to final states with a b1 meson and a ρ or K*(892) meson. The search is based on a data sample consisting of 465 million B Bmacr pairs collected by the BABAR detector at the SLAC National Accelerator Laboratory. We do not observe any statistically significant signal. The upper limits we set on the branching fractions range from 1.4 to 8.0×10-6 at the 90% confidence level, including systematic uncertainties.

  10. Comparative analysis between P1 and B1 equations for neutron moderation; Analise comparativa entre os metodos de obtencao e das solucoes das equacoes P1 e B1 para moderacao de neutrons

    Energy Technology Data Exchange (ETDEWEB)

    Martinez, Aquilino Senra; Silva, Fernando Carvalho da; Cardoso, Carlos Eduardo Santos [Universidade Federal, Rio de Janeiro, RJ (Brazil). Coordenacao dos Programas de Pos-graduacao de Engenharia. Programa de Engenharia Nuclear

    2000-07-01

    In order to calculate the neutron flux in nuclear reactors, B1 or P1 equations are solved by numerical methods for several groups of energy. The neutron fluxes obtained from the solutions of the B1 and P1 equations are similar when they are applied to large nuclear power reactors. However, an important difference between the two fluxes is that the system of P1 equations uses one more approximation than the B1 system and then, its flux is less precise. The present work shows the relations between both equations and analyzes for what conditions the two equations systems are equivalent. Furthermore, this equations are numerically solved in 54 groups of energy for a quadrangular arrange. (author)

  11. Construction of HEK293 cells stably expressing wild-type organic anion transporting polypeptide 1B1 (OATP1B1*1a) and variant OATP1B1*1b and OATP1B1*15.

    Science.gov (United States)

    Chen, M; Qu, B X; Chen, X L; Hu, H H; Jiang, H D; Yu, L S; Zhou, Q; Zeng, S

    2016-06-01

    A transgenic cell line stably expressing the human organic anion transporting polypeptide (OATP1B1) was established. Human Embryonic Kidney 293 (HEK293) cell line stably expressing OATP1B1*1a sequence was amplified through PCR with the extracted total RNA as templates from human liver, then subcloned into the plasmid pMD19-T and verified by sequencing. OATP1B1*1b/OATP1B1*15 mutant sequences were obtained by site-directed mutation PCR with pMD19-T/ OATP1B1*1a as templates. The plasmids pcDNA3.1(+)/OATP1B1*1a, *1b and *15 were constructed and transfected into HEK293 cell line using Lipofectamine 2000 transfection reagent. Several stable transfected clones were obtained after selection with G418. Using rosuvastatin as a probe substrate of OATP1B1, the intracellular rosuvastatin accumulation in HEK293 and HEK-OATP1B1*1a, *1b and *15 monoclone cells were validated by a ultra-performance liquid chromatography-tandem mass spectrometry. OATP1B1 mRNA and protein expression were detected by RT-PCR and Western blot, respectively. The results from RT-PCR, rosuvastatin uptake and Western blot assay indicated that human OATP1B1 was highly expressed in transfected cells compared with controls. The HEK-293 cell lines stably expressing human OATP1B1-wild and variant (HEK-OATP1B1, *1b and *15) are potential models to study drug transport in vitro. PMID:27455553

  12. Construction of HEK293 cells stably expressing wild-type organic anion transporting polypeptide 1B1 (OATP1B1*1a) and variant OATP1B1*1b and OATP1B1*15.

    Science.gov (United States)

    Chen, M; Qu, B X; Chen, X L; Hu, H H; Jiang, H D; Yu, L S; Zhou, Q; Zeng, S

    2016-06-01

    A transgenic cell line stably expressing the human organic anion transporting polypeptide (OATP1B1) was established. Human Embryonic Kidney 293 (HEK293) cell line stably expressing OATP1B1*1a sequence was amplified through PCR with the extracted total RNA as templates from human liver, then subcloned into the plasmid pMD19-T and verified by sequencing. OATP1B1*1b/OATP1B1*15 mutant sequences were obtained by site-directed mutation PCR with pMD19-T/ OATP1B1*1a as templates. The plasmids pcDNA3.1(+)/OATP1B1*1a, *1b and *15 were constructed and transfected into HEK293 cell line using Lipofectamine 2000 transfection reagent. Several stable transfected clones were obtained after selection with G418. Using rosuvastatin as a probe substrate of OATP1B1, the intracellular rosuvastatin accumulation in HEK293 and HEK-OATP1B1*1a, *1b and *15 monoclone cells were validated by a ultra-performance liquid chromatography-tandem mass spectrometry. OATP1B1 mRNA and protein expression were detected by RT-PCR and Western blot, respectively. The results from RT-PCR, rosuvastatin uptake and Western blot assay indicated that human OATP1B1 was highly expressed in transfected cells compared with controls. The HEK-293 cell lines stably expressing human OATP1B1-wild and variant (HEK-OATP1B1, *1b and *15) are potential models to study drug transport in vitro.

  13. Surface Binding of Aflatoxin B1 by Lactic Acid Bacteria

    OpenAIRE

    Haskard, Carolyn A.; El-Nezami, Hani S.; Kankaanpää, Pasi E.; Salminen, Seppo; Ahokas, Jorma T.

    2001-01-01

    Specific lactic acid bacterial strains remove toxins from liquid media by physical binding. The stability of the aflatoxin B1 complexes formed with 12 bacterial strains in both viable and nonviable (heat- or acid-treated) forms was assessed by repetitive aqueous extraction. By the fifth extraction, up to 71% of the total aflatoxin B1 remained bound. Nonviable bacteria retained the highest amount of aflatoxin B1. Lactobacillus rhamnosus strain GG (ATCC 53103) and L. rhamnosus strain LC-705 (DS...

  14. MAN1B1 deficiency: an unexpected CDG-II.

    Directory of Open Access Journals (Sweden)

    Daisy Rymen

    Full Text Available Congenital disorders of glycosylation (CDG are a group of rare metabolic diseases, due to impaired protein and lipid glycosylation. In the present study, exome sequencing was used to identify MAN1B1 as the culprit gene in an unsolved CDG-II patient. Subsequently, 6 additional cases with MAN1B1-CDG were found. All individuals presented slight facial dysmorphism, psychomotor retardation and truncal obesity. Generally, MAN1B1 is believed to be an ER resident alpha-1,2-mannosidase acting as a key factor in glycoprotein quality control by targeting misfolded proteins for ER-associated degradation (ERAD. However, recent studies indicated a Golgi localization of the endogenous MAN1B1, suggesting a more complex role for MAN1B1 in quality control. We were able to confirm that MAN1B1 is indeed localized to the Golgi complex instead of the ER. Furthermore, we observed an altered Golgi morphology in all patients' cells, with marked dilatation and fragmentation. We hypothesize that part of the phenotype is associated to this Golgi disruption. In conclusion, we linked mutations in MAN1B1 to a Golgi glycosylation disorder. Additionally, our results support the recent findings on MAN1B1 localization. However, more work is needed to pinpoint the exact function of MAN1B1 in glycoprotein quality control, and to understand the pathophysiology of its deficiency.

  15. 26 CFR 31.3401(b)-1 - Payroll period.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 15 2010-04-01 2010-04-01 false Payroll period. 31.3401(b)-1 Section 31.3401(b... Collection of Income Tax at Source § 31.3401(b)-1 Payroll period. (a) The term payroll period means the... elapsed and receives the remainder at the end of the week, the payroll period is still the calendar...

  16. SerpinB1 Promotes Pancreatic β Cell Proliferation

    Energy Technology Data Exchange (ETDEWEB)

    Quaamari, Abdelfattah; Dirice, Ercument; Gedeon, Nicholas; Hu, Jiang; Zhou, Jian-Ying; Shirakawa, Jun; Hou, Lifei; Goodman, Jessica; Karampelias, Christos; Qiang, Guifeng; Boucher, Jeremie; Martinez, Rachael; Gritsenko, Marina A.; De Jesus, Dario F.; Kahraman, Sevim; Bhatt, Shweta; Smith, Richard D.; Beer, Hans-Dietmar; Jungtrakoon, Prapaporn; Gong, Yanping; Goldfine, Allison B.; Liew, Chong Wee; Doria, Alessandro; Andersson, Olov; Qian, Weijun; Remold-O' Donnell, Eileen; Kulkami, Rohit N.

    2016-01-12

    Compensatory β-cell growth in response to insulin resistance is a common feature in diabetes. We recently reported that liver-derived factors participate in this compensatory response in the liver insulin receptor knockout (LIRKO) mouse, a model of significant islet hyperplasia. Here we show that serpinB1 is a liver-derived secretory protein that controls β-cell proliferation. SerpinB1 is abundant in the hepatocyte secretome and sera derived from LIRKO mice. SerpinB1 and small molecule compounds that partially mimic serpinB1 activity enhanced proliferation of zebrafish, mouse and human β-cells. We report that serpinB1-induced β-cell replication requires protease inhibition activity and mice lacking serpinB1 exhibit attenuated β-cell replication in response to insulin resistance. Finally, SerpinB1-treatment of islets modulated signaling proteins in growth and survival pathways such as MAPK, PKA and GSK3. Together, these data implicate SerpinB1 as a protein that can potentially be harnessed to enhance functional β-cell mass in patients with diabetes.

  17. OECD 28-days oral toxicity study on fumonisin B1

    NARCIS (Netherlands)

    Nijs M de; Egmond HP van; Jong WH de; Loveren H van; LPI; ARO; MGB

    1999-01-01

    Het beschreven experiment werd uitgevoerd om inzicht te verkrijgen over effecten van lage doseringen fumonisine B1 op target organen en het immuunsysteem. Mannelijke ratten van drie weken oud werden oraal via maagsonde behandeld met 0, 0,19, 0,75 of 3 mg/kg lichaamsgewicht fumonisine B1, dagelij

  18. 29 CFR 2520.104b-1 - Disclosure.

    Science.gov (United States)

    2010-07-01

    ... of this chapter, and section 414(b) of the Internal Revenue Code of 1954 and 26 CFR 1.414(f) (40 FR... 29 Labor 9 2010-07-01 2010-07-01 false Disclosure. 2520.104b-1 Section 2520.104b-1 Labor... REPORTING AND DISCLOSURE UNDER THE EMPLOYEE RETIREMENT INCOME SECURITY ACT OF 1974 RULES AND REGULATIONS...

  19. 17 CFR 260.10b-1 - Calculation of percentages.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Calculation of percentages. 260.10b-1 Section 260.10b-1 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION... Calculation of percentages. The percentages of voting securities and other securities specified in section...

  20. 77 FR 32599 - 36(b)(1) Arms Sales Notification

    Science.gov (United States)

    2012-06-01

    ... possible sale to provide the regeneration, overhaul, modifications, and logistics support of 4 Lockheed... of the Secretary 36(b)(1) Arms Sales Notification AGENCY: Department of Defense, Defense Security... a section 36(b)(1) arms sales notification. This is published to fulfill the requirements of...

  1. 78 FR 36534 - 36(b)(1) Arms Sales Notification

    Science.gov (United States)

    2013-06-18

    ... of the Secretary 36(b)(1) Arms Sales Notification AGENCY: Defense Security Cooperation Agency... of a section 36(b)(1) arms sales notification. This is published to fulfill the requirements of... contractor technical and logistics support services, and other related elements of logistics support....

  2. 78 FR 50045 - 36(b)(1) Arms Sales Notification

    Science.gov (United States)

    2013-08-16

    ... of the Secretary 36(b)(1) Arms Sales Notification AGENCY: Defense Security Cooperation Agency... of a section 36(b)(1) arms sales notification. This is published to fulfill the requirements of... engineering, technical and logistics support services, and other related elements of logistics support....

  3. 76 FR 60455 - 36(b)(1) Arms Sales Notification

    Science.gov (United States)

    2011-09-29

    ... of the Secretary 36(b)(1) Arms Sales Notification AGENCY: Department of Defense, Defense Security... a section 36(b)(1) arms sales notification. This is published to fulfill the requirements of section... engineering, technical and logistics support services, and other related elements of logistical and...

  4. 76 FR 72684 - 36(b)(1) Arms Sales Notification

    Science.gov (United States)

    2011-11-25

    ... of the Secretary 36(b)(1) Arms Sales Notification AGENCY: Defense Security Cooperation Agency... of a section 36(b)(1) arms sales notification. This is published to fulfill the requirements of... engineering, technical and logistics support services, and other related elements of logistical and...

  5. 78 FR 41039 - 36(b)(1) Arms Sales Notification

    Science.gov (United States)

    2013-07-09

    ... elements of logistics support. The estimated cost is $170 million. The proposed sale will contribute to the... of the Secretary 36(b)(1) Arms Sales Notification AGENCY: Department of Defense, Defense Security... a section 36(b)(1) arms sales notification. This is published to fulfill the requirements of...

  6. 26 CFR 11.410(b)-1 - Minimum coverage requirements.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 14 2010-04-01 2010-04-01 false Minimum coverage requirements. 11.410(b)-1 Section 11.410(b)-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) TEMPORARY INCOME TAX REGULATIONS UNDER THE EMPLOYEE RETIREMENT INCOME SECURITY...

  7. 77 FR 52698 - 36(b)(1) Arms Sales Notification

    Science.gov (United States)

    2012-08-30

    ... of the Secretary 36(b)(1) Arms Sales Notification AGENCY: Defense Security Cooperation Agency... of a section 36(b)(1) arms sales notification. This is published to fulfill the requirements of...: 18 AGM-65K2 MAVERICK All-Up- Round Missiles, 36 TGM-65K2 Captive Air Training Missiles, 3...

  8. 77 FR 42709 - 36(b)(1) Arms Sales Notification

    Science.gov (United States)

    2012-07-20

    ... of the Secretary 36(b)(1) Arms Sales Notification AGENCY: Department of Defense, Defense Security... a section 36(b)(1) arms sales notification. This is published to fulfill the requirements of section... Services under Consideration for Purchase: 700 AGM-114K3A or AGM-114R3 HELLFIRE tactical missiles,...

  9. 76 FR 68432 - 36(b)(1) Arms Sales Notification

    Science.gov (United States)

    2011-11-04

    ... of the Secretary 36(b)(1) Arms Sales Notification AGENCY: Defense Security Cooperation Agency... of a section 36(b)(1) arms sales notification. This is published to fulfill the requirements of... Purchase: 70 AGM-158 Joint Air-to- Surface Standoff Missiles (JASSM), 2 test vehicles, support and...

  10. 78 FR 26330 - 36(b)(1) Arms Sales Notification

    Science.gov (United States)

    2013-05-06

    ... of the Secretary 36(b)(1) Arms Sales Notification AGENCY: Defense Security Cooperation Agency... of a section 36(b)(1) arms sales notification. This is published to fulfill the requirements of... Services under Consideration for Purchase: 500 AGM-114-N4/P4 HELLFIRE missiles. (iv) Military...

  11. 76 FR 60461 - 36(b)(1) Arms Sales Notification

    Science.gov (United States)

    2011-09-29

    ... of the Secretary 36(b)(1) Arms Sales Notification AGENCY: Department of Defense, Defense Security... a section 36(b)(1) arms sales notification. This is published to fulfill the requirements of section...: 500 AGM-114R3 HELLFIRE II missiles, containers, spare and repair parts, support and test...

  12. 77 FR 40026 - 36(b)(1) Arms Sales Notification

    Science.gov (United States)

    2012-07-06

    ... of the Secretary 36(b)(1) Arms Sales Notification AGENCY: Department of Defense, Defense Security... a section 36(b)(1) arms sales notification. This is published to fulfill the requirements of section... Consideration for Purchase: 300 AGM-114R3 HELLFIRE II missiles, containers, spare and repair parts, support...

  13. 26 CFR 1.7702B-1 - Consumer protection provisions.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 13 2010-04-01 2010-04-01 false Consumer protection provisions. 1.7702B-1 Section 1.7702B-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME...-Term Care Insurance Model Act (Model Act) and Long-Term Care Insurance Model Regulation...

  14. Dual effects of phloretin on aflatoxin B1 metabolism: activation and detoxification of aflatoxin B1.

    Science.gov (United States)

    Gao, Shang Shang; Chen, Xiao Yan; Zhu, Ri Zhe; Choi, Byung-Min; Kim, Sun Jun; Kim, Bok-Ryang

    2012-01-01

    Typically, chemopreventive agents involve either induction of phase II detoxifying enzymes and/or inhibition of cytochrome P450 enzymes (CYPs) that are required for the activation of procarcinogens. In this study, we investigated the protective effects of phloretin against aflatoxin B1 (AFB1) activation to the ultimate carcinogenic intermediate, AFB(1)-8, 9-epoxide (AFBO), and its subsequent detoxification. Phloretin markedly inhibited formation of the epoxide with human liver microsomes in a dose-dependent manner. Phloretin also inhibited the activities of nifedipine oxidation and ethoxyresorufin O-deethylase (EROD) in human liver microsomes. These data show that phloretin strongly inhibits CYP1A2 and CYP3A4 activities, which are involved in the activation of AFB1. Phloretin increased glutathione S-transferase (GST) activity of alpha mouse liver 12 (AML 12) cells in a dose-dependent manner. GST activity toward AFBO in cell lysates treated with 20 μM phloretin was 23-fold that of untreated control cell lysates. The expression of GSTA3, GSTA4, GSTM1, GSTP1 and GSTT1 was induced by phloretin in a dose-dependent manner in AML 12 cells. GSTP1, GSTM1, and GSTT1 were able to significantly increase the conjugation of AFBO with glutathione. Concurrently, induction of the GST isozyme genes was partially associated with the Nrf2/ARE pathway. Taken together, the results demonstrate that phloretin has a strong chemopreventive effect against AFB1 through its inhibitory effect on CYP1A2, CYP3A4, and its inductive effect on GST activity. PMID:22253071

  15. The b1 structure function and nuclear pions

    International Nuclear Information System (INIS)

    The b1 structure function is measurable in deep inelastic scattering from polarized nuclei with unpolarized beams. The contributions of nuclear pions are evaluated and found to be small, about 2%. 8 refs

  16. Analysis of CYP27B1 in multiple sclerosis

    Science.gov (United States)

    Ross, Jay P; Bernales, Cecily Q; Lee, Joshua D; Sadovnick, A Dessa; Traboulsee, Anthony L; Vilariño-Güell, Carles

    2016-01-01

    The analysis of genetic variability in CYP27B1 and its effect on risk of multiple sclerosis (MS) has yielded conflicting results. Here we describe a study to genetically characterize CYP27B1 and elucidate its role on MS risk in the Canadian population. Sequencing CYP27B1 failed to identify mutations known to cause loss of enzymatic activity, however genotyping of p.R389H in cases and controls identified the mutation in one multi-incident family (allele frequency = 0.03%) in which the p.R389H mutation segregates with disease in five family members diagnosed with MS, thus providing additional support for CYP27B1 p.R389H in the pathogenicity of MS. PMID:24308945

  17. Supercritical Fluid Extraction of Aflatoxin B 1 from Soil

    Science.gov (United States)

    This research describes the development of a Supercritical Fluid Extraction (SFE) method to recover aflatoxin B1 from fortified soil. The effects of temperature, pressure, modifier (identity and percentage), and extraction type were assessed. Using the optimized SFE conditions, ...

  18. Synthesis of 4"-benzyloxyimino-4"-deoxyavermectin B1a derivatives

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    Six new 4"-benzyloxyimino-4"-deoxyavermectin B1a derivatives were synthesized from avermectin B1a by the selective protection of C-5-hydroxy group, oxidation of C-4"-hydroxy group, and deprotection followed by reaction with O-substituted hydroxylamine hydrochlorides. Their structures were confirmed by IR, 1H NMR, 13C NMR and MS. Insecticidal activities of the derivatives against Phopalosiphum pseudobrassicae, Spodoptera exigua and Pluteua xylosteua were evaluated.

  19. Occurrence of aflatoxin B1 in natural products.

    Science.gov (United States)

    Prado, Guilherme; Altoé, Aline F; Gomes, Tatiana C B; Leal, Alexandre S; Morais, Vanessa A D; Oliveira, Marize S; Ferreira, Marli B; Gomes, Mateus B; Paschoal, Fabiano N; von S Souza, Rafael; Silva, Daniela A; Cruz Madeira, Jovita E G

    2012-10-01

    The media claims for the consumption of natural resource-based food have gradually increased in both developing and developed countries. The interest in the safety of these products is partially due to the possible presence of toxigenic fungi acting as mycotoxin producers, such as aflatoxins produced during the secondary metabolism of Aspergillus flavus, A. parasiticus and A. nomius. Aflatoxins, mainly aflatoxin B1, are directly associated with liver cancer in human beings. This paper is aimed at evaluating the presence of aflatoxin B1 in a few vegetable drugs, dried plant extracts and industrialized products traded in 2010 in the city of Belo Horizonte, State of Minas Gerais, Brazil. The method used for the quantification of aflatoxin B1 was based on extraction through acetone:water (85:15), immunoaffinity column purification followed by separation and detection in high efficiency liquid chromatography. Under the conditions of analysis, the Limits of Detection and Quantification were 0.6 µg kg(-1) and 1.0 µg kg(-1) respectively. The complete sets of analyses were carried out in duplicate. Aflatoxin B1 was noticed in a single sample (aflatoxin B1 contamination in the products under analysis. However, it is required to establish a broad monitoring program in order to obtain additional data and check up on the actual extension of contamination. PMID:24031973

  20. Occurrence of aflatoxin B1 in natural products

    Directory of Open Access Journals (Sweden)

    Guilherme Prado

    2012-12-01

    Full Text Available The media claims for the consumption of natural resource-based food have gradually increased in both developing and developed countries. The interest in the safety of these products is partially due to the possible presence of toxigenic fungi acting as mycotoxin producers, such as aflatoxins produced during the secondary metabolism of Aspergillus flavus, A. parasiticus and A. nomius. Aflatoxins, mainly aflatoxin B1, are directly associated with liver cancer in human beings. This paper is aimed at evaluating the presence of aflatoxin B1 in a few vegetable drugs, dried plant extracts and industrialized products traded in 2010 in the city of Belo Horizonte, State of Minas Gerais, Brazil. The method used for the quantification of aflatoxin B1 was based on extraction through acetone:water (85:15, immunoaffinity column purification followed by separation and detection in high efficiency liquid chromatography. Under the conditions of analysis, the Limits of Detection and Quantification were 0.6 µg kg-1 and 1.0 µg kg-1respectively. The complete sets of analyses were carried out in duplicate. Aflatoxin B1 was noticed in a single sample (< 1.0 µg kg-1. The results revealed low aflatoxin B1contamination in the products under analysis. However, it is required to establish a broad monitoring program in order to obtain additional data and check up on the actual extension of contamination.

  1. Variability in equatorial B0 and B1

    International Nuclear Information System (INIS)

    Variability of ionospheric profile parameters B0 and B1, below the F2 peak is investigated for an equatorial station at two levels of solar activities. The whole 24 hours of the day and the four seasons of the year are covered. Absolute and relative variability indices were utilized in the study. Some evidences of correlations of variability index and profiles parameters were observed. Daytime values of relative variability in B1 at solar minimum were found to be greater than those of solar maximum. (author)

  2. Seasonal behaviour of B0 and B1

    International Nuclear Information System (INIS)

    A preliminary analysis of the thickness parameter B0 and the shape parameter B1 is presented. Noon electron density profiles recorded at five ionospheric stations during different seasonal and solar activity conditions are used in the study. The results show that both parameters present a seasonal trend with minimum value for B0 during the local winter and maximum during the local summer. This behaviour is inverted for B1. Discrepancies with IRI-90 model are found. (author). 8 refs, 4 figs, 2 tabs

  3. Base substitution mutations induced by metabolically activated aflatoxin B1.

    Science.gov (United States)

    Foster, P L; Eisenstadt, E; Miller, J H

    1983-05-01

    We have determined the base substitutions generated by metabolically activated aflatoxin B1 in the lacI gene of a uvrB- strain of Escherichia coli. By monitoring over 70 different nonsense mutation sites, we show that activated aflatoxin B1 specifically induced GxC leads to TxA transversions. One possible pathway leading to this base change involves depurination at guanine residues. We consider this mechanism of mutagenesis in the light of our other findings that the carcinogens benzo[a]pyrene diol epoxide and N-acetoxyacetylaminofluorene also specifically induce GxC leads to TxA transversions. PMID:6405385

  4. Base substitution mutations induced by metabolically activated aflatoxin B1.

    OpenAIRE

    Foster, P. L.; Eisenstadt, E; Miller, J H

    1983-01-01

    We have determined the base substitutions generated by metabolically activated aflatoxin B1 in the lacI gene of a uvrB- strain of Escherichia coli. By monitoring over 70 different nonsense mutation sites, we show that activated aflatoxin B1 specifically induced GxC leads to TxA transversions. One possible pathway leading to this base change involves depurination at guanine residues. We consider this mechanism of mutagenesis in the light of our other findings that the carcinogens benzo[a]pyren...

  5. N Reactor

    Data.gov (United States)

    Federal Laboratory Consortium — The last of Hanfordqaodmasdkwaspemas7ajkqlsmdqpakldnzsdflss nine plutonium production reactors to be built was the N Reactor.This reactor was called a dual purpose...

  6. Wind tunnel tests of Risø-B1-18 and Risø-B1-24

    DEFF Research Database (Denmark)

    Fuglsang, P.; Bak, Christian; Gaunaa, Mac;

    2003-01-01

    This report contains 2D measurements of the Risø-B1-18 and Risø-B1-24 airfoils. The aerodynamic properties were derived from pressure measurements on the airfoil surface and in the wake. The measurements were conducted in the VELUX open jet wind tunnel,which has a background turbulence intensity...... of the measurements was good and the agreement between measurements and numerical CFD predictions with EllipSys2D wasgood. For both airfoils predictions with turbulent flow captured very well the shapes of lift and drag curves as well as the magnitude of maximum lift. Measurements of Risø-B1-18 showed...

  7. 76 FR 79658 - 36(b)(1) Arms Sales Notification

    Science.gov (United States)

    2011-12-22

    ... Proposed Issuance of Letter of Offer Pursuant to Section 36(b)(1) of the Arms Export Control Act (U) (i... Other 10 million TOTAL 60 million * as defined in Section 47(6) of the Arms Export Control Act. (iii... Anti-Tank Guided Missiles, tripods, JAVELIN Weapon Effects Simulators, enhanced basic skills...

  8. 77 FR 77040 - 36(b)(1) Arms Sales Notification

    Science.gov (United States)

    2012-12-31

    ... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF DEFENSE Office of the Secretary 36(b)(1) Arms Sales Notification AGENCY: Department of Defense, Defense Security... unguided BLU-111B/B free-fall bomb into precision-guided ``smart'' bomb. The control and airfoil...

  9. 77 FR 77043 - 36(b)(1) Arms Sales Notification

    Science.gov (United States)

    2012-12-31

    ... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF DEFENSE Office of the Secretary 36(b)(1) Arms Sales Notification AGENCY: Department of Defense, Defense Security... into precision-guided ``smart'' munitions. By adding a new tail section containing Inertial...

  10. 76 FR 69707 - 36(b)(1) Arms Sales Notification

    Science.gov (United States)

    2011-11-09

    ... defeat perimeter security threats and readily employ counter- and anti-terrorism measures. The RSLF... Section 36(b)(1) of the Arms Export Control Act, as Amended (i) Prospective Purchaser: Kingdom of Saudi... million. Other 2 million. Total 33 million. *As defined in Section 47(6) of the Arms Export Control...

  11. Aspergillus flavus and aflatoxin B1 in flour production.

    Science.gov (United States)

    Halt, M

    1994-10-01

    This paper discusses the results of investigations of contamination with aflatoxin-producing fungi and aflatoxin B1 affecting 545 samples of wheat grains, 475 samples of intermediate products of wheat grain being milled to flour (like middlings) and 238 samples of flour. A significant contamination with moulds was detected in analyzed samples. Although Aspergillus (34.87%) and Penicillium (32.37%) dominated, other types were also present, e.g., Cladosporium, Fusarium, Mucor, Alternaria, Rhizopus, Absidia and Trichoderma (listed in order of frequency). The presence of Aspergillus flavus, the known aflatoxin producer, was detected in 9.94% of analyzed samples. Isolates of A. Flavus were capable of producing aflatoxin B1 under favourable conditions. Aflatoxin B1 was found in 76.8% of samples contaminated with A. flavus. The highest contamination with aflatoxin B1 was detected in wheat grain samples (mean value of 16.3 micrograms/kg) and in intermediate products of wheat grain being milled to flour (mean value of 11.13 micrograms/kg). Contamination was lower in flour samples (mean value of 4.13 micrograms/kg). With regard to proposed standards given by the FAO and WHO, under which the content of aflatoxin should not exceed 30 micrograms/kg in food products, only two of 96 samples did not meet these criteria. PMID:7859854

  12. 76 FR 72180 - 36(b)(1) Arms Sales Notification

    Science.gov (United States)

    2011-11-22

    ... continues to be, an important force for political stability and economic progress in East Asia. The Royal... Section 36(b)(1) of the Arms Export Control Act, as amended (i) Prospective Purchaser: Malaysia. (ii... Arms Export Control Act. Policy Justification Malaysia--AIM-9X-2 SIDEWINDER Missiles The Government...

  13. 26 CFR 1.167(b)-1 - Straight line method.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Straight line method. 1.167(b)-1 Section 1.167(b... Straight line method. (a) In general. Under the straight line method the cost or other basis of the... may be reduced to a percentage or fraction. The straight line method may be used in determining...

  14. 26 CFR 1.677(b)-1 - Trusts for support.

    Science.gov (United States)

    2010-04-01

    ... (CONTINUED) INCOME TAXES Grantors and Others Treated As Substantial Owners § 1.677(b)-1 Trusts for support... the child of the grantor, whom the grantor or his spouse is legally obligated to support. If income of... extent income of the current year is actually applied for the support or maintenance of his spouse....

  15. 77 FR 70153 - 36(b)(1) Arms Sales Notification

    Science.gov (United States)

    2012-11-23

    ... in the region. The principal contractors will be Raytheon/Lockheed Martin Javelin Joint Venture in... Section 36(b)(1) of the Arms Export Control Act, as amended (i) Prospective Purchaser: Oman (ii) Total... Section 47(6) of the Arms Export Control Act. POLICY JUSTIFICATION Oman--Javelin Missile The Sultanate...

  16. 77 FR 70151 - 36(b)(1) Arms Sales Notification

    Science.gov (United States)

    2012-11-23

    ... region. The principal contractors will be Raytheon/Lockheed Martin Javelin Joint Venture (JJV) in Tucson... Section 36(b)(1) of the Arms Export Control Act, as amended (i) Prospective Purchaser: Indonesia. (ii... defined in Section 47(6) of the Arms Export Control Act. (iii) Description and Quantity or Quantities...

  17. Aflatoxin B1content in patients with hepatic diseases Aflatoxina B1 en pacientes con enfermedades hepáticas

    Directory of Open Access Journals (Sweden)

    Clara López

    2002-08-01

    Full Text Available Aflatoxins are toxic metabolites of some Aspergillus flavus, A. parasiticus and A. nomius strains that occur in many foods and feeds. There are four major natural occurring aflatoxins: B1, B2, G1 and G2. These toxins can cause illness in human beings and animals. Aflatoxin B1 is the most abundant and toxic member of the family, and it is also the most potent hepatocarcinogen known. In order to estimate the potential human health risk of AFB1, it is useful to measure blood concentration. The presence of aflatoxin B1 in patients was evaluated by high-performance liquid chromatography, in serum samples, obtained from 20 patient volunteers with hepatic disease. Out of the 20 patients, the presence of AFB1 was detected in only one of them, in a concentration of 0.47 ng/cm³. Nevertheless, this result should draw the attention of control organizations in Argentina to the need for a thorough food and feed inspection.Las aflatoxinas son metabolitos tóxicos producidos por cepas de Aspergillus flavus, A. parasiticus y A. nomius, presentes en alimentos y piensos. Las cuatro aflatoxinas principales son: aflatoxina B1, B2, G1 y G2. Dichas toxinas pueden causar enfermedades tanto en seres humanos como en animales. La aflatoxina B1 es la más abundante y la más tóxica del grupo y es también el más potente hepatocarcinógeno conocido. El objetivo de este trabajo fue detectar la presencia de aflatoxina B1 en sangre humana para estimar el riesgo potencial de la salud. La determinación de aflatoxina B1 fue realizada por cromatografía líquida de alto rendimiento, en suero de 20 pacientes voluntarios con enfermedades hepáticas. En sólo uno de estos pacientes se detectó la presencia de aflatoxina B1, en una concentración de 0.47ng/cm³. Estos resultados deberían ser tenidos en cuenta por los responsables de la vigilancia y control de los alimentos en la Argentina.

  18. Abnormal Expressions of Age, RAGE, TGF- b1 and TGF- b1 Receptor in Colonic Wall Contributed to STZ-Induced Diabetic Colon Remodeling

    DEFF Research Database (Denmark)

    Zhao, Jingbo; Gregersen, Hans

    2016-01-01

    glycation end product (AGE) and AGE receptor (RAGE) were up-regulated in the diabetic colon wall (2). However, it lacks data in relation to the association between AGE, RAGE, transforming growth factor- b1 (TGF-b1) and TGFb1 receptor expressions with colon morphological and biomechanical remodeling...... glucose level was measured. The parameters of morphometric and biomechanical properties of colonic segments were obtained from diabetic (DM) and normal (Con) rats. The expressions of AGE, RAGE, TGF- b1 and TGF- b1 receptor were detected in different layers of the colon by immunohistochemistry. In order...... to determine the expressions of AGE, RAGE, TGF- b1 and TGF- b1 receptor in association with other parameters, and to see interrelation among AGE, RAGE, TGF- b1 and TGF- b1 receptor expressions, the multiple linear regression analysis was done. Results: The expressions of AGE, RAGE, TGF-b1 and TGF- b1 receptor...

  19. Biochemical characterization of the GM2 gangliosidosis B1 variant

    Directory of Open Access Journals (Sweden)

    J.C. Tutor

    2004-06-01

    Full Text Available The deficiency of the A isoenzyme of ß-hexosaminidase (Hex produced by different mutations of the gene that codes for the alpha subunit (Tay-Sachs disease has two variants with enzymological differences: the B variant consists of the absence of Hex A isoenzyme and the B1 variant produces an inactive Hex A isoenzyme for the hydrolysis of the GM2 ganglioside and synthetic substrates with negative charge. In contrast to the early childhood form of the B variant, the B1 variant appears at a later clinical stage (3 to 7 years of age with neurodegenerative symptoms leading to the death of the patient in the second decade of life. The most frequent mutation responsible for the GM2 gangliosidosis B1 variant is R178H, which has a widespread geographic and ethnic distribution. The highest incidence has been described in Portugal, which has been suggested as the point of origin of this mutation. Biochemical characterization of this lysosomal disease is carried out using negatively charged synthetic alpha subunit-specific sulfated substrates, since Hex A isoenzyme heat-inactivation assays are not applicable. However, the determination of the apparent activation energy of Hex using the neutral substrate 3,3'-dichlorophenolsulfonphthaleinyl N-acetyl-ß-D-glucosaminide, may offer a valid alternative. The presence of an alpha subunit in the alphaß heterodimer Hex A means that its activation energy (41.8 kJ/mol is significantly lower than that of the ßß homodimer Hex B (75.1 kJ/mol; however, as mutation inactivates the alpha subunit, the Hex A of the B1 variant presents an activation energy that is similar to that of the Hex B isoenzyme.

  20. Rapid Immunoenzyme Assay of Aflatoxin B1 Using Magnetic Nanoparticles

    OpenAIRE

    Urusov, Alexandr E.; Alina V. Petrakova; Vozniak, Maxim V.; Zherdev, Anatoly V.; Boris B. Dzantiev

    2014-01-01

    The main limitations of microplate-based enzyme immunoassays are the prolonged incubations necessary to facilitate heterogeneous interactions, the complex matrix and poorly soluble antigens, and the significant sample dilutions often required because of the presence of organic extractants. This study presents the use of antibody immobilization on the surface of magnetic particles to overcome these limitations in the detection of the mycotoxin, aflatoxin B1. Features of the proposed system are...

  1. Occurrence of aflatoxin B1 in natural products

    OpenAIRE

    Guilherme Prado; Altoé, Aline F.; Tatiana C. B. Gomes; Leal, Alexandre S.; Morais, Vanessa A. D.; Marize S. Oliveira; Marli B. Ferreira; Gomes, Mateus B.; Fabiano N. Paschoal; Rafael von S. Souza; Daniela A. Silva; Cruz Madeira, Jovita E. G.

    2012-01-01

    The media claims for the consumption of natural resource-based food have gradually increased in both developing and developed countries. The interest in the safety of these products is partially due to the possible presence of toxigenic fungi acting as mycotoxin producers, such as aflatoxins produced during the secondary metabolism of Aspergillus flavus, A. parasiticus and A. nomius. Aflatoxins, mainly aflatoxin B1, are directly associated with liver cancer in human beings. This paper is aime...

  2. Improving MRI surface coil decoupling to reduce B1 distortion

    Science.gov (United States)

    Larson, Christian

    As clinical MRI systems continue to advance, larger focus is being given to image uniformity. Good image uniformity begins with generating uniform magnetic fields, which are easily distorted by induced currents on receive-only surface coils. It has become an industry standard to combat these induced currents by placing RF blocking networks on surface coils. This paper explores the effect of blocking network impedance of phased array surface coils on B1 distortion. It has been found and verified, that traditional approaches for blocking network design in complex phased arrays can leave undesirable B1 distortions at 3 Tesla. The traditional approach of LC tank blocking is explored, but shifts from the idea that higher impedance equals better B1 distortion at 3T. The result is a new design principle for a tank with a finite inductive reactance at the Larmor Frequency. The solution is demonstrated via simulation using a simple, single, large tuning loop. The same loop, along with a smaller loop, is used to derive the new design principle, which is then applied to a complex phased array structure.

  3. Wind tunel tests of Risoe-B1-18 and Risoe-B1-24

    Energy Technology Data Exchange (ETDEWEB)

    Fuglsang, P.; Bak, C.; Gaunaa, M.; Antoniou, I.

    2003-01-01

    This report contains 2D measurements of the Risoe-B1-18 and Risoe-B1-24 airfoils. The aerodynamic properties were derived from pressure measurements on the airfoil surface and in the wake. The measurements were conducted in the VELUX open jet wind tunnel, which has a background turbulence intensity of 1%, and an inlet flow velocity of 42 m/s. The airfoil sections had a chord of 0.600 m giving a Reynolds number of 1.6Oe106. The span was 1.9 m and end plates were used to minimize 3D flow effects. The measurements comprised both static and dynamic inflow. Static inflow covered angles of attack from 5o to 30 deg. Dynamic inflow was obtained by pitching the airfoil in a harmonic motion around various mean angles of attack. The test matrix involved smooth flow, various kinds of leading edge roughness, stall strips, vortex generators and Gurney flaps in different combinations. The quality of the measurements was good and the agreement between measurements and numerical CFD predictions with EllipSys2D was good. For both airfoils predictions with turbulent flow captured very well the shapes of lift and drag curves as well as the magnitude of maximum lift. Measurements of Risoe-B1-18 showed that the maximum lift coefficient was 1.64 at an angle of attack of approximately 13 deg. The airfoil was not very sensitive to leading edge roughness despite its high maximum lift. Measurements with stall strips showed that stall strips could control the level of maximum lift. The Risoe-B1-24 measurements showed that the maximum lift coefficient was 1.62 at an angle of attack of approximately 14 deg. The airfoil was only little sensitive to leading edge roughness despite its high relative thickness and high maximum lift. Measurements with delta wing shaped vortex generators increased the maximum lift coefficient to 2.02 and measurements with Gurney flaps increased the maximum lift coefficient to 1.85. Measurements with combination of vortex generators and Gurney flaps showed a maximum

  4. First observation of the hadronic transition $ \\Upsilon(4S) \\to \\eta h_{b}(1P)$ and new measurement of the $h_b(1P)$ and $\\eta_b(1S)$ parameters

    CERN Document Server

    Tamponi, U; Abdesselam, A; Aihara, H; Arinstein, K; Asner, D M; Atmacan, H; Aushev, T; Ayad, R; Badhrees, I; Bakich, A M; Barberio, E; Bhardwaj, V; Bhuyan, B; Biswal, J; Bondar, A; Bonvicini, G; Bozek, A; Bračko, M; Browder, T E; Červenkov, D; Chen, A; Cheon, B G; Cho, K; Chobanova, V; Choi, S -K; Choi, Y; Cinabro, D; Danilov, M; Doležal, Z; Drásal, Z; Drutskoy, A; Eidelman, S; Epifanov, D; Farhat, H; Fast, J E; Ferber, T; Fulsom, B G; Gaur, V; Gabyshev, N; Garmash, A; Getzkow, D; Gillard, R; Goh, Y M; Golob, B; Haba, J; Hayasaka, K; Hayashii, H; He, X H; Hedges, M T; Hou, W -S; Iijima, T; Inami, K; Ishikawa, A; Jaegle, I; Joffe, D; Julius, T; Kato, E; Katrenko, P; Kichimi, H; Kiesling, C; Kim, D Y; Kim, H J; Kim, J H; Kim, K T; Kim, S H; Kinoshita, K; Kodyš, P; Korpar, S; Križan, P; Krokovny, P; Kumita, T; Kuzmin, A; Lange, J S; Lewis, P; Libby, J; Lukin, P; Matvienko, D; Miyabayashi, K; Miyata, H; Mizuk, R; Mohanty, G B; Moll, A; Mori, T; Nakano, E; Nakao, M; Nanut, T; Natkaniec, Z; Nayak, M; Nisar, N K; Nishida, S; Ogawa, S; Okuno, S; Olsen, S L; Ostrowicz, W; Oswald, C; Pakhlova, G; Pal, B; Park, H; Pedlar, T K; Pesántez, L; Pestotnik, R; Petriřc, M; Piilonen, L E; Ribežl, E; Ritter, M; Rostomyan, A; Ryu, S; Sakai, Y; Sandilya, S; Santelj, L; Sanuki, T; Sato, Y; Savinov, V; Schneider, O; Schnell, G; Schwanda, C; Semmler, D; Senyo, K; Sevior, M E; Shapkin, M; Shebalin, V; Shen, C P; Shibata, T -A; Shiu, J -G; Shwartz, B; Sibidanov, A; Simon, F; Sohn, Y -S; Sokolov, A; Starič, M; Steder, M; Stypula, J; Tanida, K; Teramoto, Y; Trabelsi, K; Uchida, M; Uglov, T; Unno, Y; Uno, S; Urquijo, P; Van Hulse, C; Vanhoefer, P; Varner, G; Vinokurova, A; Vossen, A; Wagner, M N; Wang, M -Z; Wang, X L; Watanabe, Y; Williams, K M; Won, E; Yamaoka, J; Yashchenko, S; Zhang, Z P; Zhilich, V; Zhulanov, V; Zupanc, A

    2015-01-01

    Using a sample of $771.6 \\times 10^{6}$ $\\Upsilon(4S)$ decays collected by the Belle experiment at the KEKB $e^+e^-$ collider, we observe for the first time the transition $\\Upsilon(4S) \\to \\eta h_b(1P)$ with the branching fraction ${\\cal B}[\\Upsilon(4S) \\to \\eta h_b(1P)]= (2.18 \\pm 0.11 \\pm 0.18) \\times 10^{-3}$ and we measure the $h_b(1P)$ mass $M_{h_{b}(1P)} = (9899.3 \\pm 0.4 \\pm 1.0)$ MeV/$c^{2}$, corresponding to the hyperfine splitting $\\Delta M_{\\mathrm HF}(1P) = (0.6 \\pm 0.4 \\pm 1.0)$ MeV/$c^{2}$. Using the transition $h_b(1P) \\to \\gamma \\eta_b(1S)$, we measure the $\\eta_b(1S)$ mass $M_{\\eta_{b}(1S)} = (9400.7 \\pm 1.7 \\pm 1.6)$ MeV/$c^{2}$, corresponding to $\\Delta M_{\\mathrm HF}(1S) = (59.6 \\pm 1.7 \\pm 1.6)$ MeV/$c^{2}$, the $\\eta_b(1S)$ width $\\Gamma_{\\eta_{b}(1S)} = (8 ^{+6}_{-5} \\pm 5)$ MeV/$c^{2}$ and the branching fraction ${\\cal B}[h_b(1P) \\to \\gamma \\eta_b(1S)]= (56 \\pm 8 \\pm 4) \\%$.

  5. Reactor Physics

    Energy Technology Data Exchange (ETDEWEB)

    Ait Abderrahim, A

    2001-04-01

    The Reactor Physics and MYRRHA Department of SCK-CEN offers expertise in various areas of reactor physics, in particular in neutronics calculations, reactor dosimetry, reactor operation, reactor safety and control and non-destructive analysis of reactor fuel. This expertise is applied in the Department's own research projects in the VENUS critical facility, in the BR1 reactor and in the MYRRHA project (this project aims at designing a prototype Accelerator Driven System). Available expertise is also used in programmes external to the Department such as the reactor pressure steel vessel programme, the BR2 reactor dosimetry, and the preparation and interpretation of irradiation experiments by means of neutron and gamma calculations. The activities of the Fuzzy Logic and Intelligent Technologies in Nuclear Science programme cover several domains outside the department. Progress and achievements in these topical areas in 2000 are summarised.

  6. Reactor safeguards

    CERN Document Server

    Russell, Charles R

    2013-01-01

    Reactor Safeguards provides information for all who are interested in the subject of reactor safeguards. Much of the material is descriptive although some sections are written for the engineer or physicist directly concerned with hazards analysis or site selection problems. The book opens with an introductory chapter on radiation hazards, the construction of nuclear reactors, safety issues, and the operation of nuclear reactors. This is followed by separate chapters that discuss radioactive materials, reactor kinetics, control and safety systems, containment, safety features for water reactor

  7. Reactor operation

    CERN Document Server

    Shaw, J

    2013-01-01

    Reactor Operation covers the theoretical aspects and design information of nuclear reactors. This book is composed of nine chapters that also consider their control, calibration, and experimentation.The opening chapters present the general problems of reactor operation and the principles of reactor control and operation. The succeeding chapters deal with the instrumentation, start-up, pre-commissioning, and physical experiments of nuclear reactors. The remaining chapters are devoted to the control rod calibrations and temperature coefficient measurements in the reactor. These chapters also exp

  8. Determination of aflatoxin B1 in medical herbs: interlaboratory study.

    Science.gov (United States)

    Arranz, Isabel; Sizoo, Eric; van Egmond, Hans; Kroeger, Katy; Legarda, Teresa M; Burdaspal, Pedro; Reif, Klaus; Stroka, Joerg

    2006-01-01

    A method was developed for the determination of aflatoxin B1 in medical herbs (senna pods, botanical name Cassia angustifolia; devil's claw, botanical name Harpagophytum procumbens; and ginger roots, botanical name Zingiber officinale). The method, which was tested in a mini-collaborative study by 4 laboratories, is based on an immunoaffinity cleanup followed by reversed-phase high-performance liquid chromatography separation and fluorescence detection after post-column derivatization. It allows the quantitation of aflatoxin B1 at levels lower than 2 ng/g. A second extractant (acetone-water) was tested and compared to the proposed methanol-water extractant. Several post-column derivatization options (electrochemically generated bromine, photochemical reaction, and chemical bromination) as well as different integration modes (height versus area) were also investigated. No differences were found depending on the choice of derivatization system or the signal integration mode used. The method was tested for 3 different matrixes: senna pods, ginger root, and devil's claw. Performance characteristics were established from the results of the study and resulted in HorRat values ranging from 0.12 to 0.75 with mean recoveries from 78 to 91% for the extraction with methanol-water and HorRat values ranging from 0.10-1.03 with mean recoveries from 98 to 103% for the extraction with acetone-water. As a result, the method, with all tested variations, was found to be fit-for-purpose for the determination of aflatoxin B1 in medical herbs at levels of 1 microg/kg and above. PMID:16792057

  9. Systematic impact of spent nuclear fuel on θ13 sensitivity at reactor neutrino experiment

    Institute of Scientific and Technical Information of China (English)

    AN Feng-Peng; TIAN Xin-Chun; ZHAN Liang; CAO Jun

    2009-01-01

    Reactor neutrino oscillation experiments, such as Daya Bay, Double Chooz and RENO are designed to determine the neutrino mixing angle θ13 with a sensitivity of 0.01--0.03 in sin2 2θ13 at 90% confidence level, an improvement over the current limit by more than one order of magnitude. The control of systematic uncertainties is critical to achieving the sin2 2θ13 sensitivity goal of these experiments. Antineutrinos emitted from spent nuclear fuel (SNF) would distort the soft part of energy spectrum and may introduce a non-negligible systematic uncertainty. In this article, a detailed calculation of SNF neutrinos is performed taking account of the operation of a typical reactor and the event rate in the detector is obtained. A further estimation shows that the event rate contribution of SNF neutrinos is less than 0.2% relative to the reactor neutrino signals. A global χ2 analysis shows that this uncertainty will degrade the θ13 sensitivity at a negligible level.

  10. The CHESS survey of the L1157-B1 shock

    Science.gov (United States)

    Busquet, G.; Lefloch, B.; Benedettini, M.; Codella, C.; Cabrit, S.; Ceccarelli, C.; Vasta, M.; Viti, S.; Giannini, T.; Nisini, B.; Cernicharo, J.; Lorenzani, A.

    2012-03-01

    Outflows generated by protostars heavily affect the kinematics and chemistry of the hosting molecular cloud due to strong shocks. These shocks heats and compress the ambient dense gas switching on a complex chemistry that leads to an enhancement of the abundance of several species, as reported in ``chemically active'' outflows, whose archetype is the outflow of the low-mass Class 0 protostar L1157. We present the results of the spectral survey of the shock region L1157-B1 carried out with PACS, SPIRE and HIFI instruments in the framework of the Herschel key program CHESS. The high spectral resolution data from HIFI show that different excitation conditions coexist in the B1 shock while the high PACS spatial resolution data shows a different spatial distribution of the the detected specie. We will discuss the properties of the different gas components and present the physical conditions derived from different species. We will present a first comparison with shock models highlighting the complex structure of this shocked region.

  11. DELF B1 200 activités

    CERN Document Server

    Bloomfield, Anatole

    2006-01-01

    L'ouvrage est organisé par compétences de réception et de production. Chaque partie propose d'abord une présentation de l'épreuve correspondante, puis les activités de préparation suivies d'épreuves-types et d'une auto-évaluation. Dans le cadre d'une approche actionnelle, les activités fournissent les outils nécessaires à la préparation des examens. Elles donnent des exemples concrets répondant aux attentes des candidats comme à celle des examinateurs. LeNouveau DELF B1 propose des activités précises en vue d'atteindre les compétences nécessaires aux épreuves (oral, écrit, réception, production); sa simplicité et sa pédagogie en font une méthode complète. Dans la tradition de la collection Nouvel Entraînez-vous, cet ouvrage est pratique, didactique et se prête à une utilisation en autonomie ou en classe.Le niveau B1 dit " avancé " évalue un niveau de compétence où l'apprenant peut se considérer comme étant indépendant. Arrivé à ce stade, il est apte de comprendre l'inform...

  12. Screening and Initial Binding Assessment of Fumonisin B1 Aptamers

    Directory of Open Access Journals (Sweden)

    Maria C. DeRosa

    2010-11-01

    Full Text Available Fumonisins are mycotoxins produced by Fusarium verticillioides and F. proliferatum, fungi that are ubiquitous in corn (maize. Insect damage and some other environmental conditions result in the accumulation of fumonisins in corn-based products worldwide. Current methods of fumonisin detection rely on the use of immunoaffinity columns and high-performance liquid chromatography (HPLC. The use of aptamers offers a good alternative to the use of antibodies in fumonisin cleanup and detection due to lower costs and improved stability. Aptamers are single-stranded oligonucleotides that are selected using Systematic Evolution of Ligands by EXponential enrichment (SELEX for their ability to bind to targets with high affinity and specificity. Sequences obtained after 18 rounds of SELEX were screened for their ability to bind to fumonisin B1. Six unique sequences were obtained, each showing improved binding to fumonisin B1 compared to controls. Sequence FB1 39 binds to fumonisin with a dissociation constant of 100 ± 30 nM and shows potential for use in fumonisin biosensors and solid phase extraction columns.

  13. Rapid Immunoenzyme Assay of Aflatoxin B1 Using Magnetic Nanoparticles

    Directory of Open Access Journals (Sweden)

    Alexandr E. Urusov

    2014-11-01

    Full Text Available The main limitations of microplate-based enzyme immunoassays are the prolonged incubations necessary to facilitate heterogeneous interactions, the complex matrix and poorly soluble antigens, and the significant sample dilutions often required because of the presence of organic extractants. This study presents the use of antibody immobilization on the surface of magnetic particles to overcome these limitations in the detection of the mycotoxin, aflatoxin B1. Features of the proposed system are a high degree of nanoparticle dispersion and methodologically simple immobilization of the antibodies by adsorption. Reactions between the immobilized antibodies with native and labeled antigens are conducted in solution, thereby reducing the interaction period to 5 min without impairing the analytical outcome. Adsorption of immunoglobulins on the surface of magnetic nanoparticles increases their stability in aqueous-organic media, thus minimizing the degree of sample dilution required. Testing barley and maize extracts demonstrated a limit of aflatoxin B1 detection equal to 20 pg/mL and total assay duration of 20 min. Using this method, only the 3-fold dilution of the initial methanol/water (60/40 extraction mixture in the microplate wells is necessary. The proposed pseudo-homogeneous approach could be applied toward immunodetection of a wide range of compounds.

  14. Rapid immunoenzyme assay of aflatoxin B1 using magnetic nanoparticles.

    Science.gov (United States)

    Urusov, Alexandr E; Petrakova, Alina V; Vozniak, Maxim V; Zherdev, Anatoly V; Dzantiev, Boris B

    2014-01-01

    The main limitations of microplate-based enzyme immunoassays are the prolonged incubations necessary to facilitate heterogeneous interactions, the complex matrix and poorly soluble antigens, and the significant sample dilutions often required because of the presence of organic extractants. This study presents the use of antibody immobilization on the surface of magnetic particles to overcome these limitations in the detection of the mycotoxin, aflatoxin B1. Features of the proposed system are a high degree of nanoparticle dispersion and methodologically simple immobilization of the antibodies by adsorption. Reactions between the immobilized antibodies with native and labeled antigens are conducted in solution, thereby reducing the interaction period to 5 min without impairing the analytical outcome. Adsorption of immunoglobulins on the surface of magnetic nanoparticles increases their stability in aqueous-organic media, thus minimizing the degree of sample dilution required. Testing barley and maize extracts demonstrated a limit of aflatoxin B1 detection equal to 20 pg/mL and total assay duration of 20 min. Using this method, only the 3-fold dilution of the initial methanol/water (60/40) extraction mixture in the microplate wells is necessary. The proposed pseudo-homogeneous approach could be applied toward immunodetection of a wide range of compounds. PMID:25412219

  15. Research reactors

    International Nuclear Information System (INIS)

    This article proposes an overview of research reactors, i.e. nuclear reactors of less than 100 MW. Generally, these reactors are used as neutron generators for basic research in matter sciences and for technological research as a support to power reactors. The author proposes an overview of the general design of research reactors in terms of core size, of number of fissions, of neutron flow, of neutron space distribution. He outlines that this design is a compromise between a compact enough core, a sufficient experiment volume, and high enough power densities without affecting neutron performance or its experimental use. The author evokes the safety framework (same regulations as for power reactors, more constraining measures after Fukushima, international bodies). He presents the main characteristics and operation of the two families which represent almost all research reactors; firstly, heavy water reactors (photos, drawings and figures illustrate different examples); and secondly light water moderated and cooled reactors with a distinction between open core pool reactors like Melusine and Triton, pool reactors with containment, experimental fast breeder reactors (Rapsodie, the Russian BOR 60, the Chinese CEFR). The author describes the main uses of research reactors: basic research, applied and technological research, safety tests, production of radio-isotopes for medicine and industry, analysis of elements present under the form of traces at very low concentrations, non destructive testing, doping of silicon mono-crystalline ingots. The author then discusses the relationship between research reactors and non proliferation, and finally evokes perspectives (decrease of the number of research reactors in the world, the Jules Horowitz project)

  16. Reactor physics and reactor computations

    International Nuclear Information System (INIS)

    Mathematical methods and computer calculations for nuclear and thermonuclear reactor kinetics, reactor physics, neutron transport theory, core lattice parameters, waste treatment by transmutation, breeding, nuclear and thermonuclear fuels are the main interests of the conference

  17. First Observation of the Hadronic Transition ϒ(4S)→ηh(b)(1P) and New Measurement of the h(b)(1P) and η(b)(1S) Parameters.

    Science.gov (United States)

    Tamponi, U; Mussa, R; Abdesselam, A; Aihara, H; Arinstein, K; Asner, D M; Atmacan, H; Aushev, T; Ayad, R; Badhrees, I; Bakich, A M; Barberio, E; Bhardwaj, V; Bhuyan, B; Biswal, J; Bondar, A; Bonvicini, G; Bozek, A; Bračko, M; Browder, T E; Červenkov, D; Chen, A; Cheon, B G; Cho, K; Chobanova, V; Choi, S-K; Choi, Y; Cinabro, D; Danilov, M; Doležal, Z; Drásal, Z; Drutskoy, A; Eidelman, S; Epifanov, D; Farhat, H; Fast, J E; Ferber, T; Fulsom, B G; Gaur, V; Gabyshev, N; Garmash, A; Getzkow, D; Gillard, R; Goh, Y M; Golob, B; Haba, J; Hayasaka, K; Hayashii, H; He, X H; Hedges, M T; Hou, W-S; Iijima, T; Inami, K; Ishikawa, A; Jaegle, I; Joffe, D; Julius, T; Kato, E; Katrenko, P; Kichimi, H; Kiesling, C; Kim, D Y; Kim, H J; Kim, J H; Kim, K T; Kim, S H; Kinoshita, K; Kodyš, P; Korpar, S; Križan, P; Krokovny, P; Kumita, T; Kuzmin, A; Lange, J S; Lewis, P; Libby, J; Lukin, P; Matvienko, D; Miyabayashi, K; Miyata, H; Mizuk, R; Mohanty, G B; Moll, A; Mori, T; Nakano, E; Nakao, M; Nanut, T; Natkaniec, Z; Nayak, M; Nisar, N K; Nishida, S; Ogawa, S; Okuno, S; Olsen, S L; Ostrowicz, W; Oswald, C; Pakhlova, G; Pal, B; Park, H; Pedlar, T K; Pesántez, L; Pestotnik, R; Petrič, M; Piilonen, L E; Ribežl, E; Ritter, M; Rostomyan, A; Ryu, S; Sakai, Y; Sandilya, S; Santelj, L; Sanuki, T; Sato, Y; Savinov, V; Schneider, O; Schnell, G; Schwanda, C; Semmler, D; Senyo, K; Sevior, M E; Shapkin, M; Shebalin, V; Shen, C P; Shibata, T-A; Shiu, J-G; Shwartz, B; Sibidanov, A; Simon, F; Sohn, Y-S; Sokolov, A; Starič, M; Steder, M; Stypula, J; Tanida, K; Teramoto, Y; Trabelsi, K; Uchida, M; Uglov, T; Unno, Y; Uno, S; Urquijo, P; Van Hulse, C; Vanhoefer, P; Varner, G; Vinokurova, A; Vossen, A; Wagner, M N; Wang, M-Z; Wang, X L; Watanabe, Y; Williams, K M; Won, E; Yamaoka, J; Yashchenko, S; Zhang, Z P; Zhilich, V; Zhulanov, V; Zupanc, A

    2015-10-01

    Using a sample of 771.6×10(6) ϒϒ(4S) decays collected by the Belle experiment at the KEKB e(+)e(-) collider, we observe, for the first time, the transition ϒ(4S)→ηh(b)(1P) with the branching fraction B[ϒ(4S)→ηh(b)(1P)]=(2.18±0.11±0.18)×10(-3) and we measure the h(b)(1P) mass M(h(b)(1P))=(9899.3±0.4±1.0)  MeV/c(2), corresponding to the hyperfine (HF) splitting ΔM(HF)(1P)=(0.6±0.4±1.0)  MeV/c(2). Using the transition h(b)(1P)→γη(b)(1S), we measure the η(b)(1S) mass M(η(b)(1S))=(9400.7±1.7±1.6)  MeV/c(2), corresponding to ΔM(HF)(1S)=(59.6±1.7±1.6)  MeV/c(2), the η(b)(1S) width Γ(η(b)(1S))=(8(-5)(+6)±5)  MeV/c(2) and the branching fraction B[h(b)(1P)→γη(b)(1S)]=(56±8±4)%. PMID:26551806

  18. Predominant porB1A and porB1B genotypes and correlation of gene mutations with drug resistance in Neisseria gonorrhoeae isolates in Eastern China

    Directory of Open Access Journals (Sweden)

    Tang Renxian

    2010-11-01

    Full Text Available Abstract Background Variations of porB1A and porB1B genes and their serotypes exist in Neisseria gonorrhoeae isolates from different geographical areas, and some site mutations in the porB1B gene correlate with drug resistance. Methods The β-lactamase production of N. gonorrhoeae isolates was determined by paper acidometric test and nitrocefin discs. The porB1A and porB1B genes of 315 non-penicillinase-producting N. gonorrhoeae (non-PPNG strains were amplified by PCR for sequencing to determine serotypes and site mutations. A duplex PCR was designed to simultaneously detect both porB1A and porB1B genes. Penicillin and tetracycline resistance was assessed by an in vitro drug sensitivity test. Results Of the N. gonorrhoeae isolates, 31.1% tested positive for porB1A and 68.9% for porB1B genes. All the 98 porB1A+ isolates belonging to IA6 serotype with either no mutation at the 120 and 121 sites (88.8% or a D120G (11.2% mutation and were no resistance to both penicillin and tetracycline. Among the 217 porB1B+ isolates, 26.7%, 22.6% and 11.5% belonged to IB3, IB3/6 and IB4 serotypes, respectively. Particularly, two novel chimeric serotypes, IB3/6-IB2 and IB2-IB4-IB2, were found in 77 and 8 porB1B+ isolates. Two hundred and twelve (97.7% of the porB1B+ isolates were presented G120 and/or A121 mutations with 163 (76.9% at both sites. Interestingly, within the 77 porB1B+ isolates belonging to IB3/6-IB2 serotype, 15 were discovered to possess novel deletions at both A121 and N122 sites. All the replacement mutations at these sites in PorB1B were correlated with resistance and the deletion mutation showed the highest resistance. Conclusion N. gonorrhoeae isolates circulating in Eastern China include a sole PorB1A serotype (IA6 and five PorB1B serotypes. Multiple mutations in porB1B genes, including novel A121 and N122 deletions, are correlated with high levels of penicillin and tetracycline resistance.

  19. Fumonisin B1 and the kidney: modes of action for renal tumor formation by fumonisin B1 in rodents.

    Science.gov (United States)

    Müller, Stephanie; Dekant, Wolfgang; Mally, Angela

    2012-10-01

    The mycotoxin fumonisin B1 (FB1) is an important contaminant of maize and maize-based products. In rodent toxicity studies, FB1 was shown to be hepato- and nephrotoxic, and to induce renal tumors in rats when administered via the diet. Of particular note are the aggressive growth characteristics of FB1-induced tumors with a high potential to metastasize. While genotoxicity does not appear to contribute to FB1 carcinogenicity, it is well established that FB1-mediated disruption of sphingolipid metabolism plays a key role in FB1 toxicity. This review provides an overview on human dietary exposure to FB1, FB1 toxicity and carcinogenicity, and potential mechanisms involved in FB1-mediated tumor formation, with a particular focus on cellular functions of sphingolipids and biological consequences of FB1-mediated perturbation of sphingolipid metabolism. PMID:22771819

  20. Generation and characterization of a Cyp4b1 null mouse and the role of CYP4B1 in the activation and toxicity of Ipomeanol.

    Science.gov (United States)

    Parkinson, Oliver T; Liggitt, H Denny; Rettie, Allan E; Kelly, Edward J

    2013-08-01

    4-Ipomeanol (IPO) is a prototypical pulmonary toxin that requires P450-mediated metabolic activation to reactive intermediates in order to elicit its toxic effects. CYP4B1 is a pulmonary enzyme that has been shown, in vitro, to have a high capacity for bioactivating IPO. In order to determine, unambiguously, the role of CYP4B1 in IPO bioactivation in vivo, we generated Cyp4b1 null mice following targeted disruption of the gene downstream of exon 1. Cyp4b1 (-/-) mice are viable and healthy, with no overt phenotype, and no evidence of compensatory upregulation of other P450 isoforms in any of the tissues examined. Pulmonary and renal microsomes prepared from male Cyp4b1 (-/-) mice exhibited no detectable expression of the protein and catalyzed the in vitro bioactivation of IPO at IPO (20mg/kg) to Cyp4b1 (+/+) mice resulted in characteristic lesions in the lung, and to a lesser extent in the kidney, which were completely absent in Cyp4b1 (-/-) mice. We conclude that CYP4B1 is a critical enzyme for the bioactivation of IPO in vivo and that the Cyp4b1 (-/-) mouse is a useful model for studying CYP4B1-dependent metabolism and toxicity. PMID:23748241

  1. Aflatoxin B1 in poultry: toxicology, metabolism and prevention.

    Science.gov (United States)

    Rawal, Sumit; Kim, Ji Eun; Coulombe, Roger

    2010-12-01

    Aflatoxins (AF) are ubiquitous in corn-based animal feed and causes hepatotoxic and hepatocarcinogenic effects. The most important AF in terms of toxic potency and occurrence is aflatoxin B1 (AFB1). Poultry, especially turkeys, are extremely sensitive to the toxic and carcinogenic action of AFB1, resulting in millions of dollars in annual losses to producers due to reduced growth rate, increased susceptibility to disease, reduced egg production and other adverse effects. The extreme sensitivity of turkeys and other poultry to AFB1 is associated with efficient hepatic cytochrome P450-mediated bioactivation and deficient detoxification by glutathione S-transferases (GST). Discerning the biochemical and molecular mechanisms of this extreme sensitivity of poultry to AFB1, will contribute in the development of novel strategies to increase aflatoxin resistance. Since AFB1 is an unavoidable contaminant of corn-based poultry feed, chemoprevention strategies aimed at reducing AFB1 toxicity in poultry and in other animals have been the subject of numerous studies. This brief review summarizes many of the key recent findings regarding the action of aflatoxins in poultry.

  2. Aflatoxin B1 transfer and metabolism in human placenta.

    Science.gov (United States)

    Partanen, Heidi A; El-Nezami, Hani S; Leppänen, Jukka M; Myllynen, Päivi K; Woodhouse, Heather J; Vähäkangas, Kirsi H

    2010-01-01

    Aflatoxin B1 (AFB1), a common dietary contaminant, is a major risk factor of hepatocellular carcinoma (HCC). Early onset of HCC in some countries in Africa and South-East Asia indicates the importance of early life exposure. Placenta is the primary route for various compounds, both nutrients and toxins, from the mother to the fetal circulation. Furthermore, placenta contains enzymes for xenobiotic metabolism. AFB1, AFB1-metabolites, and AFB1-albumin adducts have been detected in cord blood of babies after maternal exposure during pregnancy. However, the role that the placenta plays in the transfer and metabolism of AFB1 is not clear. In this study, placental transfer and metabolism of AFB1 were investigated in human placental perfusions and in in vitro studies. Eight human placentas were perfused with 0.5 or 5microM AFB1 for 2-4 h. In vitro incubations with placental microsomal and cytosolic proteins from eight additional placentas were also conducted. Our results from placental perfusions provide the first direct evidence of the actual transfer of AFB1 and its metabolism to aflatoxicol (AFL) by human placenta. In vitro incubations with placental cytosolic fraction confirmed the capacity of human placenta to form AFL. AFL was the only metabolite detected in both perfusions and in vitro incubations. Since AFL is less mutagenic, but putatively as carcinogenic as AFB1, the formation of AFL may not protect the fetus from the toxicity of AFB1.

  3. Genotoxicity of aflatoxin B1 and its ammonium derivatives.

    Science.gov (United States)

    Márquez Márquez, R; Tejada de Hernandez, I; Madrigal Bujaidar, E

    1995-01-01

    Aflatoxin (AF) B1 is a main contaminant in diverse agricultural products. In an attempt to reduce this problem and the hazards to human health, an AFB1 inactivating system with ammonia has been developed. In this work we evaluated the efficiency of the system in mice using micronucleus (MN) and sister chromatid exchange (SCE) analysis. Four groups of animals were fed for 8 weeks with a special diet mainly composed of maize: (1) uncontaminated; (2) uncontaminated/inactivated; (3) contaminated/inactivated; and (4) contaminated. We evaluated MN at weekly intervals in peripheral blood, and in weeks 4 and 8 SCE frequencies were quantified in bone marrow cells. The results shows that animals fed with AFB1 contaminated/inactivated maize had a 45% lower level of induced cytogenetic damage than those animals fed with AFB1 contaminated but not inactivated maize. A residual amount of AFB1 after the inactivating treatment and reconversion back to AFB1 in the organism may account for the remaining increased levels of SCE and MN.

  4. Regulation of nucleotide excision repair by nuclear lamin b1.

    Directory of Open Access Journals (Sweden)

    Veronika Butin-Israeli

    Full Text Available The nuclear lamins play important roles in the structural organization and function of the metazoan cell nucleus. Recent studies on B-type lamins identified a requirement for lamin B1 (LB1 in the regulation of cell proliferation in normal diploid cells. In order to further investigate the function of LB1 in proliferation, we disrupted its normal expression in U-2 OS human osteosarcoma and other tumor cell lines. Silencing LB1 expression induced G1 cell cycle arrest without significant apoptosis. The arrested cells are unable to mount a timely and effective response to DNA damage induced by UV irradiation. Several proteins involved in the detection and repair of UV damage by the nucleotide excision repair (NER pathway are down-regulated in LB1 silenced cells including DDB1, CSB and PCNA. We propose that LB1 regulates the DNA damage response to UV irradiation by modulating the expression of specific genes and activating persistent DNA damage signaling. Our findings are relevant to understanding the relationship between the loss of LB1 expression, DNA damage signaling, and replicative senescence.

  5. Phosphorous chemistry in the shocked region L1157 B1

    CERN Document Server

    Aota, Takuhiro

    2012-01-01

    We study the evolution of phosphorous-bearing species in one-dimensional C-shock models. We find that the abundances of P-bearing species depend sensitively on the elemental abundance of P in the gas phase and on the abundance of N atoms in the pre-shock gas. The observed abundance of PN and the non-detection of PO towards L1157 B1 are reproduced in C-shock models with shock velocity v=20km s-1 and pre-shock density n(H2) =10^4 - 10^5, if the elemental abundance of P in the gas phase is 10^-9 and the N-atom abundance is n(N)/nH - 10^-5 in the pre-shock gas. We also find that P-chemistry is sensitive to O- and N-chemistry, because N atoms are destroyed mainly by OH and NO. We identify the reactions of O-bearing and N-bearing species that significantly affect P chemistry.

  6. Reactor building

    International Nuclear Information System (INIS)

    The whole reactor building is accommodated in a shaft and is sealed level with the earth's surface by a building ceiling, which provides protection against penetration due to external effects. The building ceiling is supported on walls of the reactor building, which line the shaft and transfer the vertical components of forces to the foundations. The thickness of the walls is designed to withstand horizontal pressure waves in the floor. The building ceiling has an opening above the reactor, which must be closed by cover plates. Operating equipment for the reactor can be situated above the building ceiling. (orig./HP)

  7. The body vitamin B1 levels of rats fed a diet containing the minimum requirement of vitamin B1 is reduced by exercise.

    Science.gov (United States)

    Shibata, Katsumi; Fukuwatari, Tsutomu

    2013-01-01

    It is thought that increasing energy expenditure increases consumption of vitamin B1, leading to an increase in the requirement of vitamin B1. However, evidence supporting this hypothesis is lacking. To examine the hypothesis, initially, we determined the minimum requirement of vitamin B1 for weaning rats. We found that the minimum requirement of vitamin B1 for optimum growth of weaning rats was around 0.786 mg thiamin/kg diet. Next, rats fed a diet containing the minimum requirement of vitamin B1 were forced to swim until exhaustion. Concentrations of vitamin B1 in the blood and liver as well as urinary excretion of swimming rats decreased significantly compared with those of non-swimming rats (prats fed the diet containing a sufficient amount of vitamin B1 (4.720 mg thiamin/kg diet), vitamin B1 amounts in the blood, liver and urine were not affected by swimming. We clearly and firstly showed the reduction of body vitamin B1 following increases in energy expenditure. PMID:23727637

  8. PENGARUH KETEBALAN SUBSTRAT PADA FERMENTASI TEMPE TERHADAP KADAR VITAMIN B1 (THE INFLUENCE OF SUBSTRATE THICKNESS DURING TEMPE FERMENTATION ON VITAMINS B1 LEVEL

    Directory of Open Access Journals (Sweden)

    Fifi Retiaty

    2012-12-01

    Full Text Available ABSTRACT The level of vitamin B1 in tempe could be increased by modifying the surface of substrate during soybean fermentation. This research aimed to know the influence of substrate thickness during soybean fermentation into tempe to the levels of vitamin B1. The design of this research was completed randomized design with two replication. Vitamin B1 content was analyzed on raw soybeans, boiled soybeans, and tempe using spectrophotometer methods. The substrate thicknesses examined were 0.25 cm, 0.50 cm and 1.00cm. Vitamin B1 level on raw soybean was 0.7436 mg percent and on boiled soybean was 0.4898 mg percent, while in tempe with substrate thickness  0.25 cm, 0.50 cm and 1.00 cm, the vitamin B1 contents were 1.1413, 0.9044, and 0.7130 mg percent respectively. The thickness of tempe substrate affected on vitamin B1 content. A thinner substrate resulted on higher vitamin B1 level. Keywords: fermentation, tempe, vitamin B1   ABSTRAK Kadar vitamin B1 pada tempe dapat ditingkatkan dengan memodifikasi permukaan dari substrat dalam fermentasi kedelai. Tujuan penelitian ini adalah untuk mengetahui pengaruh ketebalan substrat pada fermentasi kedelai menjadi tempe terhadap kadar vitamin B1. Disain penelitian ini adalah Rancangan Acak Lengkap dengan dua kali ulangan. Kadar vitamin B1 dianalisis pada kedelai mentah, kedelai rebus, dan tempe dengan menggunakan metode spektrofotometri. Ketebalan substrat yang diteliti adalah 0.25 cm, 0,50 cm, 1,00 cm. Kadar vitamin B1 pada  kedelai mentah adalah 0,7436 mg persen dan pada kedelai rebus adalah 0.4898 mg persen. Sedangkan kadar vitamin B1 pada tempe dengan ketebalan 0,25, 0,5 dan 1 cm secara berturut-turut adalah 1,1413 mg persen , 0,9044 mg persen dan 0,7130 mg persen. Ketebalan substar tempe berpengaruh pada kandungan vitamin B1. Semakin tipis substrat, akan menghasilkan vitamin B1 yang semakin tinggi. [Penel Gizi Makan 2012, 35(2: 182-188]   Kata Kunci: fermentasi, tempe, vitamin B1

  9. Co-expression of CYP27B1 enzyme with the 1.5kb CYP27B1 promoter-luciferase transgene in the mouse.

    Science.gov (United States)

    Anderson, Paul H; Hendrix, Ivanka; Sawyer, Rebecca K; Zarrinkalam, Reza; Manavis, Jim; Sarvestani, Ghafar T; May, Brian K; Morris, Howard A

    2008-03-26

    The renal enzyme 25-hydroxyvitamin D 1alpha-hydroxylase (CYP27B1), responsible for the synthesis of circulating. 1,25-dihydroxyvitamin D (1,25D), is also expressed in a number of non-renal tissues. The regulation of CYP27B1 expression by the short flanking promoter outside the kidney is, however, largely unknown. We have used a transgenic mice expressing the 1.5kb promoter of the human CYP27B1 gene fused to the firefly luciferase gene in order to investigate tissue-specific CYP27B1 expression. These transgenic animals demonstrated co-localised luciferase and endogenous CYP27B1 expression in kidney proximal convoluted tubular cells. Strong co-expression of luciferase and CYP27B1 also occurred in neurons and Purkinje cells of the cerebellum and in Leydig and Sertoli cells of the testes. Other tissues to exhibit CYP27B1-promoter directed luciferase activity included lung, prostate, trabecular bone and jejunum as well as the choroid epithelium. The tissue specific changes in luciferase activity were age-related. These findings demonstrate that the proximal 1.5kb 5' flanking region of the CYP27B1 gene directs the expression of CYP27B1 in a number of known and novel tissues in a specific manner. PMID:18313834

  10. Fumonisin B1 facilitates seizures induced by pentylenetetrazol in mice.

    Science.gov (United States)

    Poersch, Alice Bertotto; Trombetta, Francielle; Souto, Naiéli Schiefelbein; de Oliveira Lima, Camilla; Braga, Ana Cláudia Monteiro; Dobrachinski, Fernando; Ribeiro, Leandro Rodrigo; Soares, Félix Alexandre Antunes; Fighera, Michele Rechia; Royes, Luiz Fernando Freire; Oliveira, Mauro Schneider; Furian, Ana Flávia

    2015-01-01

    Fumonisin B1 (FB1) is a Fusarium spp. mycotoxin which constitutes a major public health issue because of its worldwide distribution and diversity of toxic effects.While the liver and kidney are considered the major target organs of FB1 toxicity in several species, evidence indicates that FB1 may be toxic to the brain. To further investigate the effects of FB1 on the central nervous system the present study aimed to test the hypothesis that acute FB1 exposure causes brain hyperexcitability and the potential underlying mechanisms. For these purposes, adult male C57BL/6 mice were injected with FB1 (8 mg/kg, i.p.) or its vehicle and 30 min thereafter received with a low dose of the classical convulsant pentylenetetrazol (PTZ, 30 mg/kg, i.p.) or its vehicle. After behavioral evaluation the cerebral cortex and the hippocampus were collected for analysis of Na(+),K(+)-ATPase activity, mitochondrial membrane potential (ΔΨm) and mitochondrial complex I and II activities. We found that FB1 reduced the latency for PTZ-induced myoclonic jerks and increased the number of these events. After exposure to FB1 total and α1 Na(+),K(+)-ATPase activities increased in cerebral cortex, whereas the same enzyme activities decreased in the hippocampus. Although no changes in mitochondrial complex I and II activities were found, acute exposure to FB1 increased ΔΨm in the cerebral cortex. Altogether, present results indicate that FB1 causes brain hyperexcitability in vivo, and that mitochondrial dysfunction may represent a potential underlying mechanism. PMID:26342287

  11. Aflatoxin B1 Degradation by a Pseudomonas Strain

    Science.gov (United States)

    Sangare, Lancine; Zhao, Yueju; Folly, Yawa Minnie Elodie; Chang, Jinghua; Li, Jinhan; Selvaraj, Jonathan Nimal; Xing, Fuguo; Zhou, Lu; Wang, Yan; Liu, Yang

    2014-01-01

    Aflatoxin B1 (AFB1), one of the most potent naturally occurring mutagens and carcinogens, causes significant threats to the food industry and animal production. In this study, 25 bacteria isolates were collected from grain kernels and soils displaying AFB1 reduction activity. Based on its degradation effectiveness, isolate N17-1 was selected for further characterization and identified as Pseudomonas aeruginosa. P. aeruginosa N17-1 could degrade AFB1, AFB2 and AFM1 by 82.8%, 46.8% and 31.9% after incubation in Nutrient Broth (NB) medium at 37 °C for 72 h, respectively. The culture supernatant of isolate N17-1 degraded AFB1 effectively, whereas the viable cells and intra cell extracts were far less effective. Factors influencing AFB1 degradation by the culture supernatant were investigated. Maximum degradation was observed at 55 °C. Ions Mn2+ and Cu2+ were activators for AFB1 degradation, however, ions Mg2+, Li+, Zn2+, Se2+, Fe3+ were strong inhibitors. Treatments with proteinase K and proteinase K plus SDS significantly reduced the degradation activity of the culture supernatant. No degradation products were observed based on preliminary LC-QTOF/MS analysis, indicating AFB1 was metabolized to degradation products with chemical properties different from that of AFB1. The results indicated that the degradation of AFB1 by P. aeruginosa N17-1 was enzymatic and could have a great potential in industrial applications. This is the first report indicating that the isolate of P. aeruginosa possesses the ability to degrade aflatoxin. PMID:25341538

  12. Aflatoxin B1 is toxic to porcine oocyte maturation.

    Science.gov (United States)

    Liu, Jun; Wang, Qiao-Chu; Han, Jun; Xiong, Bo; Sun, Shao-Chen

    2015-07-01

    As a toxic secondary metabolite of Aspergillus species, Aflatoxin B1 (AFB1) is a major food and feed contaminant in tropical and sub-tropical regions with high temperature and humidity. It has been reported to be toxic to the female reproductive system in laboratory and domestic animals. In the present study, the influence of acute exposure to AFB1 (10 and 50 μM, 44h) on porcine oocyte maturation and its possible mechanism were investigated. The maturation rates of oocytes decreased significantly in the presence of 50 μM of AFB1. Cell cycle analysis showed that most oocytes were arrested at germinal vesicle breakdown or meosis I stage. However, actin assembly, spindle structure and chromosome alignment were not disrupted after exposure to 50 μM AFB1. Further study showed that DNA methylation levels increased in treated oocytes (50 μM). Histone methylation levels were also analysed after treatment (50 μM): H3K27me3 and H3K4me2 levels decreased, whereas H3K9me3 level increased, indicating that epigenetic modification was affected. AFB1 treatment (50 μM) also induced oxidative stress and further led to autophagy, as shown by accumulation of reactive oxygen species, up-regulated LC3 protein expression and increased mRNA levels of ATG3, ATG5 and ATG7. Annexin V-FITC staining assay revealed that AFB1 treatment (50 μM) resulted in oocyte early apoptosis, which was confirmed by increased Bak, Bax, Bcl-xl mRNA levels. Collectively, our results suggest that AFB1 disrupts porcine oocyte maturation through changing epigenetic modifications as well as inducing oxidative stress, excessive autophagy and apoptosis.

  13. AFLATOXIN B1 RESIDUES IN EGGS AND FLESH OF LAYING HENS FED AFLATOXIN B1 CONTAMINATED DIET

    Directory of Open Access Journals (Sweden)

    Saqer Mohammad Herzallah

    2013-01-01

    Full Text Available Aflatoxin B1(AFB1 and total Aflatoxins (AFT contaminated feed effect on aflatoxins residue level in eggs, muscles (breast, leg, organs (liver, kidney, gizzard and excreted aflatoxins in chicken litter of layer hens were monitored. Laying hens were on four levels of aflatoxins for 6 weeks and monitored weekly for the change in both AFB1 and AFT levels. Pronouncedly, the AFB1 and AFT were detected in eggs, muscles (legs, breast, organs (liver, kidney and gizzard and litter in noticeable amounts. Total Aflatoxin (AFT level was lowest in chicken breast (0.63 ppb and highest in liver (2.12 ppb and gizzard (1.22 ppb of chicken fed diet with 965.12 ppb. Whereas, AFB1 residue was 0.66 ppb in eggs, 1.59 ppb in liver tissues of hens given feed contaminated with 894.12 ppb. Residue level of AFB1 was high in liver and kidney of all treatments. The chicken breast tissues were lowest in AFB1 and AFT of values 0.72 and 0.63, respectively. Eggs production was significantly (p<0.05 affected with AFB1 contaminated feed and egg production was decreased by more than 30%.

  14. 17 CFR 270.57b-1 - Exemption for downstream affiliates of business development companies.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Exemption for downstream affiliates of business development companies. 270.57b-1 Section 270.57b-1 Commodity and Securities Exchanges....57b-1 Exemption for downstream affiliates of business development companies....

  15. 26 CFR 1.263(b)-1 - Expenditures for advertising or promotion of good will.

    Science.gov (United States)

    2010-04-01

    ... good will. 1.263(b)-1 Section 1.263(b)-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Items Not Deductible § 1.263(b)-1 Expenditures for... section 733 or section 451 of the Internal Revenue Code of 1939, in computing its excess profits...

  16. Strain background modifies phenotypes in the ATP8B1-deficient mouse

    NARCIS (Netherlands)

    S. Shah; U.R. Sanford; J.C. Vargas; H. Xu; A. Groen; C.C. Paulusma; J.P. Grenert; L. Pawlikowska; S. Sen; R.P.J. Oude Elferink; L.N. Bull

    2010-01-01

    BACKGROUND: Mutations in ATP8B1 (FIC1) underlie cases of cholestatic disease, ranging from chronic and progressive (progressive familial intrahepatic cholestasis) to intermittent (benign recurrent intrahepatic cholestasis). The ATP8B1-deficient mouse serves as an animal model of human ATP8B1 deficie

  17. EphB1 Suppression in Acute Myelogenous Leukemia : Regulating the DNA Damage Control System

    NARCIS (Netherlands)

    Kampen, K. R.; Scherpen, F. J. G.; Garcia-Manero, G.; Yang, H.; Kaspers, G. J. L.; Cloos, J.; Zwaan, C. M.; van den Heuvel-Eibrink, M. M.; Kornblau, S. M.; De Bont, E. S. J. M.

    2015-01-01

    Loss of ephrin receptor (EphB1) expression may associate with aggressive cancer phenotypes; however, the mechanism of action remains unclear. To gain detailed insight into EphB1 function in acute myelogenous leukemia (AML), comprehensive analysis of EphB1 transcriptional regulation was conducted. In

  18. 26 CFR 48.4062(b)-1 - Rebuilt parts or accessories sold on an exchange basis.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 16 2010-04-01 2010-04-01 true Rebuilt parts or accessories sold on an exchange basis. 48.4062(b)-1 Section 48.4062(b)-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE..., Tires, Tubes, Tread Rubber, and Taxable Fuel Automotive and Related Items § 48.4062(b)-1 Rebuilt...

  19. 22 CFR 9b.1 - Press access to the Department of State.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Press access to the Department of State. 9b.1 Section 9b.1 Foreign Relations DEPARTMENT OF STATE GENERAL REGULATIONS GOVERNING DEPARTMENT OF STATE PRESS BUILDING PASSES § 9b.1 Press access to the Department of State. (a) Media correspondents without...

  20. Proteasomal degradation of human CYP1B1: effect of the Asn453Ser polymorphism on the post-translational regulation of CYP1B1 expression.

    Science.gov (United States)

    Bandiera, Silvio; Weidlich, Simone; Harth, Volker; Broede, Peter; Ko, Yun; Friedberg, Thomas

    2005-02-01

    Allelic variations in CYP1B1 are reported to modulate the incidence of several types of cancer. To provide a mechanistic basis for this association, we investigated the impact of nonsilent allelic changes on the intracellular levels and post-translational regulation of CYP1B1 protein. When transiently expressed in COS-1 cells, either in the presence or absence of recombinant cytochrome P450 reductase, the cellular level of the CYP1B1.4 allelic variant (containing a Ser at the amino acid position 453; Ser453) was 2-fold lower compared with the other four allelic CYP1B1 proteins (containing Asn453), as analyzed by both immunoblotting and ethoxyresorufin O-deethylase activity. This difference was caused by post-translational regulation; as in the presence of cycloheximide, the rate of degradation of immunodetectable and enzymatically active CYP1B1.4 was distinctly faster than that of CYP1B1.1. Pulse-chase analysis revealed that the half-life of CYP1B1.4 was a mere 1.6 h compared with 4.8 h for CYP1B1.1. The presence of the proteasome inhibitor MG132 [N-benzoyloxycarbonyl (Z)-Leu-Leuleucinal] increased the stability not only of immunodetectable CYP1B1, but also--unexpectedly given the size of the proteasome access channel--increased the stability of enzymatically active CYP1B1. The data presented herein also demonstrate that CYP1B1 is targeted for its polymorphism-dependent degradation by polyubiquitination but not phosphorylation. Our results importantly provide a mechanism to explain the recently reported lower incidence of endometrial cancer in individuals carrying the CYP1B1*4 compared with the CYP1B1*1 haplo-type. In addition, the mechanistic paradigms revealed herein may explain the strong overexpression of CYP1B1 in tumors compared with nondiseased tissues. PMID:15486049

  1. Compact Reactor

    International Nuclear Information System (INIS)

    Weyl's Gauge Principle of 1929 has been used to establish Weyl's Quantum Principle (WQP) that requires that the Weyl scale factor should be unity. It has been shown that the WQP requires the following: quantum mechanics must be used to determine system states; the electrostatic potential must be non-singular and quantified; interactions between particles with different electric charges (i.e. electron and proton) do not obey Newton's Third Law at sub-nuclear separations, and nuclear particles may be much different than expected using the standard model. The above WQP requirements lead to a potential fusion reactor wherein deuterium nuclei are preferentially fused into helium nuclei. Because the deuterium nuclei are preferentially fused into helium nuclei at temperatures and energies lower than specified by the standard model there is no harmful radiation as a byproduct of this fusion process. Therefore, a reactor using this reaction does not need any shielding to contain such radiation. The energy released from each reaction and the absence of shielding makes the deuterium-plus-deuterium-to-helium (DDH) reactor very compact when compared to other reactors, both fission and fusion types. Moreover, the potential energy output per reactor weight and the absence of harmful radiation makes the DDH reactor an ideal candidate for space power. The logic is summarized by which the WQP requires the above conditions that make the prediction of DDH possible. The details of the DDH reaction will be presented along with the specifics of why the DDH reactor may be made to cause two deuterium nuclei to preferentially fuse to a helium nucleus. The presentation will also indicate the calculations needed to predict the reactor temperature as a function of fuel loading, reactor size, and desired output and will include the progress achieved to date

  2. CYP1B1 expression, a potential risk factor for breast cancer

    Energy Technology Data Exchange (ETDEWEB)

    Goth-Goldstein, Regine; Erdmann, Christine A.; Russell, Marion

    2001-05-31

    CYP1B1 expression in non-tumor breast tissue from breast cancer patients and cancer-free individuals was determined to test the hypothesis that high CYP1B1 expression is a risk factor for breast cancer. Large interindividual variations in CYP1B1 expression were found with CYP1B1 levels notably higher in breast cancer patients than cancer-free individuals. The results indicate that CYP1B1 might play a role in breast cancer either through increased PAH activation or through metabolism of endogenous estrogen to a carcinogenic derivative.

  3. Neuronal SH2B1 is essential for controlling energy and glucose homeostasis

    OpenAIRE

    Ren, Decheng; Zhou, Yingjiang; Morris, David; Li, Minghua; Li, Zhiqin; Rui, Liangyou

    2007-01-01

    SH2B1 (previously named SH2-B), a cytoplasmic adaptor protein, binds via its Src homology 2 (SH2) domain to a variety of protein tyrosine kinases, including JAK2 and the insulin receptor. SH2B1-deficient mice are obese and diabetic. Here we demonstrated that multiple isoforms of SH2B1 (α, β, γ, and/or δ) were expressed in numerous tissues, including the brain, hypothalamus, liver, muscle, adipose tissue, heart, and pancreas. Rat SH2B1β was specifically expressed in neural tissue in SH2B1-tran...

  4. Dependence of B1+ and B1− Field Patterns of Surface Coils on the Electrical Properties of the Sample and the MR Operating Frequency

    Science.gov (United States)

    Vaidya, Manushka V.; Collins, Christopher M.; Sodickson, Daniel K.; Brown, Ryan; Wiggins, Graham C.; Lattanzi, Riccardo

    2016-01-01

    In high field MRI, the spatial distribution of the radiofrequency magnetic (B1) field is usually affected by the presence of the sample. For hardware design and to aid interpretation of experimental results, it is important both to anticipate and to accurately simulate the behavior of these fields. Fields generated by a radiofrequency surface coil were simulated using dyadic Green’s functions, or experimentally measured over a range of frequencies inside an object whose electrical properties were varied to illustrate a variety of transmit (B1+) and receive (B1−) field patterns. In this work, we examine how changes in polarization of the field and interference of propagating waves in an object can affect the B1 spatial distribution. Results are explained conceptually using Maxwell’s equations and intuitive illustrations. We demonstrate that the electrical conductivity alters the spatial distribution of distinct polarized components of the field, causing “twisted” transmit and receive field patterns, and asymmetries between |B1+| and |B1−|. Additionally, interference patterns due to wavelength effects are observed at high field in samples with high relative permittivity and near-zero conductivity, but are not present in lossy samples due to the attenuation of propagating EM fields. This work provides a conceptual framework for understanding B1 spatial distributions for surface coils and can provide guidance for RF engineers.

  5. NEUTRONIC REACTOR

    Science.gov (United States)

    Anderson, H.L.

    1960-09-20

    A nuclear reactor is described comprising fissionable material dispersed in graphite blocks, helium filling the voids of the blocks and the spaces therebetween, and means other than the helium in thermal conductive contact with the graphite for removing heat.

  6. NUCLEAR REACTOR

    Science.gov (United States)

    Miller, H.I.; Smith, R.C.

    1958-01-21

    This patent relates to nuclear reactors of the type which use a liquid fuel, such as a solution of uranyl sulfate in ordinary water which acts as the moderator. The reactor is comprised of a spherical vessel having a diameter of about 12 inches substantially surrounded by a reflector of beryllium oxide. Conventionnl control rods and safety rods are operated in slots in the reflector outside the vessel to control the operation of the reactor. An additional means for increasing the safety factor of the reactor by raising the ratio of delayed neutrons to prompt neutrons, is provided and consists of a soluble sulfate salt of beryllium dissolved in the liquid fuel in the proper proportion to obtain the result desired.

  7. Chemical Reactors.

    Science.gov (United States)

    Kenney, C. N.

    1980-01-01

    Describes a course, including content, reading list, and presentation on chemical reactors at Cambridge University, England. A brief comparison of chemical engineering education between the United States and England is also given. (JN)

  8. NUCLEAR REACTOR

    Science.gov (United States)

    Anderson, C.R.

    1962-07-24

    A fluidized bed nuclear reactor and a method of operating such a reactor are described. In the design means are provided for flowing a liquid moderator upwardly through the center of a bed of pellets of a nentron-fissionable material at such a rate as to obtain particulate fluidization while constraining the lower pontion of the bed into a conical shape. A smooth circulation of particles rising in the center and falling at the outside of the bed is thereby established. (AEC)

  9. Nuclear reactor

    International Nuclear Information System (INIS)

    In order to reduce neutron embrittlement of the pressue vessel of an LWR, blanked off elements are fitted at the edge of the reactor core, with the same dimensions as the fuel elements. They are parallel to each other, and to the edge of the reactor taking the place of fuel rods, and are plates of neutron-absorbing material (stainless steel, boron steel, borated Al). (HP)

  10. Heat shock protein B1-deficient mice display impaired wound healing.

    Directory of Open Access Journals (Sweden)

    Jonathan Crowe

    Full Text Available There is large literature describing in vitro experiments on heat shock protein (hspB1 but understanding of its function in vivo is limited to studies in mice overexpressing human hspB1 protein. Experiments in cells have shown that hspB1 has chaperone activity, a cytoprotective role, regulates inflammatory gene expression, and drives cell proliferation. To investigate the function of the protein in vivo we generated hspB1-deficient mice. HspB1-deficient fibroblasts display increased expression of the pro-inflammatory cytokine, interleukin-6, compared to wild-type cells, but reduced proliferation. HspB1-deficient fibroblasts exhibit reduced entry into S phase and increased expression of cyclin-dependent kinase inhibitors p27(kip1 and p21(waf1. The expression of hspB1 protein and mRNA is also controlled by the cell cycle. To investigate the physiological function of hspB1 in regulating inflammation and cell proliferation we used an excisional cutaneous wound healing model. There was a significant impairment in the rate of healing of wounds in hspB1-deficient mice, characterised by reduced re-epithelialisation and collagen deposition but also increased inflammation. HspB1 deficiency augments neutrophil infiltration in wounds, driven by increased chemokine (C-X-C motif ligand 1 expression. This appears to be a general mechanism as similar results were obtained in the air-pouch and peritonitis models of acute inflammation.

  11. Optimisation of Liquid Phase Separation on an Aflatoxin B1 Radioimmunoassay Kit

    International Nuclear Information System (INIS)

    Aflatoxins are secondary metabolites of Aspergillus flavus and A. parasiticus, which grow on a wide variety of food, feeds and their products. Aflatoxin, particularly aflatoxin B1 (AfB1) has wide biological activities including toxic, teratogenic, mutagenic and carcinogenic. Therefore the AfB1 content in foods should be met the requirement of food safety standard. Radioimmunoassay (RIA) technique is one of immunochemical methods or immunoassays which has been considered to be sensitive, specific, accurate and practical for detection of aflatoxin. This technique is based on immunological reaction using radioactive tracer. AfB1 was indirectly radiolabelled and then purified by using a solvent extraction. The tracer was then undergone a immunological testing by using a polyclonal antibody of AfB1. In order to produce AfB1 RIA kit which meets the standard quality’s requirement there are two parameters that have to be optimised. First is optimisation of kit components which consist : standard AfB1, AfB1 tracer (125I-AfB1) and AfB1 antibody. (author)

  12. Radiative transition probabilities for the B 1PI - X 1SIGMA+ and B 1PI - A 1SIGMA+ of 7LiH

    International Nuclear Information System (INIS)

    The recently reported (J. Chem. Phys. 66, 5412 (1977)) hybrid potential curves for the X 1Σ+ and A 1Σ+ states of LiH and the herein reported hybrid potential curve for the B 1Pi state of LiH are combined with the ab initio transition moments of Docken and Hinze (J. Chem. Phys. 57, 4936 (1972)) to calculate radiative transition probabilities between all B 1Pi (v' less than or equal to 2) and all X 1Σ+ (v'' less than or equal to 23) and A 1Σ+ (v'' less than or equal to 26) vibrational levels of 7LiH. The strongest single emission band found is the B 1Pi (v' = 2) → X 1Σ+ (v'' = 23) band between the highest ''long-range'' levels in each potential. For all B 1Pi levels, the emission is dominated by B → X rather than B → A emission

  13. NOAA Climate Data Record (CDR) of Gridded Satellite Data from ISCCP B1 (GridSat-B1) Infrared Channel Brightness Temperature, Version 2

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The Gridded Satellite (GridSat-B1) data provides a uniform set of quality controlled geostationary satellite observations for the visible, infrared window and...

  14. Cell stress promotes the association of phosphorylated HspB1 with F-actin.

    Directory of Open Access Journals (Sweden)

    Joseph P Clarke

    Full Text Available Previous studies have suggested that the small heat shock protein, HspB1, has a direct influence on the dynamics of cytoskeletal elements, in particular, filamentous actin (F-actin polymerization. In this study we have assessed the influence of HspB1 phosphorylation on its interaction(s with F-actin. We first determined the distribution of endogenous non-phosphorylated HspB1, phosphorylated HspB1 and F-actin in neuroendocrine PC12 cells by immunocytochemistry and confocal microscopy. We then investigated a potential direct interaction between HspB1 with F-actin by precipitating F-actin directly with biotinylated phalloidin followed by Western analyses; the reverse immunoprecipitation of HspB1 was also carried out. The phosphorylation influence of HspB1 in this interaction was investigated by using pharmacologic inhibition of p38 MAPK. In control cells, HspB1 interacts with F-actin as a predominantly non-phosphorylated protein, but subsequent to stress there is a redistribution of HspB1 to the cytoskeletal fraction and a significantly increased association of pHspB1 with F-actin. Our data demonstrate HspB1 is found in a complex with F-actin both in phosphorylated and non-phosphorylated forms, with an increased association of pHspB1 with F-actin after heat stress. Overall, our study combines both cellular and biochemical approaches to show cellular localization and direct demonstration of an interaction between endogenous HspB1 and F-actin using methodolgy that specifically isolates F-actin.

  15. Evidence for the eta_b(2S) and observation of h_b(1P) -> eta_b(1S) gamma and h_b(2P) -> eta_b(1S) gamma

    CERN Document Server

    Mizuk, R; Bondar, A; Pedlar, T K; Adachi, I; Aihara, H; Arinstein, K; Aulchenko, V; Aushev, T; Aziz, T; Bakich, A M; Bay, A; Belous, K; Bhardwaj, V; Bhuyan, B; Bischofberger, M; Bonvicini, G; Bozek, A; Bračko, M; Browder, T E; Chekelian, V; Chen, A; Chen, P; Cheon, B G; Chilikin, K; Chistov, R; Cho, I -S; Cho, K; Choi, S -K; Choi, Y; Dalseno, J; Danilov, M; Doležal, Z; Drásal, Z; Drutskoy, A; Eidelman, S; Epifanov, D; Fast, J E; Gaur, V; Gabyshev, N; Garmash, A; Golob, B; Haba, J; Hara, T; Hayasaka, K; Hayashii, H; Horii, Y; Hoshi, Y; Hou, W -S; Hsiung, Y B; Hyun, H J; Iijima, T; Ishikawa, A; Itoh, R; Iwabuchi, M; Iwasaki, Y; Iwashita, T; Jaegle, I; Julius, T; Kang, J H; Kapusta, P; Kawasaki, T; Kim, H J; Kim, H O; Kim, J H; Kim, K T; Kim, M J; Kim, Y J; Kinoshita, K; Ko, B R; Koblitz, S; Kodyš, P; Korpar, S; Kouzes, R T; Križan, P; Krokovny, P; Kuhr, T; Kumita, T; Kuzmin, A; Kwon, Y -J; Lange, J S; Lee, S -H; Li, J; Libby, J; Liu, C; Liu, Y; Liu, Z Q; Liventsev, D; Louvot, R; Matvienko, D; McOnie, S; Miyabayashi, K; Miyata, H; Mohanty, G B; Mohapatra, D; Moll, A; Muramatsu, N; Mussa, R; Nakao, M; Natkaniec, Z; Ng, C; Nishida, S; Nishimura, K; Nitoh, O; Nozaki, T; Ohshima, T; Okuno, S; Olsen, S L; Onuki, Y; Pakhlov, P; Pakhlova, G; Park, C W; Park, H; Pestotnik, R; Petrič, M; Piilonen, L E; Poluektov, A; Röhrken, M; Sakai, Y; Sandilya, S; Santel, D; Sanuki, T; Sato, Y; Schneider, O; Schwanda, C; Senyo, K; Seon, O; Sevior, M E; Shapkin, M; Shen, C P; Shibata, T -A; Shiu, J -G; Shwartz, B; Sibidanov, A; Simon, F; Smerkol, P; Sohn, Y -S; Sokolov, A; Solovieva, E; Stanič, S; Starič, M; Sumihama, M; Sumiyoshi, T; Tanida, K; Tatishvili, G; Teramoto, Y; Tikhomirov, I; Trabelsi, K; Tsuboyama, T; Uchida, M; Uehara, S; Uglov, T; Unno, Y; Uno, S; Vanhoefer, P; Varner, G; Varvell, K E; Vinokurova, A; Vorobyev, V; Wang, C H; Wang, M -Z; Wang, P; Wang, X L; Watanabe, M; Watanabe, Y; Williams, K M; Won, E; Yabsley, B D; Yamaoka, J; Yamashita, Y; Yuan, C Z; Zhang, Z P; Zhilich, V

    2012-01-01

    We report the first evidence for the eta_b(2S) using the h_b(2P)->eta_b(2S)gamma transition and the first observation of the h_b(1P)->eta_b(1S)gamma and h_b(2P)->eta_b(1S)gamma transitions. The mass and width of the eta_b(1S) and eta_b(2S) are measured to be m_etab(1S)=(9402.4+-1.5+-1.8)MeV/c^2, m_etab(2S)=(9999.0+-3.5 +2.8-1.9)MeV/c^2 and Gamma_etab(1S)=(10.8 +4.0-3.7 +4.5-2.0)MeV. We also update the h_b(1P) and h_b(2P) mass measurements. We use a 133.4/fb data sample collected at energies near the Upsilon(5S) resonance with the Belle detector at the KEKB asymmetric-energy e+e- collider.

  16. Metabolism of aflatoxin B1 and identification of the major aflatoxin B1-DNA adducts formed in cultured human bronchus and colon

    DEFF Research Database (Denmark)

    1979-01-01

    Aflatoxin B1 and benzo(a)pyrene were activated by both cultured human bronchus and human colon as measured by binding to cellular DNA and protein. The binding of aflatoxin B1 to DNA was dose dependent, and the level of binding was higher in cultured human bronchus than it was in the colon. When...... compared to aflatoxin B1, the binding level of benzo(a)pyrene to both bronchial and colonic DNA was generally higher. The major adducts formed in both tissues by the interaction of aflatoxin B1 and DNA were chromatographically identical to 2,3-dihydro-2-(N7-guanyl)-3-hydroxyaflatoxin B1 (Structure 1...... in these two peaks, and the ratio of radioactivity between the peaks was nearly 1. In colonic DNA, the ratio between Structures 1 and 11 was approximately 2. These observations add aflatoxin B1 to the list of chemical procarcinogens metabolized by cultured human tissues and in which the carcinogen-DNA adducts...

  17. Montelukast Disposition: No Indication of Transporter-Mediated Uptake in OATP2B1 and OATP1B1 Expressing HEK293 Cells

    Directory of Open Access Journals (Sweden)

    Marie Brännström

    2015-12-01

    Full Text Available Clinical studies with montelukast show variability in effect and polymorphic OATP2B1-dependent absorption has previously been implicated as a possible cause. This claim has been challenged with conflicting data and here we used OATP2B1-transfected HEK293 cells to clarify the mechanisms involved. For montelukast, no significant difference in cell uptake between HEK-OATP2B1 and empty vector cell lines was observed at pH 6.5 or pH 7.4, and no concentration-dependent uptake was detected. Montelukast is a carboxylic acid, a relatively potent inhibitor of OATP1B1, OATP1B3, and OATP2B1, and has previously been postulated to be actively transported into human hepatocytes. Using OATP1B1-transfected HEK293 cells and primary human hepatocytes in the presence of OATP inhibitors we demonstrate for the first time that active OATP-dependent transport is unlikely to play a significant role in the human disposition of montelukast.

  18. Montelukast Disposition: No Indication of Transporter-Mediated Uptake in OATP2B1 and OATP1B1 Expressing HEK293 Cells.

    Science.gov (United States)

    Brännström, Marie; Nordell, Pär; Bonn, Britta; Davis, Andrew M; Palmgren, Anna-Pia; Hilgendorf, Constanze; Rubin, Katarina; Grime, Ken

    2015-01-01

    Clinical studies with montelukast show variability in effect and polymorphic OATP2B1-dependent absorption has previously been implicated as a possible cause. This claim has been challenged with conflicting data and here we used OATP2B1-transfected HEK293 cells to clarify the mechanisms involved. For montelukast, no significant difference in cell uptake between HEK-OATP2B1 and empty vector cell lines was observed at pH 6.5 or pH 7.4, and no concentration-dependent uptake was detected. Montelukast is a carboxylic acid, a relatively potent inhibitor of OATP1B1, OATP1B3, and OATP2B1, and has previously been postulated to be actively transported into human hepatocytes. Using OATP1B1-transfected HEK293 cells and primary human hepatocytes in the presence of OATP inhibitors we demonstrate for the first time that active OATP-dependent transport is unlikely to play a significant role in the human disposition of montelukast. PMID:26694455

  19. Flavonoids exhibit diverse effects on CYP11B1 expression and cortisol synthesis

    Energy Technology Data Exchange (ETDEWEB)

    Cheng, Li-Chuan; Li, Lih-Ann, E-mail: lihann@nhri.org.tw

    2012-02-01

    CYP11B1 catalyzes the final step of cortisol biosynthesis. The effects of flavonoids on transcriptional expression and enzyme activity of CYP11B1 were investigated using the human adrenocortical H295R cell model. All tested nonhydroxylated flavones including 3′,4′-dimethoxyflavone, α-naphthoflavone, and β-naphthoflavone upregulated CYP11B1 expression and cortisol production, whereas apigenin and quercetin exhibited potent cytotoxicity and CYP11B1 repression at high concentrations. Nonhydroxylated flavones stimulated CYP11B1-catalyzed cortisol formation at transcriptional level. Resveratrol increased endogenous and substrate-supported cortisol production like nonhydroxylated flavones tested, but it had no effect on CYP11B1 gene expression and enzyme activity. Resveratrol appeared to alter cortisol biosynthesis at an earlier step. The Ad5 element situated in the − 121/− 106 region was required for basal and flavone-induced CYP11B1 expression. Overexpression of COUP-TFI did not improve the responsiveness of Ad5 to nonhydroxylated flavones. Although COUP-TFI overexpression increased CYP11B1 and CYP11B2 promoter activation, its effect was not mediated through the common Ad5 element. Treating cells with PD98059 (a flavone-type MEK1 inhibitor) increased CYP11B1 promoter activity, but not involving ERK signaling because phosphorylation of ERK1/2 remained unvarying throughout the course of treatment. Likewise, AhR was not responsible for the CYP11B1-modulating effects of flavonoids because inconsistency with their effects on AhR activation. 3′,4′-dimethoxyflavone and 8-Br-cAMP additively activated CYP11B1 promoter activity. H-89 reduced 3′,4′-dimethoxyflavone-induced CYP11B1 promoter activation but to a lesser extent as compared to its inhibition on cAMP-induced transactivation. Our data suggest that constant exposure to nonhydroxylated flavones raises a potential risk of high basal and cAMP-induced cortisol synthesis in consequence of increased CYP11B1

  20. 26 CFR 1.50B-1 - Definitions of WIN expenses and WIN employees.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 1 2010-04-01 2010-04-01 true Definitions of WIN expenses and WIN employees. 1.50B-1 Section 1.50B-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY INCOME TAX INCOME TAXES Rules for Computing Credit for Expenses of Work Incentive Programs § 1.50B-1 Definitions of WIN expenses and WIN employees. (a)...

  1. Apoptotic extinction of germ cells in testes of Cyp26b1 knockout mice.

    Science.gov (United States)

    MacLean, Glenn; Li, Hui; Metzger, Daniel; Chambon, Pierre; Petkovich, Martin

    2007-10-01

    Cyp26b1 encodes a retinoic acid (RA) metabolizing cytochrome P450 enzyme that is expressed in embryonic tissues undergoing morphogenesis, including the testes. We have generated transgenic mice lacking Cyp26b1 and have observed increased RA levels in embryonic testes. Cyp26b1(-/-) germ cells prematurely enter meiosis at embryonic d 13.5 and appear to arrest at pachytene stage. Furthermore, after embryonic d 13.5, a rapid increase in apoptosis is observed in male germ cells derived from Cyp26b1(-/-) embryos; germ cells are essentially absent in mutant male neonates. In contrast, testicular somatic cells appear to develop normally in the absence of Cyp26b1. Moreover, ovarian germ and somatic cells appear unaffected by the lack of CYP26B1. We also show that the synthetic retinoid Am580, which is resistant to CYP26 metabolism, induces meiosis of male germ cells in cultured gonads, suggesting that abnormal development of germ cells in the Cyp26b1(-/-) testes results from excess RA rather than the absence of CYP26B1-generated metabolites of RA. These results provide evidence that CYP26B1 maintains low levels of RA in the developing testes that blocks entry into meiosis and acts as a survival factor to prevent apoptosis of male germ cells.

  2. Ascorbate-Glutathione Cycle Alteration in Cadmium Sensitive Rice Mutant cadB-1

    Institute of Scientific and Technical Information of China (English)

    SHEN Guo-ming; ZHU Cheng; DU Qi-zhen; SHANGGUAN Li-na

    2012-01-01

    A rice cadmium (Cd) sensitive mutant cadB-1 was obtained using Agrobacterium tumefaciens mediated system.After exposure of cadB-1 and wild type (WT) rice seedlings to a range of Cd concentrations for 10 d,Cd accumulated to higher levels in roots,stems and leaves of both cadB-1 and WT with increasing external Cd concentrations,and the inhibition of seedling growth in cadB-1 was more serious than in WT.Hydrogen peroxide accumulation was higher in leaves and roots of cadB-1.The ratios of reduced glutathione (GSH)/oxidized glutathione (GSSG),ascorbate (ASC)/dehydroascorbate (DHA) and reduced nicotinamide adenine dinucleotide phosphate (NADPH)/oxidized nicotinamide adenine dinucleotide phosphate (NADP+) were lower in cadB-1 than in WT both in leaves and roots under high Cd levels.The activities of ascorbate peroxidase (APX),glutathione peroxidase (GR),dehydroascorbate reductase (DHAR) and monodehydroascorbate reductase (MDHAR) were also lower in cadB-1 than in WT both in leaves and roots under the treatment of high levels of Cd.Our results suggest that under Cd stress,the ASC-GSH cycle was more seriously inhibited in cadB-1 than in WT,indicating that the mutant cadB-1 is less able to scavenge reactive oxygen species and sensitive to Cd.

  3. Downregulation of kinin B1 receptor function by B2 receptor heterodimerization and signaling.

    Science.gov (United States)

    Zhang, Xianming; Brovkovych, Viktor; Zhang, Yongkang; Tan, Fulong; Skidgel, Randal A

    2015-01-01

    Signaling through the G protein-coupled kinin receptors B1 (kB1R) and B2 (kB2R) plays a critical role in inflammatory responses mediated by activation of the kallikrein-kinin system. The kB2R is constitutively expressed and rapidly desensitized in response to agonist whereas kB1R expression is upregulated by inflammatory stimuli and it is resistant to internalization and desensitization. Here we show that the kB1R heterodimerizes with kB2Rs in co-transfected HEK293 cells and natively expressing endothelial cells, resulting in significant internalization and desensitization of the kB1R response in cells pre-treated with kB2R agonist. However, pre-treatment of cells with kB1R agonist did not affect subsequent kB2R responses. Agonists of other G protein-coupled receptors (thrombin, lysophosphatidic acid) had no effect on a subsequent kB1R response. The loss of kB1R response after pretreatment with kB2R agonist was partially reversed with kB2R mutant Y129S, which blocks kB2R signaling without affecting endocytosis, or T342A, which signals like wild type but is not endocytosed. Co-endocytosis of the kB1R with kB2R was dependent on β-arrestin and clathrin-coated pits but not caveolae. The sorting pathway of kB1R and kB2R after endocytosis differed as recycling of kB1R to the cell surface was much slower than that of kB2R. In cytokine-treated human lung microvascular endothelial cells, pre-treatment with kB2R agonist inhibited kB1R-mediated increase in transendothelial electrical resistance (TER) caused by kB1R stimulation (to generate nitric oxide) and blocked the profound drop in TER caused by kB1R activation in the presence of pyrogallol (a superoxide generator). Thus, kB1R function can be downregulated by kB2R co-endocytosis and signaling, suggesting new approaches to control kB1R signaling in pathological conditions. PMID:25289859

  4. Plexin-B1 silencing inhibits ovarian cancer cell migration and invasion

    International Nuclear Information System (INIS)

    Elevated Plexin-B1 expression has been found in diverse human cancers and in non-neoplastic tissues, and it mediates diverse biological and pathological activities. However, whether or not Plexin-B1 expression is involved in human ovarian tumors remains unclear. In the present study, Plexin-B1 expression was explored in benign and malignant human ovarian tumor tissues. In addition, the impact of Plexin-B1 expression on ovarian cancer cell proliferation, migration and invasion were investigated in vitro. Plexin-B1 expression was analyzed in normal and benign ovarian tissues and serous ovarian tumors (both borderline and malignant) by immunohistochemical staining, as well as in four human ovarian cancer cell lines (A2780, C13*, SKOV3, and OV2008) by RT-PCR and western blot analyses. Furthermore, endogenous Plexin-B1 expression was suppressed by Plexin-B1 siRNA in SKOV3 cells, which overexpress Plexin-B1. Protein levels of Plexin-B1, AKT and AKTSer473 were examined by western blot analysis. Cell proliferation, migration and invasion were measured with MTT, wound healing and boyden chamber assays, respectively, and the cytoskeleton was monitored via F-actin staining. Expression levels of Plexin-B1 protein were significantly higher in serous ovarian carcinomas than in normal ovaries or benign ovarian neoplasms, and in the former, Plexin-B1 expression was positively correlated with lymphatic metastasis, and the membrane and cytoplasm of cancer cells stained positively. SKOV3 cells displayed the highest Plexin-B1 expression at both the mRNA and protein levels among the four tested human ovarian cancer cell lines and was selected as a cell model for further in vitro experiments. Plexin-B1 siRNA significantly suppressed phosphorylation of AKT at Ser473 in SKOV3 cells, but it did not alter total AKT expression. In addition, silencing of Plexin-B1 in SKOV3 cells inhibited cell migration and invasion and reorganized the cytoskeleton, whereas cell proliferation was not affected

  5. Targeting cyclin B1 inhibits proliferation and sensitizes breast cancer cells to taxol

    Directory of Open Access Journals (Sweden)

    Strebhardt Klaus

    2008-12-01

    Full Text Available Abstract Background Cyclin B1, the regulatory subunit of cyclin-dependent kinase 1 (Cdk1, is essential for the transition from G2 phase to mitosis. Cyclin B1 is very often found to be overexpressed in primary breast and cervical cancer cells as well as in cancer cell lines. Its expression is correlated with the malignancy of gynecological cancers. Methods In order to explore cyclin B1 as a potential target for gynecological cancer therapy, we studied the effect of small interfering RNA (siRNA on different gynecological cancer cell lines by monitoring their proliferation rate, cell cycle profile, protein expression and activity, apoptosis induction and colony formation. Tumor formation in vivo was examined using mouse xenograft models. Results Downregulation of cyclin B1 inhibited proliferation of several breast and cervical cancer cell lines including MCF-7, BT-474, SK-BR-3, MDA-MB-231 and HeLa. After combining cyclin B1 siRNA with taxol, we observed an increased apoptotic rate accompanied by an enhanced antiproliferative effect in breast cancer cells. Furthermore, control HeLa cells were progressively growing, whereas the tumor growth of HeLa cells pre-treated with cyclin B1 siRNA was strongly inhibited in nude mice, indicating that cyclin B1 is indispensable for tumor growth in vivo. Conclusion Our data support the notion of cyclin B1 being essential for survival and proliferation of gynecological cancer cells. Concordantly, knockdown of cyclin B1 inhibits proliferation in vitro as well as in vivo. Moreover, targeting cyclin B1 sensitizes breast cancer cells to taxol, suggesting that specific cyclin B1 targeting is an attractive strategy for the combination with conventionally used agents in gynecological cancer therapy.

  6. Global gene profiling of aging lungs in Atp8b1 mutant mice

    Science.gov (United States)

    Soundararajan, Ramani; Stearns, Timothy M.; Czachor, Alexander; Fukumoto, Jutaro; Turn, Christina; Westermann-Clark, Emma; Breitzig, Mason; Tan, Lee; Lockey, Richard F.; King, Benjamin L.; Kolliputi, Narasaiah

    2016-01-01

    Objective Recent studies implicate cardiolipin oxidation in several age-related diseases. Atp8b1 encoding Type 4 P-type ATPases is a cardiolipin transporter. Mutation in Atp8b1 gene or inflammation of the lungs impairs the capacity of Atp8b1 to clear cardiolipin from lung fluid. However, the link between Atp8b1 mutation and age-related gene alteration is unknown. Therefore, we investigated how Atp8b1 mutation alters age-related genes. Methods We performed Affymetrix gene profiling of lungs isolated from young (7-9 wks, n=6) and aged (14 months, 14 M, n=6) C57BL/6 and Atp8b1 mutant mice. In addition, Ingenuity Pathway Analysis (IPA) was performed. Differentially expressed genes were validated by quantitative real-time PCR (qRT-PCR). Results Global transcriptome analysis revealed 532 differentially expressed genes in Atp8b1 lungs, 157 differentially expressed genes in C57BL/6 lungs, and 37 overlapping genes. IPA of age-related genes in Atp8b1 lungs showed enrichment of Xenobiotic metabolism and Nrf2-mediated signaling pathways. The increase in Adamts2 and Mmp13 transcripts in aged Atp8b1 lungs was validated by qRT-PCR. Similarly, the decrease in Col1a1 and increase in Cxcr6 transcripts was confirmed in both Atp8b1 mutant and C57BL/6 lungs. Conclusion Based on transcriptome profiling, our study indicates that Atp8b1 mutant mice may be susceptible to age-related lung diseases. PMID:27689529

  7. Evidence for the h_b(1P) meson in the decay Upsilon(3S) --> pi0 h_b(1P)

    Energy Technology Data Exchange (ETDEWEB)

    Lees, J.P.

    2011-08-12

    Using a sample of 122 million {Upsilon}(3S) events recorded with the BABAR detector at the PEP-II asymmetric-energy e{sup +}e{sup -} collider at SLAC, we search for the h{sub b}(1P) spin-singlet partner of the P-wave {chi}{sub b}(1P) states in the sequential decay {Upsilon}(3S) {yields} {pi}{sup 0}h{sub b}(1P), h{sub b}(1P) {yields} {gamma}{eta}{sub b}(1S). We observe an excess of events above background in the distribution of the recoil mass against the {pi}{sup 0} at mass 9902 {+-} 4(stat.) {+-} 1(syst.) MeV/c{sup 2}. The width of the observed signal is consistent with experimental resolution, and its significance is 3.0 {sigma}, including systematic uncertainties. We obtain the value (3.7 {+-} 1.1 (stat.) {+-} 0.7 (syst.)) x 10{sup -4} for the product branching fraction {Beta}({Upsilon}(3S) {yields} {pi}{sup 0}h{sub b}) x {Beta}(h{sub b} {yields} {gamma}{eta}{sub b}).

  8. Observation of B+->b_1+K0 and search for B-meson decays to b_10K0 and b_1pi0

    CERN Document Server

    Aubert, B; Bóna, M; Karyotakis, Yu; Lees, J P; Poireau, V; Prencipe, E; Prudent, X; Tisserand, V; Garra Tico, J; Graugès-Pous, E; Lopezab, L; Palanoab, A; Pappagalloab, M; Eigen, G; Stugu, B; Sun, L; Abrams, G S; Battaglia, M; Brown, D N; Cahn, R N; Jacobsen, R G; Kerth, L T; Kolomensky, Yu G; Kukartsev, G; Lynch, G; Osipenkov, I L; Ronan, M T; Tackmann, K; Tanabé, T; Hawkes, C M; Soni, N; Watson, A T; Koch, H; Schröder, T; Walker, D; Asgeirsson, D J; Çuhadar-Dönszelmann, T; Fulsom, B G; Hearty, C; Mattison, T S; McKenna, J A; Barrett, M; Khan, A; Teodorescu, L; Blinov, V E; Bukin, A D; Buzykaev, A R; Druzhinin, V P; Golubev, V B; Onuchin, A P; Serednyakov, S I; Skovpen, Yu I; Solodov, E P; Todyshev, K Yu; Bondioli, M; Curry, S; Eschrich, I; Kirkby, D; Lankford, A J; Lund, P; Mandelkern, M; Martin, E C; Stoker, D P; Abachi, S; Buchanan, C; Gary, J W; Liu, F; Long, O; Shen, B C; Vitug, G M; Yasin, Z; Zhang, L; Sharma, V; Campagnari, C; Hong, T M; Kovalskyi, D; Mazur, M A; Richman, J D; Beck, T W; Eisner, A M; Flacco, C J; Heusch, C A; Kroseberg, J; Lockman, W S; Schalk, T; Schumm, B A; Seiden, A; Wang, L; Wilson, M G; Winstrom, L O; Cheng, C H; Doll, D A; Echenard, B; Fang, F; Hitlin, D G; Narsky, I; Piatenko, T; Porter, F C; Andreassen, R; Mancinelli, G; Meadows, B T; Mishra, K; Sokoloff, M D; Blanc, F; Bloom, P C; Clifton, Z C; Ford, W T; Gaz, A; Hirschauer, J F; Kreisel, A; Nagel, M; Nauenberg, U; Smith, J G; Ulmer, K A; Wagner, S R; Ayad, R; Soffer, A; Toki, W H; Wilson, R J; Altenburg, D D; Feltresi, E; Hauke, A; Jasper, H; Karbach, M; Merkel, J; Petzold, A; Spaan, B; Wacker, K; Kobel, M J; Mader, W F; Nogowski, R; Schubert, K R; Schwierz, R; Sundermann, J E; Volk, A; Bernard, D; Bonneaud, G R; Latour, E; Thiebaux, C; Verderi, M; Clark, P J; Gradl, W; Playfer, S; Watson, J E; Andreottiab, M; Bettonia, D; Bozzia, C; Calabreseab, R; Cecchiab, A; Cibinettoab, G; Franchiniab, P; Luppiab, E; Negriniab, M; Petrellaab, A; Piemontesea, L; Santoroab, V; Baldini-Ferroli, R; Calcaterra, A; De Sangro, R; Finocchiaro, G; Pacetti, S; Patteri, P; Peruzzi, I M; Piccolo, M; Rama, M; Zallo, A; Buzzoa, A; Contriab, R; Lo Vetereab, M; Macria, M M; Mongeab, M R; Passaggioa, S; Patrignaniab, C; Robuttia, E; Santroniab, A; Tosiab, S; Chaisanguanthum, K S; Morii, M; Dubitzky, R S; Marks, J; Schenk, S; Uwer, U; Klose, V; Lacker, H M; De Nardoab, G; Listaa, L; Monorchioab, D; Onoratoab, G; Sciaccaab, C; Bard, D J; Dauncey, P D; Nash, J A; Panduro-Vazquez, W; Tibbetts, M; Behera, P K; Chai, X; Charles, M J; Mallik, U; Cochran, J; Crawley, H B; Dong, L; Meyer, W T; Prell, S; Rosenberg, E I; Rubin, A E; Gao, Y Y; Gritsan, A V; Guo, Z J; Lae, C K; Denig, A G; Fritsch, M; Schott, G; Arnaud, N; Bquilleux, J; D'Orazio, A; Davier, M; Firminoda Costa, J; Grosdidier, G; Höcker, A; Lepeltier, V; Le Diberder, F; Lutz, A M; Pruvot, S; Roudeau, P; Schune, M H; Serrano, J; Sordini, V; Stocchi, A; Wormser, G; Lange, D J; Wright, D M; Bingham, I; Burke, J P; Chavez, C A; Fry, J R; Gabathuler, E; Gamet, R; Hutchcroft, D E; Payne, D J; Touramanis, C; Bevan, A J; George, K A; Di Lodovico, F; Sacco, R; Sigamani, M; Cowan, G; Flächer, H U; Hopkins, D A; Paramesvaran, S; Salvatore, F; Wren, A C; Brown, D N; Davis, C L; Alwyn, K E; Barlow, N R; Barlow, R J; Chia, Y M; Edgar, C L; Lafferty, G D; West, T J; Yi, J I; Anderson, J; Chen, C; Jawahery, A; Roberts, D A; Simi, G; Tuggle, J M; Dallapiccola, C; Hertzbach, S S; Li, X; Salvati, E; Saremi, S; Cowan, R; Dujmic, D; Fisher, P H; Koeneke, K; Sciolla, G; Spitznagel, M; Taylor, F; Yamamoto, R K; Zhao, M; Mclachlin, S E; Patel, P M; Robertson, S H; Lazzaroab, A; Lombardoa, V; Palomboab, F; Bauer, J M; Cremaldi, L; Eschenburg, V; Godang, R; Kroeger, R; Sanders, D A; Summers, D J; Zhao, H W; Simard, M; Taras, P; Viaud, F B; Nicholson, H; Baak, M A; Raven, G; Snoek, H L; Jessop, C P; Knoepfel, K J; LoSecco, J M; Wang, W F; Benelli, G; Corwin, L A; Honscheid, K; Kagan, H; Kass, R; Morris, J P; Rahimi, A M; Regensburger, J J; Sekula, S J; Wong, Q K; Blount, N L; Brau, J E; Frey, R; Igonkina, O; Kolb, J A; Lu, M; Rahmat, R; Sinev, N B; Strom, D; Strube, J; Torrence, E; Castelliab, G; Gagliardiab, N; Margoniab, M; Morandina, M; Posoccoa, M; Rotondoa, M; Simonettoab, F; Stroiliab, R; Vociab, C; Del Amo-Sánchez, P; Ben-Haim, E; Briand, H; Calderini, G; Chauveau, J; David, P; Del Buono, L; Hamon, O; Leruste, P; Ocariz, J; Pérez, A; Prendki, J; Gladney, L; Biasiniab, M; Covarelliab, R; Manoniab, E; Angeliniab, C; Batignaniab, G; Bettariniab, S; Carpinelliab, M; Cervelliab, A; Fortiab, F; Giorgiab, M A; Lusianiac, A; Marchioriab, G; Morgantiab, M; Neriab, N; Paoloniab, E; Rizzoab, G; Walsha, J J; Biesiada, J; Lopes-Pegna, D; Lü, C; Olsen, J; Smith, A J S; Telnov, A V; Anullia, F; Baracchiniab, E; Cavotoa, G; del Reab, D; Di Marcoab, E; Facciniab, R

    2008-01-01

    We present the results of searches for decays of B mesons to final states with a b_1 meson and a neutral pion or kaon. The data, collected with the BABAR detector at the Stanford Linear Accelerator Center, represent 465 million BBbar pairs produced in e+e- annihilation. The results for the branching fractions are, in units of 1e-6, BR(B+ to b_1+K0) = 9.6+/-1.7+/-0.9, BR(B0 to b_10K0) = 5.1+/-1.8+/-0.5 (<7.8), BR(B+ to b_1+pi0) = 1.8+/-0.9+/-0.2 (<3.3), and BR(B0 to b_10pi0) = 0.4+/-0.8+/-0.2 (<1.9), with the assumption that BR(B_1 to omega pi)=1. We also measure the charge asymmetry A_ch(B+ to b_1+K0) = -0.03+/-0.15+/-0.02. The first error quoted is statistical, the second systematic, and the upper limits in parentheses indicate the 90% confidence level.

  9. Measuring electron-impact cross sections of water: elastic scattering and electronic excitation of the ã3B1 and Ã1B1 states

    Science.gov (United States)

    Matsui, Midori; Hoshino, Masamitsu; Kato, Hidetoshi; Ferreira da Silva, Fillipe; Limão-Vieira, Paulo; Tanaka, Hiroshi

    2016-04-01

    Here, we report elastic differential cross sections (DCSs) for electron scattering from water in the incident energy range of 2-100 eV. Furthermore, we present a complete study on the electronic excitation of the ã3B1 and Ã1B1 states at electron impact energies of 15, 20, and 30 eV and in the scattering angle range of 10° - 130°. Integral cross sections (ICSs) are determined from the DCSs. Measuring elastic DCSs in various experimental conditions confirmed the reproducibility of the data. The present results agree with the data previously obtained from a conventional collimating tube gas source. Ambiguities associated with the unfolding procedure of the electron energy loss (EEL) spectra for the electronic excitations have been reduced by comparison against the EEL spectrum at high electron impact energy and for small scattering angle. The reliability of the extracted DCSs is improved significantly for optically forbidden contributions from the overlap of the ã3B1 and Ã1B1 electronic states. The BEf-scaling model is also confirmed to produce the integral cross section for the optical allowed transition of the Ã1B1 state in the intermediate electron energy region above 15 eV.

  10. Sonochemical Reactors.

    Science.gov (United States)

    Gogate, Parag R; Patil, Pankaj N

    2016-10-01

    Sonochemical reactors are based on the generation of cavitational events using ultrasound and offer immense potential for the intensification of physical and chemical processing applications. The present work presents a critical analysis of the underlying mechanisms for intensification, available reactor configurations and overview of the different applications exploited successfully, though mostly at laboratory scales. Guidelines have also been presented for optimum selection of the important operating parameters (frequency and intensity of irradiation, temperature and liquid physicochemical properties) as well as the geometric parameters (type of reactor configuration and the number/position of the transducers) so as to maximize the process intensification benefits. The key areas for future work so as to transform the successful technique at laboratory/pilot scale into commercial technology have also been discussed. Overall, it has been established that there is immense potential for sonochemical reactors for process intensification leading to greener processing and economic benefits. Combined efforts from a wide range of disciplines such as material science, physics, chemistry and chemical engineers are required to harness the benefits at commercial scale operation.

  11. UNC93B1 mediates host resistance to infection with Toxoplasma gondii.

    Directory of Open Access Journals (Sweden)

    Mariane B Melo

    Full Text Available UNC93B1 associates with Toll-Like Receptor (TLR 3, TLR7 and TLR9, mediating their translocation from the endoplasmic reticulum to the endolysosome, hence allowing proper activation by nucleic acid ligands. We found that the triple deficient '3d' mice, which lack functional UNC93B1, are hyper-susceptible to infection with Toxoplasma gondii. We established that while mounting a normal systemic pro-inflammatory response, i.e. producing abundant MCP-1, IL-6, TNFα and IFNγ, the 3d mice were unable to control parasite replication. Nevertheless, infection of reciprocal bone marrow chimeras between wild-type and 3d mice with T. gondii demonstrated a primary role of hemopoietic cell lineages in the enhanced susceptibility of UNC93B1 mutant mice. The protective role mediated by UNC93B1 to T. gondii infection was associated with impaired IL-12 responses and delayed IFNγ by spleen cells. Notably, in macrophages infected with T. gondii, UNC93B1 accumulates on the parasitophorous vacuole. Furthermore, upon in vitro infection the rate of tachyzoite replication was enhanced in non-activated macrophages carrying mutant UNC93B1 as compared to wild type gene. Strikingly, the role of UNC93B1 on intracellular parasite growth appears to be independent of TLR function. Altogether, our results reveal a critical role for UNC93B1 on induction of IL-12/IFNγ production as well as autonomous control of Toxoplasma replication by macrophages.

  12. 26 CFR 31.3302(b)-1 - Additional credit against tax.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 15 2010-04-01 2010-04-01 false Additional credit against tax. 31.3302(b)-1...) EMPLOYMENT TAXES AND COLLECTION OF INCOME TAX AT SOURCE EMPLOYMENT TAXES AND COLLECTION OF INCOME TAX AT SOURCE Federal Unemployment Tax Act (Chapter 23, Internal Revenue Code of 1954) § 31.3302(b)-1...

  13. 26 CFR 1.410(b)-1 - Minimum coverage requirements (before 1994).

    Science.gov (United States)

    2010-04-01

    ....410(b)-1(b)(2). (6) Integration with Social Security Act. See section 401(a)(5) and the regulations thereunder for rules relating to integration of plans with the Social Security Act. (7) Different age and... service. The plan can be shown not to satisfy the requirements of IRC section 410(b)(1)(A) as follows:...

  14. 26 CFR 1.802(b)-1 - Tax on life insurance companies.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 8 2010-04-01 2010-04-01 false Tax on life insurance companies. 1.802(b)-1...) INCOME TAX (CONTINUED) INCOME TAXES Life Insurance Companies § 1.802(b)-1 Tax on life insurance companies... August 16, 1954, section 802(b) imposes a tax on the 1954 life insurance company taxable income of...

  15. Construction and Virulence of Filamentous Hemagglutinin Protein B1 Mutant of Pasteurella multocida in Chickens

    Institute of Scientific and Technical Information of China (English)

    GUO Dong-chun; QU Lian-dong; SUN Yan; ZHANG Ai-qin; LIU Jia-sen; LU Yan; LIU Pei-xin; YUAN Dong-wei; JIANG Qian; SI Chang-de

    2014-01-01

    Pasteurella multocida, a Gram-negative nonmotile coccobacillus, is the causative agent of fowl cholera, bovine hemorrhagic septicemia, enzoonotic pneumonia and swine atropic rhinitis. Two iflamentous hemagglutinin genes, fhaB1 and fhaB2, are the potential virulence factors. In this study, an inactivation fhaB1 mutant of P. multocida in avian strain C48-102 was constructed by a kanamycin-resistance cassette. The virulence of the fhaB1 mutant and the wild type strain was assessed in chickens by intranasal and intramuscular challenge. The inactivation of fhaB1 resulted in a high degree of attenuation when the chickens were challenged intranasally and a lesser degree when challenged intramuscularly. The fhaB1 mutant and the wild type strain were investigated their sensitivity to the antibody-dependent classical complement-mediated killing pathway in 90%convalescent chicken serum. The fhaB1 mutant was serum sensitive as the viability has reduced between untreated serum and heat inactivated chicken serum (P<0.007). These results conifrmed that FhaB1 played the critical roles in the bacterial pathogenesis and further studies were needed to investigate the mechanism which caused reduced virulence of the fhaB1 mutant.

  16. 26 CFR 1.6050B-1 - Information returns by person making unemployment compensation payments.

    Science.gov (United States)

    2010-04-01

    ... unemployment compensation payments. 1.6050B-1 Section 1.6050B-1 Internal Revenue INTERNAL REVENUE SERVICE... Information returns by person making unemployment compensation payments. For taxable years beginning after December 31, 1978, every person who makes payments of unemployment compensation (as defined in section...

  17. The use of MR B+1 imaging for validation of FDTD electromagnetic simulations of human anatomies

    International Nuclear Information System (INIS)

    In this study, MR B+1 imaging is employed to experimentally verify the validity of FDTD simulations of electromagnetic field patterns in human anatomies. Measurements and FDTD simulations of the B+1 field induced by a 3 T MR body coil in a human corpse were performed. It was found that MR B+1 imaging is a sensitive method to measure the radiofrequency (RF) magnetic field inside a human anatomy with a precision of approximately 3.5%. A good correlation was found between the B+1 measurements and FDTD simulations. The measured B+1 pattern for a human pelvis consisted of a global, diagonal modulation pattern plus local B+1 heterogeneties. It is believed that these local B+1 field variations are the result of peaks in the induced electric currents, which could not be resolved by the FDTD simulations on a 5 mm3 simulation grid. The findings from this study demonstrate that B+1 imaging is a valuable experimental technique to gain more knowledge about the dielectric interaction of RF fields with the human anatomy

  18. 26 CFR 48.4161(b)-1 - Imposition and rates of tax; bows and arrows.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 16 2010-04-01 2010-04-01 true Imposition and rates of tax; bows and arrows. 48.4161(b)-1 Section 48.4161(b)-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) MISCELLANEOUS EXCISE TAXES MANUFACTURERS AND RETAILERS EXCISE TAXES Sporting Goods §...

  19. Preparation and application of new fluorescein-labeled fumonisins B1 in fluorescence polarization analysis technique

    Science.gov (United States)

    Objective: To prepare a new fluorescent tracer against common mycotoxins such as fumonisin B1 in order to replace 6-(4,6-Dichlorotriazinyl) aminofluorescein (6-DTAF), an expensive marker, and to develop a technique for quick detection of fumonisin B1 based on the principle of fluorescence polarizati...

  20. Data of evolutionary structure change: 1B1ZA-2NTSA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1B1ZA-2NTSA 1B1Z 2NTS A A DPDPSQLHRSSLVKNLQNIYFLYE-GDPVTHENVKSVDQ...ELDYKVRKYLTDNKQLYTN--------------GPSKYETGYIKFIPKNKESFWFDFF-PEPEFTQSKYLMIYKDNETLDSNTSQIEVYLTT-- ...ine> 2NTS A 2NTSA 2NTS A 2NTS.../line> PHE CA 274 2NTS A 2NTS

  1. Data of evolutionary structure change: 1B1ZC-2NTSA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1B1ZC-2NTSA 1B1Z 2NTS C A DPDPSQLHRSSLVKNLQNIYFLYE-GDPVTHENVKSVDQ...ELDYKVRKYLTDNKQLYTNG--------------PSKYETGYIKFIPKNKESFWFDFFP-EPEFTQSKYLMIYKDNETLDSNTSQIEVYLTT-- ...e>THR CA 392 2NTS A 2NTS...CA 343 LYS CA 296 2NTS A 2NTS...208 PHE CA 276 THR CA 304 2NTS

  2. Data of evolutionary structure change: 1B1ZD-2NTSA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1B1ZD-2NTSA 1B1Z 2NTS D A DPDPSQLHRSSLVKNLQNIYFLYE-GDPVTHENVKSVDQ...ELDYKVRKYLTDNKQLYT--------------NGPSKYETGYIKFIPKNKESFWFDFFP-EPEFTQSKYLMIYKDNETLDSNTSQIEVYLTT-- ...R CA 395 2NTS A 2NTS... LYS CA 294 2NTS A 2NTS...e>PHE CA 282 THR CA 304 2NTS

  3. Data of evolutionary structure change: 1B1ZB-2NTSA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1B1ZB-2NTSA 1B1Z 2NTS B A DPDPSQLHRSSLVKNLQNIYFLYE-GDPVTHENVKSVDQ...ELDYKVRKYLTDNKQLYT--------------NGPSKYETGYIKFIPKNKESFWFDFF-PEPEFTQSKYLMIYKDNETLDSNTSQIEVYLTT-- ...4 2NTS A 2NTSA 2NTS A 2NTSAPHE CA 283 2NTS A 2NTS

  4. 26 CFR 1.6038B-1 - Reporting of certain transfers to foreign corporations.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 13 2010-04-01 2010-04-01 false Reporting of certain transfers to foreign corporations. 1.6038B-1 Section 1.6038B-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY... either: (1) The transferor (or one or more successors) properly entered into a gain recognition...

  5. 26 CFR 48.6416(b)(1)-2 - Determination of price readjustments.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 16 2010-04-01 2010-04-01 true Determination of price readjustments. 48.6416(b)(1)-2 Section 48.6416(b)(1)-2 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY... models are introduced, or a general price reduction affecting articles held in stock by the vendee as...

  6. Sulfolobus Replication Factor C stimulates the activity of DNA Polymerase B1

    DEFF Research Database (Denmark)

    Xing, Xuanxuan; Zhang, Likui; Guo, Li;

    2014-01-01

    Replication factor C (RFC) is known to function in loading proliferating cell nuclear antigen (PCNA) onto primed DNA, allowing PCNA to tether DNA polymerase for highly processive DNA synthesis in eukaryotic and archaeal replication. In this report, we show that an RFC complex from the...... with the ability of RFC to facilitate DNA binding by PolB1 through protein-protein interaction. These results suggest that Sulfolobus RFC may play a role in recruiting DNA polymerase for efficient primer extension, in addition to clamp loading, during DNA replication....... hyperthermophilic archaea of the genus Sulfolobus physically interacts with DNA polymerase B1 (PolB1) and enhances both the polymerase and 3'-5' exonuclease activities of PolB1 in an ATP-independent manner. Stimulation of the PolB1 activity by RFC is independent of the ability of RFC to bind DNA but is consistent...

  7. Cyp26b1 within the growth plate regulates bone growth in juvenile mice

    Energy Technology Data Exchange (ETDEWEB)

    Minegishi, Yoshiki [Department of Cell Growth and Differentiation, Center for iPS Cell Research and Application, Kyoto University, 53 Kawahara-cho, Shogoin, Sakyo-ku, Kyoto 606-8507 (Japan); Department of Plastic and Reconstructive Surgery, University of Fukui Hospital, 23-3 Matsuokashimoaizuki, Eiheiji-cho, Yoshida-gun, Fukui 910-1193 (Japan); Department of Plastic Surgery, Osaka University Graduate School of Medicine, 2-2 Yamadaoka, Suita, Osaka 565-0871 (Japan); Sakai, Yasuo [Department of Plastic Surgery, Osaka University Graduate School of Medicine, 2-2 Yamadaoka, Suita, Osaka 565-0871 (Japan); Department of Plastic Surgery, Bellland General Hospital, 500-3 Higashiyama Naka-ku, Sakai, Osaka 599-8247 (Japan); Yahara, Yasuhito [Department of Cell Growth and Differentiation, Center for iPS Cell Research and Application, Kyoto University, 53 Kawahara-cho, Shogoin, Sakyo-ku, Kyoto 606-8507 (Japan); Akiyama, Haruhiko [Department of Orthopaedic Surgery, Gifu University Graduate School of Medicine, 1-1 Yanagito, Gifu 501-1194 (Japan); Yoshikawa, Hideki [Department of Orthopaedic Surgery, Osaka University Graduate School of Medicine, 2-2 Yamadaoka, Suita, Osaka 565-0871 (Japan); Hosokawa, Ko [Department of Plastic Surgery, Osaka University Graduate School of Medicine, 2-2 Yamadaoka, Suita, Osaka 565-0871 (Japan); Tsumaki, Noriyuki, E-mail: ntsumaki@cira.kyoto-u.ac.jp [Department of Cell Growth and Differentiation, Center for iPS Cell Research and Application, Kyoto University, 53 Kawahara-cho, Shogoin, Sakyo-ku, Kyoto 606-8507 (Japan); Japan Science and Technology Agency, CREST, Tokyo 102-0075 (Japan)

    2014-11-07

    Highlights: • Retinoic acid and Cyp26b1 were oppositely localized in growth plate cartilage. • Cyp26b1 deletion in chondrocytes decreased bone growth in juvenile mice. • Cyp26b1 deletion reduced chondrocyte proliferation and growth plate height. • Vitamin A-depletion partially reversed growth plate abnormalities caused by Cyp26b1 deficiency. • Cyp26b1 regulates bone growth by controlling chondrocyte proliferation. - Abstract: Retinoic acid (RA) is an active metabolite of vitamin A and plays important roles in embryonic development. CYP26 enzymes degrade RA and have specific expression patterns that produce a RA gradient, which regulates the patterning of various structures in the embryo. However, it has not been addressed whether a RA gradient also exists and functions in organs after birth. We found localized RA activities in the diaphyseal portion of the growth plate cartilage were associated with the specific expression of Cyp26b1 in the epiphyseal portion in juvenile mice. To disturb the distribution of RA, we generated mice lacking Cyp26b1 specifically in chondrocytes (Cyp26b1{sup Δchon} cKO). These mice showed reduced skeletal growth in the juvenile stage. Additionally, their growth plate cartilage showed decreased proliferation rates of proliferative chondrocytes, which was associated with a reduced height in the zone of proliferative chondrocytes, and closed focally by four weeks of age, while wild-type mouse growth plates never closed. Feeding the Cyp26b1 cKO mice a vitamin A-deficient diet partially reversed these abnormalities of the growth plate cartilage. These results collectively suggest that Cyp26b1 in the growth plate regulates the proliferation rates of chondrocytes and is responsible for the normal function of the growth plate and growing bones in juvenile mice, probably by limiting the RA distribution in the growth plate proliferating zone.

  8. Cyp26b1 within the growth plate regulates bone growth in juvenile mice

    International Nuclear Information System (INIS)

    Highlights: • Retinoic acid and Cyp26b1 were oppositely localized in growth plate cartilage. • Cyp26b1 deletion in chondrocytes decreased bone growth in juvenile mice. • Cyp26b1 deletion reduced chondrocyte proliferation and growth plate height. • Vitamin A-depletion partially reversed growth plate abnormalities caused by Cyp26b1 deficiency. • Cyp26b1 regulates bone growth by controlling chondrocyte proliferation. - Abstract: Retinoic acid (RA) is an active metabolite of vitamin A and plays important roles in embryonic development. CYP26 enzymes degrade RA and have specific expression patterns that produce a RA gradient, which regulates the patterning of various structures in the embryo. However, it has not been addressed whether a RA gradient also exists and functions in organs after birth. We found localized RA activities in the diaphyseal portion of the growth plate cartilage were associated with the specific expression of Cyp26b1 in the epiphyseal portion in juvenile mice. To disturb the distribution of RA, we generated mice lacking Cyp26b1 specifically in chondrocytes (Cyp26b1Δchon cKO). These mice showed reduced skeletal growth in the juvenile stage. Additionally, their growth plate cartilage showed decreased proliferation rates of proliferative chondrocytes, which was associated with a reduced height in the zone of proliferative chondrocytes, and closed focally by four weeks of age, while wild-type mouse growth plates never closed. Feeding the Cyp26b1 cKO mice a vitamin A-deficient diet partially reversed these abnormalities of the growth plate cartilage. These results collectively suggest that Cyp26b1 in the growth plate regulates the proliferation rates of chondrocytes and is responsible for the normal function of the growth plate and growing bones in juvenile mice, probably by limiting the RA distribution in the growth plate proliferating zone

  9. Structure-function relationships of the Mycobacterium tuberculosis transcription factor WhiB1.

    Directory of Open Access Journals (Sweden)

    Laura J Smith

    Full Text Available BACKGROUND: Members of the WhiB-like (Wbl protein family possess iron-sulfur clusters and are implicated in the regulation of developmental processes in Actinomycetes. Mycobacterium tuberculosis possesses seven Wbl proteins. The [4Fe-4S] cluster of M. tuberculosis WhiB1 is relatively insensitive to O(2 but very sensitive to nitric oxide (NO. Nitric oxide nitrosylates the WhiB1 iron-sulfur cluster and promotes DNA-binding; the apo-forms of WhiB1 also bind DNA. However, the molecular requirements for iron-sulfur cluster acquisition and for DNA-binding by WhiB1 are poorly characterized. METHODS AND FINDINGS: WhiB1 variants were created by site-directed mutagenesis and the abilities of the corresponding proteins to acquire an iron-sulfur cluster and/or bind to whiB1 promoter DNA were assessed. All four Cys residues (Cys9, 37, 40, and 46 in the N-terminal region of WhiB1 were required for incorporation of a [4Fe-4S] cluster, whereas a possible alternative cluster ligand Asp13 (by analogy with M. smegmatis WhiB2 was not. The C-terminal region of WhiB1 is predicted to house the DNA-binding domain of the protein consisting of a predicted β-turn ((58GVWGG(62 followed by two amino acid motifs ((72KRRN(75 and (78TKAR(81 that are conserved in WhiB1 proteins. Gly residues (Gly58, 61 and 62 in the β-turn and positively-charged residues (Lys72, Arg73, Arg74, Lys79 and Arg81 in the downstream conserved regions were required for binding of WhiB1 DNA. CONCLUSIONS: Site-directed mutagenesis of M. tuberculosis whiB1 and characterization of the corresponding proteins has been used to explore structure-function relationships of the NO-responsive transcription factor WhiB1. This showed that all four conserved Cys residues in the N-terminal region are required for incorporation of iron-sulfur clusters but not for DNA-binding. Analysis of variants with amino acid substitutions in the C-terminal region revealed the crucial roles played by a predicted β-turn and two

  10. Reactor container

    International Nuclear Information System (INIS)

    A reactor container has a suppression chamber partitioned by concrete side walls, a reactor pedestal and a diaphragm floor. A plurality of partitioning walls are disposed in circumferential direction each at an interval inside the suppression chamber, so that independent chambers in a state being divided into plurality are formed inside the suppression chamber. The partition walls are formed from the bottom portion of the suppression chamber up to the diaphragm floor to isolate pool water in a divided state. Operation platforms are formed above the suppression chamber and connected to an access port. Upon conducting maintenance, inspection or repairing, a pump is disposed in the independent chamber to transfer pool water therein to one or a plurality of other independent chambers to make it vacant. (I.N.)

  11. NEUTRONIC REACTORS

    Science.gov (United States)

    Anderson, J.B.

    1960-01-01

    A reactor is described which comprises a tank, a plurality of coaxial steel sleeves in the tank, a mass of water in the tank, and wire grids in abutting relationship within a plurality of elongated parallel channels within the steel sleeves, the wire being provided with a plurality of bends in the same plane forming adjacent parallel sections between bends, and the sections of adjacent grids being normally disposed relative to each other.

  12. Interaction of vitamin B1 with bovine serum albumin investigation using vitamin B1-selective electrode: potentiometric and molecular modeling study.

    Science.gov (United States)

    Hosseinzadeh, Reza; Khorsandi, Khatereh

    2016-09-01

    Vitamin B1 or thiamin is one of the B vitamins. All B vitamins help the body to convert food (carbohydrates) into fuel (glucose), which produces energy. The B vitamins are necessary for healthy skin, eyes, hair, and liver. It also could help the nervous system function properly, and is necessary for brain functions. Drug interactions with protein can affect the distribution of the drug and eliminate the drug in living systems. In this study, the binding of thiamine hydrochloride (vitamin B1) to bovine serum albumin (BSA) was evaluated using a new proposed vitamin B1 (thiamine)-selective membrane electrode under various experimental conditions, such as pH, ionic strength, and protein concentration; in addition molecular modeling was applied as well. The binding isotherms plotted based on potentiometric data and analyzed using the Wyman binding potential concept. The apparent binding constant was determined and used for the calculation of intrinsic Gibbs free energy of binding. According to the electrochemical and molecular docking results, it can be concluded that the hydrophobic interactions and hydrogen binding are major interactions between BSA and vitamin B1. PMID:26372107

  13. Interaction of vitamin B1 with bovine serum albumin investigation using vitamin B1-selective electrode: potentiometric and molecular modeling study.

    Science.gov (United States)

    Hosseinzadeh, Reza; Khorsandi, Khatereh

    2016-09-01

    Vitamin B1 or thiamin is one of the B vitamins. All B vitamins help the body to convert food (carbohydrates) into fuel (glucose), which produces energy. The B vitamins are necessary for healthy skin, eyes, hair, and liver. It also could help the nervous system function properly, and is necessary for brain functions. Drug interactions with protein can affect the distribution of the drug and eliminate the drug in living systems. In this study, the binding of thiamine hydrochloride (vitamin B1) to bovine serum albumin (BSA) was evaluated using a new proposed vitamin B1 (thiamine)-selective membrane electrode under various experimental conditions, such as pH, ionic strength, and protein concentration; in addition molecular modeling was applied as well. The binding isotherms plotted based on potentiometric data and analyzed using the Wyman binding potential concept. The apparent binding constant was determined and used for the calculation of intrinsic Gibbs free energy of binding. According to the electrochemical and molecular docking results, it can be concluded that the hydrophobic interactions and hydrogen binding are major interactions between BSA and vitamin B1.

  14. Drug-drug interactions between rosuvastatin and oral antidiabetic drugs occurring at the level of oatp1b1s

    NARCIS (Netherlands)

    Steeg, E. van de; Greupink, R.; Schreurs, M.; Nooijen, I.H.G.; Verhoeck, K.C.M.; Hanemaaijer, R.; Ripken, D.; Monshouwer, M.; Vlaming, M.L.H.; DeGroot, J.; Verwei, M.; Russel, F.G.M.; Huisman, M.T.; Wortelboer, H.M.

    2013-01-01

    Organic anion-transporting polypeptide 1B1 (OATP1B1) is an important hepatic uptake transporter, of which the polymorphic variant OATP1B1*15 (Asn130Asp and Val174Ala) has been associated with decreased transport activity. Rosuvastatin is an OATP1B1 substrate and often concomitantly prescribed with o

  15. Host kinin B1 receptor plays a protective role against melanoma progression.

    Science.gov (United States)

    Maria, Andrea G; Dillenburg-Pilla, Patrícia; Reis, Rosana I; Floriano, Elaine M; Tefé-Silva, Cristiane; Ramos, Simone G; Pesquero, João B; Nahmias, Clara; Costa-Neto, Claudio M

    2016-01-01

    Melanoma is a very aggressive tumor that arises from melanocytes. Late stage and widely spread diseases do not respond to standard therapeutic approaches. The kallikrein-kinin system (KKS) participates in biological processes such as vasodilatation, pain and inflammatory response. However, the role of KKS in tumor formation and progression is not completely understood. The role of the host kinin B1 receptor in melanoma development was evaluated using a syngeneic melanoma model. Primary tumors and metastasis were respectively induced by injecting B16F10 melanoma cells, which are derived from C57BL/6 mice, subcutaneously or in the tail vein in wild type C57BL/6 and B1 receptor knockout mice (B1(-/-)). Tumors developed in B1(-/-) mice presented unfavorable prognostic factors such as increased incidence of ulceration, higher levels of IL-10, higher activation of proliferative pathways such as ERK1/2 and Akt, and increased mitotic index. Furthermore, in the metastasis model, B1(-/-) mice developed larger metastatic colonies in the lung and lower CD8(+)immune effector cells when compared with WT animals. Altogether, our results provide evidences that B1(-/-) animals developed primary tumors with multiple features associated with poor prognosis and unfavorable metastatic onset, indicating that the B1 receptor may contribute to improve the host response against melanoma progression. PMID:26898917

  16. Comparative Oral Bioavailability, Toxicokinetics, and Biotransformation of Enniatin B1 and Enniatin B in Broiler Chickens.

    Science.gov (United States)

    Fraeyman, Sophie; Devreese, Mathias; Antonissen, Gunther; De Baere, Siegrid; Rychlik, Michael; Croubels, Siska

    2016-09-28

    A toxicokinetic study of the Fusarium mycotoxins enniatin B1 (ENN B1) and enniatin B (ENN B) was performed in broiler chickens. Each animal received ENN B1 or B orally via an intracrop bolus and intravenously at a dose of 0.2 mg/kg body weight. Both enniatins were poorly absorbed after oral administration, with absolute oral bioavailabilities of 0.05 and 0.11 for ENNs B1 and B, respectively. Both enniatins were readily distributed to the tissues, with mean volumes of distribution of 25.09 and 33.91 L/kg for ENNs B1 and B, respectively. The mean total body clearance was rather high, namely, 6.63 and 7.10 L/h/kg for ENNs B1 and B, respectively. Finally, an UHPLC-HRMS targeted approach was used to investigate the phase I and II biotransformations of both mycotoxins. Oxygenation was the major phase I biotransformation pathway for both ENNs B1 and B. Neither glucuronide nor sulfate phase II metabolites were detected. PMID:27632250

  17. Determination of Aflatoxin B1 in Smokeless Tobacco Products by Use of UHPLC-MS/MS.

    Science.gov (United States)

    Zitomer, Nicholas; Rybak, Michael E; Li, Zhong; Walters, Matthew J; Holman, Matthew R

    2015-10-21

    This work developed a UHPLC-MS/MS method for the detection and quantitation of aflatoxins in smokeless tobacco products, which was then used to determine aflatoxin B1 concentrations in 32 smokeless tobacco products commercially available in the United States. Smokeless tobacco products were dried, milled, and amended with (13)C17-labeled internal standards, extracted in water/methanol solution in the presence of a surfactant, isolated through use of immunoaffinity column chromatography, and reconstituted in mobile phase prior to UHPLC-MS/MS analysis. The method was capable of baseline separation of aflatoxins B1, B2, G1, and G2 in a 2.5 min run by use of a fused core C18 column and a water/methanol gradient. MS/MS transition (m/z) 313.3 → 241.2 was used for aflatoxin B1 quantitation, with 313.3 → 285.1 used for confirmation. The limit of detection (LOD) for aflatoxin B1 was 0.007 parts per billion (ppb). Method imprecision for aflatoxin B1 (expressed as coefficient of variation) ranged from 5.5 to 9.4%. Spike recoveries were 105-111%. Aflatoxin B1 concentrations in the smokeless tobacco products analyzed ranged from snuffs and chews, whereas all moist snuff products tested were below LOD. The amounts of aflatoxin B1 detected were low relative to the 20 ppb regulatory limit established by the U.S. Food and Drug Administration for foods and feeds.

  18. Pathogenesis-Related Protein 1b1 (PR1b1) Is a Major Tomato Fruit Protein Responsive to Chilling Temperature and Upregulated in High Polyamine Transgenic Genotypes

    Science.gov (United States)

    Fatima, Tahira; Topuz, Muhamet; Bernadec, Anne; Sicher, Richard; Handa, Avtar K.; Mattoo, Autar K.

    2016-01-01

    Plants execute an array of mechanisms in response to stress which include upregulation of defense-related proteins and changes in specific metabolites. Polyamines – putrescine (Put), spermidine (Spd), and spermine (Spm) – are metabolites commonly found associated with abiotic stresses such as chilling stress. We have generated two transgenic tomato lines (556HO and 579HO) that express yeast S-adenosylmethionine decarboxylase and specifically accumulate Spd and Spm in fruits in comparison to fruits from control (556AZ) plants (Mehta et al., 2002). Tomato fruits undergo chilling injury at temperatures below 13°C. The high Spd and Spm tomato together with the control azygous line were utilized to address role(s) of polyamines in chilling-injury signaling. Exposure to chilling temperature (2°C) led to several-fold increase in the Put content in all the lines. Upon re-warming of the fruits at 20°C, the levels of Spd and Spm increased further in the fruit of the two transgenic lines, the higher levels remaining stable for 15 days after re-warming as compared to the fruit from the control line. Profiling their steady state proteins before and after re-warming highlighted a protein of ∼14 kD. Using proteomics approach, protein sequencing and immunoblotting, the ∼14-kD protein was identified as the pathogenesis related protein 1b1 (PR1b1). The PR1b1 protein accumulated transiently in the control fruit whose level was barely detectable at d 15 post-warming while in the fruit from both the 556HO and 579HO transgenic lines PR1b1 abundance increased and remained stable till d 15 post warming. PR1b1 gene transcripts were found low in the control fruit with a visible accumulation only on d 15 post warming; however, in both the transgenic lines it accumulated and increased soon after rewarming being several-fold higher on day 2 while in 556HO line this increase continued until d 6 than the control fruit. The chilling-induced increase in PR1b1 protein seems independent

  19. Aflatoxin B1 metabolism by 3-methylcholanthrene-induced hamster hepatic cytochrome P-450s.

    Science.gov (United States)

    Lai, T S; Chiang, J Y

    1990-01-01

    We have studied the activation of aflatoxin B1 by hamster liver microsomes and purified hamster cytochrome P-450 isozymes using a umu mutagen test. The hamster liver microsomes or S-9 fractions were much more active than rat liver microsomes or S-9 fractions in the activation of umu gene expression by aflatoxin B1 metabolites. 3-Methyl-cholanthrene treatment increased aflatoxin B1 activation by hamster liver microsomes. Two major 3-methylcholanthrene-inducible cytochrome P-450 isozymes, P-450 MC1 (IIA) and P-450 MC4 (IA2), were purified from 3-methylcholanthrene-treated hamster liver microsomes, and the metabolism of aflatoxin B1 by these two cytochromes was studied. In the reconstituted enzyme system, both P-450 MC1 and P-450 MC4 were highly active in the activation of aflatoxin B1, and antibodies against these P-450s specifically inhibited these activities. Antibody against P-450 MC1 inhibited the activation of aflatoxin B1 by 20% in the presence of 3-methyl-cholanthrene-treated hamster liver microsomes. In contrast, antibody against P-450 MC4 stimulated the activity by 175%. These results indicated that hamster P-450 MC1 might convert aflatoxin B1 to more toxic metabolite(s), whereas P-450 MC4 might convert aflatoxin B1 to less toxic metabolite(s), than aflatoxin B1 in liver microsomes. The metabolite(s) produced by both hamster cytochrome P-450 MC1 and MC4 were genotoxic in the umu mutagen test. PMID:2126562

  20. SF3B1 haploinsufficiency leads to formation of ring sideroblasts in myelodysplastic syndromes.

    Science.gov (United States)

    Visconte, Valeria; Rogers, Heesun J; Singh, Jarnail; Barnard, John; Bupathi, Manoj; Traina, Fabiola; McMahon, James; Makishima, Hideki; Szpurka, Hadrian; Jankowska, Anna; Jerez, Andres; Sekeres, Mikkael A; Saunthararajah, Yogen; Advani, Anjali S; Copelan, Edward; Koseki, Haruhiko; Isono, Kyoichi; Padgett, Richard A; Osman, Sami; Koide, Kazunori; O'Keefe, Christine; Maciejewski, Jaroslaw P; Tiu, Ramon V

    2012-10-18

    Whole exome/genome sequencing has been fundamental in the identification of somatic mutations in the spliceosome machinery in myelodysplastic syndromes (MDSs) and other hematologic disorders. SF3B1, splicing factor 3b subunit 1 is mutated in 60%-80% of refractory anemia with ring sideroblasts (RARS) and RARS associated with thrombocytosis (RARS-T), 2 distinct subtypes of MDS and MDS/myeloproliferative neoplasms (MDSs/MPNs). An idiosyncratic feature of RARS/RARS-T is the presence of abnormal sideroblasts characterized by iron overload in the mitochondria, called RS. Based on the high frequency of mutations of SF3B1 in RARS/RARS-T, we investigated the consequences of SF3B1 alterations. Ultrastructurally, SF3B1 mutants showed altered iron distribution characterized by coarse iron deposits compared with wild-type RARS patients by transmission electron microscopy. SF3B1 knockdown experiments in K562 cells resulted in down-regulation of U2-type intron-splicing by RT-PCR. RNA-sequencing analysis of SF3B1 mutants showed differentially used genes relevant in MDS pathogenesis, such as ASXL1, CBL, EZH, and RUNX families. A SF3B pharmacologic inhibitor, meayamycin, induced the formation of RS in healthy BM cells. Further, BM aspirates of Sf3b1 heterozygous knockout mice showed RS by Prussian blue. In conclusion, we report the first experimental evidence of the association between SF3B1 and RS phenotype. Our data suggest that SF3B1 haploinsufficiency leads to RS formation.

  1. SH2B1 regulation of energy balance, body weight, and glucose metabolism

    Institute of Scientific and Technical Information of China (English)

    Liangyou; Rui

    2014-01-01

    The Src homology 2B(SH2B)family members(SH2B1,SH2B2 and SH2B3)are adaptor signaling proteins containing characteristic SH2 and PH domains.SH2B1(also called SH2-B and PSM)and SH2B2(also called APS)are able to form homo-or hetero-dimers via their N-terminal dimerization domains.Their C-terminal SH2 domains bind to tyrosyl phosphorylated proteins,including Janus kinase 2(JAK2),TrkA,insulin receptors,insulin-like growth factor-1 receptors,insulin receptor substrate-1(IRS1),and IRS2.SH2B1 enhances leptin signaling by both stimulating JAK2 activity and assembling a JAK2/IRS1/2 signaling complex.SH2B1 promotes insulin signaling by both enhancing insulin receptor catalytic activity and protecting against dephosphorylation of IRS proteins.Accordingly,genetic deletion of SH2B1 results in severe leptin resistance,insulin resistance,hyperphagia,obesity,and type 2 diabetes in mice.Neuronspecific overexpression of SH2B1βtransgenes protects against diet-induced obesity and insulin resistance.SH2B1 in pancreaticβcells promotesβcell expansion and insulin secretion to counteract insulin resistance in obesity.Moreover,numerous SH2B1 mutations are genetically linked to leptin resistance,insulin resistance,obesity,and type 2 diabetes in humans.Unlike SH2B1,SH2B2 and SH2B3 are not required for the maintenance of normal energy and glucose homeostasis.The metabolic function of the SH2B family is conserved from insects to humans.

  2. Search for eta_b(1S) in Inclusive Radiative Decays of the Upsilon(3S)

    CERN Document Server

    Mahmood, A H; Danko, I; Bonvicini, G; Cinabro, D; Dubrovin, M; McGee, S; Bornheim, A; Lipeles, E; Pappas, S P; Shapiro, A; Sun, W M; Weinstein, A J; Mahapatra, R; Briere, R A; Chen, G P; Ferguson, T; Tatishvili, G T; Vogel, H; Adam, N E; Alexander, J P; Berkelman, K; Boisvert, V; Cassel, David G; Drell, P S; Duboscq, J E; Ecklund, K M; Ehrlich, R; Galik, R S; Gibbons, L; Gittelman, B; Gray, S W; Hartill, D L; Heltsley, B K; Hsu, L; Jones, C D; Kandaswamy, J; Kreinick, D L; Magerkurth, A; Mahlke-Krüger, H; Meyer, T O; Mistry, N B; Nordberg, E; Patterson, J R; Peterson, D; Pivarski, J; Riley, D; Sadoff, A J; Schwarthoff, H; Shepherd, M R; Thayer, J G; Urner, D; Viehhauser, G; Warburton, A; Weinberger, M; Athar, S B; Avery, P; Breva-Newell, L; Potlia, V; Stöck, H; Yelton, J; Brandenburg, G; Kim, D Y J; Wilson, R; Benslama, K; Eisenstein, B I; Ernst, J; Gollin, G D; Hans, R M; Karliner, I; Lowrey, N; Plager, C; Sedlack, C; Selen, M; Thaler, J J; Williams, J; Edwards, K W; Ammar, R; Besson, D; Zhao, X; Anderson, S; Frolov, V V; Kubota, Y; Lee, S J; Li, S Z; Poling, R A; Smith, A; Stepaniak, C J; Urheim, J; Metreveli, Z V; Seth, K K; Tomaradze, A G; Zweber, P; Ahmed, S; Alam, M S; Jian, L; Saleem, M; Wappler, F; Eckhart, E; Gan, K K; Gwon, C; Hart, T; Honscheid, K; Hufnagel, D; Kagan, H; Kass, R; Pedlar, T K; Thayer, J B; Von Törne, E; Wilksen, T; Zoeller, M M; Muramatsu, H; Richichi, S J; Severini, H; Skubic, P L; Dytman, S A; Müller, J A; Nam, S; Savinov, V; Chen, S; Hinson, J W; Lee, J; Miller, D H; Pavlunin, V; Shibata, E I; Shipsey, I P J; Cronin-Hennessy, D; Lyon, A L; Park, C S; Park, W; Thorndike, E H; Coan, T E; Gao, Y S; Liu, F; Maravin, Y; Stroynowski, R; Artuso, M; Boulahouache, C; Bukin, K; Dambasuren, E; Khroustalev, K; Mountain, R; Nandakumar, R; Skwarnicki, T; Stone, S; Wang, J C

    2002-01-01

    We have searched for the bottomonium eta_b(1S) via the hindered magnetic dipole (M1) photon transition Upsilon(3S) -> gamma eta_b(1S). No evidence for such a transition is found in the data sample of 4.7 x 10^6 Upsilon(3S)'s collected with the CLEO-III detector. We set upper limits on the branching ratio from 9.30 to 9.43 GeV/c^2 of eta_b(1S) masses. These upper limits rule out many previously published phenomenological estimates of the rate for this transition.

  3. Lipid Polymorphism Induced by Surfactant Peptide SP-B1-25

    OpenAIRE

    Farver, R. Suzanne; Mills, Frank D.; Antharam, Vijay C.; Chebukati, Janetricks N.; Fanucci, Gail E.; Long, Joanna R.

    2010-01-01

    Pulmonary surfactant protein B (SP-B) is an essential protein for lowering surface tension in the alveoli. SP-B1-25, a peptide comprised of the N-terminal 25 amino-acid residues of SP-B, is known to retain much of the biological activity of SP-B. Circular dichroism has shown that when SP-B1-25 interacts with negatively charged lipid vesicles, it contains significant helical structure for the lipid compositions and peptide/lipid ratios studied here. The effect of SP-B1-25 on lipid organization...

  4. Use of gamma irradiation to prevent aflatoxin B 1 production in smoked dried fish

    Science.gov (United States)

    Ogbadu, G. H.

    Smoked dried fish bought from the Nigerian market was inoculated with spores of barAspergillus flavus (U.I. 81) and irradiated with doses of 0.625, 1.25, 2.50 and 5.00 KGy gamma irradiation. The effect of aflatoxin B 1 production on subsequent incubation for 8 days as stationary cultures was measured. The amount of aflatoxin B 1 produced was found to decrease with increased gamma irradiation dose levels. While the non-irradiated control produced significantly (at 1% level) greater amounts of aflatoxin B 1 as compared to the treated cultures.

  5. The capsular polysaccharide Vi from Salmonella Typhi is a B1b antigen

    OpenAIRE

    Marshall, Jennifer L.; Flores-Langarica, Adriana; Kingsley, Robert A.; Hitchcock, Jessica R; Ross, Ewan A.; Lopez-Macias, Constantino; Lakey, Jeremy; Martin, Laura B; Toellner, Kai-michael; MacLennan, Calman A.; MacLennan, Ian C; Henderson, Ian R.; Dougan, Gordon; Cunningham, Adam F.

    2012-01-01

    Vaccination with purified capsular polysaccharide Vi antigen from Salmonella Typhi can protect against typhoid fever, although the mechanism for its efficacy is not clearly established. Here, we have characterised the B cell response to this vaccine in wild-type and T cell-deficient mice. We show that immunization with Typhim Vi rapidly induces proliferation in B1b peritoneal cells, but not in B1a cells or marginal zone (MZ) B cells. This induction of B1b proliferation is concomitant with the...

  6. Observation and Properties of L=1 B_1 and B_2* Mesons

    CERN Document Server

    Abazov, V M; Abolins, M; Acharya, B S; Adams, M; Adams, T; Aguiló, E; Ahn, S H; Ahsan, M; Alexeev, G D; Alkhazov, G; Alton, A; Alverson, G; Alves, G A; Anastasoaie, M; Ancu, L S; Andeen, T; Anderson, S; Andrieu, B; Anzelc, M S; Arnoud, Y; Arov, M; Arthaud, M; Askew, A; Åsman, B; Assis-Jesus, A C S; Atramentov, O; Autermann, C; Avila, C; Ay, C; Badaud, F; Baden, A; Bagby, L; Baldin, B; Bandurin, D V; Banerjee, S; Banerjee, P; Barberis, E; Barfuss, A F; Bargassa, P; Baringer, P; Barreto, J; Bartlett, J F; Bassler, U; Bauer, D; Beale, S; Bean, A; Begalli, M; Begel, M; Belanger-Champagne, C; Bellantoni, L; Bellavance, A; Benítez, J A; Beri, S B; Bernardi, G; Bernhard, R; Berntzon, L; Bertram, I; Besançon, M; Beuselinck, R; Bezzubov, V A; Bhat, P C; Bhatnagar, V; Biscarat, C; Blazey, G; Blekman, F; Blessing, S; Bloch, D; Bloom, K; Böhnlein, A; Boline, D; Bolton, T A; Borissov, G; Bos, K; Bose, T; Brandt, A; Brock, R; Brooijmans, G; Bross, A; Brown, D; Buchanan, N J; Buchholz, D; Bühler, M; Büscher, V; Burdin, S; Burke, S; Burnett, T H; Buszello, C P; Butler, J M; Calfayan, P; Calvet, S; Cammin, J; Caron, S; Carvalho, W; Casey, B C K; Cason, N M; Castilla-Valdez, H; Chakrabarti, S; Chakraborty, D; Chan, K M; Chan, K; Chandra, A; Charles, F; Cheu, E; Chevallier, F; Cho, D K; Choi, S; Choudhary, B; Christofek, L; Christoudias, T; Cihangir, S; Claes, D; Clément, C; Clement, B; Coadou, Y; Cooke, M; Cooper, W E; Corcoran, M; Couderc, F; Cousinou, M C; Crepe-Renaudin, S; Cutts, D; Cwiok, M; Da Motta, H; Das, A; Davies, G; De, K; De Jong, S J; de Jong, P; De La Cruz-Burelo, E; De Oliveira Martins, C; Degenhardt, J D; Déliot, F; Demarteau, M; Demina, R; Denisov, D; Denisov, S P; Desai, S; Diehl, H T; Diesburg, M; Dominguez, A; Dong, H; Dudko, L V; Duflot, L; Dugad, S R; Duggan, D; Duperrin, A; Dyer, J; Dyshkant, A; Eads, M; Edmunds, D; Ellison, J; Elvira, V D; Enari, Y; Eno, S; Ermolov, P; Evans, H; Evdokimov, A; Evdokimov, V N; Ferapontov, A V; Ferbel, T; Fiedler, F; Filthaut, F; Fisher, W; Fisk, H E; Ford, M; Fortner, M; Fox, H; Fu, S; Fuess, S; Gadfort, T; Galea, C F; Gallas, E; Galyaev, E; García, C; García-Bellido, A; Gavrilov, V; Gay, P; Geist, W; Gelé, D; Gerber, C E; Gershtein, Yu; Gillberg, D; Ginther, G; Gollub, N; Gómez, B; Goussiou, A; Grannis, P D; Greenlee, H; Greenwood, Z D; Gregores, E M; Grenier, G; Gris, P; Grivaz, J F; Grohsjean, A; Grünendahl, S; Grünewald, M W; Guo, J; Guo, F; Gutíerrez, P; Gutíerrez, G; Haas, A; Hadley, N J; Haefner, P; Hagopian, S; Haley, J; Hall, I; Hall, R E; Han, L; Hanagaki, K; Hansson, P; Harder, K; Harel, A; Harrington, R; Hauptman, J M; Hauser, R; Hays, J; Hebbeker, T; Hedin, D; Hegeman, J G; Heinmiller, J M; Heinson, A P; Heintz, U; Hensel, C; Herner, K; Hesketh, G; Hildreth, M D; Hirosky, R; Hobbs, J D; Hoeneisen, B; Hoeth, H; Hohlfeld, M; Hong, S J; Hooper, R; Hossain, S; Houben, P; Hu, Y; Hubacek, Z; Hynek, V; Iashvili, I; Illingworth, R; Ito, A S; Jabeen, S; Jaffré, M; Jain, S; Jakobs, K; Jarvis, C; Jesik, R; Johns, K; Johnson, C; Johnson, M; Jonckheere, A; Jonsson, P; Juste, A; Käfer, D; Kahn, S; Kajfasz, E; Kalinin, A M; Kalk, J R; Kalk, J M; Kappler, S; Karmanov, D; Kasper, J; Kasper, P; Katsanos, I; Kau, D; Kaur, R; Kaushik, V; Kehoe, R; Kermiche, S; Khalatyan, N; Khanov, A; Kharchilava, A I; Kharzheev, Yu M; Khatidze, D; Kim, H; Kim, T J; Kirby, M H; Kirsch, M; Klima, B; Kohli, J M; Konrath, J P; Kopal, M; Korablev, V M; Kothari, B; Kozelov, A V; Krop, D; Kryemadhi, A; Kühl, T; Kumar, A; Kunori, S; Kupco, A; Kurca, T; Kvita, J; Lacroix, F; Lam, D; Lammers, S; Landsberg, G L; Lazoflores, J; Lebrun, P; Lee, W M; Leflat, A; Lehner, F; Lellouch, J; Lesne, V; Lévêque, J; Lewis, P; Li, J; Li, Q Z; Li, L; Lietti, S M; Lima, J G R; Lincoln, D; Linnemann, J; Lipaev, V V; Lipton, R; Liu, Y; Liu, Z; Lobo, L; Lobodenko, A; Lokajícek, M; Lounis, A; Love, P; Lubatti, H J; Lyon, A L; Maciel, A K A; Mackin, D; Madaras, R J; Mättig, P; Magass, C; Magerkurth, A; Makovec, N; Mal, P K; Malbouisson, H B; Malik, S; Malyshev, V L; Mao, H S; Maravin, Y; Martin, B; McCarthy, R; Melnitchouk, A; Mendes, A; Mendoza, L; Mercadante, P G; Merkin, M; Merritt, K W; Meyer, J; Meyer, A; Michaut, M; Millet, T; Mitrevski, J; Molina, J; Mommsen, R K; Mondal, N K; Moore, R W; Moulik, T; Muanza, G S; Mulders, M; Mulhearn, M; Mundal, O; Mundim, L; Nagy, E; Naimuddin, M; Narain, M; Naumann, N A; Neal, H A; Negret, J P; Neustroev, P; Nilsen, H; Nomerotski, A; Novaes, S F; Nunnemann, T; O'Dell, V; O'Neil, D C; Obrant, G; Ochando, C; Onoprienko, D; Oshima, N; Osta, J; Otec, R; Oteroy-Garzon, G J; Owen, M; Padley, P; Pangilinan, M; Parashar, N; Park, S J; Park, S K; Parsons, J; Partridge, R; Parua, N; Patwa, A; Pawloski, G; Penning, B; Perea, P M; Peters, K; Peters, Y; Petroff, P; Petteni, M; Piegaia, R; Piper, J; Pleier, M A; Podesta-Lerma, P L M; Podstavkov, V M; Pogorelov, Y; Pol, M E; Polozov, P; Pompo, A; Pope, B G; Popov, A V; Potter, C; Prado da Silva, W L; Prosper, H B; Protopopescu, S D; Qian, J; Quadt, A; Quinn, B; Rakitine, A; Rangel, M S; Rani, K J; Ranjan, K; Ratoff, P N; Renkel, P; Reucroft, S; Rich, P; Rijssenbeek, M; Ripp-Baudot, I; Rizatdinova, F K; Robinson, S; Rodrigues, R F; Royon, C; Rubinov, P; Ruchti, R; Safronov, G; Sajot, G; Sánchez-Hernández, A; Sanders, M P; Santoro, A F S; Savage, G; Sawyer, L; Scanlon, T; Schaile, A D; Schamberger, R D; Scheglov, Y; Schellman, H; Schieferdecker, P; Schliephake, T; Schmitt, C; Schwanenberger, C; Schwartzman, A; Schwienhorst, R; Sekaric, J; Sen-Gupta, S; Severini, H; Shabalina, E; Shamim, M; Shary, V; Shchukin, A A; Shivpuri, R K; Shpakov, D; Siccardi, V; Simák, V; Sirotenko, V I; Skubic, P L; Slattery, P F; Smirnov, D; Smith, R P; Snow, J; Snow, G R; Snyder, S; Söldner-Rembold, S; Sonnenschein, L; Sopczak, A; Sosebee, M; Soustruznik, K; Souza, M; Spurlock, B; Stark, J; Steele, J; Stolin, V; Stone, A; Stoyanova, D A; Strandberg, J; Strandberg, S; Strang, M A; Strauss, M; Strauss, E; Ströhmer, R; Strom, D; Strovink, M; Stutte, L; Sumowidagdo, S; Svoisky, P; Sznajder, A; Talby, M; Tamburello, P; Tanasijczuk, A; Taylor, W; Telford, P; Temple, J; Tiller, B; Tissandier, F; Titov, M; Tokmenin, V V; Tomoto, M; Toole, T; Torchiani, I; Trefzger, T; Tsybychev, D; Tuchming, B; Tully, C; Tuts, P M; Unalan, R; Uvarov, S; Uvarov, L; Uzunyan, S; Vachon, B; Van den Berg, P J; van Eijk, B; Van Kooten, R; Van Leeuwen, W M; Varelas, N; Varnes, E W; Vartapetian, A H; Vasilyev, I A; Vaupel, M; Verdier, P; Vertogradov, L S; Verzocchi, M; Villeneuve-Séguier, F; Vint, P; Vokac, P; Von Törne, E; Voutilainen, M; Vreeswijk, M; Wagner, R; Wahl, H D; Wang, L; Wang, M H L; Warchol, J; Watts, G; Wayne, M; Weber, M; Weber, G; Weerts, H; Wenger, A; Wermes, N; Wetstein, M; White, A; Wicke, D; Wilson, G W; Williams, M R J; Wimpenny, S J; Wobisch, M; Wood, D R; Wyatt, T R; Xie, Y; Yacoob, S; Yamada, R; Yan, M; Yasuda, T; Yatsunenko, Y A; Yip, K; Yoo, H D; Youn, S W; Yu, J; Yu, C; Yurkewicz, A; Zatserklyaniy, A; Zeitnitz, C; Zhang, D; Zhao, T; Zhou, B; Zhu, J; Zielinski, M; Zieminska, D; Zieminski, A; Zivkovic, L; Zutshi, V; Zverev, E G

    2007-01-01

    Excited B mesons B_1 and B_2* are observed directly for the first time as two separate states in fully reconstructed decays to B+(*) pi-. The mass of B_1 is measured to be (5720.6 +- 2.4 +- 1.4) MeV/c^2 and the mass difference DeltaM between B_2* and B_1 is (26.2 +- 3.1 +- 0.9) MeV/c^2, giving the mass of the B_2* as (5746.8 +- 2.4 +- 1.7) MeV/c^2. The production rate for B_1 and B_2* mesons is determined to be a fraction (13.9 +- 1.9 +- 3.2)% of the production rate of the B+ meson.

  7. The impact of SF3B1 mutations in CLL on the DNA-damage response

    DEFF Research Database (Denmark)

    Te Raa, G D; Derks, I A M; Navrkalova, V;

    2015-01-01

    Mutations or deletions in TP53 or ATM are well-known determinants of poor prognosis in chronic lymphocytic leukemia (CLL), but only account for approximately 40% of chemo-resistant patients. Genome-wide sequencing has uncovered novel mutations in the splicing factor sf3b1, that were in part...... associated with ATM aberrations, suggesting functional synergy. We first performed detailed genetic analyses in a CLL cohort (n=110) containing ATM, SF3B1 and TP53 gene defects. Next, we applied a newly developed multiplex assay for p53/ATM target gene induction and measured apoptotic responses to DNA damage....... Interestingly, SF3B1 mutated samples without concurrent ATM and TP53 aberrations (sole SF3B1) displayed partially defective ATM/p53 transcriptional and apoptotic responses to various DNA-damaging regimens. In contrast, NOTCH1 or K/N-RAS mutated CLL displayed normal responses in p53/ATM target gene induction...

  8. Inclusive prompt χc,b(1++) production at the LHC

    International Nuclear Information System (INIS)

    We study the prompt production of the χc(1+) and χb(1+) mesons at high energies. Unlike χ(0+,2+) production, χ(1+) mesons cannot be created at LO via the fusion of two on-mass-shell gluons, that is, gg → χc,b(1+) are not allowed. However, the available experimental data show that the cross sections for χc(1+) and χc(2+) are comparable. We therefore investigate four other χ(1+) production mechanisms: namely, (i) the standard NLO process gg → χc,b(1+) + g, (ii) via gluon virtuality, (iii) via gluon reggeisation and, finally, (iv) the possibility to form χc,b(1+) by the fusion of three gluons, where one extra gluon comes from another parton cascade, as in the Double Parton Scattering processes. (orig.)

  9. An Overview of B-1 Cells as Antigen-Presenting Cells

    Science.gov (United States)

    Popi, Ana F.; Longo-Maugéri, Ieda M.; Mariano, Mario

    2016-01-01

    The role of B cells as antigen-presenting cells (APCs) has been extensively studied, mainly in relation to the activation of memory T cells. Considering the B cell subtypes, the role of B-1 cells as APCs is beginning to be explored. Initially, it was described that B-1 cells are activated preferentially by T-independent antigens. However, some reports demonstrated that these cells are also involved in a T-dependent response. The aim of this review is to summarize information about the ability of B-1 cells to play a role as APCs and to briefly discuss the role of the BCR and toll-like receptor signals in this process. Furthermore, some characteristics of B-1 cells, such as natural IgM production and phagocytic ability, could interfere in the participation of these cells in the onset of an adaptive response. PMID:27148259

  10. MISR Level 1B1 Local Mode Radiance Data V002

    Data.gov (United States)

    National Aeronautics and Space Administration — This is the Local Mode Level 1B1 Product containing the DNs radiometrically scaled to radiances with no geometric resampling (Suggested Usage: The MISR Instrument...

  11. Aflatoxin B1 induced upregulation of protein arginine methyltransferase 5 in human cell lines.

    Science.gov (United States)

    Ghufran, Md Sajid; Ghosh, Krishna; Kanade, Santosh R

    2016-09-01

    The exposure of naturally occurring mycotoxins affects human health and play a vital role in cancer initiation and progression. Aflatoxin B1 is a difuranocoumarin mycotoxin, classified as a group I carcinogen. The present study was conducted to assess the effect of aflatoxin B1 on epigenetic regulatory proteins. The protein arginine methyltransferase 5 expression was induced upon aflatoxin B1 treatment in a dose and time dependent manner. Further global arginine methylation was also increased in the same manner. This is the first report showing the induction of epigenetic regulatory protein, protein arginine methyltransferase 5 upon aflatoxin B1 treatment. Further study is required to establish the detailed pathway of PRMT5 induction. PMID:27242039

  12. Data of evolutionary structure change: 1CB4B-1FUNF [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1CB4B-1FUNF 1CB4 1FUN B F ATKAVCVLKGDGPVQGTIHFEAKG--DTVVVTGSITGLT...VIGIAK ATKAVAVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVT...E EEEEEEEE GGG EEEEE EEEEEEE EEEEE HHHH EEEEEEE EVID> 01FUN F 1FUNF FEQKESNGPVKV

  13. Inclusive prompt χ{sub c,b}(1{sup ++}) production at the LHC

    Energy Technology Data Exchange (ETDEWEB)

    Shuvaev, A. G. [Petersburg Nuclear Physics Institute, NRC Kurchatov Institute, Gatchina, 188300, St. Petersburg (Russian Federation); Khoze, V. A. [Petersburg Nuclear Physics Institute, NRC Kurchatov Institute, Gatchina, 188300, St. Petersburg (Russian Federation); Institute for Particle Physics Phenomenology, University of Durham, DH1 3LE, Durham (United Kingdom); Martin, A. D., E-mail: a.d.martin@durham.ac.uk [Institute for Particle Physics Phenomenology, University of Durham, DH1 3LE, Durham (United Kingdom); Ryskin, M. G. [Petersburg Nuclear Physics Institute, NRC Kurchatov Institute, Gatchina, 188300, St. Petersburg (Russian Federation); Institute for Particle Physics Phenomenology, University of Durham, DH1 3LE, Durham (United Kingdom)

    2015-12-28

    We study the prompt production of the χ{sub c}(1{sup +}) and χ{sub b}(1{sup +}) mesons at high energies. Unlike χ(0{sup +},2{sup +}) production, χ(1{sup +}) mesons cannot be created at LO via the fusion of two on-mass-shell gluons, that is, gg→χ{sub c,b}(1{sup +}) are not allowed. However, the available experimental data show that the cross sections for χ{sub c}(1{sup +}) and χ{sub c}(2{sup +}) are comparable. We therefore investigate four other χ(1{sup +}) production mechanisms: namely, (i) the standard NLO process gg→χ{sub c,b}(1{sup +})+g, (ii) via gluon virtuality, (iii) via gluon reggeisation and, finally, (iv) the possibility to form χ{sub c,b}(1{sup +}) by the fusion of three gluons, where one extra gluon comes from another parton cascade, as in the Double Parton Scattering processes.

  14. Plant compounds that induce polychlorinated biphenyl biodegradation by Arthrobacter sp. strain B1B.

    OpenAIRE

    Gilbert, E S; Crowley, D. E.

    1997-01-01

    Plant compounds that induced Arthrobacter sp. strain B1B to cometabolize polychlorinated biphenyls (PCBs) were identified by a screening assay based on the formation of a 4,4'-dichlorobiphenyl ring fission product. A chemical component of spearmint (Mentha spicata), l-carvone, induced Arthrobacter sp. strain B1B to cometabolize Aroclor 1242, resulting in significant degradation of 26 peaks in the mixture, including selected tetra- and pentachlorobiphenyls. Evidence for PCB biodegradation incl...

  15. Analysis of aflatoxins B1 and G1 in maize by quechers

    OpenAIRE

    Bursić Vojislava P.; Vuković Gorica Lj.; Jajić Igor M.; Lazić Sanja D.; Kara Magdalena H.; Čolović Radmilo R.; Vukmirović Đuro M.

    2013-01-01

    A reliable and easy method has been developed for the determination of aflatoxins B1 and G2 in maize samples. High performance liquid chromatography coupled with FLD (HPLC-FLD) with photochemical derivatization was used. Mycotoxins were extracted from maize using a QuEChERS-based extraction procedure. The optimized analytical conditions were evaluated in terms of recoveries, reproducibility, LOD, LOQ and linearity for aflatoxin B1 and aflatoxin G1 in maize. Extraction, chromatographic a...

  16. BIOCONTROL OF ASPERGILLUS FLAVUS AND AFLATOXIN B1 PRODUCTION IN CORN

    OpenAIRE

    A. Khanafari, H. Soudi, M. Miraboulfathi

    2007-01-01

    The potent mycotoxin aflatoxin B1 is a secondary metabolite of Aspergillus fungi that grow, on a variety of food and feed commodities at any stage during growth, harvest, storage and transportation. The occurrence of aflatoxin contamination is global, with severe problems especially prevalent in developing countries. In present study, corn samples were contaminated with aflatoxin B1 in the concentration of 240 µg/kg. Four trials were inoculated by Lactobacillus plantarum (PTCC 1058). Three co...

  17. The phospholipid flippase ATP8B1 mediates apical localization of the cystic fibrosis transmembrane regulator.

    Science.gov (United States)

    van der Mark, Vincent A; de Jonge, Hugo R; Chang, Jung-Chin; Ho-Mok, Kam S; Duijst, Suzanne; Vidović, Dragana; Carlon, Marianne S; Oude Elferink, Ronald P J; Paulusma, Coen C

    2016-09-01

    Progressive familial intrahepatic cholestasis type 1 (PFIC1) is caused by mutations in the gene encoding the phospholipid flippase ATP8B1. Apart from severe cholestatic liver disease, many PFIC1 patients develop extrahepatic symptoms characteristic of cystic fibrosis (CF), such as pulmonary infection, sweat gland dysfunction and failure to thrive. CF is caused by mutations in the cystic fibrosis transmembrane conductance regulator (CFTR), a chloride channel essential for epithelial fluid transport. Previously it was shown that CFTR transcript levels were strongly reduced in livers of PFIC1 patients. Here we have investigated the hypothesis that ATP8B1 is important for proper CFTR expression and function. We analyzed CFTR expression in ATP8B1-depleted intestinal and pulmonary epithelial cell lines and assessed CFTR function by measuring short-circuit currents across transwell-grown ATP8B1-depleted intestinal T84 cells and by a genetically-encoded fluorescent chloride sensor. In addition, we studied CFTR surface expression upon induction of CFTR transcription. We show that CFTR protein levels are strongly reduced in the apical membrane of human ATP8B1-depleted intestinal and pulmonary epithelial cell lines, a phenotype that coincided with reduced CFTR activity. Apical membrane insertion upon induction of ectopically-expressed CFTR was strongly impaired in ATP8B1-depleted cells. We conclude that ATP8B1 is essential for correct apical localization of CFTR in human intestinal and pulmonary epithelial cells, and that impaired CFTR localization underlies some of the extrahepatic phenotypes observed in ATP8B1 deficiency. PMID:27301931

  18. Distribution of [14C]-labelled aflatoxin B1 in mice

    International Nuclear Information System (INIS)

    The distribution of [14C]-labelled aflatoxin B1 has been studied in mice with the aid of whole-body autoradiography. In addition to the localisation of labelled aflatoxin B1 and/or its metabolites in the liver, bile, kidney, lung and urine an uptake of 14C in the pigment of the Harderian gland and the eye was observed. Uptake of radioactivity was also found in the eyes of the foetuses although their livers did not accumulate radioactivity. (author)

  19. Role of CYP1B1 in PAH-DNA adduct formation and breast cancer risk

    Energy Technology Data Exchange (ETDEWEB)

    Goth-Goldstein, Regine; Russell, Marion L.; Muller, A.P.; Caleffi, M.; Eschiletti, J.; Graudenz, M.; Sohn, Michael D.

    2010-04-01

    This study investigated the hypothesis that increased exposure to polycyclic aromatic hydrocarbons (PAHs) increases breast cancer risk. PAHs are products of incomplete burning of organic matter and are present in cigarette smoke, ambient air, drinking water, and diet. PAHs require metabolic transformation to bind to DNA, causing DNA adducts, which can lead to mutations and are thought to be an important pre-cancer marker. In breast tissue, PAHs appear to be metabolized to their cancer-causing form primarily by the cytochrome P450 enzyme CYP1B1. Because the genotoxic impact of PAH depends on their metabolism, we hypothesized that high CYP1B1 enzyme levels result in increased formation of PAH-DNA adducts in breast tissue, leading to increased development of breast cancer. We have investigated molecular mechanisms of the relationship between PAH exposure, CYP1B1 expression and breast cancer risk in a clinic-based case-control study. We collected histologically normal breast tissue from 56 women (43 cases and 13 controls) undergoing breast surgery and analyzed these specimens for CYP1B1 genotype, PAH-DNA adducts and CYP1B1 gene expression. We did not detect any difference in aromatic DNA adduct levels of cases and controls, only between smokers and non-smokers. CYP1B1 transcript levels were slightly lower in controls than cases, but the difference was not statistically significant. We found no correlation between the levels of CYP1B1 expression and DNA adducts. If CYP1B1 has any role in breast cancer etiology it might be through its metabolism of estrogen rather than its metabolism of PAHs. However, due to the lack of statistical power these results should be interpreted with caution.

  20. Nuclear research reactors

    International Nuclear Information System (INIS)

    It's presented data about nuclear research reactors in the world, retrieved from the Sien (Nuclear and Energetic Information System) data bank. The information are organized in table forms as follows: research reactors by countries; research reactors by type; research reactors by fuel and research reactors by purpose. (E.G.)

  1. Nuclear reactor

    International Nuclear Information System (INIS)

    A nuclear reactor is described in which the core components, including fuel-rod assemblies, control-rod assemblies, fertile rod-assemblies, and removable shielding assemblies, are supported by a plurality of separate inlet modular units. These units are referred to as inlet module units to distinguish them from the modules of the upper internals of the reactor. The modular units are supported, each removable independently of the others, in liners in the supporting structure for the lower internals of the reactor. The core assemblies are removably supported in integral receptacles or sockets of the modular units. The liners, units, sockets and assemblies have inlet openings for entry of the fluid. The modular units are each removably mounted in the liners with fluid seals interposed between the opening in the liner and inlet module into which the fluid enters in the upper and lower portion of the liner. Each assembly is similarly mounted in a corresponding receptacle with fluid seals interposed between the openings where the fluid enters in the lower portion of the receptacle or fitting closely in these regions. As fluid flows along each core assembly a pressure drop is produced along the fluid so that the fluid which emerges from each core assembly is at a lower pressure than the fluid which enters the core assembly. However because of the seals interposed in the mountings of the units and assemblies the pressures above and below the units and assemblies are balanced and the units are held in the liners and the assemblies are held in the receptacles by their weights as they have a higher specific gravity than the fluid. The low-pressure spaces between each module and its liner and between each core assembly and its module is vented to the low-pressure regions of the vessel to assure that fluid which leaks through the seals does not accumulate and destroy the hydraulic balance

  2. Nuclear reactor physics course for reactor operators

    International Nuclear Information System (INIS)

    The education and training of nuclear reactor operators is important to guarantee the safe operation of present and future nuclear reactors. Therefore, a course on basic 'Nuclear reactor physics' in the initial and continuous training of reactor operators has proven to be indispensable. In most countries, such training also results from the direct request from the safety authorities to assure the high level of competence of the staff in nuclear reactors. The aim of the basic course on 'Nuclear Reactor Physics for reactor operators' is to provide the reactor operators with a basic understanding of the main concepts relevant to nuclear reactors. Seen the education level of the participants, mathematical derivations are simplified and reduced to a minimum, but not completely eliminated

  3. Chronic Moderate Alcohol Intakes Accelerate SR-B1 Mediated Reverse Cholesterol Transport.

    Science.gov (United States)

    Li, Menghua; Diao, Yan; Liu, Ying; Huang, Hui; Li, Yanze; Tan, Peizhu; Liang, Huan; He, Qi; Nie, Junhui; Dong, Xingli; Wang, Yang; Zhou, Lingyun; Gao, Xu

    2016-01-01

    Cholesterol is essential for all animal life. However, a high level of cholesterol in the body is strongly associated with the progression of various severe diseases. In our study, the potential involvement of alcohol in the regulation of high density lipoprotein (HDL) receptor scavenger receptor class B and type I (SR-B1)-mediated reverse cholesterol transport was investigated. We separated male C57BL/6 mice into four diets: control, alcohol, Control + HC and alcohol + HC. The SR-B1 level and 1,1'-dioctadecyl-3,3,3',3'-tetramethylindocarbocyanine perchlorate- high- density lipoprotein (DiI-HDL) uptake were also measured in AML12 cells and HL7702 cells treated with alcohol. The control + HC diet led to increased hepatic triglyceride and cholesterol levels while alcohol + HC led no significant change. Compared with that of the control group, the SR-B1 mRNA level was elevated by 27.1% (P alcohol, control + HC and alcohol + HC groups, respectively. In AML12 and HL7702 cells, SR-B1 level and DiI-HDL uptake were repressed by SR-B1 siRNA or GW9662. However, these effects were reversed through alcohol treatment. These data suggest that a moderate amount of alcohol plays a novel role in reverse cholesterol transport, mainly mediated by PPARγ and SR-B1. PMID:27618957

  4. Plasma extravasation mediated by lipopolysaccharide-induction of kinin B1 receptors in rat tissues

    Directory of Open Access Journals (Sweden)

    Paulo Roberto Wille

    2001-01-01

    Full Text Available The present study was performed to: (a evaluate the effects of kinin B1 (Sar{D-Phe8}-des-Arg9-BK; 10 nmol/kg and B2 (bradykinin (BK; 10 nmol/kg receptor agonists on plasma extravasation in selected rat tissues; (b determine the contribution of a lipopolysaccharide (LPS (100 μ g/kg to the effects triggered by B1 and B2 agonists; and (c characterize the selectivity of B1 ({Leu8}desArg9-BK; 10 nmol/kg and B2 (HOE 140; 10 nmol/kg antagonists as inhibitors of this kinin-induced phenomenon. B1 and B2 agonists were shown to increase plasma extravasation in the duodenum, ileum and also in the urinary bladder of the rat. LPS pretreatment enhanced the plasma extravasation mediated only by the B1 agonist in the duodenum, ileum, trachea, main and segmentar bronchi. These effects were prevented by the B1. but not the B2 antagonist. In normal rats, the B2 antagonist inhibited the effect of B2 agonist in all the tissues analyzed. However, in LPS-treated rats, the B2 antagonist was ineffective in the urinary bladder.

  5. Toxicity of aflatoxin B1 towards the vitamin D receptor (VDR).

    Science.gov (United States)

    Costanzo, Paola; Santini, Antonello; Fattore, Luigi; Novellino, Ettore; Ritieni, Alberto

    2015-02-01

    This research describes an unexpected toxicity of the aflatoxin B1 towards the vitamin D receptors. Rickets is a childhood disease, and calcium deficiency is the aetiological cause in Africa, being primarily associated with nutritional problems; in this research the contribution of aflatoxin B1 exposure during the early months of life is an interesting factor to deepen in order to prevent liver damages or the development of rickets. The results show that the expression of vitamin D receptor in osteosarcoma cell line SAOS-2 is significantly down-modulated by exposure to aflatoxin B1. This seems to suggest that Aflatoxin B1, toxic towards the vitamin D receptor, interferes with the actions of the vitamin D on calcium binding gene expression in the kidney and intestine. Experimental data indicate a 58% and 86% decrease if the cells are exposed to 5 ng/mL and 50 ng/mL of aflatoxin B1, respectively. These results seem to indicate that natural occurrence of the aflatoxin B1 and allelic variant of vitamin D receptor on (F allele) increase the risk of developing rickets of African children.

  6. Impaired cortical neurogenesis in plexin-B1 and -B2 double deletion mutant.

    Science.gov (United States)

    Daviaud, Nicolas; Chen, Karen; Huang, Yong; Friedel, Roland H; Zou, Hongyan

    2016-08-01

    Mammalian cortical expansion is tightly controlled by fine-tuning of proliferation and differentiation of neural progenitors in a region-specific manner. How extrinsic cues interface with cell-intrinsic programs to balance proliferative versus neurogenic decisions remains an unsolved question. We examined the function of Semaphorin receptors Plexin-B1 and -B2 in corticogenesis by generating double mutants, whereby Plexin-B2 was conditionally ablated in the developing brain in a Plexin-B1 null mutant background. Absence of both Plexin-Bs resulted in cortical thinning, particularly in the caudomedial cortex. Plexin-B1/B2 double, but not single, mutants exhibited a reduced neural progenitor pool, attributable to decreased proliferation and an altered division mode favoring cell cycle exit. This resulted in deficient production of neurons throughout the neurogenic period, proportionally affecting all cortical laminae. Consistent with the in vivo data, cultured neural progenitors lacking both Plexin-B1 and -B2 displayed decreased proliferative capacity and increased spontaneous differentiation. Our study therefore defines a novel function of Plexin-B1 and -B2 in transmitting extrinsic signals to maintain proliferative and undifferentiated states of neural progenitors. As single mutants displayed no apparent cortical defects, we conclude that Plexin-B1 and -B2 play redundant or compensatory roles during forebrain development to ensure proper neuronal production and neocortical expansion. © 2015 Wiley Periodicals, Inc. Develop Neurobiol 76: 882-899, 2016. PMID:26579598

  7. A full CI treatment of the 1A1, 1B1, and 3B1 states of SiH2

    Science.gov (United States)

    Bauschlicher, Charles W., Jr.; Taylor, Peter R.

    1987-01-01

    Full CI calculations are presented for the 1A1, 3B1, and 1B1 states of SiH2 at their respective equilibrium geometries and at geometries with the SiH bonds stretched. These results are compared with those obtained from single-reference and multireference CI calculations. The computed Te values agree well with the full CI results, provided that the effects of higher-than-double excitations are accounted for either by the Davidson correction or by a multireference approach. When the SiH bonds are stretched, the single-reference methods are not sufficiently flexible, and only CASSCF/MRCI achieves chemical accuracy (i.e., agrees with the full CI to 1 kcal/mol). Overall, the accuracy of the various approximate methods is very similar to that found for H2O, NH2, and CH2.

  8. 茶叶中黄曲霉毒素B1的检测方法研究%Determination methods of aflatoxin B1 in tea

    Institute of Scientific and Technical Information of China (English)

    吴国华; 赵榕; 里南; 王雄

    2014-01-01

    Objectives To compare the three different methods for the determination of aflatoxin B1 in tea samples, including gold immune chromatography assay (GICA), high performance liquid chromatography (HPLC) and enzyme-linked immunosorbent assay (ELISA). Methods Method validation was done based on black tea, green tea and jasmine tea. And black tea, green tea, oolong tea, jasmine tea, extracted tea, medicinal health tea as representatives were detected with different methods. Results Both of optimized GICA and HPLC achieved high accuracy and precision. ELISA assay produced fake positive. Only one of eleven tested samples had aflatoxin B1 in random test.%目的:针对茶叶中黄曲霉毒素 B1的检测,对比胶体金免疫层析法、高效液相色谱、酶联免疫法的差异。方法以红茶、绿茶、花茶为基质,进行方法验证。并选取具有代表性的红茶、绿茶、乌龙茶、及花茶、萃取茶、药用保健茶分别用不同的方法检测。结果改良后的液相法和胶体金免疫层析法准确度和精密度较高,酶联免疫法存在假阳性。随机检测11种茶叶仅有一种检出黄曲霉毒素B1

  9. Analysis of CYP1B1 in pediatric and adult glaucoma and other ocular phenotypes

    Science.gov (United States)

    Reis, Linda M.; Tyler, Rebecca C.; Weh, Eric; Hendee, Kathryn E.; Kariminejad, Ariana; Abdul-Rahman, Omar; Ben-Omran, Tawfeg; Manning, Melanie A.; McCarty, Catherine A.; Kitchner, Terrie E.; Costakos, Deborah

    2016-01-01

    Purpose The CYP1B1 gene encodes an enzyme that is a member of the cytochrome P450 superfamily. Mutations in CYP1B1 have been mainly reported in recessive pediatric ocular phenotypes, such as primary congenital glaucoma (PCG) and congenital glaucoma with anterior segment dysgenesis (CG with ASD), with some likely pathogenic variants also identified in families affected with adult-onset primary open angle glaucoma (POAG). Methods We examined CYP1B1 in 158 pediatric patients affected with PCG (eight), CG with ASD (22), CG with other developmental ocular disorders (11), juvenile glaucoma with or without additional ocular anomalies (26), and ASD or other developmental ocular conditions without glaucoma (91); in addition, a large cohort of adult patients with POAG (193) and POAG-negative controls (288) was examined. Results Recessive pathogenic variants in CYP1B1 were identified in two PCG pedigrees, three cases with CG and ASD, and two families with CG and other ocular defects, such as sclerocornea in one patient and microphthalmia in another individual; neither sclerocornea nor microphthalmia has been previously associated with CYP1B1. Most of the identified causative mutations are new occurrences of previously reported pathogenic alleles with two novel variants identified: a c.1325delC, p.(Pro442Glnfs*15) frameshift allele in a family with PCG and a c.157G>A, p.(Gly53Ser) variant identified in a proband with CG, Peters anomaly, and microphthalmia. Analysis of the family history in the CYP1B1-positive families revealed POAG in confirmed or presumed heterozygous relatives in one family with PCG and two families with ASD/CG; POAG was associated with the c.1064_1076del, p.(Arg355Hisfs*69) allele in two of these pedigrees. Screening of an unrelated POAG cohort identified the same c.1064_1076del heterozygous allele in one individual with sporadic POAG but not in age- and ethnicity-matched POAG-negative individuals. Overall, there was no significant enrichment for mutant

  10. Expansion of B-1a Cells with Germline Heavy Chain Sequence in Lupus Mice

    Science.gov (United States)

    Holodick, Nichol E.; Zeumer, Leilani; Rothstein, Thomas L.; Morel, Laurence

    2016-01-01

    B6.Sle1.Sle2.Sle3 (B6.TC) lupus-prone mice carrying the NZB allele of Cdkn2c, encoding for the cyclin-dependent kinase inhibitor P18INK4, accumulate B-1a cells due to a higher rate of proliferative self-renewal. However, it is unclear whether this affects primarily early-appearing B-1a cells of fetal origin or later-appearing B-1a cells that emerge from bone marrow. B-1a cells are the major source of natural autoantibodies, and it has been shown that their protective nature is associated with a germline-like sequence, which is characterized by few N-nucleotide insertions and a repertoire skewed toward rearrangements predominated during fetal life, VH11 and VH12. To determine the nature of B-1a cells expanded in B6.TC mice, we amplified immunoglobulin genes by PCR from single cells in mice. Sequencing showed a significantly higher proportion of B-1a cell antibodies that display fewer N-additions in B6.TC mice than in B6 control mice. Following this lower number of N-insertions within the CDR-H3 region, the B6.TC B-1a cells display shorter CDR-H3 length than B6 B-1a cells. The absence of N-additions is a surrogate for fetal origin, as TdT expression starts after birth in mice. Therefore, our results suggest that the B-1a cell population is not only expanded in autoimmune B6.TC mice but also qualitatively different with the majority of cells from fetal origin. Accordingly, our sequencing results also demonstrated the overuse of VH11 and VH12 in autoimmune B6.TC mice as compared to B6 controls. These results suggest that the development of lupus autoantibodies in these mice is coupled with skewing of the B-1a cell repertoire and possible retention of protective natural antibodies. PMID:27047495

  11. Expansion of B-1a cells with germline heavy chain sequence in lupus mice

    Directory of Open Access Journals (Sweden)

    Nichol E Holodick

    2016-03-01

    Full Text Available B6.Sle1.Sle2.Sle3 (B6.TC lupus-prone mice carrying the NZB allele of Cdkn2c, encoding for the cyclin-dependent kinase inhibitor P18INK4, accumulate B-1a cells due to a higher rate of proliferative self-renewal. However, it is unclear whether this affects primarily early appearing B-1a cells of fetal origin or later appearing B-1a cells that emerge from bone marrow. B-1a cells are the major source of natural autoantibodies, and it has been shown that their protective nature is associated with a germline-like sequence, which is characterized by few N-nucleotide insertions and a repertoire skewed towards rearrangements predominated during fetal life, VH11 and VH12. To determine the nature of B-1a cells expanded in B6.TC mice, we amplified immunoglobulin genes by PCR from single cells in mice. Sequencing showed a significantly higher proportion of B-1a cell antibodies display fewer N-additions in B6.TC mice than in B6 control mice. Following this lower number of N-insertions within the CDR-H3 region, the B6.TC B-1a cells display shorter CDR-H3 length than B6 B-1a cells. The absence of N-additions is a surrogate for fetal origin, as TdT expression starts after birth in mice. Therefore, our results suggest that the B-1a cell population is not only expanded in autoimmune B6.TC mice but also qualitatively different with the majority of cells from fetal origin. Accordingly, our sequencing results also demonstrated overuse of VH11 and VH12 in autoimmune B6.TC mice as compared to B6 controls. These results suggest that the development of lupus autoantibodies in these mice is coupled with skewing of the B-1a cell repertoire and possible retention of protective natural antibodies.

  12. Decays of the Three Top Contributors to the Reactor ν¯e High-Energy Spectrum, 92Rb, Ygs96 , and 142Cs, Studied with Total Absorption Spectroscopy

    Science.gov (United States)

    Rasco, B. C.; Wolińska-Cichocka, M.; Fijałkowska, A.; Rykaczewski, K. P.; Karny, M.; Grzywacz, R. K.; Goetz, K. C.; Gross, C. J.; Stracener, D. W.; Zganjar, E. F.; Batchelder, J. C.; Blackmon, J. C.; Brewer, N. T.; Go, S.; Heffron, B.; King, T.; Matta, J. T.; Miernik, K.; Nesaraja, C. D.; Paulauskas, S. V.; Rajabali, M. M.; Wang, E. H.; Winger, J. A.; Xiao, Y.; Zachary, C. J.

    2016-08-01

    We report total absorption spectroscopy measurements of 92Rb, Ygs96 , and 142Cs β decays, which are the most important contributors to the high energy ν¯e spectral shape in nuclear reactors. These three β decays contribute 43% of the ν¯e flux near 5.5 MeV emitted by nuclear reactors. This ν¯e energy is particularly interesting due to spectral features recently observed in several experiments including the Daya Bay, Double Chooz, and RENO Collaborations. Measurements were conducted at Oak Ridge National Laboratory by means of proton-induced fission of 238U with on-line mass separation of fission fragments and the Modular Total Absorption Spectrometer. We observe a β -decay pattern that is similar to recent measurements of 92Rb, with a ground-state to ground-state β feeding of 91(3)%. We verify the Ygs96 ground-state to ground-state β feeding of 95.5(20)%. Our measurements substantially modify the β -decay feedings of 142Cs, reducing the β feeding to 142Ba states below 2 MeV by 32% when compared with the latest evaluations. Our results increase the discrepancy between the observed and the expected reactor ν¯e flux between 5 and 7 MeV, the maximum excess increases from ˜10 % to ˜12 %.

  13. Decays of the Three Top Contributors to the Reactor ν[over ¯]_{e} High-Energy Spectrum, ^{92}Rb, ^{96gs}Y, and ^{142}Cs, Studied with Total Absorption Spectroscopy.

    Science.gov (United States)

    Rasco, B C; Wolińska-Cichocka, M; Fijałkowska, A; Rykaczewski, K P; Karny, M; Grzywacz, R K; Goetz, K C; Gross, C J; Stracener, D W; Zganjar, E F; Batchelder, J C; Blackmon, J C; Brewer, N T; Go, S; Heffron, B; King, T; Matta, J T; Miernik, K; Nesaraja, C D; Paulauskas, S V; Rajabali, M M; Wang, E H; Winger, J A; Xiao, Y; Zachary, C J

    2016-08-26

    We report total absorption spectroscopy measurements of ^{92}Rb, ^{96gs}Y, and ^{142}Cs β decays, which are the most important contributors to the high energy ν[over ¯]_{e} spectral shape in nuclear reactors. These three β decays contribute 43% of the ν[over ¯]_{e} flux near 5.5 MeV emitted by nuclear reactors. This ν[over ¯]_{e} energy is particularly interesting due to spectral features recently observed in several experiments including the Daya Bay, Double Chooz, and RENO Collaborations. Measurements were conducted at Oak Ridge National Laboratory by means of proton-induced fission of ^{238}U with on-line mass separation of fission fragments and the Modular Total Absorption Spectrometer. We observe a β-decay pattern that is similar to recent measurements of ^{92}Rb, with a ground-state to ground-state β feeding of 91(3)%. We verify the ^{96gs}Y ground-state to ground-state β feeding of 95.5(20)%. Our measurements substantially modify the β-decay feedings of ^{142}Cs, reducing the β feeding to ^{142}Ba states below 2 MeV by 32% when compared with the latest evaluations. Our results increase the discrepancy between the observed and the expected reactor ν[over ¯]_{e} flux between 5 and 7 MeV, the maximum excess increases from ∼10% to ∼12%.

  14. Decays of the Three Top Contributors to the Reactor ν[over ¯]_{e} High-Energy Spectrum, ^{92}Rb, ^{96gs}Y, and ^{142}Cs, Studied with Total Absorption Spectroscopy.

    Science.gov (United States)

    Rasco, B C; Wolińska-Cichocka, M; Fijałkowska, A; Rykaczewski, K P; Karny, M; Grzywacz, R K; Goetz, K C; Gross, C J; Stracener, D W; Zganjar, E F; Batchelder, J C; Blackmon, J C; Brewer, N T; Go, S; Heffron, B; King, T; Matta, J T; Miernik, K; Nesaraja, C D; Paulauskas, S V; Rajabali, M M; Wang, E H; Winger, J A; Xiao, Y; Zachary, C J

    2016-08-26

    We report total absorption spectroscopy measurements of ^{92}Rb, ^{96gs}Y, and ^{142}Cs β decays, which are the most important contributors to the high energy ν[over ¯]_{e} spectral shape in nuclear reactors. These three β decays contribute 43% of the ν[over ¯]_{e} flux near 5.5 MeV emitted by nuclear reactors. This ν[over ¯]_{e} energy is particularly interesting due to spectral features recently observed in several experiments including the Daya Bay, Double Chooz, and RENO Collaborations. Measurements were conducted at Oak Ridge National Laboratory by means of proton-induced fission of ^{238}U with on-line mass separation of fission fragments and the Modular Total Absorption Spectrometer. We observe a β-decay pattern that is similar to recent measurements of ^{92}Rb, with a ground-state to ground-state β feeding of 91(3)%. We verify the ^{96gs}Y ground-state to ground-state β feeding of 95.5(20)%. Our measurements substantially modify the β-decay feedings of ^{142}Cs, reducing the β feeding to ^{142}Ba states below 2 MeV by 32% when compared with the latest evaluations. Our results increase the discrepancy between the observed and the expected reactor ν[over ¯]_{e} flux between 5 and 7 MeV, the maximum excess increases from ∼10% to ∼12%. PMID:27610847

  15. Hybrid adsorptive membrane reactor

    Science.gov (United States)

    Tsotsis, Theodore T.; Sahimi, Muhammad; Fayyaz-Najafi, Babak; Harale, Aadesh; Park, Byoung-Gi; Liu, Paul K. T.

    2011-03-01

    A hybrid adsorbent-membrane reactor in which the chemical reaction, membrane separation, and product adsorption are coupled. Also disclosed are a dual-reactor apparatus and a process using the reactor or the apparatus.

  16. Hybrid adsorptive membrane reactor

    Science.gov (United States)

    Tsotsis, Theodore T. (Inventor); Sahimi, Muhammad (Inventor); Fayyaz-Najafi, Babak (Inventor); Harale, Aadesh (Inventor); Park, Byoung-Gi (Inventor); Liu, Paul K. T. (Inventor)

    2011-01-01

    A hybrid adsorbent-membrane reactor in which the chemical reaction, membrane separation, and product adsorption are coupled. Also disclosed are a dual-reactor apparatus and a process using the reactor or the apparatus.

  17. Incidência de fumonisina B1, aflatoxinas B1, B2, G1 e G2, ocratoxina A e zearalenona em produtos de milho Occurrence of fumonisin B1, aflatoxins B1, B2, G1, and G2, ochratoxin A and zearalenone in corn products

    Directory of Open Access Journals (Sweden)

    Luciane Mie Kawashima

    2006-09-01

    Full Text Available Levantamentos de ocorrência de micotoxinas em alimentos foram realizados nas últimas duas décadas nas regiões Sudeste e Sul do Brasil. Levantamentos em alimentos comercializados em outras regiões têm-se limitado a aflatoxinas em amendoim e castanhas do Brasil. O presente trabalho pesquisou a presença de fumonisina B1, aflatoxinas B1, B2, G1 e G2, ocratoxina A e zearalenona em 74 amostras de produtos a base de milho adquiridas no comércio da cidade de Recife, PE, durante o período de 1999 a 2001. Fumonisina B1 foi determinada por cromatografia líquida de alta eficiência com detecção por fluorescência e as demais toxinas foram determinadas por cromatografia em camada delgada. Fumonisina B1 foi encontrada em 94,6% das amostras em concentrações variando de 20 a 8600 µg/kg. Apenas 5 amostras continham aflatoxina B1 e o teor máximo encontrado foi 20 µg/kg. Duas amostras ultrapassaram o limite de 20 µg/kg para a somatória das aflatoxinas B1, B2, G1 e G2 (farinha de milho pré-cozida com 21,5 µg/kg e quirera (xerém com 23,3 µg/kg. As aflatoxinas G1 e G2, ocratoxina A e zearalenona não foram detectadas em nenhuma das amostras. Todas as amostras contaminadas com aflatoxinas também apresentaram fumonisina B1.Research concerning the presence of mycotoxin in food has been conducted in the Southwest and South regions of Brazil over the last two decades. Research in other regions has been limited to aflatoxin in peanuts and Brazil nuts. The aim of this work is to study the presence of fumonisin B1, aflatoxins B1, B2, G1, and G2, ochratoxin A and zearalenone in 74 samples of corn products acquired in shops and food markets in the city of Recife (PE from 1999 to 2001. Fumonisin B1 was determined by high performance liquid chromatography and fluorescence was detected. The other toxins were determined by thin layer chromatography. Fumonisin B1 was found in 94.6% of the samples in levels from 20 to 8600 µg/kg. Only 5 samples contained

  18. 黄曲霍毒素B1人工抗原的合成及鉴定%Synthesis and Identification of Aflatoxin B1 Artificial Antigen

    Institute of Scientific and Technical Information of China (English)

    伍鑫茹; 杨雪娇; 赵肃清; 张焜

    2013-01-01

    Carboxyl group was introduced to Aflatoxin B1 (aflatoxin B1, AFB1) by derivatization method to synthesis the hapten (AFB1 carboxymethyl activator). And the AFBiO was coupled with BSA by using N-hydroxy-succinimide method to prepare the complete antigen of AFB,. The results of ECI-MS and ultraviolet spectroscopy showed that the target hapten was successfully synthesized. Through combined with ultraviolet spectrophotometry and regression equation, the standard curves of the different concentration hapten and BSA were abtained as follow: y=0.1440x+0.0103 (R2 =0.9986) and y=0.0059x+0.0808 (R2 =0.9889) respectively. The concentrations of AFB1O and BSA in adduct were 186.32 μg/mlL and 6127.46 ng/mL respectively, and the molar ration was 5.13:1.%采用衍生化在黄曲霉毒素B1(aflatoxin B1,AFB1)上引入羧基合成AFB1羧甲基活化物,通过N-羟琥珀酰亚胺酯(N-hydroxy-succinimide NHS)法将AFB1O与牛血清白蛋白(BSA)偶联,制备黄曲霉毒素B1完全抗原AFB1-BSA.ECI-MS和紫外光谱法的鉴定结果表明目标半抗原合成成功.结合紫外分光光度法和回归方程,分别测得不同浓度的半抗原和蛋白质线性曲线为:Y=0.1440X+0.0103,R2=0.9986; Y=0.0059X+0.0808,R2=0.9889.偶联物中半抗原和蛋白质的浓度分别为186.32 μg/mL、6127.46 μg/mL,即求得抗原分子结合比为5.13∶1,从而为制备抗AFB1抗体奠定基础.

  19. Activation of the kinin B1 receptor attenuates melanoma tumor growth and metastasis.

    Directory of Open Access Journals (Sweden)

    Patricia Dillenburg-Pilla

    Full Text Available Melanoma is a very aggressive tumor that does not respond well to standard therapeutic approaches, such as radio- and chemotherapies. Furthermore, acquiring the ability to metastasize in melanoma and many other tumor types is directly related to incurable disease. The B1 kinin receptor participates in a variety of cancer-related pathophysiological events, such as inflammation and angiogenesis. Therefore, we investigated whether this G protein-coupled receptor plays a role in tumor progression. We used a murine melanoma cell line that expresses the kinin B1 receptor and does not express the kinin B2 receptor to investigate the precise contribution of activation of the B1 receptor in tumor progression and correlated events using various in vitro and in vivo approaches. Activation of the kinin B1 receptor in the absence of B2 receptor inhibits cell migration in vitro and decreases tumor formation in vivo. Moreover, tumors formed from cells stimulated with B1-specific agonist showed several features of decreased aggressiveness, such as smaller size and infiltration of inflammatory cells within the tumor area, higher levels of pro-inflammatory cytokines implicated in the host anti-tumor immune response, lower number of cells undergoing mitosis, a poorer vascular network, no signs of invasion of surrounding tissues or metastasis and increased animal survival. Our findings reveal that activation of the kinin B1 receptor has a host protective role during murine melanoma tumor progression, suggesting that the B1 receptor could be a new anti-tumor GPCR and provide new opportunities for therapeutic targeting.

  20. Ultrafine carbon particles down-regulate CYP1B1 expression in human monocytes

    Directory of Open Access Journals (Sweden)

    Ziegler-Heitbrock Loems

    2009-10-01

    Full Text Available Abstract Background Cytochrome P450 monoxygenases play an important role in the defence against inhaled toxic compounds and in metabolizing a wide range of xenobiotics and environmental contaminants. In ambient aerosol the ultrafine particle fraction which penetrates deeply into the lungs is considered to be a major factor for adverse health effects. The cells mainly affected by inhaled particles are lung epithelial cells and cells of the monocyte/macrophage lineage. Results In this study we have analyzed the effect of a mixture of fine TiO2 and ultrafine carbon black Printex 90 particles (P90 on the expression of cytochrome P450 1B1 (CYP1B1 in human monocytes, macrophages, bronchial epithelial cells and epithelial cell lines. CYP1B1 expression is strongly down-regulated by P90 in monocytes with a maximum after P90 treatment for 3 h while fine and ultrafine TiO2 had no effect. CYP1B1 was down-regulated up to 130-fold and in addition CYP1A1 mRNA was decreased 13-fold. In vitro generated monocyte-derived macrophages (MDM, epithelial cell lines, and primary bronchial epithelial cells also showed reduced CYP1B1 mRNA levels. Benzo[a]pyrene (BaP is inducing CYB1B1 but ultrafine P90 can still down-regulate gene expression at 0.1 μM of BaP. The P90-induced reduction of CYP1B1 was also demonstrated at the protein level using Western blot analysis. Conclusion These data suggest that the P90-induced reduction of CYP gene expression may interfere with the activation and/or detoxification capabilities of inhaled toxic compounds.

  1. Scavenger receptor B1 facilitates macrophage uptake of silver nanoparticles and cellular activation

    Energy Technology Data Exchange (ETDEWEB)

    Aldossari, Abdullah A.; Shannahan, Jonathan H. [The University of Colorado Anschutz Medical Campus, Department of Pharmaceutical Sciences, Skaggs School of Pharmacy and Pharmaceutical Sciences (United States); Podila, Ramakrishna [Clemson University, Department of Physics and Astronomy (United States); Brown, Jared M., E-mail: jared.brown@ucdenver.edu [The University of Colorado Anschutz Medical Campus, Department of Pharmaceutical Sciences, Skaggs School of Pharmacy and Pharmaceutical Sciences (United States)

    2015-07-15

    Due to increased use of silver nanoparticles (AgNPs) for their antimicrobial activity, concerns have risen regarding potential adverse human health effects. Scavenger receptor B1 (SR-B1), a major receptor for high-density lipoprotein (HDL), is expressed by macrophages and has also been reported to play a role in recognition of negatively charged particles. We, therefore, hypothesized that SR-B1 mediates macrophage uptake of AgNPs and inflammatory activation. To test this hypothesis, we exposed a mouse macrophage cell line RAW264.7 (RAW) and bone marrow-derived macrophages (BMDM) to 20 nm citrate-suspended AgNPs. To verify the role of the SR-B1 receptor, we utilized a SR-B1 inhibitor (Blt2). In vitro studies demonstrated uptake of AgNPs and HDL-coated AgNPs by macrophages which were significantly reduced following pretreatment with Blt2. Inflammatory cytokine arrays revealed that macrophages exposed to AgNPs up-regulated expression of Tnf-α, Oncostatin m (OSM), Ccl4, Il17f, Ccl7, and Ccl2, whereas Il16 was found to be down-regulated. Macrophage activation was observed following AgNP and HDL-coated AgNP exposure as measured by OSM protein production and increased surface expression of CD86. These markers of activation were reduced with Blt2 pretreatment. The in vitro findings were confirmed in vivo through pulmonary instillation of AgNPs in mice. Pulmonary instillation of AgNPs resulted in a recruitment of inflammatory cells that were reduced in SR-B1-deficient mice or following Blt2 pretreatment. This study suggests that SR-B1 plays a major role in cellular recognition of AgNPs and the induction of cell responses that could contribute to inflammation caused by AgNP exposure.

  2. Scavenger receptor B1 facilitates macrophage uptake of silver nanoparticles and cellular activation

    International Nuclear Information System (INIS)

    Due to increased use of silver nanoparticles (AgNPs) for their antimicrobial activity, concerns have risen regarding potential adverse human health effects. Scavenger receptor B1 (SR-B1), a major receptor for high-density lipoprotein (HDL), is expressed by macrophages and has also been reported to play a role in recognition of negatively charged particles. We, therefore, hypothesized that SR-B1 mediates macrophage uptake of AgNPs and inflammatory activation. To test this hypothesis, we exposed a mouse macrophage cell line RAW264.7 (RAW) and bone marrow-derived macrophages (BMDM) to 20 nm citrate-suspended AgNPs. To verify the role of the SR-B1 receptor, we utilized a SR-B1 inhibitor (Blt2). In vitro studies demonstrated uptake of AgNPs and HDL-coated AgNPs by macrophages which were significantly reduced following pretreatment with Blt2. Inflammatory cytokine arrays revealed that macrophages exposed to AgNPs up-regulated expression of Tnf-α, Oncostatin m (OSM), Ccl4, Il17f, Ccl7, and Ccl2, whereas Il16 was found to be down-regulated. Macrophage activation was observed following AgNP and HDL-coated AgNP exposure as measured by OSM protein production and increased surface expression of CD86. These markers of activation were reduced with Blt2 pretreatment. The in vitro findings were confirmed in vivo through pulmonary instillation of AgNPs in mice. Pulmonary instillation of AgNPs resulted in a recruitment of inflammatory cells that were reduced in SR-B1-deficient mice or following Blt2 pretreatment. This study suggests that SR-B1 plays a major role in cellular recognition of AgNPs and the induction of cell responses that could contribute to inflammation caused by AgNP exposure

  3. Reactor container

    International Nuclear Information System (INIS)

    Purpose: To prevent shocks exerted on a vent head due to pool-swell caused within a pressure suppression chamber (disposed in a torus configuration around the dry well) upon loss of coolant accident in BWR type reactors. Constitution: The following relationship is established between the volume V (m3) of a dry well and the ruptured opening area A (m2) at the boundary expected upon loss of coolant accident: V >= 30340 (m) x A Then, the volume of the dry well is made larger than the ruptured open area, that is, the steam flow rate of leaking coolants upon loss of coolant accident to decrease the pressure rise in the dry well at the initial state where loss of coolant accident is resulted. Accordingly, the pressure of non-compressive gases jetted out from the lower end of the downcomer to the pool water is decreased to suppress the pool-swell. (Ikeda, J.)

  4. Prenatal exposure to aflatoxin B1: developmental, behavioral, and reproductive alterations in male rats

    Science.gov (United States)

    Supriya, Ch.; Reddy, P. Sreenivasula

    2015-06-01

    Previous studies have shown that aflatoxin B1 (AfB1) inhibits androgen biosynthesis as a result of its ability to form a high-affinity complex with the steroidogenic acute regulatory protein. The results of the present study demonstrate the postnatal effects of in utero exposure to AfB1 in the rat. Pregnant Wistar rats were given 10, 20, or 50 μg AfB1/kg body weight daily from gestation day (GD) 12 to GD 19. At parturition, newborns were observed for clinical signs and survival. All animals were born alive and initially appeared to be active. Male pups from control and AfB1-exposed animals were weaned and maintained up to postnatal day (PD) 100. Litter size, birth weight, sex ratio, survival rate, and crown-rump length of the pups were significantly decreased in AfB1-exposed rats when compared to controls. Elapsed time (days) for testes to descend into the scrotal sac was significantly delayed in experimental pups when compared to control pups. Behavioral observations such as cliff avoidance, negative geotaxis, surface rightening activity, ascending wire mesh, open field behavior, and exploratory and locomotory activities were significantly impaired in experimental pups. Body weights and the indices of testis, cauda epididymis, prostate, seminal vesicles, and liver were significantly reduced on PD 100 in male rats exposed to AfB1 during embryonic development when compared with controls. Significant reduction in the testicular daily sperm production, epididymal sperm count, and number of viable, motile, and hypo-osmotic tail coiled sperm was observed in experimental rats. The levels of serum testosterone and activity levels of testicular hydroxysteroid dehydrogenases were significantly decreased in a dose-dependent manner with a significant increase in the serum follicle-stimulating hormone and luteinizing hormone in experimental rats. Deterioration in the testicular and cauda epididymal architecture was observed in experimental rats. The results of fertility

  5. Lipid polymorphism induced by surfactant peptide SP-B(1-25).

    Science.gov (United States)

    Farver, R Suzanne; Mills, Frank D; Antharam, Vijay C; Chebukati, Janetricks N; Fanucci, Gail E; Long, Joanna R

    2010-09-22

    Pulmonary surfactant protein B (SP-B) is an essential protein for lowering surface tension in the alveoli. SP-B(1-25), a peptide comprised of the N-terminal 25 amino-acid residues of SP-B, is known to retain much of the biological activity of SP-B. Circular dichroism has shown that when SP-B(1-25) interacts with negatively charged lipid vesicles, it contains significant helical structure for the lipid compositions and peptide/lipid ratios studied here. The effect of SP-B(1-25) on lipid organization and polymorphisms was investigated via DSC, dynamic light scattering, transmission electron microscopy, and solid-state NMR spectroscopy. At 1-3 mol% peptide and physiologic temperature, SP-B(1-25) partitions at the interface of negatively charged PC/PG lipid bilayers. In lipid mixtures containing 1-5 mol% peptide, the structure of SP-B(1-25) remains constant, but (2)H and (31)P NMR spectra show the presence of an isotropic lipid phase in exchange with the lamellar phase below the T(m) of the lipids. This behavior is observed for both DPPC/POPG and POPC/POPG lipid mixtures as well as for both the PC and PG components of the mixtures. For 1-3 mol% SP-B(1-25), a return to a single lamellar phase above the lipid mixture T(m) is observed, but for 5 mol% SP-B(1-25) a significant isotropic component is observed at physiologic temperatures for DPPC and exchange broadening is observed in (2)H and (31)P NMR spectra of the other lipid components in the two mixtures. DLS and TEM rule out the formation of micellar structures and suggest that SP-B(1-25) promotes the formation of a fluid isotropic phase. The ability of SP-B(1-25) to fuse lipid lamellae via this mechanism, particularly those enriched in DPPC, suggests a specific role for the highly conserved N-terminus of SP-B in the packing of lipid lamellae into surfactant lamellar bodies or in stabilizing multilayer structures at the air-liquid interface. Importantly, this behavior has not been seen for the other SP-B fragments of

  6. Determination of Vitamin B1 in Pharmaceutical Preparations by Flow-injection Analysis with Biamperometric Detection

    Institute of Scientific and Technical Information of China (English)

    LI Li-jun; CHENG Hao; ZHAO Chuan; HU Xiao-ge

    2005-01-01

    A new electrochemical method for the on-line determination of vitamin B1 is presented. Based on dead-stop endpoint biamperometry by using two platinum foil electrodes with an applied potential difference of 150 mV, vitamin B1can be oxidized by hexacyanoferrate ( Ⅲ ) in a sodium hydroxide medium via a reversible indicating couple Fe( CN)64-/Fe(CN)63-. The cell current is linear with the concentration of vitamin B1 in the concentration range of 4.0×10-6-1.0 × 10-3 mol/L with a detection limit of 8.0×10-7 mol/L(0. 27 μg/mL). Most familiar excipients,ions and vitamins do not interfere with the determination of vitamin B1. The method displays the advantages of simplicity, high efficiency( 180 samples/h), and high selectivity, and is suitable for the determination of vitamin B1 in pharmaceutical preparations.

  7. Bancroftian filariasis: circulating B-1 cells decreased in microfilaria carriers and correlate with immunoglobulin M levels.

    Science.gov (United States)

    Mishra, R; Sahoo, P K; Mishra, S; Achary, K G; Dwibedi, B; Kar, S K; Satapathy, A K

    2014-05-01

    B-1 cells play an important role in the outcome of infection in schistosomiasis, pneumonia and experimental filariasis. However, no information exists regarding status of B-1 cells in clinical manifestations of human filariasis. We investigated the levels of B-1 cells from the total B cells by flow cytometry. Significantly low levels of B-1 cells and IgM antibodies were detected against a wide variety of autoantigens in microfilariae carriers as compared to endemic controls and patients with chronic pathology. A positive correlation was found between IgM antibodies to actin and ss-DNA. Absorption of plasma with soluble actin, myosin and lipopolysaccharides (LPS) resulted in significant removal of antifilarial antibodies. Affinity-purified anti-ss-DNA antibodies were found to be reactive to filarial antigens and various autoantigens. Further, a positive correlation was found between polyreactive antibodies and B-1 cells in filarial-infected human subjects. After antifilarial treatment, levels of IgM antibodies to ss-DNA, actin, LPS and filarial antigen increased significantly indicating a role of polyreactive naturally occurring antibodies in filarial infection. Our findings add to the existing evidence that the B-cell defect in BALB.Xid mice account for susceptibility to murine filarial infection and indicate an important role for these antibodies in providing host protection against filarial infection.

  8. Evidence for the eta(b)(1S) meson in radiative Upsilon(2S) decay.

    Science.gov (United States)

    Aubert, B; Bona, M; Karyotakis, Y; Lees, J P; Poireau, V; Prencipe, E; Prudent, X; Tisserand, V; Garra Tico, J; Grauges, E; Lopez, L; Palano, A; Pappagallo, M; Eigen, G; Stugu, B; Sun, L; Battaglia, M; Brown, D N; Kerth, L T; Kolomensky, Yu G; Lynch, G; Osipenkov, I L; Tackmann, K; Tanabe, T; Hawkes, C M; Soni, N; Watson, A T; Koch, H; Schroeder, T; Asgeirsson, D J; Fulsom, B G; Hearty, C; Mattison, T S; McKenna, J A; Barrett, M; Khan, A; Randle-Conde, A; Blinov, V E; Bukin, A D; Buzykaev, A R; Druzhinin, V P; Golubev, V B; Onuchin, A P; Serednyakov, S I; Skovpen, Yu I; Solodov, E P; Todyshev, K Yu; Bondioli, M; Curry, S; Eschrich, I; Kirkby, D; Lankford, A J; Lund, P; Mandelkern, M; Martin, E C; Stoker, D P; Abachi, S; Buchanan, C; Atmacan, H; Gary, J W; Liu, F; Long, O; Vitug, G M; Yasin, Z; Zhang, L; Sharma, V; Campagnari, C; Hong, T M; Kovalskyi, D; Mazur, M A; Richman, J D; Beck, T W; Eisner, A M; Heusch, C A; Kroseberg, J; Lockman, W S; Martinez, A J; Schalk, T; Schumm, B A; Seiden, A; Winstrom, L O; Cheng, C H; Doll, D A; Echenard, B; Fang, F; Hitlin, D G; Narsky, I; Piatenko, T; Porter, F C; Andreassen, R; Mancinelli, G; Meadows, B T; Mishra, K; Sokoloff, M D; Bloom, P C; Ford, W T; Gaz, A; Hirschauer, J F; Nagel, M; Nauenberg, U; Smith, J G; Wagner, S R; Ayad, R; Soffer, A; Toki, W H; Wilson, R J; Feltresi, E; Hauke, A; Jasper, H; Karbach, M; Merkel, J; Petzold, A; Spaan, B; Wacker, K; Kobel, M J; Nogowski, R; Schubert, K R; Schwierz, R; Volk, A; Bernard, D; Bonneaud, G R; Latour, E; Verderi, M; Clark, P J; Playfer, S; Watson, J E; Andreotti, M; Bettoni, D; Bozzi, C; Calabrese, R; Cecchi, A; Cibinetto, G; Franchini, P; Luppi, E; Negrini, M; Petrella, A; Piemontese, L; Santoro, V; Baldini-Ferroli, R; Calcaterra, A; de Sangro, R; Finocchiaro, G; Pacetti, S; Patteri, P; Peruzzi, I M; Piccolo, M; Rama, M; Zallo, A; Contri, R; Lo Vetere, M; Monge, M R; Passaggio, S; Patrignani, C; Robutti, E; Tosi, S; Chaisanguanthum, K S; Morii, M; Adametz, A; Marks, J; Schenk, S; Uwer, U; Bernlochner, F U; Klose, V; Lacker, H M; Bard, D J; Dauncey, P D; Tibbetts, M; Behera, P K; Chai, X; Charles, M J; Mallik, U; Cochran, J; Crawley, H B; Dong, L; Meyer, W T; Prell, S; Rosenberg, E I; Rubin, A E; Gao, Y Y; Gritsan, A V; Guo, Z J; Arnaud, N; Béquilleux, J; D'Orazio, A; Davier, M; Firmino da Costa, J; Grosdidier, G; Le Diberder, F; Lepeltier, V; Lutz, A M; Pruvot, S; Roudeau, P; Schune, M H; Serrano, J; Sordini, V; Stocchi, A; Wormser, G; Lange, D J; Wright, D M; Bingham, I; Burke, J P; Chavez, C A; Fry, J R; Gabathuler, E; Gamet, R; Hutchcroft, D E; Payne, D J; Touramanis, C; Bevan, A J; Clarke, C K; Di Lodovico, F; Sacco, R; Sigamani, M; Cowan, G; Paramesvaran, S; Wren, A C; Brown, D N; Davis, C L; Denig, A G; Fritsch, M; Gradl, W; Alwyn, K E; Bailey, D; Barlow, R J; Jackson, G; Lafferty, G D; West, T J; Yi, J I; Anderson, J; Chen, C; Jawahery, A; Roberts, D A; Simi, G; Tuggle, J M; Dallapiccola, C; Salvati, E; Saremi, S; Cowan, R; Dujmic, D; Fisher, P H; Henderson, S W; Sciolla, G; Spitznagel, M; Taylor, F; Yamamoto, R K; Zhao, M; Patel, P M; Robertson, S H; Lazzaro, A; Lombardo, V; Palombo, F; Bauer, J M; Cremaldi, L; Godang, R; Kroeger, R; Summers, D J; Zhao, H W; Simard, M; Taras, P; Nicholson, H; De Nardo, G; Lista, L; Monorchio, D; Onorato, G; Sciacca, C; Raven, G; Snoek, H L; Jessop, C P; Knoepfel, K J; Losecco, J M; Wang, W F; Corwin, L A; Honscheid, K; Kagan, H; Kass, R; Morris, J P; Rahimi, A M; Regensburger, J J; Sekula, S J; Wong, Q K; Blount, N L; Brau, J; Frey, R; Igonkina, O; Kolb, J A; Lu, M; Rahmat, R; Sinev, N B; Strom, D; Strube, J; Torrence, E; Castelli, G; Gagliardi, N; Margoni, M; Morandin, M; Posocco, M; Rotondo, M; Simonetto, F; Stroili, R; Voci, C; Del Amo Sanchez, P; Ben-Haim, E; Briand, H; Chauveau, J; Hamon, O; Leruste, Ph; Ocariz, J; Perez, A; Prendki, J; Sitt, S; Gladney, L; Biasini, M; Manoni, E; Angelini, C; Batignani, G; Bettarini, S; Calderini, G; Carpinelli, M; Cervelli, A; Forti, F; Giorgi, M A; Lusiani, A; Marchiori, G; Morganti, M; Neri, N; Paoloni, E; Rizzo, G; Walsh, J J; Lopes Pegna, D; Lu, C; Olsen, J; Smith, A J S; Telnov, A V; Anulli, F; Baracchini, E; Cavoto, G; Faccini, R; Ferrarotto, F; Ferroni, F; Gaspero, M; Jackson, P D; Li Gioi, L; Mazzoni, M A; Morganti, S; Piredda, G; Renga, F; Voena, C; Ebert, M; Hartmann, T; Schröder, H; Waldi, R; Adye, T; Franek, B; Olaiya, E O; Wilson, F F; Emery, S; Esteve, L; Hamel de Monchenault, G; Kozanecki, W; Vasseur, G; Yèche, Ch; Zito, M; Chen, X R; Liu, H; Park, W; Purohit, M V; White, R M; Wilson, J R; Allen, M T; Aston, D; Bartoldus, R; Benitez, J F; Cenci, R; Coleman, J P; Convery, M R; Dingfelder, J C; Dorfan, J; Dubois-Felsmann, G P; Dunwoodie, W; Field, R C; Gabareen, A M; Graham, M T; Grenier, P; Hast, C; Innes, W R; Kaminski, J; Kelsey, M H; Kim, H; Kim, P; Kocian, M L; Leith, D W G S; Li, S; Lindquist, B

    2009-10-16

    We have performed a search for the eta_{b}(1S) meson in the radiative decay of the Upsilon(2S) resonance using a sample of 91.6x10(6) Upsilon(2S) events recorded with the BABAR detector at the PEP-II B factory at the SLAC National Accelerator Laboratory. We observe a peak in the photon energy spectrum at Egamma=609.3(-4.5)(+4.6)(stat)+/-1.9(syst) MeV, corresponding to an eta(b)(1S) mass of 9394.2(-4.9)(+4.8)(stat)+/-2.0(syst) MeV/c2. The branching fraction for the decay Upsilon(2S)-->gamma(eta)b(1S) is determined to be [3.9+/-1.1(stat)-0.9+1.1(syst)]x10(-4). We find the ratio of branching fractions B[Upsilon(2S)-->gamma(eta)b(1S)]/B[Upsilon(3S)-->gamma(eta)b(1S)]=0.82+/-0.24(stat)(-0.19)(+0.20)(syst).

  9. Evidence for the ηb(1S) Meson in Radiative Υ(2S) Decay

    Science.gov (United States)

    Aubert, B.; Bona, M.; Karyotakis, Y.; Lees, J. P.; Poireau, V.; Prencipe, E.; Prudent, X.; Tisserand, V.; Garra Tico, J.; Grauges, E.; Lopez, L.; Palano, A.; Pappagallo, M.; Eigen, G.; Stugu, B.; Sun, L.; Battaglia, M.; Brown, D. N.; Kerth, L. T.; Kolomensky, Yu. G.; Lynch, G.; Osipenkov, I. L.; Tackmann, K.; Tanabe, T.; Hawkes, C. M.; Soni, N.; Watson, A. T.; Koch, H.; Schroeder, T.; Asgeirsson, D. J.; Fulsom, B. G.; Hearty, C.; Mattison, T. S.; McKenna, J. A.; Barrett, M.; Khan, A.; Randle-Conde, A.; Blinov, V. E.; Bukin, A. D.; Buzykaev, A. R.; Druzhinin, V. P.; Golubev, V. B.; Onuchin, A. P.; Serednyakov, S. I.; Skovpen, Yu. I.; Solodov, E. P.; Todyshev, K. Yu.; Bondioli, M.; Curry, S.; Eschrich, I.; Kirkby, D.; Lankford, A. J.; Lund, P.; Mandelkern, M.; Martin, E. C.; Stoker, D. P.; Abachi, S.; Buchanan, C.; Atmacan, H.; Gary, J. W.; Liu, F.; Long, O.; Vitug, G. M.; Yasin, Z.; Zhang, L.; Sharma, V.; Campagnari, C.; Hong, T. M.; Kovalskyi, D.; Mazur, M. A.; Richman, J. D.; Beck, T. W.; Eisner, A. M.; Heusch, C. A.; Kroseberg, J.; Lockman, W. S.; Martinez, A. J.; Schalk, T.; Schumm, B. A.; Seiden, A.; Winstrom, L. O.; Cheng, C. H.; Doll, D. A.; Echenard, B.; Fang, F.; Hitlin, D. G.; Narsky, I.; Piatenko, T.; Porter, F. C.; Andreassen, R.; Mancinelli, G.; Meadows, B. T.; Mishra, K.; Sokoloff, M. D.; Bloom, P. C.; Ford, W. T.; Gaz, A.; Hirschauer, J. F.; Nagel, M.; Nauenberg, U.; Smith, J. G.; Wagner, S. R.; Ayad, R.; Soffer, A.; Toki, W. H.; Wilson, R. J.; Feltresi, E.; Hauke, A.; Jasper, H.; Karbach, M.; Merkel, J.; Petzold, A.; Spaan, B.; Wacker, K.; Kobel, M. J.; Nogowski, R.; Schubert, K. R.; Schwierz, R.; Volk, A.; Bernard, D.; Bonneaud, G. R.; Latour, E.; Verderi, M.; Clark, P. J.; Playfer, S.; Watson, J. E.; Andreotti, M.; Bettoni, D.; Bozzi, C.; Calabrese, R.; Cecchi, A.; Cibinetto, G.; Franchini, P.; Luppi, E.; Negrini, M.; Petrella, A.; Piemontese, L.; Santoro, V.; Baldini-Ferroli, R.; Calcaterra, A.; de Sangro, R.; Finocchiaro, G.; Pacetti, S.; Patteri, P.; Peruzzi, I. M.; Piccolo, M.; Rama, M.; Zallo, A.; Contri, R.; Lo Vetere, M.; Monge, M. R.; Passaggio, S.; Patrignani, C.; Robutti, E.; Tosi, S.; Chaisanguanthum, K. S.; Morii, M.; Adametz, A.; Marks, J.; Schenk, S.; Uwer, U.; Bernlochner, F. U.; Klose, V.; Lacker, H. M.; Bard, D. J.; Dauncey, P. D.; Tibbetts, M.; Behera, P. K.; Chai, X.; Charles, M. J.; Mallik, U.; Cochran, J.; Crawley, H. B.; Dong, L.; Meyer, W. T.; Prell, S.; Rosenberg, E. I.; Rubin, A. E.; Gao, Y. Y.; Gritsan, A. V.; Guo, Z. J.; Arnaud, N.; Béquilleux, J.; D'Orazio, A.; Davier, M.; Firmino da Costa, J.; Grosdidier, G.; Le Diberder, F.; Lepeltier, V.; Lutz, A. M.; Pruvot, S.; Roudeau, P.; Schune, M. H.; Serrano, J.; Sordini, V.; Stocchi, A.; Wormser, G.; Lange, D. J.; Wright, D. M.; Bingham, I.; Burke, J. P.; Chavez, C. A.; Fry, J. R.; Gabathuler, E.; Gamet, R.; Hutchcroft, D. E.; Payne, D. J.; Touramanis, C.; Bevan, A. J.; Clarke, C. K.; di Lodovico, F.; Sacco, R.; Sigamani, M.; Cowan, G.; Paramesvaran, S.; Wren, A. C.; Brown, D. N.; Davis, C. L.; Denig, A. G.; Fritsch, M.; Gradl, W.; Alwyn, K. E.; Bailey, D.; Barlow, R. J.; Jackson, G.; Lafferty, G. D.; West, T. J.; Yi, J. I.; Anderson, J.; Chen, C.; Jawahery, A.; Roberts, D. A.; Simi, G.; Tuggle, J. M.; Dallapiccola, C.; Salvati, E.; Saremi, S.; Cowan, R.; Dujmic, D.; Fisher, P. H.; Henderson, S. W.; Sciolla, G.; Spitznagel, M.; Taylor, F.; Yamamoto, R. K.; Zhao, M.; Patel, P. M.; Robertson, S. H.; Lazzaro, A.; Lombardo, V.; Palombo, F.; Bauer, J. M.; Cremaldi, L.; Godang, R.; Kroeger, R.; Summers, D. J.; Zhao, H. W.; Simard, M.; Taras, P.; Nicholson, H.; de Nardo, G.; Lista, L.; Monorchio, D.; Onorato, G.; Sciacca, C.; Raven, G.; Snoek, H. L.; Jessop, C. P.; Knoepfel, K. J.; Losecco, J. M.; Wang, W. F.; Corwin, L. A.; Honscheid, K.; Kagan, H.; Kass, R.; Morris, J. P.; Rahimi, A. M.; Regensburger, J. J.; Sekula, S. J.; Wong, Q. K.; Blount, N. L.; Brau, J.; Frey, R.; Igonkina, O.; Kolb, J. A.; Lu, M.; Rahmat, R.; Sinev, N. B.; Strom, D.; Strube, J.; Torrence, E.; Castelli, G.; Gagliardi, N.; Margoni, M.; Morandin, M.; Posocco, M.; Rotondo, M.; Simonetto, F.; Stroili, R.; Voci, C.; Del Amo Sanchez, P.; Ben-Haim, E.; Briand, H.; Chauveau, J.; Hamon, O.; Leruste, Ph.; Ocariz, J.; Perez, A.; Prendki, J.; Sitt, S.; Gladney, L.; Biasini, M.; Manoni, E.; Angelini, C.; Batignani, G.; Bettarini, S.; Calderini, G.; Carpinelli, M.; Cervelli, A.; Forti, F.; Giorgi, M. A.; Lusiani, A.; Marchiori, G.; Morganti, M.; Neri, N.; Paoloni, E.; Rizzo, G.; Walsh, J. J.; Lopes Pegna, D.; Lu, C.; Olsen, J.; Smith, A. J. S.; Telnov, A. V.; Anulli, F.; Baracchini, E.; Cavoto, G.; Faccini, R.; Ferrarotto, F.; Ferroni, F.; Gaspero, M.; Jackson, P. D.; Li Gioi, L.; Mazzoni, M. A.; Morganti, S.; Piredda, G.; Renga, F.; Voena, C.; Ebert, M.

    2009-10-01

    We have performed a search for the ηb(1S) meson in the radiative decay of the Υ(2S) resonance using a sample of 91.6×106 Υ(2S) events recorded with the BABAR detector at the PEP-II B factory at the SLAC National Accelerator Laboratory. We observe a peak in the photon energy spectrum at Eγ=609.3-4.5+4.6(stat)±1.9(syst)MeV, corresponding to an ηb(1S) mass of 9394.2-4.9+4.8(stat)±2.0(syst)MeV/c2. The branching fraction for the decay Υ(2S)→γηb(1S) is determined to be [3.9±1.1(stat)-0.9+1.1(syst)]×10-4. We find the ratio of branching fractions B[Υ(2S)→γηb(1S)]/B[Υ(3S)→γηb(1S)]=0.82±0.24(stat)-0.19+0.20(syst).

  10. The aflatoxin B1 isolating potential of two lactic acid bacteria

    Institute of Scientific and Technical Information of China (English)

    Adel Hamidi; Reza Mirnejad; Emad Yahaghi; Vahid Behnod; Ali Mirhosseini; Sajad Amani; Sara Sattari; Ebrahim Khodaverdi Darian

    2013-01-01

    Objective:To determine lactic acid bacteria’s capability to enhance the process of binding and isolating aflatoxin B1 and to utilize such lactic acid bacteria as a food supplement or probiotic products for preventing absorption of aflatoxin B1 in human and animal bodies. Methods: In the present research, the bacteria were isolated from five different sources. For surveying the capability of the bacteria in isolating aflatoxin B1, ELISA method was implemented, and for identifying the resultant strains through 16S rRNA sequencing method, universal primers were applied. Results: Among the strains which were isolated, two strains of Lactobacillus pentosus and Lactobacillus beveris exhibited the capability of absorbing and isolating aflatoxin B1 by respectively absorbing and discharging 17.4%and 34.7%of the aforementioned toxin existing in the experiment solution. Conclusions:Strains of Lactobacillus pentosus and Lactobacillus beveris were isolated from human feces and local milk samples, respectively. And both strains has the ability to isolate or bind with aflatoxin B1.

  11. Herschel Observations of a Potential Core Forming Clump: Perseus B1-E

    CERN Document Server

    Sadavoy, S I; Andre, Ph; Pezzuto, S; Bernard, J -P; Bontemps, S; Bressert, E; Chitsazzadeh, S; Fallscheer, C; Hennemann, M; Hill, T; Martin, P; Motte, F; Luong, Q Nguyen; Peretto, N; Reid, M; Schneider, N; Testi, L; White, G J; Wilson, C

    2011-01-01

    We present continuum observations of the Perseus B1-E region from the Herschel Gould Belt Survey. These Herschel data reveal a loose grouping of substructures at 160 - 500 micron not seen in previous submillimetre observations. We measure temperature and column density from these data and select the nine densest and coolest substructures for follow-up spectral line observations with the Green Bank Telescope. We find that the B1-E clump has a mass of ~ 100 solar masses and appears to be gravitationally bound. Furthermore, of the nine substructures examined here, one substructure (B1-E2) appears to be itself bound. The substructures are typically less than a Jeans length from their nearest neighbour and thus, may interact on a timescale of ~ 1 Myr. We propose that B1-E may be forming a first generation of dense cores, which could provide important constraints on the initial conditions of prestellar core formation. Our results suggest that B1-E may be influenced by a strong, localized magnetic field, but further...

  12. Herschel observations of a potential core-forming clump: Perseus B1-E

    Science.gov (United States)

    Sadavoy, S. I.; di Francesco, J.; André, Ph.; Pezzuto, S.; Bernard, J.-P.; Bontemps, S.; Bressert, E.; Chitsazzadeh, S.; Fallscheer, C.; Hennemann, M.; Hill, T.; Martin, P.; Motte, F.; Nguyen Luong, Q.; Peretto, N.; Reid, M.; Schneider, N.; Testi, L.; White, G. J.; Wilson, C.

    2012-04-01

    We present continuum observations of the Perseus B1-E region from the Herschel Gould Belt Survey. These Herschel data reveal a loose grouping of substructures at 160-500 μm not seen in previous submillimetre observations. We measure temperature and column density from these data and select the nine densest and coolest substructures for follow-up spectral line observations with the Green Bank Telescope. We find that the B1-E clump has a mass of ~100 M⊙ and appears to be gravitationally bound. Furthermore, of the nine substructures examined here, one substructure (B1-E2) appears to be itself bound. The substructures are typically less than a Jeans length from their nearest neighbour and thus, may interact on a timescale of ~1 Myr. We propose that B1-E may be forming a first generation of dense cores, which could provide important constraints on the initial conditions of prestellar core formation. Our results suggest that B1-E may be influenced by a strong, localized magnetic field, but further observations are still required.

  13. The SH2B1 obesity locus and abnormal glucose homeostasis

    DEFF Research Database (Denmark)

    Prudente, S; Copetti, M; Morini, E;

    2013-01-01

    The development of type 2 diabetes (T2D) is influenced both by environmental and by genetic determinants. Obesity is an important risk factor for T2D, mostly mediated by obesity-related insulin resistance. Obesity and insulin resistance are also modulated by the genetic milieu; thus, genes...... affecting risk of obesity and insulin resistance might also modulate risk of T2D. Recently, 32 loci have been associated with body mass index (BMI) by genome-wide studies, including one locus on chromosome 16p11 containing the SH2B1 gene. Animal studies have suggested that SH2B1 is a physiological enhancer...... of the insulin receptor and humans with rare deletions or mutations at SH2B1 are obese with a disproportionately high insulin resistance. Thus, the role of SH2B1 in both obesity and insulin resistance makes it a strong candidate for T2D. However, published data on the role of SH2B1 variability on the risk for T2...

  14. Rapid pretreatment and detection of trace aflatoxin B1 in traditional soybean sauce.

    Science.gov (United States)

    Xie, Fang; Lai, WeiHua; Saini, Jasdeep; Shan, Shan; Cui, Xi; Liu, DaoFeng

    2014-05-01

    Soybean sauce, a traditional fermented food in China, has different levels of aflatoxin B1 pollution. Two kinds of direct and indirect immunomagnetic bead methods for the pretreatment of aflatoxin B1 were evaluated in this work. A method was established to detect aflatoxin B1 in soybean sauce using an immunomagnetic bead system for pretreatment and ELISA for quantification. The pretreatment method of immunomagnetic beads performed better compared with the conventional extraction and immunoaffinity column method. ELISA exhibited a good linear relationship at an aflatoxin B1 concentration of 0.05-0.3μg/kg (r(2)=0.9842). The average recoveries across spike levels varied from 0.5 to 7μg/kg were 83.6-104% with a relative standard deviation between 4.2% and 11.7%. With the advantages of rapid detection, easy operation, simple equipment, sensitivity, accuracy, and high recovery; this method can be well applied in the trace determination of aflatoxin B1 in soybean sauce samples. PMID:24360425

  15. The capsular polysaccharide Vi from Salmonella Typhi is a B1b antigen

    Science.gov (United States)

    Marshall, Jennifer L.; Flores-Langarica, Adriana; Kingsley, Robert A.; Hitchcock, Jessica R.; Ross, Ewan A.; Lopez-Macias, Constantino; Lakey, Jeremy; Martin, Laura B.; Toellner, Kai-Michael; MacLennan, Calman A.; MacLennan, Ian C; Henderson, Ian R.; Dougan, Gordon; Cunningham, Adam F.

    2012-01-01

    Vaccination with purified capsular polysaccharide Vi antigen from Salmonella Typhi can protect against typhoid fever, although the mechanism for its efficacy is not clearly established. Here, we have characterised the B cell response to this vaccine in wild-type and T cell-deficient mice. We show that immunization with Typhim Vi rapidly induces proliferation in B1b peritoneal cells, but not in B1a cells or marginal zone (MZ) B cells. This induction of B1b proliferation is concomitant with the detection of splenic Vi-specific antibody secreting cells and protective antibody and Rag1-deficient B1b cell chimeras generated by adoptive transfer induced specific antibody after Vi immunization. Furthermore, antibody derived from peritoneal B cells is sufficient to confer protection against Salmonella that express Vi antigen. Expression of Vi by Salmonella during infection did not inhibit the development of early antibody responses to non-Vi antigens. Despite this, the protection conferred by immunization of mice with porin proteins from Salmonella, which induce antibody-mediated protection, was reduced after infection with Vi-expressing Salmonella, although protection was not totally abrogated. This work therefore suggests that in mice, B1b cells contribute to the protection induced by Vi antigen and targeting non-Vi antigens as sub-unit vaccines may offer an attractive strategy to augment current Vi-based vaccine strategies. PMID:23162127

  16. The capsular polysaccharide Vi from Salmonella typhi is a B1b antigen.

    Science.gov (United States)

    Marshall, Jennifer L; Flores-Langarica, Adriana; Kingsley, Robert A; Hitchcock, Jessica R; Ross, Ewan A; López-Macías, Constantino; Lakey, Jeremy; Martin, Laura B; Toellner, Kai-Michael; MacLennan, Calman A; MacLennan, Ian C; Henderson, Ian R; Dougan, Gordon; Cunningham, Adam F

    2012-12-15

    Vaccination with purified capsular polysaccharide Vi Ag from Salmonella typhi can protect against typhoid fever, although the mechanism for its efficacy is not clearly established. In this study, we have characterized the B cell response to this vaccine in wild-type and T cell-deficient mice. We show that immunization with typhoid Vi polysaccharide vaccine rapidly induces proliferation in B1b peritoneal cells, but not in B1a cells or marginal zone B cells. This induction of B1b proliferation is concomitant with the detection of splenic Vi-specific Ab-secreting cells and protective Ab in Rag1-deficient B1b cell chimeras generated by adoptive transfer-induced specific Ab after Vi immunization. Furthermore, Ab derived from peritoneal B cells is sufficient to confer protection against Salmonella that express Vi Ag. Expression of Vi by Salmonella during infection did not inhibit the development of early Ab responses to non-Vi Ags. Despite this, the protection conferred by immunization of mice with porin proteins from Salmonella, which induce Ab-mediated protection, was reduced postinfection with Vi-expressing Salmonella, although protection was not totally abrogated. This work therefore suggests that, in mice, B1b cells contribute to the protection induced by Vi Ag, and targeting non-Vi Ags as subunit vaccines may offer an attractive strategy to augment current Vi-based vaccine strategies.

  17. The Invalidation of HspB1 Gene in Mouse Alters the Ultrastructural Phenotype of Muscles.

    Science.gov (United States)

    Kammoun, Malek; Picard, Brigitte; Astruc, Thierry; Gagaoua, Mohammed; Aubert, Denise; Bonnet, Muriel; Blanquet, Véronique; Cassar-Malek, Isabelle

    2016-01-01

    Even though abundance of Hsp27 is the highest in skeletal muscle, the relationships between the expression of HspB1 (encoding Hsp27) and muscle characteristics are not fully understood. In this study, we have analysed the effect of Hsp27 inactivation on mouse development and phenotype. We generated a mouse strain devoid of Hsp27 protein by homologous recombination of the HspB1 gene. The HspB1-/- mouse was viable and fertile, showing neither apparent morphological nor anatomical alterations. We detected a gender dimorphism with marked effects in males, a lower body weight (P optical microscopy and transmission electron microscopy. Not any differences in the characteristics of muscle fibres (contractile and metabolic type, shape, perimeter, cross-sectional area) were detected except a trend for a higher proportion of small fibres. Different myosin heavy chains electrophoretic profiles were observed in the HspB1-/- mouse especially the presence of an additional isoform. Electron microscopy revealed ultrastructural abnormalities in the myofibrillar structure of the HspB1-/- mouse mutant mice (e.g. destructured myofibrils and higher gaps between myofibrils) especially in the m. Soleus. Combined with our previous data, these findings suggest that Hsp27 could directly impact the organization of muscle cytoskeleton at the molecular and ultrastructural levels. PMID:27512988

  18. Temperature dependent expression of cdc2 and cyclin B1 in spermatogenic cells during spermatogenesis

    Institute of Scientific and Technical Information of China (English)

    2000-01-01

    p34cdc2 and Cyclin Bi are key components of cell cycle controlling machine and are believed to play a fundamental role in gametogenesis. It is also well known that, in scrotal mammals, spermatogenesis depends greatly on the maintenance of comparatively low temperature in the scrotum. To investigate whether the expression of cdc2 and cyclin B1 in spermatogenic cells during spermatogenesis is actually a temperature dependent event, in situ hybridization, Western blotting and immunohistochemistry analysis were used to study the expression of cdc2 and cyclin B1 in normal and cryptorchid testis. Results showed that the abdominal temperature had no significant influence on the transcription of cdc2 and cyclin B1 in the spermatogonia and pachytene/diplotene primary spermatocytes, but it blocked the translation of them. Due to the deficiency of p34cdc2 and Cyclin B1, the spermatogonia and pachytene/diplotene primary spermatocytes were unable to form MPF, hence, they couldn't undergo karyokinesis. The development of primary spermato cytes was arrested at the G2 to M phase transition. We also found that testosterone could regulate the Cyclin B1 expression in spermatogenic cells. Muscular injection of testosterone could recover spermatogenesis in the unilateral scrotal testis which was influenced by the contralateral cryptorchid testis, but it could not salvage the spermatogenesis block in the cryptorchid testis.

  19. The GABAB1a isoform mediates heterosynaptic depression at hippocampal mossy fiber synapses

    DEFF Research Database (Denmark)

    Guetg, Nicole; Seddik, Riad; Vigot, Réjan;

    2009-01-01

    GABA(B) receptor subtypes are based on the subunit isoforms GABA(B1a) and GABA(B1b), which associate with GABA(B2) subunits to form pharmacologically indistinguishable GABA(B(1a,2)) and GABA(B(1b,2)) receptors. Studies with mice selectively expressing GABA(B1a) or GABA(B1b) subunits revealed...... baclofen. Here, we used a combination of genetic, ultrastructural and electrophysiological approaches to analyze to what extent GABA(B(1a,2)) and GABA(B(1b,2)) receptors inhibit glutamate release in response to physiological activation. We first show that at hippocampal mossy fiber (MF)-CA3 pyramidal...

  20. Extraction of aflatoxin B1 by ultrasonic radiation%应用超声波法提取大米中黄曲霉毒素B1

    Institute of Scientific and Technical Information of China (English)

    孙秀兰; 张银志

    2007-01-01

    目的:建立一种超声波快速提取大米中黄曲霉毒素B1的方法,并对提取方法的回收率和准确度进行评价.方法:采用ELISA方法,研究和评价了超声波提取大米中黄曲霉素B1的提取效率.结果:与普通振荡处理相比,采用超声波处理明显增大了提取效率,缩短了提取时间,超声波处理10 min时达到最大提取率,振荡处理30 min才能达到,而且超声波最大提取浓度比振荡处理提高了30.5%.在针对0.1、1和10μg/kg这3个浓度水平做加标回收试验,回收率达到83.0%~95.2%,比振荡处理提高10%左右.结论:超声频率20 KHz,时间为10 min,为提取黄曲霉毒素B1的最佳条件,而且不同超声频率对结果产生的影响不显著.

  1. Studies on Non-potentiometric Piezoelectric Sensor System for Determination of Vitamin B1

    Institute of Scientific and Technical Information of China (English)

    YUAN Jin-bin; NIE Li-hua; YAO Shou-zhuo

    2003-01-01

    A piezoelectric sensor responsive to vitamin B1 was fabricated based on the vitamin B1-tetraphenylborate ion pair. The general performance characteristics of the sensor are presented here. The proposed sensor showed a wide working pH range, a good sensitivity and selectivity. The response range is between 1.0×10-7-4.9×10-5 mol/L with a detection limit of 8×10-8 mol/L at pH 4.0. The selectivity should be attributed to the preferential adsorption of the component ion on the membrane/solution interface. The adsorption behavior of vitamin B1 on the crystal surface was investigated with a quartz crystal impedance(QCI) system.

  2. L1157-B1: Water and ammonia as diagnostics of shock temperature

    CERN Document Server

    Viti, S; Yates, J A; Codella, C; Vasta, M; Caselli, P; Lefloch, B; Ceccarelli, C

    2011-01-01

    We investigate the origin and nature of the profiles of water and ammonia observ ed toward the L1157-B1 clump as part of the HIFI CHESS survey (Ceccarelli et al. 2010) using a new code coupling a gas-grain chemical model with a parametric shock model. Fir st results from the unbiased survey (Lefloch et al. 2010, Codella et al. 2010) reveal different molecular components at different excitation conditions coexisting in the B1 bow shock structure, with NH$_3$, H$_2$CO and CH$_3$OH emitting only at relatively low outflow velocities whereas H$_2$O shows bright emission at high velocities. Our model suggests that these differences are purely chemical and can be explained by the presence of a C-type shock whose maximum temperature must be close to 4000 K along the B1 clump.

  3. Inhibition effects of Chinese cabbage powder on aflatoxin B1-induced liver cancer.

    Science.gov (United States)

    Wang, Tuoyi; Li, Chunyan; Liu, Yang; Li, Tiezhu; Zhang, Jie; Sun, Yonghai

    2015-11-01

    In this study, 0.25 μg/ml aflatoxin B1 was used to establish a liver cancer model for assessing the potential anticancer ability of Chinese cabbage powder, which is a complex water-soluble extract from Chinese cabbage by spray-drying at an outlet temperature of 130 °C. We found at least 11 potential anticancer substances in Chinese cabbage powder. A 90-d animal experiment demonstrated that 10% of Chinese cabbage powder in drinking water could improve the plasma micronutrient status, inhibit the formation of aflatoxin B1-DNA adducts in liver cells, and effectively reduce the incidence of liver tumor induced by aflatoxin B1 from 6.67% to 0%. The dose effect experiment revealed that 10% may be the minimal effective dose to prevent the occurrence of early liver tumors. This study will help elucidate the basis of epidemiological observations of dietary cancer prevention in humans, as well as explore related mechanisms.

  4. Oligomerization of Vibrio cholerae Hemolysin Induces CXCR3 Upregulation and Activation of B-1a Cell

    Institute of Scientific and Technical Information of China (English)

    Gayatri Mukherjee; Kalyan K Banerjee; Tapas Biswas

    2008-01-01

    The hemolysin oligomer promotes the proliferation of B-1a cells and the expression of CD25, which is indicative of cell activation, on B-1a cells. The upregulation of CD86 induced by the oligomer showed its selective bias for the B7-2 member of B7 family while the monomer failed to induce these effects. The oligomer induced the expression of CXCR3, associated with B cell activation, while the monomer induced the expression of CXCL4, a powerful angiostatic chemokine. In conclusion, we found that B-1a cells responded to the apoptogenic monomer by expressing CXCL4, whereas oligomerization of the immunogen induced CXCR3 to shift the response towards activation. Cellular & Molecular Immunology. 2008;5(3):231-234.

  5. L1157-B1: WATER AND AMMONIA AS DIAGNOSTICS OF SHOCK TEMPERATURE

    International Nuclear Information System (INIS)

    We investigate the origin and nature of the profiles of water and ammonia observed toward the L1157-B1 clump as part of the HIFI CHESS survey using a new code coupling a gas-grain chemical model with a parametric shock model. First results from the unbiased survey reveal different molecular components at different excitation conditions coexisting in the B1 bow shock structure, with NH3, H2CO, and CH3OH emitting only at relatively low outflow velocities whereas H2O shows bright emission at high velocities. Our model suggests that these differences are purely chemical and can be explained by the presence of a C-type shock whose maximum temperature must be close to 4000 K along the B1 clump.

  6. Intrinsic fluorescence spectra characteristics of vitamin B1, B2, and B6

    Science.gov (United States)

    Yang, Hui; Xiao, Xue; Zhao, Xuesong; Hu, Lan; Lv, Caofang; Yin, Zhangkun

    2015-11-01

    This paper presents the intrinsic fluorescence characteristics of vitamin B1, B2 and B6 measured with 3D fluorescence Spectrophotometer. Three strong fluorescence areas of vitamin B2 locate at λex/λem=270/525nm, 370/525nm and 450/525nm, one fluorescence areas of vitamin B1 locates at λex/λem=370/460nm, two fluorescence areas of vitamin B6 locates at λex/λem=250/370nm and 325/370nm were found. The influence of pH of solution to the fluorescence profile was also discussed. Using the PARAFAC algorithm, 10 vitamin B1, B2 and B6 mixed solutions were successfully decomposed, and the emission profiles, excitation profiles, central wavelengths and the concentration of the three components were retrieved precisely through about 5 iteration times.

  7. Extracellular roles of high-mobility-group B1%高迁移率族蛋白B1的细胞核外作用

    Institute of Scientific and Technical Information of China (English)

    王忠堂; 姚咏明; 盛志勇

    2004-01-01

    High-mobility-group B1 (HMGB1), an abundant, highly conserved cellular protein, is widely known as a nuclear DNA - binding protein that stabilizes nucleosome formation, and facilitates gene transcription. Recent studies suggested that HMGBI could be overexpressed and released from cellular nucleosome upon endotoxin and cytokine stimulation, or other stress challenge including bums, shock, as well as infection.Therefore, extracellular HMGB1 might be involved in the pathogenesis of sepsis and subsequent multiple organ dysfunction syndrome. Moreover, experimental data showedextracellular HMGB1 might play vital roles in nerves development, tumor metastasis, atherosclerosis and restenosis after vascular damage.

  8. Identification of a novel antagonist of the ErbB1 receptor capable of inhibiting migration of human glioblastoma cells

    DEFF Research Database (Denmark)

    Staberg, Mikkel; Riemer, Christian; Xu, Ruodan;

    2013-01-01

    processing. RESULTS: The present study shows that Herfin-1 functions as an ErbB1 antagonist. It binds to the extracellular domain of ErbB1 with a KD value of 361 nM. In U87 and U118 cells, both expressing high levels of ErbB1, Herfin-1 inhibits EGF-induced ErbB1 phosphorylation and cell migration...

  9. Moulds identification and detection of aflatoxin B1 on commercial codiments fermented of shrimp

    Directory of Open Access Journals (Sweden)

    NOOR SOESANTI HANDAJANI

    2006-07-01

    Full Text Available Indonesian tropical climate have an opportunity for fungi growth as Aspergillus flavus Link which can produce aflatoxin within foodstuffs, include condiment of fermented shrimp. Aflatoxin B1 is the dangerous agent having roles as carcinogenic, mutagenic and teratogenic. The aims of this research were known kinds of moulds and detection of aflatoxin B1 on commercial condiments fermented of shrimp. Two brands of commercial condiments fermented of shrimp were taken from traditional markets and supermarkets in Surakarta. Isolation was done by made suspension of sample in aquadets. Suspension on appropriate dilutions was grown on CDA (Czapek’s Dox Agar media with surface spread. The grown colonies were separated and grown on PDA (Potato Dextrose Agar slant media. Furthermore, isolates were cultured on CDA and MEA (Malt Extract Agar media. The grown colonies were microscopes and microscopes examined and identified. Existence of aflatoxin B1 was known by Commercial RIDA Screen ELISA Kit that could detect qualitatively and quantitatively with detection sensitive < 1.7 ppb. Moulds that could be isolated from condiments fermented of shrimp were: Aspergillus flavus Link, Aspergillus niger van Tieghem, Aspergillus wentii Wehmer, Aspergillus PU1 or Aspergillus PU2 and Penicillium citrinum Thom. There was aflatoxin B1 contaminated to 2 brands of commercial condiments fermented of shrimp that were examined. Traditional markets’ commercial condiments fermented of shrimp contained higher aflatoxin B1 than supermarkets’. The brands of commercial condiment of fermented shrimp which had better inner package quality contained lower aflatoxin B1 than the worst inner package quality of commercial condiments of fermented of shrimp.

  10. The induction of neoplastic lesions by aflatoxin-B1 in the Egyptian toad (Bufo regularis).

    Science.gov (United States)

    el-Mofty, M M; Sakr, S A

    1988-01-01

    The carcinogenic activity of aflatoxin-B1, the metabolic product of the mold Aspergillus flavus (a commonly occurring contaminant of groundnuts and other foodstuffs), was tested using the Egyptian toad (Bufo regularis). Injecting the toads with aflatoxin-B1 at a dose level of 0.01 mg/50 g body wt in 1 ml corn oil once a week for 15 weeks induced hepatocellular carcinomas in 19% of the experimental toads. Four toads developed tumors in the kidney due to metastases from the primary hepatocellular carcinomas.

  11. Microwave assisted convenient synthesis of quino[2,3-b][1,5]benzoxazepines

    Institute of Scientific and Technical Information of China (English)

    Swapnil S.Sonar; Sandip A.Sadaphal; Shivaji S.Pawar; Bapurao B.Shingate; Murlidhar S.Shingare

    2009-01-01

    A convenient synthesis of quino[2,3-b][1,5]benzoxazepines from substituted 2-chloroquinoline-3-carbaldehyde and 2-hydroxy-aniline by using stable,non-toxic and inexpensive catalyst 1,8-diazabicyclo-undecan-7-ene (DBU)/silica gel is described.This method affords the quino[2,3-b][1,5]benzoxazepines under the influence of microwave irradiation (360 W) in solvent-free conditions within short reaction times (2-3 min),giving high yields of products (93-96%).

  12. Kinin B1 receptors contributes to acute pain following minor surgery in humans

    Directory of Open Access Journals (Sweden)

    Brahim Jaime S

    2010-02-01

    Full Text Available Abstract Background Kinins play an important role in regulation of pain and hyperalgesia after tissue injury and inflammation by activating two types of G-protein-coupled receptors, the kinin B1 and B2 receptors. It is generally accepted that the B2 receptor is constitutively expressed, whereas the B1 receptor is induced in response to inflammation. However, little is known about the regulatory effects of kinin receptors on the onset of acute inflammation and inflammatory pain in humans. The present study investigated the changes in gene expression of kinin receptors and the levels of their endogenous ligands at an early time point following tissue injury and their relation to clinical pain, as well as the effect of COX-inhibition on their expression levels. Results Tissue injury resulted in a significant up-regulation in the gene expression of B1 and B2 receptors at 3 hours post-surgery, the onset of acute inflammatory pain. Interestingly, the up-regulation in the gene expression of B1 and B2 receptors was positively correlated to pain intensity only after ketorolac treatment, signifying an interaction between prostaglandins and kinins in the inflammatory pain process. Further, the gene expression of both B1 and B2 receptors were correlated. Following tissue injury, B1 ligands des-Arg9-BK and des-Arg10-KD were significantly lower at the third hour compared to the first 2 hours in both the placebo and the ketorolac treatment groups but did not differ significantly between groups. Tissue injury also resulted in the down-regulation of TRPV1 gene expression at 3 hours post-surgery with no significant effect by ketorolac treatment. Interestingly, the change in gene expression of TRPV1 was correlated to the change in gene expression of B1 receptor but not B2 receptor. Conclusions These results provide evidence at the transcriptional level in a clinical model of tissue injury that up-regulation of kinin receptors are involved in the development of the

  13. Sampling and Analysis Instruction for Borehole Sampling at 118-B-1 Burial Ground

    Energy Technology Data Exchange (ETDEWEB)

    W. S. Thompson

    2007-04-02

    The Washington Closure Hanford (WCH) Field Remediation Project has removed all of the disposed materials and contaminated soil from the 118-B-1 Burial Ground with the exception of tritium-contaminated soil that is believed to extend from the bottom of the present excavation to groundwater and is believed to contribute to tritium contamination observed at down-gradient monitoring Well 199-B8-6. This sampling and analysis instruction (SAI) provides the requirements for sample collection and laboratory analysis for characterization of the vertical distribution of tritium contamination in the vadose zone soil below the 118-B-1 Burial Ground remedial action excavation.

  14. Biotechnological Fluorescent Ligands of the Bradykinin B1 Receptor: Protein Ligands for a Peptide Receptor.

    Directory of Open Access Journals (Sweden)

    Xavier Charest-Morin

    Full Text Available The bradykinin (BK B1 receptor (B1R is a peculiar G protein coupled receptor that is strongly regulated to the point of being inducible in immunopathology. Limited clinical evidence suggests that its expression in peripheral blood mononuclear cells is a biomarker of active inflammatory states. In an effort to develop a novel imaging/diagnostic tool, we report the rational design and testing of a fusion protein that is a ligand of the human B1R but not likely to label peptidases. This ligand is composed of a fluorescent protein (FP (enhanced green FP [EGFP] or mCherry prolonged at its N-terminus by a spacer peptide and a classical peptide agonist or antagonist (des-Arg9-BK, [Leu8]des-Arg9-BK, respectively. The design of the spacer-ligand joint peptide was validated by a competition assay for [3H]Lys-des-Arg9-BK binding to the human B1R applied to 4 synthetic peptides of 18 or 19 residues. The labeling of B1R-expressing cells with EGFP or mCherry fused with 7 of such peptides was performed in parallel (microscopy. Both assays indicated that the best design was FP-(Asn-Glyn-Lys-des-Arg9-BK; n = 15 was superior to n = 5, suggesting benefits from minimizing steric hindrance between the FP and the receptor. Cell labeling concerned mostly plasma membranes and was inhibited by a B1R antagonist. EGFP-(Asn-Gly15-Lys-des-Arg9-BK competed for the binding of [3H]Lys-des-Arg9-BK to human recombinant B1R, being only 10-fold less potent than the unlabeled form of Lys-des-Arg9-BK to do so. The fusion protein did not label HEK 293a cells expressing recombinant human BK B2 receptors or angiotensin converting enzyme. This study identifies a modular C-terminal sequence that can be adapted to protein cargoes, conferring high affinity for the BK B1R, with possible applications in diagnostic cytofluorometry, histology and drug delivery (e.g., in oncology.

  15. 26 CFR 301.6103(p)(2)(B)-1 - Disclosure of returns and return information by other agencies.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 18 2010-04-01 2010-04-01 false Disclosure of returns and return information by other agencies. 301.6103(p)(2)(B)-1 Section 301.6103(p)(2)(B)-1 Internal Revenue INTERNAL REVENUE... Information and Returns Returns and Records § 301.6103(p)(2)(B)-1 Disclosure of returns and return...

  16. 26 CFR 301.6222(b)-1 - Notification to the Internal Revenue Service when partnership items are treated inconsistently.

    Science.gov (United States)

    2010-04-01

    ..., see § 301.6222(b)-1T contained in 26 CFR part 1, revised April 1, 2001. ... when partnership items are treated inconsistently. 301.6222(b)-1 Section 301.6222(b)-1 Internal Revenue... partnership items are treated inconsistently. (a) In general. The statement identifying an...

  17. Cytotoxic assessment of the regulated, co-existing mycotoxins aflatoxin B1, fumonisin B1 and ochratoxin, in single, binary and tertiary mixtures.

    Science.gov (United States)

    Clarke, Rachel; Connolly, Lisa; Frizzell, Caroline; Elliott, Christopher T

    2014-11-01

    Aflatoxin B1 (AFB1), ochratoxin A (OTA) and fumonisin B1 (FB1) are contaminants which have been shown to regularly co-occur in a range of foods. However, only a small number of studies have evaluated the interactive effect of binary and tertiary mycotoxins. The present study evaluated the effects of low levels of each mycotoxin in combination at their EU regulatory limits. Toxic effect with respect to cell viability was measured by MTT and neutral red assays, assessing mitochondria and lysosome integrities respectively. Individual toxicity showed that OTA (10 μg/ml) was the most cytotoxic mycotoxin in all three cell lines studied (caco-2, MDBK and raw 264.7). Binary combinations were cytotoxic to the MDBK cell line in the order [OTA/FB1] > [AFB1/FB1] > [AFB1/OTA], whilst all effects observed were classified as being additive. Tertiary combinations of AFB1, FB1 and OTA at the EU regulatory limits were tested and not found to exhibit measurable cytotoxicity in MDBK, caco-2 or raw 264.7 cells. However by increasing these concentrations above the legal limits to OTA (3 μg/ml), FB1 (8 μg/ml) and AFB1 (1.28 μg/ml), cytotoxicity was observed with up to 26% reduction in cell viability and synergistic effects were evident with regard to mitochondrial integrity.

  18. Chemical and Toxicological Fate of Fumonisin B1 during Extrusion Processing of Corn Grits

    Science.gov (United States)

    Two batches of flaking corn grits were prepared by growing Fusarium verticillioides to contain low and high levels of fumonisin B1 (FB1), Batch-1 at 9.7 ppm and Batch-2 at 50 ppm FB1 as determined by HPLC. These two batches were extruded (Batch-1E; Batch-2E) or extruded with 10% w/w glucose supplem...

  19. ATP8B1-mediated spatial organization of Cdc42 signaling maintains singularity during enterocyte polarization

    Science.gov (United States)

    Bruurs, Lucas J.M.; Donker, Lisa; Zwakenberg, Susan; Zwartkruis, Fried J.; Begthel, Harry; Knisely, A.S.; Posthuma, George; van de Graaf, Stan F.J.; Paulusma, Coen C.

    2015-01-01

    During yeast cell polarization localization of the small GTPase, cell division control protein 42 homologue (Cdc42) is clustered to ensure the formation of a single bud. Here we show that the disease-associated flippase ATPase class I type 8b member 1 (ATP8B1) enables Cdc42 clustering during enterocyte polarization. Loss of this regulation results in increased apical membrane size with scattered apical recycling endosomes and permits the formation of more than one apical domain, resembling the singularity defect observed in yeast. Mechanistically, we show that to become apically clustered, Cdc42 requires the interaction between its polybasic region and negatively charged membrane lipids provided by ATP8B1. Disturbing this interaction, either by ATP8B1 depletion or by introduction of a Cdc42 mutant defective in lipid binding, increases Cdc42 mobility and results in apical membrane enlargement. Re-establishing Cdc42 clustering, by tethering it to the apical membrane or lowering its diffusion, restores normal apical membrane size in ATP8B1-depleted cells. We therefore conclude that singularity regulation by Cdc42 is conserved between yeast and human and that this regulation is required to maintain healthy tissue architecture. PMID:26416959

  20. A patient with a rare leukodystrophy related to lamin B1 duplication.

    LENUS (Irish Health Repository)

    Molloy, A

    2012-06-01

    The hereditary leukodystrophies are rare disorders caused by molecular abnormalities leading to destruction of or failure of development of central white matter. For almost 30 years there has been increasing recognition of later onset Autosomal Dominant Leukodystrophy (ADLD). We report the first genetically confirmed case of lamin B1 duplication causing ADLD from Ireland.

  1. Mineralogy and Petrology of EK-459-5-1, A Type B1 CAI from Allende

    Science.gov (United States)

    Jeffcoat, C. R.; Kerekgyarto, A. G.; Lapen, T. J.; Andreasen, R.; Righter, M.; Ross, D. K.

    2015-01-01

    Calcium-aluminum-rich inclusions (CAIs) are a type of coarse-grained clast composed of Ca-, Al-, and Mg-rich silicates and oxides found in chondrite meteorites. Type B (CAIs) are exclusively found in the CV chondrite meteorites and are the most well studied type of inclusion found in chondritic meteorites. Type B1 CAIs are distinguished by a nearly monomineralic rim of melilite that surrounds an interior predominantly composed of melilite, fassaite (Ti and Al-rich clinopyroxene), anorthite, and spinel with varying amounts of other minor primary and secondary phases. The formation of Type B CAIs has received considerable attention in the course of CAI research and quantitative models, experimental results and observations from Type B inclusions remain largely in disagreement. Recent experimental results and quantitative models have shown that the formation of B1 mantles could have occurred by the evaporative loss of Si and Mg during the crystallization of these objects. However, comparative studies suggest that the lower bulk SiO2 compositions in B1s result in more prior melilite crystallization before the onset of fassaite and anorthite crystallization leading to the formation of thick melilite rich rims in B1 inclusions. Detailed petrographic and cosmochemical studies of these inclusions will further our understanding of these complex objects.

  2. Regulation of CYP27B1 mRNA Expression in Primary Human Osteoblasts.

    Science.gov (United States)

    van der Meijden, K; van Essen, H W; Bloemers, F W; Schulten, E A J M; Lips, P; Bravenboer, N

    2016-08-01

    The enzyme 1α-hydroxylase (gene CYP27B1) catalyzes the synthesis of 1,25(OH)2D in both renal and bone cells. While renal 1α-hydroxylase is tightly regulated by hormones and 1,25(OH)2D itself, the regulation of 1α-hydroxylase in bone cells is poorly understood. The aim of this study was to investigate in a primary human osteoblast culture whether parathyroid hormone (PTH), fibroblast growth factor 23 (FGF23), calcitonin, calcium, phosphate, or MEPE affect mRNA levels of CYP27B1. Our results show that primary human osteoblasts in the presence of high calcium concentrations increase their CYP27B1 mRNA levels by 1.3-fold. CYP27B1 mRNA levels were not affected by PTH1-34, rhFGF23, calcitonin, phosphate, and rhMEPE. Our results suggest that the regulation of bone 1α-hydroxylase is different from renal 1α-hydroxylase. High calcium concentrations in bone may result in an increased local synthesis of 1,25(OH)2D leading to an enhanced matrix mineralization. In this way, the local synthesis of 1,25(OH)2D may contribute to the stimulatory effect of calcium on matrix mineralization. PMID:27016371

  3. Design and verification of the Risø-B1 airfoil family for wind turbines

    DEFF Research Database (Denmark)

    Fuglsang, P.; Bak, C.; Gaunaa, M.;

    2004-01-01

    This paper presents the design and experimental verification of the Risø-B1 airfoil family for MW-size wind turbines with variable speed and pitch control. Seven airfoils were designed with thickness-to-chord ratios between 15% and 53% to cover the entire span of a wind turbine blade. The airfoil...

  4. Genetic variation of Aflatoxin B(1) aldehyde reductase genes (AFAR) in human tumour cells

    DEFF Research Database (Denmark)

    Praml, Christian; Schulz, Wolfgang; Claas, Andreas;

    2008-01-01

    AFAR genes play a key role in the detoxification of the carcinogen Aflatoxin B(1) (AFB(1)). In the rat, Afar1 induction can prevent AFB(1)-induced liver cancer. It has been proposed that AFAR enzymes can metabolise endogenous diketones and dialdehydes that may be cytotoxic and/or genotoxic...

  5. Inhibition of apoptic cell death induced by Pseudomonas syringae pv. Tabaci and mycotoxin fumonisin B1

    NARCIS (Netherlands)

    Iakimova, E.T.; Batchvorova, R.; Kapchina, V.; Popov, T.; Atanassov, A.; Woltering, E.J.

    2004-01-01

    The impact of programmed cell death (PCD) inhibitors on lesion formation and biochemical events in transgenic (ttr line) and non-transgenic (Nevrokop 1164) tobacco infected with Pseudomonas syringae pv. tabaci was tested. Programmed cell death in tomato cell culture was induced by Fumonisin B1 (FUM)

  6. CYP264B1 from Sorangium cellulosum So ce56: a fascinating norisoprenoid and sesquiterpene hydroxylase.

    Science.gov (United States)

    Ly, Thuy T B; Khatri, Yogan; Zapp, Josef; Hutter, Michael C; Bernhardt, Rita

    2012-07-01

    Many terpenes and terpenoid compounds are known as bioactive substances with desirable fragrance and medicinal activities. Modification of such compounds to yield new derivatives with desired properties is particularly attractive. Cytochrome P450 monooxygenases are potential enzymes for these reactions due to their capability of performing different reactions on a variety of substrates. We report here the characterization of CYP264B1 from Sorangium cellulosum So ce56 as a novel sesquiterpene hydroxylase. CYP264B1 was able to convert various sesquiterpenes including nootkatone and norisoprenoids (α-ionone and β-ionone). Nootkatone, an important grapefruit aromatic sesquiterpenoid, was hydroxylated mainly at position C-13. The product has been shown to have the highest antiproliferative activity compared with other nootkatone derivatives. In addition, CYP264B1 was found to hydroxylate α- and β-ionone, important aroma compounds of floral scents, regioselectively at position C-3. The products, 3-hydroxy-β-ionone and 13-hydroxy-nootkatone, were confirmed by (1)H and (13)C NMR. The kinetics of the product formation was analyzed by high-performance liquid chromatography, and the K ( m ) and k (cat) values were calculated. The results of docking α-/β-ionone and nootkatone into a homology model of CYP264B1 revealed insights into the structural basis of these selective hydroxylations. PMID:22223101

  7. Organic anion transporting polypeptide-1B1 haplotypes in Chinese patients

    Institute of Scientific and Technical Information of China (English)

    Lin-yong XU; Hong-hao ZHOU; Zhen-qiu SUN; Yi-jing HE; Wei ZHANG; Sheng Deng; Qing LI; Wei-xia ZHANG; Zhao-qian LIU; Dan WANG; Yuan-fei HUANG

    2007-01-01

    Aim: To detect 388G>A and 521T>C variant alleles in the organic anion transporting polypeptide- 1B 1 (OATP 1B 1, encoding gene SLCOIB1) gene. Methods:One hundred and eleven healthy volunteers were screened for OATPIB 1 alleles in our study. PCR-restriction fragment length polymorphism was used to identify the 388G>A polymorphism and a 1-step tetra-primer method was developed for the determination of 521T>C mutation. Results: The frequencies of the 388G>A and 521T>C variant alleles in the Chinese population were 73.4%and 14.0%,respectively. The frequencies of the SLCO1BI*lb and *15 haplotypes were 59.9% and 14.0%, respectively. Conclusion: The SLCO1B1*1b and SLCO1B1*15 variants are relatively common in the Chinese population. Their frequencies are similar to that in the Japanese, but significantly different from that in Caucasians and blacks.

  8. Data of evolutionary structure change: 1AO5B-1ELCA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1AO5B-1ELCA 1AO5 1ELC B A VVGGFNCEKNSQPWQVAVYYQ----KEHICGGVLLDRNW...TPTWQKPDDLQCVFITLLPNENCAKV--YLQKVTDVMLCAGEMGGGKDTCRDDSGGPLICD----GILQGTTSYGPV-PCGKPGVPAIYTNLIKFNSWIKDTMMKNA TRP CA 491 1ELC A 1ELCA...hain> 1ELC A 1ELCA PLHCLVNGQYAVHG... PRO CA 225 1ELC A 1ELCA

  9. The vitamin B1 metabolism of Staphylococcus aureus is controlled at enzymatic and transcriptional levels

    NARCIS (Netherlands)

    Müller, Ingrid B; Bergmann, Bärbel; Groves, Matthew R; Couto, Isabel; Amaral, Leonard; Begley, Tadhg P; Walter, Rolf D; Wrenger, Carsten

    2009-01-01

    Vitamin B1 is in its active form thiamine pyrophosphate (TPP), an essential cofactor for several key enzymes in the carbohydrate metabolism. Mammals must salvage this crucial nutrient from their diet in order to complement the deficiency of de novo synthesis. In the human pathogenic bacterium Staphy

  10. 26 CFR 49.4262(b)-1 - Exclusion of certain travel.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 16 2010-04-01 2010-04-01 true Exclusion of certain travel. 49.4262(b)-1... Exclusion of certain travel. (a) In general. Under section 4262(b) taxable transportation does not include... computing tax on travel not excluded. (1) Where a payment is made for transportation which...

  11. 26 CFR 11.401(b)-1 - Certain retroactive changes in plan.

    Science.gov (United States)

    2010-04-01

    ... (CONTINUED) INCOME TAX (CONTINUED) TEMPORARY INCOME TAX REGULATIONS UNDER THE EMPLOYEE RETIREMENT INCOME SECURITY ACT OF 1974 § 11.401(b)-1 Certain retroactive changes in plan. (a) General rule. (1) Under section... provision of— (1) A plan as adopted, (2) A plan amendment, or (3) The Employee Income Security Act of...

  12. Data of evolutionary structure change: 1B1GA-1AK8A [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available entryIDChain>1B1GA KEGDP-NQLSK > - EEE...> A 1AK8A FDKDGDGTITT H ...A LFEEL---DKNGD >HHHHH--- ...entryIDChain>1AK8A LQDMINEVDADGN ...>HHHHH > ATOM 722 CA LEU A 48 3.325 7.917 -3.325 1.00 0

  13. Analytical potential energy function and spectroscopyparameters for B1Ⅱ state of KH

    Institute of Scientific and Technical Information of China (English)

    Jingjuan Liang; Chuanlu Yang; Lizhi Wang; Qinggang Zhang

    2011-01-01

    Multi-reference configuration interaction is used to produce potential energy curves (PECs) for the excited B1II state of KH molecule. To investigate the correlation effect of core-valence electrons, five schemes are employed which include the different correlated electrons and different active spaces. The PECs are fitted into analytical potential energy functions (APEFs). The spectroscopic parameters, ro-vibrational levels, and transition frequencies are determined based on the APEFs and compared with available experimental and theoretical data. The molecular properties for B1II obtained in this letter, which are better than those available in literature, can be reproduced with calculations using the suitable correlated electrons and active space of orbitals.%Multi-reference configuration interaction is used to produce potential energy curves (PECs) for the excited B1Ⅱ state of KH molecule.To investigate the correlation effect of core-valence electrons,five schemes are employed which include the different correlated electrons and different active spaces.The PECs are fitted into analytical potential energy functions (APEFs).The spectroscopic parameters,ro-vibrational levels,and transition frequencies are determined based on the APEFs and compared with available experimental and theoretical data.The molecular properties for B1Ⅱ obtained in this letter,which are better than those available in literature,can be reproduced with calculations using the suitable correlated electrons and active space of orbitals.

  14. Periprosthetic Vancouver type B1 and C fractures treated by locking-plate osteosynthesis

    DEFF Research Database (Denmark)

    Froberg, Lonnie; Troelsen, Anders; Brix, Michael

    2012-01-01

    internal fixation, and the introduction of locking-plate osteosynthesis may lead to improved outcome. We evaluated the outcome of Vancouver type B1 and C PFFs treated by locking-plate osteosynthesis, by assessing rates of fracture union and reoperations and by analyzing failure cases....

  15. BIOCONTROL OF ASPERGILLUS FLAVUS AND AFLATOXIN B1 PRODUCTION IN CORN

    Directory of Open Access Journals (Sweden)

    A. Khanafari, H. Soudi, M. Miraboulfathi

    2007-07-01

    Full Text Available The potent mycotoxin aflatoxin B1 is a secondary metabolite of Aspergillus fungi that grow, on a variety of food and feed commodities at any stage during growth, harvest, storage and transportation. The occurrence of aflatoxin contamination is global, with severe problems especially prevalent in developing countries. In present study, corn samples were contaminated with aflatoxin B1 in the concentration of 240 µg/kg. Four trials were inoculated by Lactobacillus plantarum (PTCC 1058. Three control assays were analysed in the same conditions. All the assays were kneaded and incubated for 4-7 days at 37°C. Aflatoxin B1 was determined after extraction by HPLC. Results showed a drastic removal of the mycotoxin with a reduction of 77 % for Aflatoxin B1 by Lactobacillus plantarum. In the Inoculated corns, spore germination of A. flavus was totally inhibited. Results in inoculated spikes showed a high percentage of reduction of aflatoxin after incubation by Lb. plantarum. Gram staining of a sample from inoculated corns and microscopic observation demonstrated that the growth of A. flavus spores was totally inhibited by Lb. plantarum. Fungal spores were surrounded by Lactobacillus plantarum and spores were degraded.

  16. Analysis of aflatoxins B1 and G1 in maize by quechers

    Directory of Open Access Journals (Sweden)

    Bursić Vojislava P.

    2013-01-01

    Full Text Available A reliable and easy method has been developed for the determination of aflatoxins B1 and G2 in maize samples. High performance liquid chromatography coupled with FLD (HPLC-FLD with photochemical derivatization was used. Mycotoxins were extracted from maize using a QuEChERS-based extraction procedure. The optimized analytical conditions were evaluated in terms of recoveries, reproducibility, LOD, LOQ and linearity for aflatoxin B1 and aflatoxin G1 in maize. Extraction, chromatographic and detection conditions were optimized in order to increase sample sensitivity. The linearity was analyzed in the range of 0.4-20 μg/kg and the correlation coefficients (R2 were higher than 0.99 for aflatoxins B1 and G1. Blank samples were spiked at 1.0, 2.0 and 4.0 μg/kg, and the average recovery for aflatoxin G1 was 96.96±1.72% and for aflatoxin B1 it was 86.80±1.24%. RSDs were lower than 25% for both mycotoxins. LOD for both aflatoxins was 0.5 μg/kg and LOQ was 1.0 μg/kg, respectively.

  17. 26 CFR 1.669(b)-1A - Tax on distribution.

    Science.gov (United States)

    2010-04-01

    ... (CONTINUED) INCOME TAXES Treatment of Excess Distributions of Trusts Applicable to Taxable Years Beginning... distribution is paid, credited, or required to be distributed to him, (a) With the inclusion in gross income of... 26 Internal Revenue 8 2010-04-01 2010-04-01 false Tax on distribution. 1.669(b)-1A Section...

  18. 17 CFR 270.34b-1 - Sales literature deemed to be misleading.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Sales literature deemed to be... (CONTINUED) RULES AND REGULATIONS, INVESTMENT COMPANY ACT OF 1940 § 270.34b-1 Sales literature deemed to be misleading. Any advertisement, pamphlet, circular, form letter, or other sales literature addressed to...

  19. Effect of fungicide on Fusarium verticillioides mycelial morphology and fumonisin B 1 production

    Science.gov (United States)

    Miguel, Tatiana de Á.; Bordini, Jaqueline G.; Saito, Gervásio H.; Andrade, Célia G.T. de J.; Ono, Mario A.; Hirooka, Elisa Y.; Vizoni, Édio; Ono, Elisabete Y.S.

    2015-01-01

    The effect of fludioxonil + metalaxyl-M on the mycelial morphology, sporulation and fumonisin B 1 production by Fusarium verticillioides 103 F was evaluated. Scanning electron microscopy analysis showed that the fungicide caused inhibition of hyphal growth and defects on hyphae morphology such as cell wall disruption, withered hyphae, and excessive septation. In addition, extracellular material around the hyphae was rarely observed in the presence of fludioxonil + metalaxyl-M. While promoting the reduction of mycelial growth, the fungicide increased sporulation of F. verticillioides compared to the control, and the highest production occurred on the 14 th day in the treatments and on the 10 th day in the control cultures. Fumonisin B 1 production in the culture media containing the fungicide (treatment) was detected from the 7 th day incubation, whereas in cultures without fungicide (control) it was detected on the 10 th day. The highest fumonisin B 1 production occurred on the 14 th day, both for the control and for the treatment. Fludioxonil + metalaxyl - M can interfere in F. verticillioides mycelial morphology and sporulation and increase fumonisin B 1 levels. These data indicate the importance of understanding the effects of fungicide to minimize the occurrence of toxigenic fungi and fumonisins. PMID:26221120

  20. A novel role for adipose ephrin-B1 in inflammatory response.

    Directory of Open Access Journals (Sweden)

    Takuya Mori

    Full Text Available AIMS: Ephrin-B1 (EfnB1 was selected among genes of unknown function in adipocytes or adipose tissue and subjected to thorough analysis to understand its role in the development of obesity. METHODS AND RESULTS: EfnB1 mRNA and protein levels were significantly decreased in adipose tissues of obese mice and such reduction was mainly observed in mature adipocytes. Exposure of 3T3-L1 adipocytes to tumor necrosis factor-α (TNF-α and their culture with RAW264.7 cells reduced EFNB1 levels. Knockdown of adipose EFNB1 increased monocyte chemoattractant protein-1 (Mcp-1 mRNA level and augmented the TNF-α-mediated THP-1 monocyte adhesion to adipocytes. Adenovirus-mediated adipose EFNB1-overexpression significantly reduced the increase in Mcp-1 mRNA level induced by coculture of 3T3-L1 adipocytes with RAW264.7 cells. Monocyte adherent assay showed that adipose EfnB1-overexpression significantly decreased the increase of monocyte adhesion by coculture with RAW264.7 cells. TNF-α-induced activation of extracellular signal-regulated kinase 1/2 (ERK1/2 was reduced by EFNB1-overexpression. CONCLUSIONS: EFNB1 contributes to the suppression of adipose inflammatory response. In obesity, reduction of adipose EFNB1 may accelerate the vicious cycle involved in adipose tissue inflammation.

  1. ATP8B1 deficiency; Pathophysiology and treatment of a cholestatic syndrome with extrahepatic symptoms

    NARCIS (Netherlands)

    Stapelbroek, J.M.

    2009-01-01

    ATP8B1 deficiency is a severe and clinically highly variable hereditary disorder that is primarily characterized by intrahepatic cholestasis. It generally presents as a permanent disorder, progressive familial intrahepatic cholestasis type 1 (PFIC1), or with intermittent cholestasis (benign recurren

  2. 26 CFR 41.4482(b)-1 - Definition of taxable gross weight.

    Science.gov (United States)

    2010-04-01

    ... oilfield machinery, etc.) mounted on the vehicle for use on construction jobs, in oilfield operations, etc...) MISCELLANEOUS EXCISE TAXES EXCISE TAX ON USE OF CERTAIN HIGHWAY MOTOR VEHICLES Tax on Use of Certain Highway Motor Vehicles § 41.4482(b)-1 Definition of taxable gross weight. (a) Actual unloaded weight—(1)...

  3. Data of evolutionary structure change: 1BT8B-1UNFX [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1BT8B-1UNFX 1BT8 1UNF B X ---AVYTLPELPYDYSALEPYISGEIMELHHDKHHKAYV...EEEEEEEEEGGG EEEEEEE EEE EEE HHHH HHHHHHHHHH EEHHHHHHHHHHHHHH EVID> 1UNF X 1UNFX VN...d>2.942183017730713 5.374790191650391 ...> TRP CA 395 ASP CA 318 ASP CA 362 1UNF

  4. A NEW CELL CLONE DERIVED FROM TRICHOPLUSIA NI TN5B1-4 CELLS

    Institute of Scientific and Technical Information of China (English)

    Jian-xiaoTian; Chang-youLi; Gui-lingZheng; Guo-xunLi; PingWang; Granados

    2004-01-01

    The characteristics of a cultured cell line do not always remain stable and may change upon continuous passage. Most continuous cell lines, even after cloning, possess several genotypes that are constantly changing. There are numerous selective and adaptive culture processes, in addition to genetic instability, that may improve phenotypic change in cell growth, virus susceptibility, gene expression, and production of virus. Similar detrimental effects of long term passaging of insect cells have also been reported for continuous cell lines, for example, Tn5B 1-4 cells, which are the most widely used for the baculovirus expression vector system (BEVS), provide superior production of recombinant proteins,however, this high productivity may be more evident in low passage cells. In this paper, we describe the isolation of a cell clone, Tn5B-40, from low passage Tn5B 1-4 cells. The growth characteristics,productions of virus, and high level of recombinant protein productions were determined. The results showed the susceptibility of both clone and Tn5B 1-4 cells to wild-type AcNPV was approximately the same rate with over 95% of infection; when the cloned cells were infected with recombinant baculoviruses expressing β-galactosidase and secreted alkaline phosphatase (SEAP), expression of the recombinant proteins from the cloned cells exceeded that from the parental Tn5B 1-4 cells.

  5. Comparison of antibody production against aflatoxin B1 in goats and rabbits.

    OpenAIRE

    Gaur, P K; El-Nakib, O; Chu, F. S.

    1980-01-01

    Antibody production against aflatoxin B1 was compared in three rabbits and one goat. Titers obtained were 20 times higher in the rabbits than in the goat. The goat antiserum appeared to have a higher degree of cross-reactivity for other aflatoxins and related metabolites than did the rabbit antiserum.

  6. Genome sequence of the Bacteroides fragilis phage ATCC 51477-B1

    OpenAIRE

    Hawkins Shawn A; Layton Alice C; Ripp Steven; Williams Dan; Sayler Gary S

    2008-01-01

    Abstract The genome of a fecal pollution indicator phage, Bacteroides fragilis ATCC 51477-B1, was sequenced and consisted of 44,929 bases with a G+C content of 38.7%. Forty-six putative open reading frames were identified and genes were organized into functional clusters for host specificity, lysis, replication and regulation, and packaging and structural proteins.

  7. Genome sequence of the Bacteroides fragilis phage ATCC 51477-B1

    OpenAIRE

    Hawkins, Shawn A; Layton, Alice C.; Ripp, Steven; Williams, Dan; Sayler, Gary S.

    2008-01-01

    The genome of a fecal pollution indicator phage, Bacteroides fragilis ATCC 51477-B1, was sequenced and consisted of 44,929 bases with a G+C content of 38.7%. Forty-six putative open reading frames were identified and genes were organized into functional clusters for host specificity, lysis, replication and regulation, and packaging and structural proteins.

  8. Gene expression profile in liver of hB1F transgenic mice

    Institute of Scientific and Technical Information of China (English)

    Shui-Liang Wang; Hua Yang; You-Hua Xie; Yuan Wang; Jian-Zhong Li; Long Wang; Zhu-Gang Wang; Ji-Liang Fu

    2004-01-01

    AIM: To analyze the tissue morphologic phenotype and liver gene expression profile of hB1F transgenic mice.METHODS: Transgene expression was analyzed with RTPCR and Western blotting. For one of the transgenic mouse lines, tissue expression pattern of the transgene was also examined with immunochemical methods. Pathological analysis was used to examine the tissue morphologic phenotype of established transgenic mice. The liver gene expression profile of transgenic mice was analyzed with microchip, and some of the differentially expressed genes were verified with RT-PCR.RESULTS: The expressions of hB1F were shown in livers from 6 of 7 transgenic mouse lines. The overexpression of hB1F transgene did not cause pathological changes. Expressions of three genes were up-regulated, while down-regulation was observed for 25 genes.CONCLUSION: The overexpression of hB1F transgene may cause changes of gene expression profiles in the liver of transgenic mice.

  9. 高效液相色谱柱后光化学反应-荧光检测茶叶中黄曲霉毒素 B1%Determination of Aflatoxins B1 in Tea by High Performance Liquid Chromatography-Fluorescence Detector with Post-column Photochemical Reaction

    Institute of Scientific and Technical Information of China (English)

    赵浩军; 王坤; 杨卫花; 杨朝义

    2013-01-01

      建立了高效液相色谱/光化学反应器/荧光检测器测定茶叶中黄曲霉毒素 B1的方法。用乙腈水溶液(V∶V=86∶14)提取黄曲霉毒素 B1,提取液经净化柱和黄曲霉毒素 B1免疫亲和柱净化,高效液相色谱测定。在黄曲霉毒素 B1标准溶液质量浓度为0.591~5.91μg/L 时,峰面积与浓度呈现良好的线性关系,黄曲霉毒素 B1的回收率为85.4%~98.9%(添加量分别为0.510μg/kg、7.090μg/kg 和14.180μg/kg),相对标准偏差为0.2%~1.8%,方法检出限为0.1μg/kg。运用所建立方法对市售的8个茶样及加标样品中的黄曲霉毒素 B1进行检测,结果显示该方法选择性强、灵敏度高,适合茶叶中黄曲霉毒素 B1的测定。%A new method for the sensitive determination of Aflatoxins B1 in tea by high performance liquid chromatography with photoelectric reactor and fluorescence detector was established. A solution of V(acetonitrile)∶V(H2O)=86∶14 was used to extract Aflatoxins B1 from tea. The extracted solution was then purified by a multifunctional and immuneaffinity column, respectively. The peak area and the concentration of Aflatoxins B1 showed a good linear relationship within the range from 0.591 μg/L to 5.91 μg/L with a linear correlation coefficient (r) of 0.9994. The recoveries at the concentrations studied [low level (7.090 μg/kg), high level (14.180 μg/kg)] were between 85.6% and 98.9% with a relative standard deviations ranging from 1.7% to 1.8%. The limit of detection (LOD) is 0.1 μg/kg (S/N=3). The limit of quantitation (LOQ) is (0.591 μg/kg). The new method was used to analyze eight tea samples collected from the local markets and negative results were obtained. The method is suitable for detection of Aflatoxins B1 in tea with high selectivity and sensitivity.

  10. Genetic variation in the HSD17B1 gene and risk of prostate cancer.

    Directory of Open Access Journals (Sweden)

    Peter Kraft

    2005-11-01

    Full Text Available Steroid hormones are believed to play an important role in prostate carcinogenesis, but epidemiological evidence linking prostate cancer and steroid hormone genes has been inconclusive, in part due to small sample sizes or incomplete characterization of genetic variation at the locus of interest. Here we report on the results of a comprehensive study of the association between HSD17B1 and prostate cancer by the Breast and Prostate Cancer Cohort Consortium, a large collaborative study. HSD17B1 encodes 17beta-hydroxysteroid dehydrogenase 1, an enzyme that converts dihydroepiandrosterone to the testosterone precursor Delta5-androsterone-3beta,17beta-diol and converts estrone to estradiol. The Breast and Prostate Cancer Cohort Consortium researchers systematically characterized variation in HSD17B1 by targeted resequencing and dense genotyping; selected haplotype-tagging single nucleotide polymorphisms (htSNPs that efficiently predict common variants in U.S. and European whites, Latinos, Japanese Americans, and Native Hawaiians; and genotyped these htSNPs in 8,290 prostate cancer cases and 9,367 study-, age-, and ethnicity-matched controls. We found no evidence that HSD17B1 htSNPs (including the nonsynonymous coding SNP S312G or htSNP haplotypes were associated with risk of prostate cancer or tumor stage in the pooled multiethnic sample or in U.S. and European whites. Analyses stratified by age, body mass index, and family history of disease found no subgroup-specific associations between these HSD17B1 htSNPs and prostate cancer. We found significant evidence of heterogeneity in associations between HSD17B1 haplotypes and prostate cancer across ethnicity: one haplotype had a significant (p < 0.002 inverse association with risk of prostate cancer in Latinos and Japanese Americans but showed no evidence of association in African Americans, Native Hawaiians, or whites. However, the smaller numbers of Latinos and Japanese Americans in this study makes

  11. Expression of HER2 and bradykinin B1 receptors in precursor lesions of gallbladder carcinoma

    Institute of Scientific and Technical Information of China (English)

    Cesar Toledo; Carola E Matus; Ximena Barraza; Pamela Arroyo; Pamela Ehrenfeld; Carlos D Figueroa; Kanti D Bhoola; Maeva del Pozo; Maria T Poblete

    2012-01-01

    AIM:TO determine the expression of HER2 and bradykinin B1 receptors (B1R) in the two pathogenic models of gallbladder cancer:the metaplasia-dysplasia-carcinoma and the adenoma-carcinoma pathways.METHODS:Receptor proteins were visualized by immunohistochemistry on 5-μm sections of paraffin-embedded tissue.Expression of both receptors was studied in biopsy samples from 92 patients (6 males and 86 females; age ranging from 28 to 86 years,mean 56 years).High HER2 expression in specimens was additionally investigated by fluorescence in situ hybridization.Cell proliferation in each sample was assessed by using the Ki-67 proliferation marker.RESULTS:HER2 receptor protein was absent in adenomas and in normal gallbladder epithelium.On the contrary,there was intense staining for HER2 on the basolateral membrane of epithelial cells of intestinal metaplasia (22/24; 91.7%) and carcinoma in situ (9/10;90%),the lesions that displayed a significantly high proliferation index.Protein up-regulation of HER2 in the epithelium with metaplasia or carcinoma in situ was not accompanied by HER2 gene amplification.A similar result was observed in invasive carcinomas (0/12).The B1R distribution pattern mirrored that of HER2 except that B1R was additionally observed in the adenomas.The B1R appeared either as cytoplasmic dots or labelingon the apical cell membrane of the cells composing the epithelia with intestinal metaplasia (24/24; 100%) and carcinoma in situ (10/10; 100%) and in the epithelial cells of adenomas.In contrast,both HER2 (4/12; 33%)and B1R (1/12; 8.3%) showed a low expression in invasive gallbladder carcinomas.CONCLUSION:The up-regulation of HER2 and B1R in precursor lesions of gallbladder carcinoma suggests cross-talk between these two receptors that may be of importance in the modulation of cell proliferation in gallbladder carcinogenesis.

  12. Genetic variation in the HSD17B1 gene and risk of prostate cancer.

    Science.gov (United States)

    Kraft, Peter; Pharoah, Paul; Chanock, Stephen J; Albanes, Demetrius; Kolonel, Laurence N; Hayes, Richard B; Altshuler, David; Andriole, Gerald; Berg, Christine; Boeing, Heiner; Burtt, Noel P; Bueno-de-Mesquita, Bas; Calle, Eugenia E; Cann, Howard; Canzian, Federico; Chen, Yen-Ching; Crawford, David E; Dunning, Alison M; Feigelson, Heather S; Freedman, Matthew L; Gaziano, John M; Giovannucci, Ed; Gonzalez, Carlos Alberto; Haiman, Christopher A; Hallmans, Goran; Henderson, Brian E; Hirschhorn, Joel N; Hunter, David J; Kaaks, Rudolf; Key, Timothy; Le Marchand, Loic; Ma, Jing; Overvad, Kim; Palli, Domenico; Pike, Malcolm C; Riboli, Elio; Rodriguez, Carmen; Setiawan, Wendy V; Stampfer, Meir J; Stram, Daniel O; Thomas, Gilles; Thun, Michael J; Travis, Ruth; Trichopoulou, Antonia; Virtamo, Jarmo; Wacholder, Sholom

    2005-11-01

    Steroid hormones are believed to play an important role in prostate carcinogenesis, but epidemiological evidence linking prostate cancer and steroid hormone genes has been inconclusive, in part due to small sample sizes or incomplete characterization of genetic variation at the locus of interest. Here we report on the results of a comprehensive study of the association between HSD17B1 and prostate cancer by the Breast and Prostate Cancer Cohort Consortium, a large collaborative study. HSD17B1 encodes 17beta-hydroxysteroid dehydrogenase 1, an enzyme that converts dihydroepiandrosterone to the testosterone precursor Delta5-androsterone-3beta,17beta-diol and converts estrone to estradiol. The Breast and Prostate Cancer Cohort Consortium researchers systematically characterized variation in HSD17B1 by targeted resequencing and dense genotyping; selected haplotype-tagging single nucleotide polymorphisms (htSNPs) that efficiently predict common variants in U.S. and European whites, Latinos, Japanese Americans, and Native Hawaiians; and genotyped these htSNPs in 8,290 prostate cancer cases and 9,367 study-, age-, and ethnicity-matched controls. We found no evidence that HSD17B1 htSNPs (including the nonsynonymous coding SNP S312G) or htSNP haplotypes were associated with risk of prostate cancer or tumor stage in the pooled multiethnic sample or in U.S. and European whites. Analyses stratified by age, body mass index, and family history of disease found no subgroup-specific associations between these HSD17B1 htSNPs and prostate cancer. We found significant evidence of heterogeneity in associations between HSD17B1 haplotypes and prostate cancer across ethnicity: one haplotype had a significant (p < 0.002) inverse association with risk of prostate cancer in Latinos and Japanese Americans but showed no evidence of association in African Americans, Native Hawaiians, or whites. However, the smaller numbers of Latinos and Japanese Americans in this study makes these subgroup

  13. Research Nuclear Reactors

    International Nuclear Information System (INIS)

    Published in English and in French, this large report first proposes an overview of the use and history of research nuclear reactors. It discusses their definition, and presents the various types of research reactors which can be either related to nuclear power (critical mock-ups, material test reactors, safety test reactors, training reactors, prototypes), or to research (basic research, industry, health), or to specific particle physics phenomena (neutron diffraction, isotope production, neutron activation, neutron radiography, semiconductor doping). It reports the history of the French research reactors by distinguishing the first atomic pile (ZOE), and the activities and achievements during the fifties, the sixties and the seventies. It also addresses the development of instrumentation for research reactors (neutron, thermal, mechanical and fission gas release measurements). The other parts of the report concern the validation of neutronics calculations for different reactors (the EOLE water critical mock-up, the MASURCA air critical mock-up dedicated to fast neutron reactor study, the MINERVE water critical mock-up, the CALIBAN pulsed research reactor), the testing of materials under irradiation (OSIRIS reactor, laboratories associated with research reactors, the Jules Horowitz reactor and its experimental programs and related devices, irradiation of materials with ion beams), the investigation of accident situations (on the CABRI, Phebus, Silene and Jules Horowitz reactors). The last part proposes a worldwide overview of research reactors

  14. B1a lymphocytes in the rectal mucosa of ulcerative colitis patients

    Institute of Scientific and Technical Information of China (English)

    Lino Polese; Stefano Merigliano; Riccardo Boetto; Giuseppe De Franchis; Imerio Angriman; Andrea Porzionato; Lorenzo Norberto; Giacomo Carlo Sturniolo; Veronica Macchi; Raffaele De Caro

    2012-01-01

    AIM: To assess B1a cell expression in the rectal mucosa of ulcerative colitis (UC) patients in comparison with healthy controls. METHODS: Rectal mucosa biopsies were collected from 15 UC patients and 17 healthy controls. CD5+ B cells were analysed by three colour flow cytometry from rectal mucosal samples after mechanical disaggregation by Medimachine?. Immunohistochemical analysis of B and T lymphocytes was also performed. Correlations between, on the one hand, rectal B1a cell concentrations and, on the other, erythrocyte sedimentation rate and C-reactive protein levels and clinical, endoscopic and histological disease activity indices were evaluated.RESULTS: Rectal B-lymphocyte (CD19+/CD45+) rate and concentration were higher in UC patients compared with those in healthy controls (47.85% ± 3.12% vs 26.10% ± 3.40%, P = 0.001 and 501 ± 91 cells/ mm2 vs 117 ± 18 cells/mm2, P < 0.001); Rectal B1a cell density (CD5+CD19+) was higher in UC patients than in healthy controls (85 ± 15 cells/mm2 vs 31 ± 6.7 cells/mm2, P = 0.009). Rectal B1a cell (CD5/CD19+) rate correlated inversely with endoscopic classification (Rs = -0.637, P < 0.05). CONCLUSION: B1a lymphocytes seem to be involved in the pathogenesis of UC, however, the role they play in its early phases and in disease activity, have yet to be defined.

  15. Acute toxicity of aflatoxin B1 and rubratoxin B in dogs.

    Science.gov (United States)

    Hayes, A W; Williams, W L

    1978-01-01

    The effect of ip administrated aflatoxin B1 and rubratoxin B, singly and in combination, on dogs was determined by serum tests, by observations of clinical signs and survival times, and by evaluation of gross and microscopic lesions. The dog is sensitive to the toxic effects of both mycotoxins. Glutamic-oxaloacetic transaminase, lactic dehydrogenase and alkaline phosphatase activities and survival time varied in relation to dose and to the mycotoxin(s) administered. All three plasma enzymes were elevated regardless of dose with the combination of aflatoxin B1/rubratoxin B at 24 hr after dosing, except LDH, which was within the normal range but only at the lowest dose level. Several serum constituents including BUN, cholesterol, uric acid, and total bilirubin were elevated, whereas serum glucose was depressed in dogs treated with the multiple-toxin regimen; these changes were not seen in dogs given only aflatoxin B1 but were characteristic in rubratoxin-treated animals. In general, gross findings at necropsy were similar in all dogs regardless of the dose regimen. A striking similarity existed in the histologic changes observed between lesions experimentally induced by the mycotoxin combination and those lesions reported for dogs fed toxic feed in laboratory studies or in natural cases of hepatitis X. Of particular similarity were the severe kidney lesions observed in dogs exposed to the mycotoxin combination and kidney lesions reported in natural outbreaks of hepatitis X. There can be little doubt of an association between hepatitis X and aflatoxin B1, although it is apparent that the disease probably involves more than a single toxic factor. Our results suggest that hepatitis X in dogs includes aflatoxin B1 as a primary etiological factor but that rubratoxin B also may be involved. PMID:581496

  16. Fumonisin B(1) is hepatotoxic and nephrotoxic in milk-fed calves.

    Science.gov (United States)

    Mathur, S; Constable, P D; Eppley, R M; Waggoner, A L; Tumbleson, M E; Haschek, W M

    2001-04-01

    Fumonisins are a group of mycotoxins that alter sphingolipid biosynthesis and induce leukoencephalomalacia in horses and pulmonary edema in pigs. Experimental administration of fumonisin induces hepatotoxicity in all species, including cattle, as well as nephrotoxicity in rats, rabbits, and sheep. We investigated the hepatotoxicity and nephrotoxicity of fumonisin B(1) to calves. Ten milk-fed male Holstein calves aged 7 to 14 days were instrumented to obtain blood and urine. Treated calves (n = 5) were administered fumonisin B(1) at 1 mg/kg, iv, daily and controls (n = 5) 10 ml 0.9% NaCl, iv, daily until euthanized on day 7. Fumonisin B(1)-treated calves were lethargic and had decreased appetite from day 4 onward, serum biochemical evidence of severe liver and bile duct injury, and impaired hepatic function. Treated calves also had biochemical evidence of renal injury that functionally involved the proximal convoluted tubules. Sphinganine and sphingosine concentrations in liver, kidney, lung, heart, and skeletal muscle were increased in treated calves. Sphinganine, but not sphingosine, concentration was increased in brains of treated calves. In fumonisin B(1)-treated calves, hepatic lesions were characterized by disorganized hepatic cords, varying severity of hepatocyte apoptosis, hepatocyte proliferation, and proliferation of bile ductular cells. Renal lesions in treated calves consisted of vacuolar change, apoptosis, karyomegaly, and proliferation of proximal renal tubular cells, as well as dilation of proximal renal tubules, which contained cellular debris and protein. This is the first report of fumonisin B(1)-induced renal injury and organ sphingolipid alterations in cattle.

  17. miR-379 regulates cyclin B1 expression and is decreased in breast cancer.

    Directory of Open Access Journals (Sweden)

    Sonja Khan

    Full Text Available MicroRNAs are small non-coding RNA molecules that control gene expression post-transcriptionally, and are known to be altered in many diseases including breast cancer. The aim of this study was to determine the relevance of miR-379 in breast cancer. miR-379 expression was quantified in clinical samples including tissues from breast cancer patients (n=103, healthy controls (n=30 and patients with benign breast disease (n=35. The level of miR-379 and its putative target Cyclin B1 were investigated on all breast tissue specimens by RQ-PCR. Potential relationships with gene expression and patient clinicopathological details were also determined. The effect of miR-379 on Cyclin B1 protein expression and function was investigated using western blot, immunohistochemistry and proliferation assays respectively. Finally, the levels of circulating miR-379 were determined in whole blood from patients with breast cancer (n=40 and healthy controls (n=34. The level of miR-379 expression was significantly decreased in breast cancer (Mean(SEM 1.9 (0.09 Log10 Relative Quantity (RQ compared to normal breast tissues (2.6 (0.16 Log10 RQ, p<0.01. miR-379 was also found to decrease significantly with increasing tumour stage. A significant negative correlation was determined between miR-379 and Cyclin B1 (r=-0.31, p<0.001. Functional assays revealed reduced proliferation (p<0.05 and decreased Cyclin B1 protein levels following transfection of breast cancer cells with miR-379. Circulating miR-379 was not significantly dysregulated in patients with breast cancer compared to healthy controls (p=0.42. This data presents miR-379 as a novel regulator of Cyclin B1 expression, with significant loss of the miRNA observed in breast tumours.

  18. SLCO1B1 Variants and Angiotensin Converting Enzyme Inhibitor (Enalapril) -Induced Cough: a Pharmacogenetic Study

    Science.gov (United States)

    Luo, Jian-Quan; He, Fa-Zhong; Wang, Zhen-Min; Sun, Ning-Ling; Wang, Lu-Yan; Tang, Gen-Fu; Liu, Mou-Ze; Li, Qing; Chen, Xiao-Ping; Liu, Zhao-Qian; Zhou, Hong-Hao; Zhang, Wei

    2015-01-01

    Clinical observations suggest that incidence of cough in Chinese taking angiotensin converting enzyme inhibitors is much higher than other racial groups. Cough is the most common adverse reaction of enalapril. We investigate whether SLCO1B1 genetic polymorphisms, previously reported to be important determinants of inter-individual variability in enalapril pharmacokinetics, are associated with the enalapril-induced cough. A cohort of 450 patients with essential hypertension taking 10 mg enalapril maleate were genotyped for the functional SLCO1B1 variants, 388A > G (Asn130Asp, rs2306283) and 521T > C (Val174Ala, rs4149056). The primary endpoint was cough, which was recorded when participants were bothered by cough and respiratory symptoms during enalapril treatment without an identifiable cause. SLCO1B1 521C allele conferred a 2-fold relative risk of enalapril-induced cough (95% confidence interval [CI] = 1.34–3.04, P = 6.2 × 10−4), and haplotype analysis suggested the relative risk of cough was 6.94-fold (95% CI = 1.30–37.07, P = 0.020) in SLCO1B1*15/*15 carriers. Furthermore, there was strong evidence for a gene-dose effect (percent with cough in those with 0, 1, or 2 copy of the 521C allele: 28.2%, 42.5%, and 71.4%, trend P = 6.6 × 10−4). Our study highlights, for the first time, SLCO1B1 variants are strongly associated with an increased risk of enalapril-induced cough. The findings will be useful to provide pharmacogenetic markers for enalapril treatment. PMID:26607661

  19. Reactor Physics Training

    International Nuclear Information System (INIS)

    University courses in nuclear reactor physics at the universities consist of a theoretical description of the physics and technology of nuclear reactors. In order to demonstrate the basic concepts in reactor physics, training exercises in nuclear reactor installations are also desirable. Since the number of reactor facilities is however strongly decreasing in Europe, it becomes difficult to offer to students a means for demonstrating the basic concepts in reactor physics by performing training exercises in nuclear installations. Universities do not generally possess the capabilities for performing training exercises. Therefore, SCK-CEN offers universities the possibility to perform (on a commercial basis) training exercises at its infrastructure consisting of two research reactors (BR1 and VENUS). Besides the organisation of training exercises in the framework of university courses, SCK-CEN also organizes theoretical courses in reactor physics for the education and training of nuclear reactor operators. It is indeed a very important subject to guarantee the safe operation of present and future nuclear reactors. In this framework, an understanding of the fundamental principles of nuclear reactor physics is also necessary for reactor operators. Therefore, the organisation of a basic Nuclear reactor physics course at the level of reactor operators in the initial and continuous training of reactor operators has proven to be indispensable. In most countries, such training also results from the direct request from the safety authorities to assure the high level of competence of the staff in nuclear reactors. The objectives this activity are: (1) to provide training and education activities in reactor physics for university students and (2) to organise courses in nuclear reactor physics for reactor operators

  20. Study of infrared emission spectroscopy for the B(1)Δg-A(1)Πu and B'(1)Σg(+)-A(1)Πu systems of C2.

    Science.gov (United States)

    Chen, Wang; Kawaguchi, Kentarou; Bernath, Peter F; Tang, Jian

    2016-02-14

    Thirteen bands for the B(1)Δg-A(1)Πu system and eleven bands for the B'(1)Σg(+)-A(1)Πu system of C2 were identified in the Fourier transform infrared emission spectra of hydrocarbon discharges. The B'(1)Σg(+)v = 4 and the B(1)Δg v = 6, 7, and 8 vibrational levels involved in nine bands were studied for the first time. A direct global analysis with Dunham parameters was carried out satisfactorily for the B(1)Δg-A(1)Πu system except for a small perturbation in the B(1)Δg v = 6 level. The calculated rovibrational term energies up to B(1)Δg v = 12 showed that the level crossing between the B(1)Δg and d(3)Πg states is responsible for many of the prominent perturbations in the Swan system observed previously. Nineteen forbidden transitions of the B(1)Δg-a(3)Πu transition were identified and the off-diagonal spin-orbit interaction constant AdB between d(3)Πg and B(1)Δg was derived as 8.3(1) cm(-1). For the B'(1)Σg(+)-A(1)Πu system, only individual band analyses for each vibrational level in the B'(1)Σg(+) state could be done satisfactorily and Dunham parameters obtained from these effective parameters showed that the anharmonic vibrational constant ωexe is anomalously small (nearly zero). Inspection of the RKR (Rydberg-Klein-Rees) potential curves for the B'(1)Σg(+) and X(1)Σg(+) states revealed that an avoided crossing or nearly avoided crossing may occur around 30,000 cm(-1), which is responsible for the anomalous molecular constants in these two states. PMID:26874482

  1. Parâmetros hematológicos de frangos de corte alimentados com ração contendo aflatoxina B1 e fumonisina B1

    Directory of Open Access Journals (Sweden)

    Tessari Eliana Neire Castiglioni

    2006-01-01

    Full Text Available O objetivo deste trabalho foi avaliar os efeitos da aflatoxina B1 (AFB1 e da fumonisina B1 (FB1 sobre o hemograma e o leucograma de frangos alimentados com ração contendo as toxinas isoladamente e em associação, nos níveis de 0, 50 e 200mig de AFB1/kg, e/ou 0, 50 e 200mg de FB1/kg. O delineamento experimental foi inteiramente casualizado, em esquema fatorial 3x3, com 9 tratamentos e 12 repetições, totalizando 108 aves. Os frangos foram alimentados com as rações contaminadas do 8degrees até o 41degrees dia de vida. As aves de todos os grupos alimentados com micotoxinas apresentaram redução (P<0,05 nos valores de hematócrito, hemoglobina e número de hemácias, caracterizando um quadro de anemia, sendo que os grupos mais afetados foram os que receberam as maiores concentrações das toxinas em associação. Observou-se um menor (P<0,05 número de leucócitos em todos os tratamentos, porém esta redução foi mais intensa nos grupos tratados com 200mig/kg de AFB1, com ou sem FB1. Conclui-se que a AFB1 e a FB1, isoladas ou em associação, nos níveis utilizados no estudo, podem afetar negativamente os parâmetros hematológicos de frangos de corte.

  2. Panax ginseng extract modulates oxidative stress, DNA fragmentation and up-regulate gene expression in rats sub chronically treated with aflatoxin B1 and fumonisin B 1.

    Science.gov (United States)

    Hassan, Aziza M; Abdel-Aziem, Sekena H; El-Nekeety, Aziza A; Abdel-Wahhab, Mosaad A

    2015-10-01

    Aflatoxins and fumonisins are important food-borne mycotoxins implicated in human health and have cytotoxic effects. The aims of the current study were to evaluate the protective role of Panax ginseng extract (PGE) against the synergistic effect of subchronic administration of aflatoxin B1 (AFB1) and fumonisin B1 (FB1) on DNA and gene expression in rat. Female Sprague-Dawley rats were divided into eight groups (ten rats/group) and treated for 12 weeks including the control group, the group having received AFB1 (80 µg/kg bw), the group having received FB1 (100 µg/kg bw), the group having received AFB1 plus FB1 and the groups having received PGE (20 mg/kg bw) alone or with AFB1 and/or FB1. At the end of experiment, liver and kidney were collected for the determination of DNA fragmentation, lipid peroxidation (LP), glutathione (GSH) contents and alterations in gene expression. The results indicated that these mycotoxins increased DNA fragmentation, LP and decreased GSH content in liver and kidney and down-regulated gene expression of antioxidants enzymes. The combined treatments with AFB1 and/or FB1 plus PGE suppressed DNA fragmentation only in the liver, normalized LP and increased GSH in the liver and kidney as well as up-regulated the expression of GPx, SOD1 and CAT mRNA. It could be concluded that AFB1 and FB1 have synergistic genotoxic effects. PGE induced protective effects against their oxidative stress and genotoxicity through its antioxidant properties. PMID:24748134

  3. A Theoretical Study of 8-Chloro-9-Hydroxy-Aflatoxin B1, the Conversion Product of Aflatoxin B1 by Neutral Electrolyzed Water

    Science.gov (United States)

    Escobedo-González, René; Méndez-Albores, Abraham; Villarreal-Barajas, Tania; Aceves-Hernández, Juan Manuel; Miranda-Ruvalcaba, René; Nicolás-Vázquez, Inés

    2016-01-01

    Theoretical studies of 8-chloro-9-hydroxy-aflatoxin B1 (2) were carried out by Density Functional Theory (DFT). This molecule is the reaction product of the treatment of aflatoxin B1 (1) with hypochlorous acid, from neutral electrolyzed water. Determination of the structural, electronic and spectroscopic properties of the reaction product allowed its theoretical characterization. In order to elucidate the formation process of 2, two reaction pathways were evaluated—the first one considering only ionic species (Cl+ and OH−) and the second one taking into account the entire hypochlorous acid molecule (HOCl). Both pathways were studied theoretically in gas and solution phases. In the first suggested pathway, the reaction involves the addition of chlorenium ion to 1 forming a non-classic carbocation assisted by anchimeric effect of the nearest aromatic system, and then a nucleophilic attack to the intermediate by the hydroxide ion. In the second studied pathway, as a first step, the attack of the double bond from the furanic moiety of 1 to the hypochlorous acid is considered, accomplishing the same non-classical carbocation, and again in the second step, a nucleophilic attack by the hydroxide ion. In order to validate both reaction pathways, the atomic charges, the highest occupied molecular orbital and the lowest unoccupied molecular orbital were obtained for both substrate and product. The corresponding data imply that the C9 atom is the more suitable site of the substrate to interact with the hydroxide ion. It was demonstrated by theoretical calculations that a vicinal and anti chlorohydrin is produced in the terminal furan ring. Data of the studied compound indicate an important reduction in the cytotoxic and genotoxic potential of the target molecule, as demonstrated previously by our research group using different in vitro assays. PMID:27455324

  4. A Theoretical Study of 8-Chloro-9-Hydroxy-Aflatoxin B1, the Conversion Product of Aflatoxin B1 by Neutral Electrolyzed Water

    Directory of Open Access Journals (Sweden)

    René Escobedo-González

    2016-07-01

    Full Text Available Theoretical studies of 8-chloro-9-hydroxy-aflatoxin B1 (2 were carried out by Density Functional Theory (DFT. This molecule is the reaction product of the treatment of aflatoxin B1 (1 with hypochlorous acid, from neutral electrolyzed water. Determination of the structural, electronic and spectroscopic properties of the reaction product allowed its theoretical characterization. In order to elucidate the formation process of 2, two reaction pathways were evaluated—the first one considering only ionic species (Cl+ and OH− and the second one taking into account the entire hypochlorous acid molecule (HOCl. Both pathways were studied theoretically in gas and solution phases. In the first suggested pathway, the reaction involves the addition of chlorenium ion to 1 forming a non-classic carbocation assisted by anchimeric effect of the nearest aromatic system, and then a nucleophilic attack to the intermediate by the hydroxide ion. In the second studied pathway, as a first step, the attack of the double bond from the furanic moiety of 1 to the hypochlorous acid is considered, accomplishing the same non-classical carbocation, and again in the second step, a nucleophilic attack by the hydroxide ion. In order to validate both reaction pathways, the atomic charges, the highest occupied molecular orbital and the lowest unoccupied molecular orbital were obtained for both substrate and product. The corresponding data imply that the C9 atom is the more suitable site of the substrate to interact with the hydroxide ion. It was demonstrated by theoretical calculations that a vicinal and anti chlorohydrin is produced in the terminal furan ring. Data of the studied compound indicate an important reduction in the cytotoxic and genotoxic potential of the target molecule, as demonstrated previously by our research group using different in vitro assays.

  5. Safeguarding research reactors

    International Nuclear Information System (INIS)

    The report is organized in four sections, including the introduction. The second section contains a discussion of the characteristics and attributes of research reactors important to safeguards. In this section, research reactors are described according to their power level, if greater than 25 thermal megawatts, or according to each fuel type. This descriptive discussion includes both reactor and reactor fuel information of a generic nature, according to the following categories. 1. Research reactors with more than 25 megawatts thermal power, 2. Plate fuelled reactors, 3. Assembly fuelled reactors. 4. Research reactors fuelled with individual rods. 5. Disk fuelled reactors, and 6. Research reactors fuelled with aqueous homogeneous fuel. The third section consists of a brief discussion of general IAEA safeguards as they apply to research reactors. This section is based on IAEA safeguards implementation documents and technical reports that are used to establish Agency-State agreements and facility attachments. The fourth and last section describes inspection activities at research reactors necessary to meet Agency objectives. The scope of the activities extends to both pre and post inspection as well as the on-site inspection and includes the examination of records and reports relative to reactor operation and to receipts, shipments and certain internal transfers, periodic verification of fresh fuel, spent fuel and core fuel, activities related to containment and surveillance, and other selected activities, depending on the reactor

  6. Experimental validation of hyperthermia SAR treatment planning using MR B1+ imaging

    International Nuclear Information System (INIS)

    In this paper the concept of using B1+ imaging as a means to validate SAR models for radiofrequency hyperthermia is presented. As in radiofrequency hyperthermia, in common clinical MR imaging which applies RF frequencies between 64 and 128 MHz, the RF field distribution inside a patient is largely determined by the dielectric distribution of the anatomy. Modern MR imaging techniques allow measurement of the RF magnetic field component B1+ making it possible to measure at high resolution the dielectric interaction of the RF field with the patient. Given these considerations, we propose to use MR imaging to verify the validity of our dielectric patient model used for SAR models of radiofrequency hyperthermia. The aim of this study was to investigate the feasibility of this concept by performing B1+ measurements and simulations on cylindrical split phantoms consisting of materials with dielectric properties similar to human tissue types. Important topics of investigation were the accuracy and sensitivity of B1+ measurements and the validity of the electric model of the MR body coil. The measurements were performed on a clinical 1.5 T MR scanner with its quadrature body coil operating at 64 MHz. It was shown that even small B1+ variations of 2 to 5% could be measured reliably in the phantom experiments. An electrical model of the transmit coil was implemented on our FDTD-based hyperthermia treatment planning platform and the RF field distributions were calculated assuming an idealized quadrature current distribution in the coil. A quantitatively good correlation between measurements and simulations was found for phantoms consisting of water and oil, while highly conductive phantoms show considerable deviations. However, assuming linear excitation for these conductive phantoms resulted in good correspondence. As an explanation it is suggested that the coil is being detuned due to the inductive nature of the conductive phantoms, breaking up the phase difference of π/2

  7. Energy distribution in CF 2( 1B 1) from the triplet-triplet annihilation of CF 2( 3B 1) and from the vacuum ultraviolet photolysis of C 2F 4

    Science.gov (United States)

    Koda, Seiichiro

    1980-02-01

    Spectral analysis of the CF 2( 1B 1) → CF 2( 1A 1) transition showed that the energy distribution found in the v2 bending vibration ( v'2 ⩽ 3) of CF 2( 1B 1) produced from the triplet-triplet annihilation of CF 2( 3B 1) and from the vacuum ultraviolet photolysis of C 2F 4 are approximately statistical and closely related to each other.

  8. [Biofilm Formation by the Nonflagellated flhB1 Mutant of Azospirillum brasilense Sp245].

    Science.gov (United States)

    Shelud'ko, A V; Filip'echeva, Yu A; Shumiliva, E M; Khlebtsov, B N; Burov, A M; Petrova, L P; Katsy, E I

    2015-01-01

    Azospirillum brasilense Sp245 with mixed flagellation are able to form biofilms on various surfaces. A nonflagellated mutant of this strain with inactivated chromosomal copy of the flhB gene (flhB1) was shown to exhibit specific traits at the later stages of biofilm formation on a hydrophilic (glass) surface. Mature biofilms of the flhB1::Omegon-Km mutant Sp245.1063 were considerably thinner than those of the parent strain Sp245. The biofilms of the mutant were more susceptible to the forces of hydrodynamic shear. A. brasilense Sp245 cells in biofilms were not found to possess lateral flagella. Cells with polar flagella were, however, revealed by atomic force microscopy of mature native biofilms of strain Sp245. Preservation of a polar flagellum (probably nonmotile) on the cells of A. brasilense Sp245 may enhance the biofilm stability.

  9. FDC-B1: a new monoclonal antibody directed against bovine follicular dendritic cells.

    Science.gov (United States)

    Mélot, F; Defaweux, V; Jolois, O; Collard, A; Robert, B; Heinen, E; Antoine, N

    2004-01-01

    Follicular dendritic cells (FDCs) are a unique population of accessory cells located in the light zone of the germinal centres of lymphoid follicles. Their involvement in the generation of humoral immune responses implies a potential role for these cells in many disorders. Indeed, in prion diseases, FDCs seem to be the major sites of extraneuronal cellular prion protein expression and the principal sites of the infectious agent accumulation in lymphoid organs. The identification of FDC is useful for the analysis of their distribution in reactive lymphoid tissue as well as in pathological conditions. The production and characterisation of a new mouse monoclonal antibody directed against bovine follicular dendritic cells (FDC-B1) is reported. The antigen detected by FDC-B1 is expressed exclusively on the surface of FDCs in ruminant lymphoid organs. The antigen has an approximate molecular weight of 28 kDa. PMID:14700533

  10. Emericella astellata, a new producer of aflatoxin B-1, B-2 and sterigmatocystin

    DEFF Research Database (Denmark)

    Frisvad, Jens Christian; Samson, R.A.; Smedsgaard, Jørn

    2004-01-01

    To report on aflatoxin B-1 and B-2 production from a species of Emericella. Methods and Results: Aflatoxins and sterigmatocystin were determined by high-pressure liquid chromatography (HPLC) with diode array detection and confirmed by HPLC with mass spectrometry detection. Among 30 known species...... of Emericella only one species produced aflatoxin. Strains originating from the same geographical source material had different patterns of aflatoxin and sterigmatocystin production on different media, indicating that epigenetic factors may be involved in the regulation of aflatoxin production. However, two...... cultures from the same original genet were very similar. Conclusions: Emericella astellata can produce small amounts of sterigmatocystin and aflatoxin B-1 and B-2. Significance and Impact of the Study: Emericella has been used extensively in genetic studies and therefore the isolates producing aflatoxin...

  11. Vitamin B1 and B6 in the malaria parasite: requisite or dispensable?

    Directory of Open Access Journals (Sweden)

    C. Wrenger

    2008-02-01

    Full Text Available Vitamins are essential compounds mainly involved in acting as enzyme co-factors or in response to oxidative stress. In the last two years it became apparent that apicomplexan parasites are able to generate B vitamers such as vitamin B1 and B6 de novo. The biosynthesis pathways responsible for vitamin generation are considered as drug targets, since both provide a high degree of selectivity due to their absence in the human host. This report updates the current knowledge about vitamin B1 and B6 biosynthesis in malaria and other apicomplexan parasites. Owing to the urgent need for novel antimalarials, the significance of the biosynthesis and salvage of these vitamins is critically discussed in terms of parasite survival and their exploitation for drug development.

  12. ESTIMATION OF AFLATOXIN B1 IN FEED INGREDIENTS AND COMPOUND POULTRY FEEDS

    Directory of Open Access Journals (Sweden)

    Bashir Mahmood Bhatti, Tanzeela Talat and Rozina Sardar

    2001-02-01

    Full Text Available A total of 3230 samples of feed ingredients of vegetable and animal origin and commercially available compound poultry feed received over a period of 5 years at Feed Testing Laboratory of the Institute were tested for Aflatoxin B1 contents (ppb . In all feed ingredients and compound feed stuffs, minimum level of aflatoxin B1 was 13 ppb and maximum level was found to be 78 ppb. No correlation of aflatoxin levels with month of collection of the year which are subject to variation in temperature and humidity could be detected. Mean values of aflatoxin concentration in feed stuffs such as rice, rice polish, wheat bran, wheat bread, maize, fish meal, blood meal, bone meal, guar meal, corn gluten 30%, corn gluten 60%, sun flower meal, soyabean meal and cotton seed meal were found to be higher than safe level of 20 ppb recommended by FDA.

  13. The influence of alloying elements in aluminium on the grain refinement with ALTI5B1

    Directory of Open Access Journals (Sweden)

    Naglič I.

    2009-07-01

    Full Text Available This work deals with the influence of alloying elements in aluminium on the grain refinement with various additions of AlTi5B1. Grain-refinement tests were made at a cooling rate of 15 °C/s. The results revealed that in both aluminium and an Al-Fe alloy the grain size decreases with increasing additions of the AlTi5B1 grain refiner. We found that for the same boron content the grain size was smaller in the case of the Al-Fe alloy. The difference in the grain sizes for the same content of boron was approximately 15 μm; this is considerably smaller than the difference between the grain sizes in samples with the same difference of growth-restricting factor made at slower cooling rates.

  14. Reactor Physics Programme

    Energy Technology Data Exchange (ETDEWEB)

    De Raedt, C

    2000-07-01

    The Reactor Physics and Department of SCK-CEN offers expertise in various areas of reactor physics, in particular in neutronics calculations, reactor dosimetry, reactor operation, reactor safety and control and non-destructive analysis on reactor fuel. This expertise is applied within the Reactor Physics and MYRRHA Research Department's own research projects in the VENUS critical facility, in the BR1 reactor and in the MYRRHA project (this project aims at designing a prototype Accelerator Driven System). Available expertise is also used in programmes external to the Department such as the reactor pressure steel vessel programme, the BR2 reactor dosimetry, and the preparation and interpretation of irradiation experiments. Progress and achievements in 1999 in the following areas are reported on: (1) investigations on the use of military plutonium in commercial power reactors; (2) neutron and gamma calculations performed for BR-2 and for other reactors; (3) the updating of neutron and gamma cross-section libraries; (4) the implementation of reactor codes; (6) the management of the UNIX workstations; and (6) fuel cycle studies.

  15. Human infections caused by Brevibacterium casei, formerly CDC groups B-1 and B-3.

    OpenAIRE

    Gruner, E; Steigerwalt, A G; Hollis, D G; Weyant, R S; Weaver, R E; Moss, C W; M Daneshvar; J. M. Brown; Brenner, D J

    1994-01-01

    Forty-one clinical strains of CDC coryneform groups B-1 and B-3 were compared biochemically, by analysis of cell wall sugars, amino acids, and cellular fatty acids, and by DNA relatedness to the type strains of Brevibacterium casei, Brevibacterium epidermidis, and Brevibacterium linens. Twenty-two strains were shown to be B. casei, while five other strains formed a phenotypically inseparable genomospecies in the same genus. The remaining isolates were genetically heterogeneous, and most are p...

  16. Hidden Color and the b1 Structure Function of the Deuteron

    International Nuclear Information System (INIS)

    The b1 structure function is an observable feature of a spin-1 system sensitive to non-nucleonic components of the target nuclear wave function. A simple model for hidden-color, six-quark configurations is proposed and found to give substantial contributions for values of x > 0.2. Good agreement with Hermes data is obtained. Predictions are made for an upcoming JLab experiment. (author)

  17. Emericella venezuelensis, a new species with stellate ascospores producing sterigmatocystin and aflatoxin B-1

    DEFF Research Database (Denmark)

    Frisvad, Jens Christian; Samson, R.A.

    2004-01-01

    media. The three species also differ in their profiles of extrolites (secondary metabolites). Emericella venezuelensis produces aflatoxin B-1, sterigmatocystin, and terrein and compounds with chromophores of the shamixanthone, emerin and desertorin type of compounds. F. variecolor produces asteltoxin......, variecoxanthone A, B, C, isoemericellin, kojic acid, varitriol, varioxiran, dihydroterrein, 7-hydroxyemodin, avariquinone and stromemycin. E. pluriseminata produces several unknown specific extrolites. E. venezuelensis is the first organism of marine origin reported to produce aflatoxin. Aflatoxin production by E...

  18. ATP8B1 deficiency; Pathophysiology and treatment of a cholestatic syndrome with extrahepatic symptoms

    OpenAIRE

    Stapelbroek, J.M.

    2009-01-01

    ATP8B1 deficiency is a severe and clinically highly variable hereditary disorder that is primarily characterized by intrahepatic cholestasis. It generally presents as a permanent disorder, progressive familial intrahepatic cholestasis type 1 (PFIC1), or with intermittent cholestasis (benign recurrent intrahepatic cholestasis type 1 (BRIC1)). Currently there is no effective medical therapy, and most patients need invasive surgery such as partial biliary drainage (PBD) or liver transplantation....

  19. Aflatoxin B1-producing Aspergillus in sun-dried medicinal plant materials

    OpenAIRE

    Chinaputi, A.; Lim, S; Petcharat, V.; Chuenchit, S.; Pathanadech, A.

    2001-01-01

    Fifty sun-dried medicinal plants were obtained from fraditional drug stores in Songkhla Province, Thailand, and examined for Aspergillus and aflatoxin B1. 288 isolates of Aspergillus were obtaines by standard blotter plate and 25 species were identified. The most common species were A. niger with 99 isolates, A. Flavus 84 isolates, A. terreus 33 isolates, A. oryzae 25 isolates, A.nidulans (Emericella nidulans) 10 isolates, A fumigatus 9 isolates and A. chevalieri (Eurotium chevalieri) 8 isola...

  20. Occurrence of B1 Aflatoxin in diet and M1 Aflatoxin in bovine milk

    OpenAIRE

    Adriana Frizzarin; Thiago Pereira Motta; Thamires Martins; Livia Castelani; Heloisa Solda de Azevedo; Cláudia Rodrigues Pozzi

    2012-01-01

    Ensuring food quality is one of the principles of food safety. Food for dairy cattle may be contaminated by fungi of the genus Aspergillus, which produce aflatoxins. The B1 aflatoxin, when ingested by animals, is biotransformed in liver in several other toxic metabolites, including M1 aflatoxin which is excreted in milk. M1 aflatoxin has a carcinogenic effect, which the presence in milk poses a serious risk to public health because milk and dairy products are consumed mainly by children, preg...

  1. Indirect determination of aflatoxin B1 in beer by a multicommuted optical sensor

    OpenAIRE

    Molina García, Lucía Molina; Fernández De Córdova, M. Luisa; Ruiz Medina, Antonio

    2012-01-01

    Abstract This manuscript reports the determination of Aflatoxin B1 (AFB1), mycotoxin which is considered one of the most carcinogenic substances known. A multicommuted flow injection-solid phase spectroscopy (FI-SPS) system combined with photochemically-induced fluorescence (PIF) is developed, for the first time, for its determination with quantitative purposes. A strongly fluorescent degradation product is obtained on-line by irradiation with ultraviolet light. The determination i...

  2. Effect of phenolic antioxidants on the mutagenicity of aflatoxin B1.

    OpenAIRE

    Shelef, L. A.; Chin, B

    1980-01-01

    The Ames assay employing Salmonella typhimurium TA100 and TA98 was used to investigate potential interactions between aflatoxin B1 (AFB1) and the phenolic antioxidants butylated hydroxytoluene, butylated hydroxyanisole, and propyl gallate. AFB1 doses were within the linear response range, and the antioxidants were used at levels of 0 to 50 micrograms per plate. All three antioxidants were nonmutagenic in either bacterial tester strain, with or without the hepatic S-9 enzyme preparation; toxic...

  3. Stratigraphic structure of the B1 Tertiary tectonostratigraphic unit in eastern Slovenia

    OpenAIRE

    Bogomir Jelen; Helena Rifelj

    2002-01-01

    High inconsistency and incoherence in the stratigraphy of the Slovenian upper Paleogene and lower Miocene have remained unsolved in the past 150 years. To solve the problem, we tried to rigorously conduct the authentic Galilei’s scientific method. Steps of logical and empirical verification confirmed the existence of the posited B1 Tertiary tectonostratigraphic unit, and a general chronostratigraphic model of new positional relationships of lithologic units resulted from rather good biochrono...

  4. Effect of gamma radiation on the inactivation of aflatoxin B1 in food and feed crops

    International Nuclear Information System (INIS)

    Samples of food crops (peanut, peeled pistachio, unpeeled pistachio, rice, and corn) and feed (barley, bran, corn) were sterilized then inoculated with 106 of spore suspension of an isolate of Aspergillus flavus fungus known to produce aflatoxin B1 . Food and feed samples were irradiated with gamma radiation at the doses 4, 6, and 10 kGy. Results indicated that degradation of Aflatoxin B1 was positively correlated with the increase in the applied dose of gamma ray for each tested sample. For example, at a dose of 4 KGy. Percentages of aflatoxin B1 degradation were 8.4, 9.7, 16.6 and 23.5, and 43.97% for peanuts, peeled pistachios, unpeeled pistachios, corn and rice, consecutively . Whereas, at a dose of 10 KGy percentages of aflatoxin degradation reached highest values at 58.6, 68.8, 84.6, 81.1 and 87.8% for peanuts, peeled pistachios, unpeeled pistachios, corn and rice, consecutively In feed samples percentages of aflatoxin degradation were 45, 66, and 90% in barley, 47, 75, and 86% in bran, and 31, 72, and 84% in corn for the doses of 4, 6, and 10 KGy, consecutively. Aflatoxin degradation in food samples correlated negatively with oil content in irradiated samples. Thus, in peanuts, which contained the highest oil content, percentage of aflatoxin degradation at 10 KGy was not more than 56.6%, whereas, the corresponding value in corn, which contained the highest oil content, reached as high as 80%. The above results indicate the possibility of using gamma irradiation as a means of degradation of aflatoxin B1 in food and feed crops to lower than the maximum allowed levels using a maximum dose of radiation of 10 KGy which represents the permitted dose of radiation for such type of crops.(author)

  5. Genome sequence of the Bacteroides fragilis phage ATCC 51477-B1

    Directory of Open Access Journals (Sweden)

    Hawkins Shawn A

    2008-08-01

    Full Text Available Abstract The genome of a fecal pollution indicator phage, Bacteroides fragilis ATCC 51477-B1, was sequenced and consisted of 44,929 bases with a G+C content of 38.7%. Forty-six putative open reading frames were identified and genes were organized into functional clusters for host specificity, lysis, replication and regulation, and packaging and structural proteins.

  6. Exercices de grammaire B1 du cadre européen

    CERN Document Server

    Beaulieu, Christian

    2007-01-01

    Ce cahier d'exercices s'adresse à des apprenants en français. Il présente des activités d'entraînement correspondant au niveau B1 du Cadre Européen commun de référence pour les langues. Ce cahier peut être utilisé en classe ou en autonomie.

  7. Androgen regulation of CYP4B1 responsible for mutagenic activation of bladder carcinogens in the rat bladder: detection of CYP4B1 mRNA by competitive reverse transcription-polymerase chain reaction.

    Science.gov (United States)

    Imaoka, S; Yoneda, Y; Sugimoto, T; Ikemoto, S; Hiroi, T; Yamamoto, K; Nakatani, T; Funae, Y

    2001-05-26

    Significant sex differences exist among cases of bladder cancer in humans as well as in experimental animals such as rats. Aromatic amines such as benzidine and 2-naphthylamine are known to induce bladder cancer. These carcinogenic amines are activated to genotoxic substances by cytochrome P 450 CYP4B1, which is present in bladder mucosa. In this study, regulation of CYP4B1 was investigated to elucidate sex difference in bladder carcinogenesis. Competitive reverse transcription-polymerase chain reaction was used to investigate the expression of rat CYP4B1 mRNA occurring in small amounts of tissue such as bladder tissue. Expression of CYP4B1 in the bladder of male rats increased with development but not in that of female rats. Moreover, mature male rats exhibited higher expression of CYP4B1 in the bladder than did mature female rats. Castration of male rats decreased CYP4B1 levels and treatment with testosterone led to a partial recovery of CYP4B1 levels. These results indicate that CYP4B1 levels in the rat bladder are partly regulated by androgens. Furthermore, the present findings suggest that the sex difference observed in bladder carcinogenesis was due to sex-different expression of CYP4B1 in bladder tissue. PMID:11311483

  8. Overgroups of D1(F) in B1(F) and its pronor-madity%D1(F)在B1(F)中的扩群及其泛正规性

    Institute of Scientific and Technical Information of China (English)

    金永容

    2001-01-01

    域F上D1(1≥4)型Chevalley群D1(F)可自然地嵌入到B1(F)中去.当Chr F≠2,且F=F2时,本文定出了D1(F)在(B1(F)中的所有扩群,由此获得了B1(F)的一类极大子群.进而证明了D1(F)是B1(F)的泛正规子群.

  9. Calcium Homeostasis and Muscle Energy Metabolism Are Modified in HspB1-Null Mice

    Directory of Open Access Journals (Sweden)

    Brigitte Picard

    2016-05-01

    Full Text Available Hsp27—encoded by HspB1—is a member of the small heat shock proteins (sHsp, 12–43 kDa (kilodalton family. This protein is constitutively present in a wide variety of tissues and in many cell lines. The abundance of Hsp27 is highest in skeletal muscle, indicating a crucial role for muscle physiology. The protein identified as a beef tenderness biomarker was found at a crucial hub in a functional network involved in beef tenderness. The aim of this study was to analyze the proteins impacted by the targeted invalidation of HspB1 in the Tibialis anterior muscle of the mouse. Comparative proteomics using two-dimensional gel electrophoresis revealed 22 spots that were differentially abundant between HspB1-null mice and their controls that could be identified by mass spectrometry. Eighteen spots were more abundant in the muscle of the mutant mice, and four were less abundant. The proteins impacted by the absence of Hsp27 belonged mainly to calcium homeostasis (Srl and Calsq1, contraction (TnnT3, energy metabolism (Tpi1, Mdh1, PdhB, Ckm, Pygm, ApoA1 and the Hsp proteins family (HspA9. These data suggest a crucial role for these proteins in meat tenderization. The information gained by this study could also be helpful to predict the side effects of Hsp27 depletion in muscle development and pathologies linked to small Hsps.

  10. Variant alleles of the CYP1B1 gene are associated with colorectal cancer susceptibility

    International Nuclear Information System (INIS)

    CYP1B1 is a P450 enzyme which is involved in the activation of pro-carcinogens to carcinogens as well as sex hormone metabolism. Because differences in the activity of the enzyme have been correlated with variant alleles of single nucleotide polymorphisms (SNPs), it represents an attractive candidate gene for studies into colorectal cancer susceptibility. We genotyped 597 cancer patients and 597controls for three CYP1B1 SNPs, which have previously been shown to be associated with altered enzymatic activity. Using the three SNPs, eight different haplotypes were constructed. The haplotype frequencies were estimated in cases and controls and then compared. The odds ratio for each tumour type, associated with each haplotype was estimated, with reference to the most common haplotype observed in the controls. The three SNPs rs10012, rs1056827 and rs1056836 alone did not provide any significant evidence of association with colorectal cancer risk. Haplotypes of rs1056827 and rs10012 or rs1056827 and rs1056836 revealed an association with colorectal cancer which was significantly stronger in the homozygous carriers. One haplotype was under represented in the colorectal cancer patient group compared to the control population suggesting a protective effect. Genetic variants within the CYP1B1 that are associated with altered function appear to influence susceptibility to a colorectal cancer in Poland. Three haplotypes were associated with altered cancer risk; one conferred protection and two were associated with an increased risk of disease. These observations should be confirmed in other populations

  11. Stratigraphic structure of the B1 Tertiary tectonostratigraphic unit in eastern Slovenia

    Directory of Open Access Journals (Sweden)

    Bogomir Jelen

    2002-06-01

    Full Text Available High inconsistency and incoherence in the stratigraphy of the Slovenian upper Paleogene and lower Miocene have remained unsolved in the past 150 years. To solve the problem, we tried to rigorously conduct the authentic Galilei’s scientific method. Steps of logical and empirical verification confirmed the existence of the posited B1 Tertiary tectonostratigraphic unit, and a general chronostratigraphic model of new positional relationships of lithologic units resulted from rather good biochronostratigraphic resolution achieved by nannoplankton and planktonic foraminifera biostratigraphy. The application of principles of newly developed fields in science helped us to avoid errors in transmission of messages (to reduce noise from the source (rock to the concept formation,which had been done previously. This in turn has strongly reduced inconsistency andincoherence (high information entropy = uncertainty. The released amount of information enabled us to answer also questions that reached beyond the original difficulty, e.g.: is the tectonostratigraphic structure of eastern Slovenia a manifestation of plate tectonics processes, and of which ones, are theories of continental escape in the Alps and associated dissection and offset of the formerly uniform Slovenian-Hungarian Paleogene basin tenableor not, are then there in the B1 stratigraphic equivalents of the Hungarian Paleogene basin formations, where are the important Eocene / Oligocene, Paleogene / Neogene, Rupelian / Chattian and Kiscellian / Egerian boundaries in Slovenia, and is there acontinuation of the B1 in Croatia and in the Mid-Hungarian tectonic zone?

  12. Theoretical study of B3-to-B1 phase transition in ZnS

    Science.gov (United States)

    Li, Qiang; Zhang, Rui; Lv, Tianquan; Cao, Qilong

    2016-10-01

    The pressure-induced phase transformation from B3 to B1 structures in ZnS using first-principle projector-augmented wave method is studied. To understand the nature and driving force behind the transition, the interesting properties in both phases, including enthalpy, phonon dispersion curves and elastic constants, are systematically investigated. The results show that the calculated transition pressure is within the range of 16.33 GPa to 19.04 GPa, which is in good agreement with the available experimental and theoretical data. The transition process can be viewed as the appearance and disappearance of very slight lattice distortion accompanied by the movement of Zn and S atoms along the [111] crystallographic axis. The physical driving force of the B3-B1 phase transition is confirmed to be a coupling effect between the mechanical instability of B3 phase under pressure and the softening acoustic phonon mode resulting from the pressure-induced lattice deformation. For B1 phase, it is further predicted that a new phase transition takes place at about 59.9 GPa.

  13. Facile synthesis of cyclopentenone B1- and L1-type Phytoprostanes

    Directory of Open Access Journals (Sweden)

    Alexandre eGuy

    2015-07-01

    Full Text Available Phytoprostanes (PhytoPs represent non-enzymatic metabolites of α-linolenic acid (ALA, the essential omega-3 polyunsaturated fatty acid (PUFA derived from plants. PhytoPs are present in the plant kingdom and represent endogenous mediators capable of protecting cells from oxidative stress damages in plants. Recently, it was found that such metabolites are present in cooking oil in high quantities, and also that B1-PhytoPs protect immature neurons from oxidant injury and promote differentiation of oligodendrocyte progenitors through PPAR-γ activation. We report a novel and facile synthesis of natural 2,3-substituted cyclopentenone PhytoPs, 16-B1-PhytoP and 9-L1-PhytoP. Our strategy is based on reductive alkylation at the 2-position of 1,3-cyclopentanedione using a recent protocol developed by Ramachary et al., and on a cross-coupling metathesis to access conjugate dienone system. In conclusion, this strategy permitted access to B1- and L1-PhytoPs in a relative short sequence process, and afford the possibility to easily develop analogs of PhytoPs.

  14. Direct protein-protein interactions and substrate channeling between cellular retinoic acid binding proteins and CYP26B1.

    Science.gov (United States)

    Nelson, Cara H; Peng, Chi-Chi; Lutz, Justin D; Yeung, Catherine K; Zelter, Alex; Isoherranen, Nina

    2016-08-01

    Cellular retinoic acid binding proteins (CRABPs) bind all-trans-retinoic acid (atRA) tightly. This study aimed to determine whether atRA is channeled directly to cytochrome P450 (CYP) CYP26B1 by CRABPs, and whether CRABPs interact directly with CYP26B1. atRA bound to CRABPs (holo-CRABP) was efficiently metabolized by CYP26B1. Isotope dilution experiments showed that delivery of atRA to CYP26B1 in solution was similar with or without CRABP. Holo-CRABPs had higher affinity for CYP26B1 than free atRA, but both apo-CRABPs inhibited the formation of 4-OH-RA by CYP26B1. Similar protein-protein interactions between soluble binding proteins and CYPs may be important for other lipophilic CYP substrates.

  15. Ship propulsion reactors technology

    International Nuclear Information System (INIS)

    This paper takes the state of the art on ship propulsion reactors technology. The french research programs with the corresponding technological stakes, the reactors specifications and advantages are detailed. (A.L.B.)

  16. Undergraduate reactor control experiment

    International Nuclear Information System (INIS)

    A sequence of reactor and related experiments has been a central element of a senior-level laboratory course at Pennsylvania State University (Penn State) for more than 20 yr. A new experiment has been developed where the students program and operate a computer controller that manipulates the speed of a secondary control rod to regulate TRIGA reactor power. Elementary feedback control theory is introduced to explain the experiment, which emphasizes the nonlinear aspect of reactor control where power level changes are equivalent to a change in control loop gain. Digital control of nuclear reactors has become more visible at Penn State with the replacement of the original analog-based TRIGA reactor control console with a modern computer-based digital control console. Several TRIGA reactor dynamics experiments, which comprise half of the three-credit laboratory course, lead to the control experiment finale: (a) digital simulation, (b) control rod calibration, (c) reactor pulsing, (d) reactivity oscillator, and (e) reactor noise

  17. Reactor System Design

    International Nuclear Information System (INIS)

    SMART NPP(Nuclear Power Plant) has been developed for duel purpose, electricity generation and energy supply for seawater desalination. The objective of this project IS to design the reactor system of SMART pilot plant(SMART-P) which will be built and operated for the integrated technology verification of SMART. SMART-P is an integral reactor in which primary components of reactor coolant system are enclosed in single pressure vessel without connecting pipes. The major components installed within a vessel includes a core, twelve steam generator cassettes, a low-temperature self pressurizer, twelve control rod drives, and two main coolant pumps. SMART-P reactor system design was categorized to the reactor coe design, fluid system design, reactor mechanical design, major component design and MMIS design. Reactor safety -analysis and performance analysis were performed for developed SMART=P reactor system. Also, the preparation of safety analysis report, and the technical support for licensing acquisition are performed

  18. Cytochrome P450 1B1 Contributes to the Development of Atherosclerosis and Hypertension in Apolipoprotein E-Deficient Mice.

    Science.gov (United States)

    Song, Chi Young; Ghafoor, Khuzema; Ghafoor, Hafiz U; Khan, Nayaab S; Thirunavukkarasu, Shyamala; Jennings, Brett L; Estes, Anne M; Zaidi, Sahar; Bridges, Dave; Tso, Patrick; Gonzalez, Frank J; Malik, Kafait U

    2016-01-01

    Cytochrome P450 (CYP) 1B1 contributes to vascular smooth muscle cell growth and hypertension in male mice. This study was conducted to determine the contribution of CYP1B1 to the development of atherosclerosis and hypertension and associated pathogenesis in 8-week-old male apolipoprotein E-deficient (ApoE(-/-)/Cyp1b1(+/+)), and ApoE- and CYP1B1-deficient (ApoE(-/-)/Cyp1b1(-/-)) mice fed a normal or atherogenic diet for 12 weeks. A separate group of ApoE(-/-)/Cyp1b1(+/+) mice on an atherogenic diet was injected every third day with the CYP1B1 inhibitor, 2,3',4,5'-tetramethoxystilbene (300 μg/kg), or its vehicle, dimethyl sulfoxide (30 μL, IP); systolic blood pressure was measured by the tail cuff method. After 12 weeks, mice were euthanized, blood collected for lipid analysis, and aortas harvested for measuring lesions and remodeling, and for infiltration of inflammatory cells by histological and immunohistochemical analysis, respectively, and for reactive oxygen species production. Blood pressure, areas of lipids and collagen deposition, elastin breaks, infiltration of macrophages and T lymphocytes, reactive oxygen species generation in the aorta, and plasma lipid levels were increased in ApoE(-/-)/Cyp1b1(+/+) mice on an atherogenic diet; these changes were minimized in mice given 2,3',4,5'-tetramethoxystilbene, and in ApoE(-/-)/Cyp1b1(-/-) mice on an atherogenic diet; absorption/production of lipids remained unaltered in these mice. These data suggest that aortic lesions, hypertension, and associated pathogenesis in ApoE(-/-)/Cyp1b1(+/+) mice on an atherogenic diet are most likely dependent on CYP1B1-generated oxidative stress and increased plasma lipid levels independent of blood pressure and absorption of lipids. CYP1B1 could serve as a novel target for developing drugs to treat atherosclerosis and hypertension caused by hypercholesterolemia.

  19. A peptide antagonist of ErbB receptors, Inherbin3, induces neurite outgrowth through ErbB1 inhibition

    DEFF Research Database (Denmark)

    Xu, Ruodan; Pankratova, Stanislava; Christiansen, Søren Hofman Oliveira;

    2013-01-01

    activity and activation of ErbB4 by NRG-1β induced neurite extension, suggesting that ErbB1 and ErbB4 act as negative and positive regulators, respectively, of the neuritogenic response. Inherbin3, inhibited activation not only of ErbB1 but also of ErbB4 in primary neurons, strongly induced neurite...... outgrowth in rat cerebellar granule neurons, indicating that this effect mainly was due to inhibition of ErbB1 activation....

  20. Vitamin B1 in marine sediments: pore water concentration gradient drives benthic flux with potential biological implications

    OpenAIRE

    Monteverde, Danielle R.; Gómez-Consarnau, Laura; Cutter, Lynda; Chong, Lauren; Berelson, William; Sañudo-Wilhelmy, Sergio A.

    2015-01-01

    Vitamin B1, or thiamin, can limit primary productivity in marine environments, however the major marine environmental sources of this essential coenzyme remain largely unknown. Vitamin B1 can only be produced by organisms that possess its complete synthesis pathway, while other organisms meet their cellular B1 quota by scavenging the coenzyme from exogenous sources. Due to high bacterial cell density and diversity, marine sediments could represent some of the highest concentrations of putativ...

  1. Occurrence of B1 Aflatoxin in diet and M1 Aflatoxin in bovine milk

    Directory of Open Access Journals (Sweden)

    Adriana Frizzarin

    2012-12-01

    Full Text Available Ensuring food quality is one of the principles of food safety. Food for dairy cattle may be contaminated by fungi of the genus Aspergillus, which produce aflatoxins. The B1 aflatoxin, when ingested by animals, is biotransformed in liver in several other toxic metabolites, including M1 aflatoxin which is excreted in milk. M1 aflatoxin has a carcinogenic effect, which the presence in milk poses a serious risk to public health because milk and dairy products are consumed mainly by children, pregnant women and elderly. The objective of this study was to detect the presence of B1 aflatoxin in feed supplied to dairy cows and the presence of M1 aflatoxin in milk. Samples were collected from complete diet (corn silage and concentrate from a batch of 15 lactating cows from a dairy farm in the Campinas region. Two samples of diets were collected directly into the troughs in intervals of 24 hours at every 15 days, totalizing a period of 45 days. Milk samples of those cows were collected 24 hours after diet collection, directly from sample valves in the glass jars.. B1 and M1 aflatoxins were detected by the technique of High Performance Liquid Chromatography after extraction and purification on immunoaffinity columns. From the 40 samples of diets evaluated, 40% were contaminated with B1 aflatoxin, and the levels found ranged from 1.93 to 43.78μg/Kg. One sample showed result higher than the maximum recommended for grain and animal feed in Brazil (20μg/Kg. From the 75 milk samples analyzed, the presence of M1 aflatoxin was detected in 13.3% with levels ranging from 0.03 to 0.16μg/L, not exceeding the maximum permitted for marketing in the country of 0.5μg/L, however 80% of contaminated samples had values above the maximum permissible levels of 0.05μg/L, value found among countries with abundant milk production... The presence of aflatoxins highlights the importance of monitoring the production, the storage and the importance of handling food and

  2. Effect of water molecules on the fluorescence enhancement of Aflatoxin B1 mediated by Aflatoxin B1:beta-cyclodextrin complexes. A theoretical study.

    Science.gov (United States)

    Ramírez-Galicia, Guillermo; Garduño-Juárez, Ramón; Gabriela Vargas, M

    2007-01-01

    In order to explain the observed fluorescence enhancement of Aflatoxin B1 (AFB1) when forming AFB1:beta-cyclodextrin (AFB1:beta-CD) inclusion complexes, we have performed a theoretical (quantum chemistry calculations) study of AFB1 and AFB1:beta-CD in vacuum and in the presence of aqueous solvent. The AM1 method was used to calculate the absorption and emission wavelengths of these molecules. With the help of density functional theory (DFT) and time-dependent DFT (TDDFT) vibrational frequencies and related excitation energies of AFB1 and AFB1.(H2O)m = 4,5,6,11 were calculated. On the basis of these calculations we propose a plausible mechanism for the fluorescence enhancement of AFB1 in the presence of beta-CD: (1) before photoexcitation of AFB1 to its S1 excited state, there is a vibrational coupling between the vibrational modes involving the AFB1 carbonyl groups and the bending modes of the nearby water molecules (CG + WM); (2) these interactions allow a thermal relaxation of the excited AFB1 molecules that results in fluorescence quenching; (3) when the AFB1 molecules form inclusion complexes with beta-CD the CG + WM interaction decreases; and (4) this gives rise to a fluorescence enhancement.

  3. A Gold Nanoparticle and Aflatoxin B1-BSA Conjugates Based Lateral Flow Assay Method for the Analysis of Aflatoxin B1

    Directory of Open Access Journals (Sweden)

    Sangdae Lee

    2012-04-01

    Full Text Available A rapid and simple immuno-chromatographic assay was developed to detect aflatoxin B1 (AFB1. The assay was based on a modified competitive binding format using colloidal gold and polyclonal antibody (Pab conjugates. The anti-AFB1 Pab was immobilized to a defined detection zone on a porous nitrocellulose membrane and colloidal gold particles were conjugated to AFB1-BSA which served as a detection reagent. The AFB1-containing sample was added to the membrane and allowed to move with AFB1-BSA-coated particles dried on the conjugation pad. The mixture was then passed along the porous membrane by capillary action past the Pab in the detection zone, which captured AFB1 or AFB1-BSA. AFB1 in the sample inhibits binding of AFB1-BSA conjugated gold particles to the Pab and prevents formation of a red color dot. In the absence of AFB1, AFB1-BSA conjugated gold particles bound to the Pab, give a red color within this detection zone. With this method, 10 μg/mL of AFB1 was detected in less than 10 min. The developed AFB1 assay also showed no cross reaction to Ochratoxin A (OTA.

  4. Measurement of the eta_b(1S) mass and the branching fraction for Upsilon(3S) --> gamma eta_b(1S)

    CERN Document Server

    Bonvicini, G; Lincoln, A; Smith, M J; Zhou, P; Zhu, J; Naik, P; Rademacker, J; Asner, D M; Edwards, K W; Reed, J; Robichaud, A N; Tatishvili, G; White, E J; Briere, R A; Vogel, H; Onyisi, P U E; Rosner, J L; Alexander, J P; Cassel, D G; Ehrlich, R; Fields, L; Galik, R S; Gibbons, L; Gray, S W; Hartill, D L; Heltsley, B K; Hunt, J M; Kreinick, D L; Kuznetsov, V E; Ledoux, J; Mahlke-Krüger, H; Patterson, J R; Peterson, D; Riley, D; Ryd, A; Sadoff, A J; Shi, X; Stroiney, S; Sun, W M; Yelton, J; Rubin, P; Lowrey, N; Mehrabyan, S; Selen, M; Wiss, J; Kornicer, M; Mitchell, R E; Shepherd, M R; Tarbert, C M; Besson, D; Pedlar, T K; Xavier, J; Cronin-Hennessy, D; Gao, K Y; Hietala, J; Poling, R; Zweber, P; Dobbs, S; Metreveli, Z; Seth, K K; Tan, B J Y; Tomaradze, A G; Brisbane, S; Libby, J; Martin, L; Powell, A; Spradlin, P; Thomas, C; Wilkinson, G; Méndez, H; Ge, J Y; Miller, D H; Shipsey, I P J; Xin, B; Adams, G S; Hu, D; Moziak, B; Napolitano, J; Ecklund, K M; Insler, J; Muramatsu, H; Park, C S; Thorndike, E H; Yang, F; Artuso, M; Blusk, S; Khalil, S; Mountain, R; Randrianarivony, K; Skwarnicki, T; Wang, J C; Zhang, L M

    2009-01-01

    We report evidence for the ground state of bottomonium, eta_b(1S), in the radiative decay Upsilon(3S) --> gamma eta_b in e^+e^- annihilation data taken with the CLEO III detector. Using 6 million Upsilon(3S) decays, and assuming Gamma(eta_b) = 10 MeV/c^2, we obtain B(Upsilon(3S) --> gamma eta_b) = (7.1 +- 1.8 +- 1.1) X 10^{-4}, where the first error is statistical and the second is systematic. The statistical significance is about 4 sigma. The mass is determined to be M(eta_b) = 9391.8 +- 6.6 +- 2.0 MeV/c^2, which corresponds to the hyperfine splitting Delta M_{hf}(1S)_b = 68.5 +- 6.6 +- 2.0 MeV/c^2. Using 9 million Upsilon(2S) decays, we place an upper limit on the corresponding Y(2S) decay, B(Y(2S) --> gamma eta_b) < 8.4 X 10^{-4} at 90 % confidence level.

  5. A PRECISION MEASUREMENT OF THE NEUTRINO MIXING ANGLE THETA (SUB 13) USING REACTOR ANTINEUTRINOS AT DAYA BAY.

    Energy Technology Data Exchange (ETDEWEB)

    KETTELL, S.; ET AL.

    2006-10-16

    This document describes the design of the Daya Bay reactor neutrino experiment. Recent discoveries in neutrino physics have shown that the Standard Model of particle physics is incomplete. The observation of neutrino oscillations has unequivocally demonstrated that the masses of neutrinos are nonzero. The smallness of the neutrino masses (<2 eV) and the two surprisingly large mixing angles measured have thus far provided important clues and constraints to extensions of the Standard Model. The third mixing angle, {delta}{sub 13}, is small and has not yet been determined; the current experimental bound is sin{sup 2} 2{theta}{sub 13} < 0.17 at 90% confidence level (from Chooz) for {Delta}m{sub 31}{sup 2} = 2.5 x 10{sup -3} eV{sup 2}. It is important to measure this angle to provide further insight on how to extend the Standard Model. A precision measurement of sin{sup 2} 2{theta}{sub 13} using nuclear reactors has been recommended by the 2004 APS Multi-divisional Study on the Future of Neutrino Physics as well as a recent Neutrino Scientific Assessment Group (NUSAG) report. We propose to perform a precision measurement of this mixing angle by searching for the disappearance of electron antineutrinos from the nuclear reactor complex in Daya Bay, China. A reactor-based determination of sin{sup 2} 2{theta}{sub 13} will be vital in resolving the neutrino-mass hierarchy and future measurements of CP violation in the lepton sector because this technique cleanly separates {theta}{sub 13} from CP violation and effects of neutrino propagation in the earth. A reactor-based determination of sin{sup 2} 2{theta}{sub 13} will provide important, complementary information to that from long-baseline, accelerator-based experiments. The goal of the Daya Bay experiment is to reach a sensitivity of 0.01 or better in sin{sup 2} 2{theta}{sub 13} at 90% confidence level.

  6. LMFBR type reactor

    Energy Technology Data Exchange (ETDEWEB)

    Kawakami, Hiroto

    1995-02-07

    A reactor container of the present invention has a structure that the reactor container is entirely at the same temperature as that at the inlet of the reactor and, a hot pool is incorporated therein, and the reactor container has is entirely at the same temperature and has substantially uniform temperature follow-up property transiently. Namely, if the temperature at the inlet of the reactor core changes, the temperature of the entire reactor container changes following this change, but no great temperature gradient is caused in the axial direction and no great heat stresses due to axial temperature distribution is caused. Occurrence of thermal stresses caused by the axial temperature distribution can be suppressed to improve the reliability of the reactor container. In addition, since the laying of the reactor inlet pipelines over the inside of the reactor is eliminated, the reactor container is made compact and the heat shielding structures above the reactor and a protection structure of container walls are simplified. Further, secondary coolants are filled to the outside of the reactor container to simplify the shieldings. The combined effects described above can improve economical property and reliability. (N.H.).

  7. Fossil nuclear reactors

    Energy Technology Data Exchange (ETDEWEB)

    Maurette, M.

    1976-01-01

    The discussion of fossil nuclear reactors (the Oklo phenomenon) covers the earth science background, neutron-induced isotopes and reactor operating conditions, radiation-damage studies, and reactor modeling. In conclusion possible future studies are suggested and the significance of the data obtained in past studies is summarized. (JSR)

  8. Suicidal gene therapy with rabbit cytochrome P450 4B1/4-ipomeanol, 2-aminoanthracene system in glioma cell

    Energy Technology Data Exchange (ETDEWEB)

    Jang, Su Jin; Kang, Joo Hyun; Kim, Kwang Il; Lee, Tae Sup; Lee, Yong Jin; Woo, Kwang Sun; Chung, Wee Sup; Cheon, Gi Jeong; Choi, Chang Woon; Lim, Sang Moo [Korea Institute of Radiological and Medical Sciences, Seoul (Korea, Republic of)

    2010-10-15

    Suicidal gene therapy is based on the transduction of tumor cells with 'suicide' genes encoding for prodrugactivating enzymes that render target cells susceptible to prodrug treatment. Suicidal gene therapy results in the death of tumor with the expression of gene encoding enzyme that converts non-toxic prodrug into cytotoxic product. Cytochrome P450 4B1 (CYP4B1) activates 4- ipomeanol (4-ipo) and 2-aminoanthracene (2-AA) to cytotoxic furane epoxide and unsaturated dialdehyde intermediate. In this study, therapeutic effects of suicidal gene therapy with rabbit CYP4B1/4-ipo or CYP4B1/2-AA system

  9. Cyclin B1和survivin在非小细胞肺癌中的表达和意义%The expression and significance of cyclin B1 and survivin in human non-small cell lung cancer

    Institute of Scientific and Technical Information of China (English)

    Guosheng Li; Xuhan Liu; Daorong Zhang; Dong Liu; Zhiyong Li

    2011-01-01

    Objective: We studied the expression of cyclin B1 and survivin in human non-small cell lung cancer (NSCLC), and the relationship between such expression and clinicopathological features of NSCLC. Methods: One hundred cases of tissue specimen including NSCLC, neighboring noncancerous tissue and normal lung tissue were collected at random. These specimens were detected by immunohistochemical methods. Results: The expression of cyclin B1 and survivin showed significant difference (P 0.05) in NSCLC. Statistical significance was marked between different clinical stages of NSCLC and the expression of cyclin B1 and survivin (P < 0.05). Conclusion: The overexpression of cyclin B1 and survivin was found in NSCLC. The expression of cyclin B1 and survivin might be up-regulated during an early step of tumorigenesis and during the development of NSCLC. The progression of cell cycle could be efficiently connected with the control of apoptosis by the interrelations between the overexpression of cyclin B1 and that of survivin in NSCLC during the G2/M phase. The overexpression of cyclin B1 and survivin might be used as marker in showing the dividing and proliferating ability, and the inhibiting apoptosis ability (lengthening cell lifespan) of NSCLC. Moreover, the overexpression of cyclin B1 and survivin was associated with the clinic stages of NSCLC.

  10. Nuclear reactor repairing device

    International Nuclear Information System (INIS)

    Purpose: To enable free repairing of an arbitrary position in an LMFBR reactor. Constitution: A laser light emitted from a laser oscillator installed out of a nuclear reactor is guided into a portion to be repaired in the reactor by using a reflecting mirror, thereby welding or cutting it. The guidance of the laser out of the reactor into the reactor is performed by an extension tube depending into a through hole of a rotary plug, and the guidance of the laser light into a portion to be repaired is performed by the transmitting and condensing action of the reflecting mirror. (Kamimura, M.)

  11. Nuclear reactor physics

    CERN Document Server

    Stacey, Weston M

    2010-01-01

    Nuclear reactor physics is the core discipline of nuclear engineering. Nuclear reactors now account for a significant portion of the electrical power generated worldwide, and new power reactors with improved fuel cycles are being developed. At the same time, the past few decades have seen an ever-increasing number of industrial, medical, military, and research applications for nuclear reactors. The second edition of this successful comprehensive textbook and reference on basic and advanced nuclear reactor physics has been completely updated, revised and enlarged to include the latest developme

  12. Light water reactor safety

    CERN Document Server

    Pershagen, B

    2013-01-01

    This book describes the principles and practices of reactor safety as applied to the design, regulation and operation of light water reactors, combining a historical approach with an up-to-date account of the safety, technology and operating experience of both pressurized water reactors and boiling water reactors. The introductory chapters set out the basic facts upon which the safety of light water reactors depend. The central section is devoted to the methods and results of safety analysis. The accidents at Three Mile Island and Chernobyl are reviewed and their implications for light wate

  13. Expression of CDK1(Tyr15, pCDK1(Thr161, Cyclin B1 (total and pCyclin B1(Ser126 in vulvar squamous cell carcinoma and their relations with clinicopatological features and prognosis.

    Directory of Open Access Journals (Sweden)

    Zhihui Wang

    Full Text Available Cyclin B1-CDK1 complex plays an important role in the regulation of cell cycle. Activation of Cyclin B1 and CDK1 and the formation of the complex in G2/M are under multiple regulations involving many regulators such as isoforms of 14-3-3 and CDC25 and Wee1. Abnormal expression of Cyclin B1 and CDK1 has been detected in various tumors. However, to our knowledge no previous study has investigated Cyclin B1 and CDK1 in vulvar cancer. Therefore, we evaluated the statuses of CDK1Tyr15, pCDK1Thr161, Cyclin B1 (total and pCyclin B1Ser126 in 297 cases of vulvar squamous cell carcinomas by immunohistochemistry. Statistical analyses were performed to explore their clinicopathological and prognostic values. In at least 25% of tumor cases high expression of CDK1Tyr15, pCDK1Thr161, Cyclin B1 (total and pCyclin B1Ser126 was observed, compared to the low levels in normal vulvar squamous epithelium. Elevated levels of CDK1Tyr15, pCDK1Thr161, Cyclin B1 (total and pCyclin B1Ser126 were correlated with advanced tumor behaviors and aggressive features. Although CDK1Tyr15, pCDK1Thr161, Cyclin B1 (total and pCyclin B1Ser126 could not be identified as prognostic factors, combinations of (pCDK1Thr161 C+N + 14-3-3σN, (pCDK1Thr161 C+N + 14-3-3ηC, (pCDK1Thr161 C+N + Wee1C and (pCDK1Thr161 C+N + 14-3-3σN + 14-3-3ηC + Wee1C were correlated with disease-specific survival (p = 0.036, p = 0.029, p = 0.042 and p = 0.007, respectively in univariate analysis. The independent prognostic significance of (pCDK1Thr161 C+N + 14-3-3σN + 14-3-3ηC + Wee1C was confirmed by multivariate analysis. In conclusion, CDK1Tyr15, pCDK1Thr161, Cyclin B1 (total and pCyclin B1Ser126 may be involved in progression of vulvar squamous cell carcinoma. The combination of pCDK1Thr161, 14-3-3σ, 14-3-3η and Wee1 was a statistically independent prognostic factor.

  14. Antioxidant/oxidant status and cardiac function in bradykinin B(1)- and B(2)-receptor null mice.

    Science.gov (United States)

    Delemasure, S; Blaes, N; Richard, C; Couture, R; Bader, M; Dutartre, P; Girolami, J-P; Connat, J-L; Rochette, L

    2013-01-01

    Kinin-vasoactive peptides activate two G-protein-coupled receptors (R), B(1)R (inducible) and B(2)R (constitutive). Their complex role in cardiovascular diseases could be related to differential actions on oxidative stress. This study investigated impacts of B(1)R or B(2)R gene deletion in mice on the cardiac function and plasma antioxidant and oxidant status. Echocardiography-Doppler was performed in B(1)R (B(1)R(-/-)) and B(2)R (B(2)R(-/-)) deficient and wild type (WT) adult male mice. No functional alteration was observed in B(2)R(-/-) hearts. B(1)R(-/-) mice had significantly lowered fractional shortening and increased isovolumetric contraction time. The diastolic E and A waves velocity ratio was similar in all mice groups. Thus B(1)R(-/-) mice provide a model of moderate systolic dysfunction, whereas B(2)R(-/-) mice displayed a normal cardiac phenotype. Plasma antioxidant capacity (ORAC) was significantly decreased in both B(1)R(-/-) and B(2)R(-/-) mice whereas the vitamin C levels were decreased in B(2)R(-/-) mice only. Plasma ascorbyl free radical was significantly higher in B(1)R(-/-) compared to WT and B(2)R(-/-) mice. Therefore, the oxidative stress index, ascorbyl free radical to vitamin C ratio, was increased in both B(1)R(-/-) and B(2)R(-/-) mice. Hence, B(1)R and B(2)R deficiency are associated with increased oxidative stress, but there is a differential imbalance between free radical production and antioxidant defense. The interrelationship between the differential B(1)R and B(2)R roles in oxidative stress and cardiovascular diseases remain to be investigated. PMID:24020815

  15. Could a B-1 cell derived phagocyte "be one" of the peritoneal macrophages during LPS-driven inflammation?

    Directory of Open Access Journals (Sweden)

    Ana Flavia Popi

    Full Text Available The inflammatory response is driven by signals that recruit and elicit immune cells to areas of tissue damage or infection. The concept of a mononuclear phagocyte system postulates that monocytes circulating in the bloodstream are recruited to inflamed tissues where they give rise to macrophages. A recent publication demonstrated that the large increase in the macrophages observed during infection was the result of the multiplication of these cells rather than the recruitment of blood monocytes. We demonstrated previously that B-1 cells undergo differentiation to acquire a mononuclear phagocyte phenotype in vitro (B-1CDP, and we propose that B-1 cells could be an alternative origin for peritoneal macrophages. A number of recent studies that describe the phagocytic and microbicidal activity of B-1 cells in vitro and in vivo support this hypothesis. Based on these findings, we further investigated the differentiation of B-1 cells into phagocytes in vivo in response to LPS-induced inflammation. Therefore, we investigated the role of B-1 cells in the composition of the peritoneal macrophage population after LPS stimulation using osteopetrotic mice, BALB/Xid mice and the depletion of monocytes/macrophages by clodronate treatment. We show that peritoneal macrophages appear in op/op((-/- mice after LPS stimulation and exhibit the same Ig gene rearrangement (VH11 that is often found in B-1 cells. These results strongly suggest that op/op((-/- peritoneal "macrophages" are B-1CDP. Similarly, the LPS-induced increase in the macrophage population was observed even following monocyte/macrophage depletion by clodronate. After monocyte/macrophage depletion by clodronate, LPS-elicited macrophages were observed in BALB/Xid mice only following the transfer of B-1 cells. Based on these data, we confirmed that B-1 cell differentiation into phagocytes also occurs in vivo. In conclusion, the results strongly suggest that B-1 cell derived phagocytes are a component of

  16. Identification of NR0B1 as a novel androgen receptor co-repressor in mouse Sertoli cells.

    Science.gov (United States)

    Li, Yu-Chi; Luo, Man-Ling; Guo, Huan; Wang, Tian-Tian; Lin, Shou-Ren; Chen, Jian-Bo; Ma, Qian; Gu, Yan-Li; Jiang, Zhi-Mao; Gui, Yao-Ting

    2016-09-01

    Nuclear receptor subfamily 0 group B member 1 (Nr0b1) is an atypical member of the nuclear receptor family that is predominantly expressed in mouse Sertoli cells (SCs). Mutations of NR0B1 in humans cause adrenal failure and hypogonadotropic hypogonadism. The targeted mutagenesis of Nr0b1 in mice has revealed a primary gonadal defect characterized by the overexpression of aromatase and cellular obstruction of the seminiferous tubules and efferent ductules, leading to germ cell death and infertility. The transgenic expression of Nr0b1 under the control of the Müllerian-inhibiting substance promoter (MIS-Nr0b1), which is selectively expressed in SCs, improves fertility. Testicular androgen receptor (AR) was also expressed in SCs. Many genes are directly regulated by androgen and its AR, which are involved in spermatogenesis and male infertility. As the association between NR0B1 and AR remains unclear in mouse SCs, we decided to further explore the relationship between them. In the present study, we have identified NR0B1 as a novel AR co-repressor in mouse SCs. Using RT‑qPCR and immunofluorescence, we determined that NR0B1 was mainly expressed in mouse SCs in an age-dependent manner from 2-8 weeks of age postnatally. The inhibition of the effects of AR on AR target genes by NR0B1, in an androgen‑dependent manner, was further demonstrated by western blot analysis and RT-qPCR in TM4 cells, a mouse Sertoli cell line. Finally, in vitro luciferase and co-immunoprecipitation assays validated that NR0B1, as an AR co-repressor, significantly inhibited the transcriptional activation of its target genes. These results suggest that novel inhibitory mechanisms underlie the effects of NR0B1 in modulating androgen-dependent gene transcription in mouse SCs. PMID:27431683

  17. In vitro study of vitamins B1, B2 and B6 adsorption on zeolite

    Directory of Open Access Journals (Sweden)

    Basić Zorica

    2011-01-01

    Full Text Available Background/Aim. Zeolites are the hydratised alumosilicates of alcali and earthalcali cations, which have a long three-dimensional crystal structure. Preparations on the basis of zeolites are used for adsorption of organic and nonorganic toxic substances and they, also, find more and more use in veterinary and human medicine and pharmacy. The aim of this study was to evaluate the possibilities of zeolite to adsorb vitamins B1, B2 and B6 in acid and neutral solutions, as well as the characteristics of the process (saturability, reversibility and competitivness. Methods. The specific and sensitive HPLC method with fluorescent detector was used for determination of vitamins B1, B2 and B6. Analyte separation and detection were carried out by applying the reverse-phase method on column C18. An in vitro experiment was done by testing the influence of pH value (2 and 7, concentration of vitamin solution (1, 2 and 5 mg/L, the lenght of contact with zeolite (10-180 min and cation competitiveness on the exchange capacity, which is achieved by media and zeolite contact, as well as a possible vitamins desorption through changing pH value of the solution at 37°C. Jon competitiveness was examined by adding commercial feed mixture (grower with a defined content of the examined vitamines in zeolite solutions the pH = 2 and pH = 7. Results. Vitamins B1, B2 and B6 were stable in both pH=2 and pH = 7 solutions at 37°C, in the defined time intervals. In acid solution concentrations of vitamins significantly declined in the first 10 min, with no significant decline in further 30 min for all the three concentrations testch. In neutral solution, after the addition of 1% zeolite, decrease in vitamins concentrations was slightly lower than in acid solution, but also significant in the first 10 min of the contact with zeolite. It was found that zeolite, which adsorbed vitamins in acid solution, transferred in the neutral one released a significant quantity of adsorbed

  18. Spinning fluids reactor

    Science.gov (United States)

    Miller, Jan D; Hupka, Jan; Aranowski, Robert

    2012-11-20

    A spinning fluids reactor, includes a reactor body (24) having a circular cross-section and a fluid contactor screen (26) within the reactor body (24). The fluid contactor screen (26) having a plurality of apertures and a circular cross-section concentric with the reactor body (24) for a length thus forming an inner volume (28) bound by the fluid contactor screen (26) and an outer volume (30) bound by the reactor body (24) and the fluid contactor screen (26). A primary inlet (20) can be operatively connected to the reactor body (24) and can be configured to produce flow-through first spinning flow of a first fluid within the inner volume (28). A secondary inlet (22) can similarly be operatively connected to the reactor body (24) and can be configured to produce a second flow of a second fluid within the outer volume (30) which is optionally spinning.

  19. GM2 gangliosidosis B1 variant: biochemical and molecular characterization of hexosaminidase A.

    Science.gov (United States)

    Peleg, L; Meltzer, F; Karpati, M; Goldman, B

    1995-04-01

    The biochemical properties of hexosaminidase A (HexA) and the coding sequence of the alpha-subunit were examined in a patient of Syrian ancestry with the B1 form of Tay-Sachs disease (TSD). The biochemical characteristics of the variant HexA suggest that both active sites are affected by the mutation(s). Kinetic studies with the beta-subunit specific substrate, 4-methylumbelliferyl-beta-D-N-acetylglucosamine (MUG), revealed a significant difference between the Km values. of normal and variant HexA, while no difference was found when the sulfated substrate MUG-6-sulfate (MUGS), which is specific for the alpha-subunit active site, was used. The Vmax values for both substrates were significantly lower in extracts from B1 variant cells than in control extracts, implying a reduced enzyme level in the variant cells. A noncompetitive inhibitor of the reaction with MUGS, N-acetylglucosamine (NAG), induced a significant inhibition (30%) in the mutant cells only. When MUG was used as substrate, variant HexA was found to be more heat stable (T50 = 170 min) than normal HexA (T50 = 65 min). Furthermore, the mutant cell preparation differed from control in the relation between Hex thermosensitivity and protein concentration in the reaction. Two new mutations were identified in exon 5 of the HexA gene: a C496 to G transversion, which produced an Arg166 -->Gly alteration and a deletion of C498 which generated a shift in the reading frame. The patient was a heterozygote for both mutations even though her parents are first cousins. There is no evidence as yet which of these mutations accounts for the B1 phenotype. PMID:8581357

  20. The CHESS survey of the L1157-B1 bow-shock: Dissecting the water content

    Science.gov (United States)

    Busquet, Gemma; Lefloch, Bertrand; Benedettini, Milena; Ceccarelli, Cecilia; Codella, Claudio; Cabrit, Sylvie; Nisini, Brunella; Viti, Serena; Gómez-Ruiz, Arturo; Gusdorf, Antoine; Di Giorgio, Anna Maria; Wiesenfeld, Laurent

    2013-07-01

    Molecular outflows powered by young protostars strongly affect the kinematics and chemistry of the natal molecular cloud through strong shocks, resulting in an increase of the abundance of several species. In particular, water is a powerful tracer of shocked material due to its sensitivity to both physical conditions and chemical processes. The observations of the "Chemical Herschel Survey of Star forming regions" (CHESS) key program towards the shock region L1157-B1 offered a unique and comprehensive view of the water emission in a typical protostellar bow shock across the submillimeter and far-infrared window. A grand total of 13 water lines have been detected with the PACS and HIFI instruments, probing a wide range of excitation conditions and providing us with a detailed picture on both the kinematics and the spatial distribution of water emission. Several gas components have been identified coexisting in the L1157-B1 shock region. Large Velocity Gradient (LVG) analysis reveals that these components have different excitation conditions: i) a warm (T~250 K) and dense (n(H2)~10^6 cm-3) gas component seen also with the CO lines and associated with the partly dissociative shock produced by the impact of the protostellar jet against the bow shock; ii) a compact (size~5''), hot (T~700 K), and less dense (n(H2)~10^4 cm-3) gas component, and iii) an extended component associated with the B1 outflow cavity. These three components present clear differences in terms of water enrichment. Finally, we confront the physical and chemical properties of the H2O emission to the predictions of current shock models.

  1. THE VITAMIN B(1) AND B(2) G CONTENT OF LIVER EXTRACT AND BREWERS' YEAST CONCENTRATE.

    Science.gov (United States)

    Miller, D K; Rhoads, C P

    1934-02-28

    1. Liver extract powder, No. 343 Lilly, and the same material prepared for parenteral use, when administered daily by mouth in amounts derived from 2.5 gm. of fresh whole liver, to rats weighing from 40 to 50 gm., contain sufficient vitamin B(1) to support normal growth, provided the animals receive in addition an adequate amount of vitamin B(2) G. Moreover, liver extract in the forms mentioned, administered in the same amounts, does not contain sufficient vitamin B(2) G to maintain normal growth of similar rate when all other necessary constituents of the diet are provided. 2. Liver extract (Lilly) in the form prepared for parenteral use, when administered daily by intraperitoneal injections, in amounts derived from 2.5 gm. of fresh whole liver, to rats under standard experimental conditions, does not contain sufficient vitamin B(2) G to maintain normal growth. Furthermore, the amount of vitamin B(1) present in liver extract in this form is not as effective in supporting normal growth when given by intraperitoneal injection as it is when given by mouth. 3. Vegex, when administered daily in amounts of 50, 150, and 250 mg. to rats of 40 to 50 gm. in weight contains sufficient vitamin B(1) to maintain normal growth of the rats, provided the animals receive in addition an adequate amount of vitamin B(2) G. However, vegex in the same amounts does not contain sufficient vitamin B(2) G to support normal growth of similar rats when all other necessary constituents of the diet are provided. 4. These experiments indicate that the extrinsic, anti-anemic factor of Castle and the thermostable growth-promoting food constituent, commonly known as vitamin B(2) G, are not identical.

  2. H2S in the L1157-B1 bow shock

    Science.gov (United States)

    Holdship, Jonathan; Viti, Serena; Jimenez-Serra, Izaskun; Lefloch, Bertrand; Codella, Claudio; Podio, Linda; Benedettini, Milena; Fontani, Francesco; Bachiller, Rafael; Tafalla, Mario; Ceccarelli, Cecilia

    2016-11-01

    Sulphur-bearing molecules are highly reactive in the gas phase of the interstellar medium. However, the form in which most of the sulphur is locked on to interstellar dust grains is unknown. By taking advantage of the short time-scales of shocks in young molecular outflows, one could track back the main form of sulphur in the ices. In this paper, six transitions of H2S and its isotopologues in the L1157-B1 bow shock have been detected using data from the Herschel-Chemical HErschel Surveys of Star forming regions survey and the IRAM-30m Astrochemical Surveys At IRAM large programme. These detections are used to calculate the properties of H2S gas in L1157-B1 through use of a rotation diagram and to explore the possible carriers of sulphur on the grains. The isotopologue detections allow the first calculation of the H2S deuteration fraction in an outflow from a low-mass protostar. The fractional abundance of H2S in the region is found to be 6.0 × 10-7 and the deuteration fraction is 2 × 10-2. In order to investigate the form of sulphur on the grains, a chemical model is run with four different networks, each with different branching ratios for the freeze out of sulphur-bearing species into molecules such as OCS and H2S. It is found that the model best fits the data when at least half of each sulphur-bearing species hydrogenates when freezing. We therefore conclude that a significant fraction of sulphur in L1157-B1 is likely to be locked in H2S on the grains.

  3. Sustained spindle-assembly checkpoint response requires de novo transcription and translation of cyclin B1.

    Directory of Open Access Journals (Sweden)

    Ana Lúcia Mena

    Full Text Available BACKGROUND: Microtubule-targeting drugs induce mitotic delay at pro-metaphase by preventing the spindle assembly checkpoint to be satisfied. However, especially after prolonged treatments, cells can escape this arrest in a process called mitotic slippage. The mechanisms underlying the spindle assembly checkpoint and slippage are not fully understood. It has been generally accepted that during mitosis there is a temporary shutdown of high-energy-consuming processes, such as transcription and translation. However, the synthesis of specific proteins is maintained or up-regulated since protein synthesis is necessary for entry into and progression through mitosis. METHODOLOGY/PRINCIPAL FINDINGS: In this work we investigated whether the mitotic arrest caused by the mitotic checkpoint is independent of transcription and translation. By using immunofluorescent microscopy and western blotting, we demonstrate that inhibition of either of these processes induces a shortening of the mitotic arrest caused by the nocodazole treatment, and ultimately leads to mitotic slippage. Our western blotting and RTQ-PCR results show that inhibition of transcription during mitotic arrest does not affect the expression of the spindle checkpoint proteins, whereas it induces a significant decrease in the mRNA and protein levels of Cyclin B1. The exogenous expression of Cyclin B1 substantially rescued the mitotic phenotype in nocodazole cells treated with the inhibitors of transcription and translation. CONCLUSIONS/SIGNIFICANCE: This work emphasizes the importance of transcription and translation for the maintenance of the spindle assembly checkpoint, suggesting the existence of a mechanism dependent on cyclin B1 gene regulation during mitosis. We propose that continuous transcription of mitotic regulators is required to sustain the activation of the spindle assembly checkpoint.

  4. New AP4B1 mutation in an African-American child associated with intellectual disability

    Science.gov (United States)

    Lamichhane, Dronacharya

    2013-01-01

    Prevalence of intellectual disability (ID) varies from 1–3%. Genetic causes of ID are being increasingly recognized. Although multiple mutations have been identified as a cause of syndromic ID, the genetic etiology of non-syndromic ID is poorly understood. However, more than 100 loci have been mapped that are associated with non-syndromic ID. There have been a couple of reports of AP4B1 gene mutation causing severe intellectual disability, absent speech, shy character, stereotypic laughter, muscular hypotonia that progressed to spastic paraplegia, microcephaly, foot deformity, decreased muscle mass of the lower limbs, inability to walk, and growth retardation. They had structural brain abnormalities and seizures. The reported cases were from Arab families where consanguineous marriage is common. We encountered an African-American child who presented first at the age of 24 mo with language difficulties and was subsequently found to have moderate to severe intellectual disability by standardized tests. Shortly, he started to have seizures and problems with ambulation. Although he was hypotonic at the time of presentation, legs slowly became spastic at the age of 4 yr. After a thorough work up, he was found to have heterozygous mutation in the AP4B1 gene along with another missense mutation in the same gene. There has been no report of mutation in this gene in the North American population. Although AP4B1 typically is said to be an autosomal recessive disease-causing gene, our case is different in the sense that there are two mutations in the same gene one of which has never been reported before and co-exists with a known disease causing mutation. Yet, the phenotype of the case closely resembles those published previously.

  5. H2S in the L1157-B1 Bow Shock

    Science.gov (United States)

    Holdship, Jonathan; Viti, Serena; Jimenez-Serra, Izaskun; Lefloch, Bertrand; Codella, Claudio; Podio, Linda; Benedettini, Milena; Fontani, Francesco; Bachiller, Rafael; Tafalla, Mario; Ceccarelli, Cecilia

    2016-08-01

    Sulfur-bearing molecules are highly reactive in the gas phase of the ISM. However, the form in which most of the sulfur is locked onto interstellar dust grains is unknown. By taking advantage of the short time-scales of shocks in young molecular outflows, one could track back the main form of sulfur in the ices. In this paper, six transitions of H2S and its isotopologues in the L1157-B1 bowshock have been detected using data from the Herschel-CHESS survey and the IRAM-30m ASAI large program. These detections are used to calculate the properties of H2S gas in L1157-B1 through use of a rotation diagram and to explore the possible carriers of sulfur on the grains. The isotopologue detections allow the first calculation of the H2S deuteration fraction in an outflow from a low mass protostar. The fractional abundance of H2S in the region is found to be 6.0× 10-7 and the deuteration fraction is 2× 10-2. In order to investigate the form of sulfur on the grains, a chemical model is run with four different networks, each with different branching ratios for the freeze out of sulfur bearing species into molecules such as OCS and H2S. It is found that the model best fits the data when at least half of each sulfur bearing species hydrogenates when freezing. We therefore conclude that a significant fraction of sulfur in L1157-B1 is likely to be locked in H2S on the grains.

  6. Degradation and Application of Aflatoxin B1 by Aspergillus Niger%黑曲霉对黄曲霉毒素B1的降解与应用研究

    Institute of Scientific and Technical Information of China (English)

    李冰; 董征英; 常维山

    2012-01-01

    试验利用黑曲霉对黄曲霉毒素B1进行了降解率、活性组分的确定、安全性及对饲料中降解黄曲霉毒素效果的研究。研究结果表明,黑曲霉对黄曲霉毒素B1的降解率达93.28%,其中黑曲霉的胞外粗提液对黄曲霉毒素B1的降解活性最高,证明黑曲霉对黄曲霉毒素B1的降解是一种生物化学反应,黑曲霉发酵液对饲料中的黄曲霉毒素B1具有很强的降解作用。小鼠的急性毒理学试验证明,试验用黑曲霉本身具有良好的安全性。%The determination of degradation efficiency and active components of aflatoxin B1 safety and the effect of degradation aflatoxin in feed about the screened aspergillus was researched in this experiment used aspergillus niger. The result showed that the degradation of aflatoxin B1 by aspergillus niger was 93.28%, the degrading efficiencies of aflatoxin B1 by exocellular coarse extraction liquid was highest, and this proved that the degration of aflatoxin B1 by aspergillus niger was a biological reaction. The degrading effect of aflatoxin B1 in feed by aspergillus fermented liquid was strong. A favorable safety of aspergillus niger was testified through the acute toxicology experiments in mice.

  7. Numerical study of the static and pitching RISØ-B1-18 airfoil

    DEFF Research Database (Denmark)

    Bertagnolio, Franck

    2004-01-01

    The objective of this report is the better understanding of the physics of the aeroelastic motion of wind turbine blades in order to improve the numerical models used for their design. In this study, the case of the RISØ-B1-18 airfoil which was equippedand measured in an open jet wind tunnel...... is studied. Two and three dimensional Navier-Stokes calculations using the k-w SST and Detached Eddy Simulation turbulence models are conducted. An engineering semi-empirical dynamic stall model is also used forperforming calculations. Computational results are compared to the experimental results...

  8. 2-Isobutyl-6-(4-methoxyphenylimidazo[2,1-b][1,3,4]thiadiazole

    Directory of Open Access Journals (Sweden)

    Hoong-Kun Fun

    2011-02-01

    Full Text Available In the title compound, C15H17N3OS, the dihedral angle between the statistically planar imidazo[2,1-b][1,3,4]thiadiazole fused-ring system (r.m.s. deviation = 0.002 Å and the methyoxbenzene ring is 4.52 (6°. In the crystal, molecules are arranged into columns and stacked down the a axis. The crystal structure is stabilized by weak C—H...π and π–π interactions [centroid–centroid separations = 3.6053 (8 and 3.7088 (7 Å].

  9. Common Variants in the ATP2B1 Gene Are Associated With Susceptibility to Hypertension

    Science.gov (United States)

    Tabara, Yasuharu; Kohara, Katsuhiko; Kita, Yoshikuni; Hirawa, Nobuhito; Katsuya, Tomohiro; Ohkubo, Takayoshi; Hiura, Yumiko; Tajima, Atsushi; Morisaki, Takayuki; Miyata, Toshiyuki; Nakayama, Tomohiro; Takashima, Naoyuki; Nakura, Jun; Kawamoto, Ryuichi; Takahashi, Norio; Hata, Akira; Soma, Masayoshi; Imai, Yutaka; Kokubo, Yoshihiro; Okamura, Tomonori; Tomoike, Hitonobu; Iwai, Naoharu; Ogihara, Toshio; Inoue, Itsuro; Tokunaga, Katsushi; Johnson, Toby; Caulfield, Mark; Munroe, Patricia; Umemura, Satoshi; Ueshima, Hirotsugu; Miki, Tetsuro

    2016-01-01

    Hypertension is one of the most common complex genetic disorders. We have described previously 38 single nucleotide polymorphisms (SNPs) with suggestive association with hypertension in Japanese individuals. In this study we extend our previous findings by analyzing a large sample of Japanese individuals (n=14 105) for the most associated SNPs. We also conducted replication analyses in Japanese of susceptibility loci for hypertension identified recently from genome-wide association studies of European ancestries. Association analysis revealed significant association of the ATP2B1 rs2070759 polymorphism with hypertension (P=5.3×10−5; allelic odds ratio: 1.17 [95% CI: 1.09 to 1.26]). Additional SNPs in ATP2B1 were subsequently genotyped, and the most significant association was with rs11105378 (odds ratio: 1.31 [95% CI: 1.21 to 1.42]; P=4.1×10−11). Association of rs11105378 with hypertension was cross-validated by replication analysis with the Global Blood Pressure Genetics consortium data set (odds ratio: 1.13 [95% CI: 1.05 to 1.21]; P=5.9×10−4). Mean adjusted systolic blood pressure was highly significantly associated with the same SNP in a meta-analysis with individuals of European descent (P=1.4×10−18). ATP2B1 mRNA expression levels in umbilical artery smooth muscle cells were found to be significantly different among rs11105378 genotypes. Seven SNPs discovered in published genome-wide association studies were also genotyped in the Japanese population. In the combined analysis with replicated 3 genes, FGF5 rs1458038, CYP17A1, rs1004467, and CSK rs1378942, odds ratio of the highest risk group was 2.27 (95% CI: 1.65 to 3.12; P=4.6×10−7) compared with the lower risk group. In summary, this study confirmed common genetic variation in ATP2B1, as well as FGF5, CYP17A1, and CSK, to be associated with blood pressure levels and risk of hypertension. PMID:20921432

  10. Role of Orphan Nuclear Receptor DAX-1/NR0B1 in Development, Physiology, and Disease

    Directory of Open Access Journals (Sweden)

    Enzo Lalli

    2014-01-01

    Full Text Available DAX-1/NR0B1 is an unusual orphan receptor that has a pivotal role in the development and function of steroidogenic tissues and of the reproductive axis. Recent studies have also indicated that this transcription factor has an important function in stem cell biology and in several types of cancer. Here I critically review the most important findings on the role of DAX-1 in development, physiology, and disease of endocrine tissues since the cloning of its gene twenty years ago.

  11. The pressure-induced transformation B1 to B2 in actinide compounds

    International Nuclear Information System (INIS)

    The phase transformation from NaCl structure (B1) to CsCl structure (B2) in actinide compounds has been studied using X-ray powder diffraction in the pressure range up to about 60 GPa. It is shown that the transition is sluggish, has a strong hysteresis and is accompanied with a volume change in the range 8-12%. These features are similar to those of the corresponding transition in the alkali halides and other compounds, indicating a common mechanism for the transformation as concerns the lattice geometry. (orig.)

  12. High mobility group B1 impairs hepatocyte regeneration in acetaminophen hepatotoxicity

    OpenAIRE

    Yang Runkuan; Zhang Shutian; Cotoia Antonella; Oksala Niku; Zhu Shengtao; Tenhunen Jyrki

    2012-01-01

    Abstract Background Acetaminophen (APAP) overdose induces massive hepatocyte necrosis. Necrotic tissue releases high mobility group B1 (HMGB1), and HMGB1 contributes to liver injury. Even though blockade of HMGB1 does not protect against APAP-induced acute liver injury (ALI) at 9 h time point, the later time points are not studied and the role of HMGB1 in APAP overdose is unknown, it is possible that neutralization of HMGB1 might improve hepatocyte regeneration. This study aims to test whethe...

  13. Thiamin (Vitamin B1 Biosynthesis and Regulation: A Rich Source of Antimicrobial Drug Targets?

    Directory of Open Access Journals (Sweden)

    Qinglin Du, Honghai Wang, Jianping Xie

    2011-01-01

    Full Text Available Drug resistance of pathogens has necessitated the identification of novel targets for antibiotics. Thiamin (vitamin B1 is an essential cofactor for all organisms in its active form thiamin diphosphate (ThDP. Therefore, its metabolic pathways might be one largely untapped source of antibiotics targets. This review describes bacterial thiamin biosynthetic, salvage, and transport pathways. Essential thiamin synthetic enzymes such as Dxs and ThiE are proposed as promising drug targets. The regulation mechanism of thiamin biosynthesis by ThDP riboswitch is also discussed. As drug targets of existing antimicrobial compound pyrithiamin, the ThDP riboswitch might serves as alternative targets for more antibiotics.

  14. Aflatoxin B1 levels in groundnut and sunflower oils in different Sudanese states.

    Science.gov (United States)

    Mariod, Abdalbasit Adam; Idris, Yousif Mohamed Ahmed

    2015-01-01

    In this article, the level of contamination of aflatoxin B1 (AFB1) in groundnut and sunflower oils was determined. The 241 oil samples were collected from Khartoum, Gezira, Kordofan and Algadarif states of Sudan and assessed for AFB1 using high-performance liquid chromatography (HPLC). AFB1 levels in groundnut oil samples ranged from 0.5 to 70 µg/kg and were 0.7 to 35 µg/kg in sunflower oil samples. High contamination was found in unrefined samples. It was concluded that AFB1 levels in oil samples indicated that growing, harvesting, handling and storage of the crops were not done properly.

  15. Study of external dynamic flap loads on a 6 percent B-1B model

    Science.gov (United States)

    Seiner, John M.; Manning, James C.; Capone, Francis J.; Pendergraft, Odis C., Jr.

    1991-01-01

    The origin of dynamic pressure loads on external divergent engine nozzle flaps of the B-1B aircraft was investigated in the NASA/LaRC 16 foot transonic tunnel using a 6 percent full span model with powered engine nacelles. External flap dynamic loads and afterbody drag associated with flap removal were measured using this model. Both dry and max. A/B power nozzles were evaluated in this study. As a result of this study, the principal mechanisms responsible for high dynamic external flap loads were determined along with performance penalty associated with flap removal.

  16. A full CI treatment of the 1A1-3B1 separation in methylene

    Science.gov (United States)

    Bauschlicher, Charles W., Jr.; Taylor, Peter R.

    1986-01-01

    The accuracy of recent theoretical computations of the total energies and the adiabatic separation of the 1A1 and 3B1 states of CH2 is investigated on the basis of complete CI calculations using the double-zeta basis sets of Dunning (1970). The results are presented in a table and characterized in detail. The errors in the separation values are found to range from less than 0.01 kcal/mol for a CASSCF/MRSDCI calculation, to 0.38 kcal/mol for a Davidson-corrected SCF/SDCI calculation, to 14.17 kcal/mol for an uncorrected SCF calculation.

  17. Determination of Aflatoxin B1 Levels in Organic Spices and Herbs

    OpenAIRE

    Halil Tosun; Recep Arslan

    2013-01-01

    Organically produced spices and herbs were analyzed for determination of aflatoxin B1 (AFB1) by ELISA using immunoaffinity column. For this purpose 93 organic spices and 37 organic herbs were randomly selected from organic markets and organic shops in Turkey. AFB1 was detected in 58 organic spice and 32 organic herb samples. Among organic spice samples, the maximum value was detected in cinnamon sample (53  μ g/kg). AFB1 was not detected in thyme samples. AFB1 levels of 41 organic spice sampl...

  18. 26 CFR 1.179B-1T - Deduction for capital costs incurred in complying with Environmental Protection Agency sulfur...

    Science.gov (United States)

    2010-04-01

    ... program (40 CFR part 80, subpart I). (ii) The average daily domestic refinery run for a refinery is the... complying with Environmental Protection Agency sulfur regulations (temporary). 1.179B-1T Section 1.179B-1T... capital costs incurred in complying with Environmental Protection Agency sulfur regulations...

  19. Effect of Gamma-irradiation on aflatoxin B1 produced by aspergillus parasiticus in barley containing antimicrobial food additives

    International Nuclear Information System (INIS)

    Influence of gamma irradiation on, growth and aflatoxin B1 produced by aspergillus parasiticus in ba supplemented with sodium chloride, potassium sorbate and sodium benzoate was investigated. Total viable population of A. Parasiticus and aflatoxin B1 production decreased significantly by increasing gamma irradiation doses. No growth or aflatoxin B1 production occurred at 4.0 KGy. Increasing the concentration of NaCl reduced the total viable population A. Parasiticus as well as the accumulation of aflatoxin B1. No growth and aflatoxin B1 production occurred in barley treated with 2.0 KGy and 6% NaCl. Potassium sorbate and sodium benzoate at concentration 500 ppm reduced the population of A. Parasiticus and the levels of aflatoxin B1 over 100 days. At 2.0 KGy, a sharp drop in aflatoxin B1 level occurred in barley by 2% NaCl and 500 ppm potassium sorbate and sodium benzoate. At 2.0 KGy, 2% NaCl and 1000 ppm potassium sorbate and sodium benzoate completely inhibited growth and aflatoxin B1 production by A. parasiticus for 100 days of incubation

  20. KINETICS OF PERITONEAL B-1A CELLS (CD5 B-CELLS) IN YOUNG-ADULT MICE

    NARCIS (Netherlands)

    DEENEN, GJ; KROESE, FGM

    1993-01-01

    In the mouse, conventional B cells are continuously generated from precursor cells located in the bone marrow (BM), whereas the small subset of B-1 cells (formerly called Ly-1 B cells) constitute a self-replenishing population of cells. Here we studied the kinetics of murine peritoneal B-1a cells (i

  1. 26 CFR 1.673(b)-1 - Income payable to charitable beneficiaries before amendment by Tax Reform Act of 1969).

    Science.gov (United States)

    2010-04-01

    ... before amendment by Tax Reform Act of 1969). 1.673(b)-1 Section 1.673(b)-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Grantors and... amendment by Tax Reform Act of 1969). (a) Pursuant to section 673(b) a grantor is not treated as an owner...

  2. Increased susceptibility to atrial fibrillation secondary to atrial fibrosis in transgenic goats expressing transforming growth factor - B1

    Science.gov (United States)

    Atrial fibrillation (AF) is the most common sustained cardiac arrhythmia in people with significant morbidity and mortality. There is a strong association between atrial fibrosis and AF. Transforming growth factor B1 (TGF-B1) is an essential mediator of atrial fibrosis in animal models and human pat...

  3. 26 CFR 20.6324B-1 - Special lien for additional estate tax attributable to farm, etc., valuation.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 14 2010-04-01 2010-04-01 false Special lien for additional estate tax attributable to farm, etc., valuation. 20.6324B-1 Section 20.6324B-1 Internal Revenue INTERNAL REVENUE SERVICE... attributable to farm, etc., valuation. (a) General rule. In the case of an estate of a decedent dying...

  4. Reactor Vessel Surveillance Program for Advanced Reactor

    Energy Technology Data Exchange (ETDEWEB)

    Jeong, Kyeong-Hoon; Kim, Tae-Wan; Lee, Gyu-Mahn; Kim, Jong-Wook; Park, Keun-Bae; Kim, Keung-Koo

    2008-10-15

    This report provides the design requirements of an integral type reactor vessel surveillance program for an integral type reactor in accordance with the requirements of Korean MEST (Ministry of Education, Science and Technology Development) Notice 2008-18. This report covers the requirements for the design of surveillance capsule assemblies including their test specimens, test block materials, handling tools, and monitors of the surveillance capsule neutron fluence and temperature. In addition, this report provides design requirements for the program for irradiation surveillance of reactor vessel materials, a layout of specimens and monitors in the surveillance capsule, procedures of installation and retrieval of the surveillance capsule assemblies, and the layout of the surveillance capsule assemblies in the reactor.

  5. Isolation and characterization of a UV-sensitive mutator (mutB1) mutant of Haemophilus influenzae

    International Nuclear Information System (INIS)

    The mutB1 mutant of Haemophilus influenzae is very sensitive to UV radiation but only slightly sensitive to methylmethane sulfonate or N-methyl-N'-nitro-N-nitrosoguanidine. Cultures of mutB1 cells contain high numbers of spontaneous mutants and show hypermutability after exposure to the latter mutagen. Normally high-efficiency transforming markers, as well as low-efficiency ones, transform mutB1 recipients at similarly low efficiencies. Significant host cell reactivation was observed when mutB1 cells were exposed to UV-damaged phage; however, these mutants showed a decrease in phage recombination. This mutant did not degrade its DNA following exposure to UV. It is speculated that the mutB1 mutation is similar to the Escherichia coli uvrD mutation

  6. [Growth and bioluminescence of luminous bacteria under the action of aflatoxin B1 before and after its treatment with nanodiamonds].

    Science.gov (United States)

    Mogil'naia, O A; Puzyr', A P; Bondar', V S

    2010-01-01

    The effect of aflatoxin B1 on growth and luminescence of marine luminous bacteria P. phosphoreum and recombinant E. coli Z905 cells was investigated. The bidirectional effect of aflatoxin B1 on the studied bacterial species was detected--an inhibition of luminescence in P. phosphoreum and its stimulation in E. coli. It was shown that aflatoxin B1 influences the cell luminescence in the freshly grown cultures and bacteria restored after lyophilization. It was detected that the effect of aflatoxin B1 was graded after interaction with the modified nanodiamond (MND) of detonation synthesis. After mycotoxin's treatment with MND, it does not cause significant changes in bacterial luminescence. The possibilities for the use of P. phosphoreum and E. coli bacteria in the bioluminescent monitoring of aflatoxin B1 and the use of MND for mycotoxin deactivation are discussed. PMID:20198915

  7. Isolation and characterization of a UV-sensitive mutator (mutB1) mutant of Haemophilus influenzae

    Energy Technology Data Exchange (ETDEWEB)

    Walter, R.B.; Stuy, J.H.

    1988-06-01

    The mutB1 mutant of Haemophilus influenzae is very sensitive to UV radiation but only slightly sensitive to methylmethane sulfonate or N-methyl-N'-nitro-N-nitrosoguanidine. Cultures of mutB1 cells contain high numbers of spontaneous mutants and show hypermutability after exposure to the latter mutagen. Normally high-efficiency transforming markers, as well as low-efficiency ones, transform mutB1 recipients at similarly low efficiencies. Significant host cell reactivation was observed when mutB1 cells were exposed to UV-damaged phage; however, these mutants showed a decrease in phage recombination. This mutant did not degrade its DNA following exposure to UV. It is speculated that the mutB1 mutation is similar to the Escherichia coli uvrD mutation.

  8. Transcriptomic Analysis of Aflatoxin B1-Regulated Genes in Rat Hepatic Epithelial Cells

    Institute of Scientific and Technical Information of China (English)

    杨柳; 季静; 李光辉; 李君文; 陈招立; 王海勇

    2014-01-01

    Aflatoxins are the most popular hepatotoxicants. Chronic exposure to aflatoxins leads to a wide variety of liver diseases, such as hepatocellular carcinoma. In this study, we analyzed the genome wide expression profiles of aflatoxin B1-induced rat hepatic epithelial cells. The expression of 325, 184 and 199 special genes was altered when exposed to 0.03, 0.1 and 0.2 μmol/L aflatoxin B1 respectively, and 239 genes were commonly expressed. After the functional analysis on these dose-special genes, we determined several key pathways related to hepatotoxicity, such as TGF-beta signaling pathway, tight junction, adherens junction, the regulation of actin cytoskeleton, ErbB signaling pathway, p53 signaling pathway, pathways in cancer and axon guidance. Common genes were mainly associated with focal adhesion, ECM-receptor interaction, and cell adhesion molecules. Gene ontology annotations showed a good concordance with these pathways. The quantitative real-time polymerase chain reaction(PCR) analysis of selected genes showed similar patterns in microarrays. The toxicogenomic study provides a better understanding of molecular mechanisms of aflatoxins.

  9. Protection against aflatoxin-B1-induced liver mutagenesis by Scutellaria baicalensis.

    Science.gov (United States)

    de Boer, Johan G; Quiney, Brendan; Walter, Patrick B; Thomas, Cynthia; Hodgson, Kimberley; Murch, Susan J; Saxena, Praveen K

    2005-10-15

    We have measured the inhibition of the mutagenicity of the mycotoxin aflatoxin-B(1) in the liver of the rat by plant material of Scutellaria baicalensis, or Huang-qin. The addition of one percent dried Huang-qin to the feed of the animals reduced the mutant frequency of a subsequent administration of aflatoxin-B1 by approximately 60 and 77%, respectively, for two different batches of the plant material. The addition of Huang-qin also increased the expression of the gene for glutathione S-transferase A5 subunit by 2.5-3.0-fold, and decreased expression of P450 cytochrome 3A2 by 1.8-2.0-fold. The greater increase of the expression of the GST gene may result in the protection shown by Huang-qin. The sensitivity of the hepatic mitochondria to swelling, a measure of the mitochondrial permeability transition, is increased significantly in animals that are on a diet containing Huang-qin. This may lead to increased sensitivity to apoptosis on treatment with toxic compounds. The two batches of Huang-qin material show differences in both chemical composition and preventive potential. This study demonstrates how a combination of generating and analysis of plant varieties together with a mammalian assay for efficacy may improve the search for better plant-based prevention of cancer initiation. PMID:16202794

  10. Metabolism of Terephthalic Acid and Its Effects on CYP4B1 Induction

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    Objective To investgate the metabolism of terephthalic acid (TPA) in rats and its mechanism. Methods Metabolism was evaluated by incubating sodium terephthalate (NaTPA) with rat normal liver microsomes, or with microsomes pretreated by phenobarbital sodium, or with 3-methycholanthrene, or with diet control following a NADPH-generating system. The determination was performed by high performance liquid chromatography (HPLC), and the mutagenic activation was analyzed by umu tester strain Salmonella typhimurium NM2009. Expression of CYP4B 1 mRNA was detected by RT-PCR. Results The amount of NaTPA (12.5-200 μmol· L-1) detected by HPLC did not decrease in microsomes induced by NADPH-generating system. Incubation of TPA (0.025-0.1 mmol·L-1) with induced or noninduced liver microsomes in an NM2009 umu response system did not show any mutagenic activation. TPA exposure increased the expression of CYP4B 1 mRNA in rat liver, kidney, and bladder. Conclusion Lack of metabolism of TPA in liver and negative genotoxic data from NM2009 study are consistent with other previous short-term tests, suggesting that the carcinogenesis in TPA feeding animals is not directly interfered with TPA itself and/or its metabolites.

  11. Glucoamylase starch-binding domain of Aspergillus niger B1: molecular cloning and functional characterization.

    Science.gov (United States)

    Paldi, Tzur; Levy, Ilan; Shoseyov, Oded

    2003-01-01

    Carbohydrate-binding modules (CBMs) are protein domains located within a carbohydrate-active enzyme, with a discrete fold that can be separated from the catalytic domain. Starch-binding domains (SBDs) are CBMs that are usually found at the C-terminus in many amylolytic enzymes. The SBD from Aspergillus niger B1 (CMI CC 324262) was cloned and expressed in Escherichia coli as an independent domain and the recombinant protein was purified on starch. The A. niger B1 SBD was found to be similar to SBD from A. kawachii, A. niger var. awamori and A. shirusami (95-96% identity) and was classified as a member of the CBM family 20. Characterization of SBD binding to starch indicated that it is essentially irreversible and that its affinity to cationic or anionic starch, as well as to potato or corn starch, does not differ significantly. These observations indicate that the fundamental binding area on these starches is essentially the same. Natural and chemically modified starches are among the most useful biopolymers employed in the industry. Our study demonstrates that SBD binds effectively to both anionic and cationic starch. PMID:12646045

  12. Effect of climate change on Aspergillus flavus and aflatoxin B1 production

    Directory of Open Access Journals (Sweden)

    Angel eMedina

    2014-07-01

    Full Text Available This review considers the available information on the potential impact of key environmental factors and their interactions on the molecular ecology, growth and aflatoxin production by Aspergillus flavus in vitro and in maize grain. The recent studies which have been carried out to examine the impact of water activity x temperature on aflatoxin biosynthesis and phenotypic aflatoxin production are examined. These have shown that there is a direct relationship between the relative expression of key regulatory and structural genes under different environmental conditions which correlate directly with aflatoxin B1 production. A model has been developed to integrate the relative expression of 10 biosynthetic genes in the pathway, growth and aflatoxin B1 (AFB1 production which was validated under elevated temperature and water stress conditions. The effect of interacting conditions of aw x temperature x elevated CO2 (2x and 3x existing levels are detailed for the first time. This suggests that while such interacting environmental conditions have little effect on growth they do have a significant impact on aflatoxin biosynthetic gene expression (structural aflD and regulatory aflR genes and can significantly stimulate the production of AFB1. While the individual factors alone have an impact, it is the combined effect of these three abiotic factors which have an impact on mycotoxin production. This approach provides data which is necessary to help predict the real impacts of climate change on mycotoxigenic fungi.

  13. Structure and Function of the Intracellular Region of the Plexin-B1 Transmembrane Receptor

    Energy Technology Data Exchange (ETDEWEB)

    Tong, Yufeng; Hota, Prasanta K.; Penachioni, Junia Y.; Hamaneh, Mehdi B.; Kim, SoonJeung; Alviani, Rebecca S.; Shen, Limin; He, Hao; Tempel, Wolfram; Tamagnone, Luca; Park, Hee-Won; Buck, Matthias; (Torino); (Toronto); (Case Western U.-Med)

    2010-02-11

    Members of the plexin family are unique transmembrane receptors in that they interact directly with Rho family small GTPases; moreover, they contain a GTPase-activating protein (GAP) domain for R-Ras, which is crucial for plexin-mediated regulation of cell motility. However, the functional role and structural basis of the interactions between the different intracellular domains of plexins remained unclear. Here we present the 2.4 {angstrom} crystal structure of the complete intracellular region of human plexin-B1. The structure is monomeric and reveals that the GAP domain is folded into one structure from two segments, separated by the Rho GTPase binding domain (RBD). The RBD is not dimerized, as observed previously. Instead, binding of a conserved loop region appears to compete with dimerization and anchors the RBD to the GAP domain. Cell-based assays on mutant proteins confirm the functional importance of this coupling loop. Molecular modeling based on structural homology to p120{sup GAP} {center_dot}H-Ras suggests that Ras GTPases can bind to the plexin GAP region. Experimentally, we show that the monomeric intracellular plexin-B1 binds R-Ras but not H-Ras. These findings suggest that the monomeric form of the intracellular region is primed for GAP activity and extend a model for plexin activation.

  14. Algicidal metabolites produced by Bacillus sp. strain B1 against Phaeocystis globosa.

    Science.gov (United States)

    Zhao, Ling; Chen, Lina; Yin, Pinghe

    2014-03-01

    The bloom of Phaeocystis globosa has broken out frequently in the coastal areas of China in recent years, which has led to substantial economic losses. This study shows that Bacillus sp. strain B1, which was previously identified by our group, is effective in regulating P. globosa by excreting active metabolites. Heat stability, pH stability and molecular weight range of the algicidal compounds from strain B1 were measured and the results demonstrated that the algicidal activities of these compounds were not affected by pH or temperature variation. The algicidal compounds extracted with methanol were isolated and purified by ODS-A column chromatography and HPLC. The algicidal compounds corresponding to peaks 2-5 eluted from HPLC were further analysed by quadrupole time-of-flight mass spectrometry (Q-TOF-MS). PeakView™ Software determined the compounds corresponding to peaks 2-5 to be L-histidine, o-tyrosine, N-acetylhistamine and urocanic acid on the basis of the accurate mass information, the isotopic pattern and MS-MS spectra. Furthermore, these compounds were also able to eliminate Skeletonema costatum, Prorocentrum donghaiense and Heterosigma akashiwo. This is the first report of bacteria-derived algicidal compounds being identified only by Q-TOF-MS and PeakView™ Software, and these compounds may be used as the constituents of algicides in the future. PMID:24370882

  15. H2S in the L1157-B1 Bow shock

    CERN Document Server

    Holdship, Jonathan; Jimenez-Serra, Izaskun; Lefloch, Bertrand; Codella, Claudio; Podio, Linda; Benedettini, Milena; Fontani, Francesco; Bachiller, Rafael; Tafalla, Mario; Ceccarelli, Cecilia

    2016-01-01

    Sulfur-bearing molecules are highly reactive in the gas phase of the ISM. However, the form in which most of the sulfur is locked onto interstellar dust grains is unknown. By taking advantage of the short time-scales of shocks in young molecular outflows, one could track back the main form of sulfur in the ices. In this paper, six transitions of H$_2$S and its isotopologues in the L1157-B1 bowshock have been detected using data from the Herschel-CHESS survey and the IRAM-30m ASAI large program. These detections are used to calculate the properties of H$_2$S gas in L1157-B1 through use of a rotation diagram and to explore the possible carriers of sulfur on the grains. The isotopologue detections allow the first calculation of the H$_2$S deuteration fraction in an outflow from a low mass protostar. The fractional abundance of H$_2$S in the region is found to be 6.0$\\times$10$^{-7}$ and the deuteration fraction is 2$\\times$10$^{-2}$. In order to investigate the form of sulfur on the grains, a chemical model is r...

  16. Potential natural exposure of Mississippi sandhill cranes to aflatoxin B1.

    Science.gov (United States)

    Couvillion, C E; Jackson, J R; Ingram, R P; Bennett, L W; McCoy, C P

    1991-10-01

    A survey was conducted to determine if carcinogenic mycotoxins were present in foods consumed by Mississippi sandhill cranes (Grus canadensis pulla). Samples of field corn (Zea mays) (n = 111) and chufa (Cyperus esculentus) (n = 20), obtained in 1987, 1988 and 1989 on the Mississippi Sandhill Crane National Wildlife Refuge (MSCNWR) and nearby private lands were analyzed for aflatoxin B1(AB1), ochratoxin A and sterigmatocystin using thin layer chromatography. Chufa samples were negative for all three mycotoxins. Aflatoxin B1 was found in corn at concentrations from 5 to 5,000 ppb; the other mycotoxins were not found in corn. Contaminated corn was found in 72% of all corn fields, but the proportion of contaminated fields was 57 to 100% for the 3-yr period. Contamination with AB1 was greatest in corn obtained from the ground post-harvest. Overall, 32% of corn samples from the ground had levels greater than or equal to 200 ppb with a mean of 427 ppb (range = 5 to 5,000 ppb) in contaminated fields. In 1989, mean AB1 concentration in corn on the ground was 5 to 1138 ppb for individual fields. The concentration of AB1 was less than or equal to 200 ppb in all corn samples from upright stalks. The study demonstrated that AB1 is available to sandhill cranes and at levels that may pose a serious health threat. PMID:1758031

  17. Pressure dependent elastic and structural (B3-B1) properties of Ga based monopnictides

    International Nuclear Information System (INIS)

    By formulating an effective interionic interaction potential that incorporates the long-range Coulomb, the covalency effects, the charge transfer caused by the deformation of the electron shells of the overlapping ions, the Hafemeister and Flygare type short-range overlap repulsion extended up to the second neighbour ions and the van der Waals (vdW) interaction, the pressure dependent elastic and thermodynamical properties of the III-V semiconductors as GaY (Y = N, P, As) are studied. The estimated values of phase transition pressure of GaY (Y = N, P, As) are in reasonably good agreement with the available data on the phase transition pressures (Pt = 41, 22, 17 GPa). The vast volume discontinuity in pressure-volume phase diagram identifies a structural phase transition from zinc-blende (B3) to rock salt (B1) structure. Later on, the Poisson's ratio ν, the ratio RS/B of S (Voigt averaged shear modulus) over B (bulk modulus), elastic anisotropy parameter, elastic wave velocity, average wave velocity and Debye temperature as functions of pressure is calculated. From Poisson's ratio and the ratio RS/B it is inferred that GaY (Y = N, P, As) is brittle [ductile] in zinc-blende (B3) [Sodium Chloride (B1)] phase. To our knowledge this is the first quantitative theoretical prediction of the pressure dependence of ductile (brittle) nature of GaY compounds and still awaits experimental confirmations.

  18. Measurement and assessment of aflatoxin B1 and its producing molds in Iranian sausages and burgers

    Directory of Open Access Journals (Sweden)

    Siavash Maktabi

    2016-09-01

    Full Text Available Abstract Introduction: Aflatoxin B1 (AFB1 is one of the most well-known hepatocarcinogens in humans. Contamination of raw materials, used in the production of sausages and burgers, with aflatoxin producing molds can lead to increased level of aflatoxin in the final products and can impose hazards to human health. Unfortunately, aflatoxin is resistant to heating and freezing processes, etc. and can remain in these products untile consumption. Methods: During a six-month period, 45 sausage and 53 burger samples from valid brands across the country were randomly purchased from the stores. The samples were analyzed for AFB1 by ELISA technique. Meanwhile, the number of molds was calculated and aflatoxin producing molds were identified by direct and slide culture methods. Results: The findings showed that 2 susage samples (4.9% and 3 burger samples (6.3% were contaminated with >1 ng/g aflatoxin. Moreover, 4 burger samples (8.9% contaminated with mold included aspergillus flavus, aspergillus niger, mucor, and penicillium while, none of the susage samples showed mold contamination. Conclusion: The Iranian meat products had a relative aflatoxin B1 contamination during the study period, but the contamination rate was low and in allowable range. Standard hygienic preparation and packaging of meat products molds is recommended to reduce fungal contamination, especially aflatoxin-producing molds.

  19. Vitamin B1 in marine sediments: pore water concentration gradient drives benthic flux with potential biological implications

    Directory of Open Access Journals (Sweden)

    Danielle eMonteverde

    2015-05-01

    Full Text Available Vitamin B1, or thiamin, can limit primary productivity in marine environments, however the major marine environmental sources of this essential coenzyme remain largely unknown. Vitamin B1 can only be produced by organisms that possess its complete synthesis pathway, while other organisms meet their cellular B1 quota by scavenging the coenzyme from exogenous sources. Due to high bacterial cell density and diversity, marine sediments could represent some of the highest concentrations of putative B1 producers, yet these environments have received little attention as a possible source of B1 to the overlying water column. Here we report the first dissolved pore water profiles of B1 measured in cores collected in two consecutive years from Santa Monica Basin, CA. Vitamin B1 concentrations were fairly consistent between the two years ranging from 30 pM up to 770 pM. A consistent maximum at ~5 cm sediment depth covaried with dissolved concentrations of iron. Pore water concentrations were higher than water column levels and represented some of the highest known environmental concentrations of B1 measured to date, (over two times higher than maximum water column concentrations suggesting increased rates of cellular production and release within the sediments. A one dimensional diffusion-transport model applied to the B1 profile was used to estimate a diffusive benthic flux of ~0.7 nmol m 2 d-1. This is an estimated flux across the sediment-water interface in a deep sea basin; if similar magnitude B-vitamin fluxes occur in shallow coastal waters, benthic input could prove to be a significant B1-source to the water column and may play an important role in supplying this organic growth factor to auxotrophic primary producers.

  20. Interaction between genetic polymorphism of cytochrome P450-1B1 and environmental pollutants in breast cancer risk.

    Science.gov (United States)

    Saintot, M; Malaveille, C; Hautefeuille, A; Gerber, M

    2004-02-01

    Cytochrome P450 1B1 (CYP1B1) is implicated in the activation of potentially carcinogenic xenobiotics and oestrogens. The polymorphism of the CYP1B1 gene at codon 432 (Val-->Leu) is associated with change in catalytic function. In a case-series study of breast cancer patients, we investigated the interaction between this polymorphism and environmental exposure. The women carrying the Val CYP1B1 allele and who had lived near to a waste incinerator for more than 10 years had a higher risk of breast cancer than those never exposed with the Leu/Leu genotype (odds ratio of interactions (ORi)=3.26, 95% confidence interval (CI) 1.20-8.84). Also, the Val CYP1B1 allele increased the susceptibility to breast cancer for women exposed during their life to agricultural products used in farming (ORi = 2.18, 95% CI 1.10-4.32). These xenobiotics, mainly organochlorine hydrocarbons, are known to bind to the aromatic hydrocarbon receptor (AhR), and to induce the expression of CYP1B1 enzyme. The excess risk for exposed women with a Val CYP1B1 homo/heterozygous genotype could result from a higher exposure to activated metabolites of pesticides or dioxin-like substances. Also, a higher induction of CYP1B1 enzyme by xenobiotics could increase the formation of genotoxic catechol-oestrogens among exposed women carrying the Val CYP1B1 allele. Our results suggested that the Val CYP1B1 allele increases the susceptibility to breast cancer in women exposed to waste incinerator or agricultural pollutants. PMID:15075793

  1. Association of Single Nucleotide Polymorphisms in CYP1B1 and COMT Genes with Breast Cancer Susceptibility in Indian Women

    Directory of Open Access Journals (Sweden)

    Sharawan Yadav

    2009-01-01

    Full Text Available Cytochrome P450 1B1 (CYP1B1 and catechol-$O$-methyltransferase (COMT enzymes play critical roles in estrogen metabolism. Alterations in the catalytic activity of CYP1B1 and COMT enzymes have been found associated with altered breast cancer risk in postmenopausal women in many populations. The substitution of leucine (Leu to valine (Val at codon 432 increases the catalytic activity of CYP1B1, however, substitution of Val to methionine (Met at codon 158 decreases the catalytic activity of COMT. The present study was performed to evaluate the associations of CYP1B1 Leu432Val and/or COMT Val158Met polymorphisms with total, premenopausal and postmenopausal breast cancer risks in Indian women. COMT and CYP1B1 polymorphisms in controls and breast cancer patients were analyzed employing polymerase chain reaction-restriction fragment length polymorphism (PCR-RFLP followed by gel electrophoresis. Although CYP1B1 and COMT genotypes did not exhibit statistically significant association with breast cancer risks when analyzed individually, COMT wild type (Val158Val in combination with CYP1B1 heterozygous variant (Leu432Val [OR: 0.21; 95% CI (0.05–0.82, p value; 0.021] and COMT heterozygous variant (Val158Met in combination with CYP1B1 wild type (Leu432Leu [OR: 0.29; 95% CI (0.08–0.96, p value; 0.042] showed significant protective association with premenopausal breast cancer risk. The results demonstrate that CYP1B1 wild type in combination with COMT heterozygous or their inverse combination offer protection against breast cancer in premenopausal Indian women.

  2. Study on aflatoxin B1 detecting in sauce by colloidal gold immunochromatographic assay%胶体金免疫层析法检测酱油中黄曲霉毒素B1

    Institute of Scientific and Technical Information of China (English)

    赖卫华; 刘道峰; 邓省亮

    2012-01-01

    采用胶体金免疫层析法检测酱油中的黄曲霉毒素B1.加标的酱油样品经提取后,以胶体金免疫层析法对其进行黄曲霉毒素B1测定,并与酶联免疫吸附法进行比较.结果表明,当酱油中黄曲霉毒素含量超过国家限量标准(5 μg/kg),胶体金免疫层析法检测结果为阳性,说明该方法能够满足酱油样品中黄曲霉毒素B1监控的要求.%Colloidal gold immunochromatographic assay was used to detect the Aflatoxin B1 in Sauce. After spiking with aflatoxin B1 and extracting, the samples from sauce were detected by colloidal gold immunochromatographic assay and enzyme-linked immunosorbent assay. The data showed that the result of colloidal gold immunochromatographic assay would be positive when the concentration of aflatoxin B1 in sauce exceeding the maximum limit of China (5 jig/kg). The immunochromatographic assay can be used to screen aflatoxin B1 of sauce products.

  3. Up-regulation and subcellular localization of hnRNP A2/B1 in the development of hepatocellular carcinoma

    Directory of Open Access Journals (Sweden)

    Fan Guocai

    2010-07-01

    Full Text Available Abstract Background Hepatocellular carcinoma (HCC is one of the world's leading causes of death among cancer patients. It is important to find a new biomarker that diagnoses HCC and monitors its treatment. In our previous work, we screened a single-chain antibody (scFv N14, which could specifically recognize human HepG2 HCC cells but not human non-cancerous liver LO2 cells. However, the antigen it recognized in the cells remained unknown. Methods Recombinant scFv N14 antibody was expressed as an active antibody. Using this antibody with a combination of immunological and proteomic approaches, we identified the antigen of scFv N14 antibody as the heterogeneous nuclear ribonucleoprotein A2/B1 (hnRNP A2/B1. The expression of hnRNP A2/B1 in HCC cells was then investigated by semi-quantitative RT-PCR and immunohistochemistry. Results We found that the up-regulation of hnRNP A2/B1 was measured at both transcriptional and translational levels in rat HCC cells but not in rat hepatic cells. We also found that in various human hepatic tissues, hnRNP A2/B1 was highly expressed in both human hepatitis virus positive liver tissues and human HCC tissues but not in normal liver tissues. Interestingly, we observed that the localization of hnRNP A2/B1 in HCC cells was altered during the development of HCC. In human hepatitis virus infected tissues hnRNP A2/B1 resides exclusively in the nuclei of hepatocytes. However, when the HCC progressed from a well differentiated to a poorly differentiated stage, hnRNP A2/B1 was increasingly localized in the cytoplasm. In contrast, the HCC tissues with hnRNP A2/B1 highly expressed in the nucleus decreased. Conclusions This work is the first to show that hnRNP A2/B1 is the antigen specifically recognized by the scFv N14 antibody in HCC cells. The over-expression of hnRNP A2/B1 was confirmed in cultured human and rat HCC cell lines, human virus related hepatitis liver tissues and human HCC tissues. The increased localization

  4. Study of Infrared Emission Spectroscopy for the B1Δg-A1Πu and B'1Σg+-A1Πu Systems of C2

    Science.gov (United States)

    Tang, Jian; Chen, Wang; Kawaguchi, Kentarou; Bernath, Peter F.

    2016-06-01

    Recently, we carried out the perturbation analysis of C_2 spectra and identified forbidden singlet-triplet intersystem transitions, which aroused further interest in other C_2 spectra for the many low-lying electronic states of this fundamental molecule. In 1988, the B1Δg-A1Πu and B'1Σg+-A1Πu band systems were discovered by Douay et al., who observed eight bands of the B1Δg-A1Πu system with v up to 5 for the B1Δg state and six bands of the B'1Σg+-A1Πu system with v up to 3 for the B'1Σg+ state in the Fourier transform infrared emission spectra of hydrocarbon discharges. In the work presented here, we identified twenty-four bands of the two systems, among which the B'1Σg+ v = 4 and the B1Δg v = 6, 7 and 8 vibrational levels involved in nine bands were studied for the first time. A direct global analysis with Dunham parameters was carried out satisfactorily for the B1Δg-A1Πu system except for a small perturbation in the B1Δg v = 6 level. The calculated rovibrational term energies up to B1Δg v = 12 showed that the level crossing between the B1Δg and d3Πg states is responsible for many of the prominent perturbations in the Swan system observed previously. Nineteen lines of the B1Δg-a3Πu forbidden transitions were identified and the off-diagonal spin-orbit interaction constant AdB between d3Πg and B1Δg was derived as 8.3(1) wn. For the B'1Σg+-A1Πu system, only individual band analyses for each vibrational level in the B'1Σg+ state could be done satisfactorily and Dunham parameters obtained from these effective parameters showed that the anharmonic vibrational constant ω_e x_e is anomalously small (nearly zero). Inspection of the RKR potential curves for the B'1Σg+ and X1Σg+ states revealed that an avoided crossing may occur around 30000 wn, which is responsible for the anomalous molecular constants in these two states. W. Chen, K. Kawaguchi, P. F. Bernath, and J. Tang, J. Chem. Phys., 141, 064317 (2015) M. Douay, R. Nietmann and P. F. Bernath

  5. Fast Spectrum Reactors

    CERN Document Server

    Todd, Donald; Tsvetkov, Pavel

    2012-01-01

    Fast Spectrum Reactors presents a detailed overview of world-wide technology contributing to the development of fast spectrum reactors. With a unique focus on the capabilities of fast spectrum reactors to address nuclear waste transmutation issues, in addition to the well-known capabilities of breeding new fuel, this volume describes how fast spectrum reactors contribute to the wide application of nuclear power systems to serve the global nuclear renaissance while minimizing nuclear proliferation concerns. Readers will find an introduction to the sustainable development of nuclear energy and the role of fast reactors, in addition to an economic analysis of nuclear reactors. A section devoted to neutronics offers the current trends in nuclear design, such as performance parameters and the optimization of advanced power systems. The latest findings on fuel management, partitioning and transmutation include the physics, efficiency and strategies of transmutation, homogeneous and heterogeneous recycling, in addit...

  6. Multipurpose research reactors

    International Nuclear Information System (INIS)

    The international symposium on the utilization of multipurpose research reactors and related international co-operation was organized by the IAEA to provide for information exchange on current uses of research reactors and international co-operative projects. The symposium was attended by about 140 participants from 36 countries and two international organizations. There were 49 oral presentations of papers and 24 poster presentations. The presentations were divided into 7 sessions devoted to the following topics: neutron beam research and applications of neutron scattering (6 papers and 1 poster), reactor engineering (6 papers and 5 posters), irradiation testing of fuel and material for fission and fusion reactors (6 papers and 10 posters), research reactor utilization programmes (13 papers and 4 posters), neutron capture therapy (4 papers), neutron activation analysis (3 papers and 4 posters), application of small reactors in research and training (11 papers). A separate abstract was prepared for each of these papers. Refs, figs and tabs

  7. Reactor BR2

    Energy Technology Data Exchange (ETDEWEB)

    Gubel, P

    2000-07-01

    The BR2 reactor is still SCK-CEN's most important nuclear facility. After an extensive refurbishment to compensate for the ageing of the installation, the reactor was restarted in April 1997. Various aspects concerning the operation of the BR2 Reactor, the utilisation of the CALLISTO loop and the irradiation programme, the BR2 R and D programme and the production of isotopes and of NTD-silicon are discussed. Progress and achievements in 1999 are reported.

  8. The Integral Fast Reactor

    International Nuclear Information System (INIS)

    The Integral Fast Reactor (IFR) is an innovative liquid metal reactor concept being developed at Argonne National Laboratory. It seeks to specifically exploit the inherent properties of liquid metal cooling and metallic fuel in a way that leads to substantial improvements in the characteristics of the complete reactor system. This paper describes the key features and potential advantages of the IFR concept, with emphasis on its safety characteristics. 3 refs., 4 figs., 1 tab

  9. Feedback from dismantling operations (level 2) on EDF's first generation reactors

    International Nuclear Information System (INIS)

    EDF's policy as regards the dismantling of the reactors that have ceased commercial operation, namely the eight power plants of the first generation and the Creys-Malville power plant, is explained. Generally speaking, prior to the year 2001, EDF had opted for the de-construction of these power plants to comply with a 'long wait' scenario, which consisted of waiting for a period of 5 to 10 years to achieve IAEA level 2 (partial release of the site), then postponing the total de-construction of the facilities for 25 to 50 years. Today, EDF has decided to undertake the total de-construction of these reactors, which have ceased commercial operation, over a period of 25 years. The purpose of this document is to present: - The reactors concerned, their background and their 'regulatory' situation, - The main operations performed and/or currently in progress, - The main elements of feedback from such operations, shedding light on the approach adopted in 2001. The installations concerned by the de-construction programme are as follows: - The 8 power plants of the first generation, which were built during the fifties and sixties and ceased commercial operation between 1973 and 1994, namely: Brennilis (industrial prototype using heavy water technology, jointly operated by EDF and CEA), the 6 power units of the NUGG type (natural uranium gas graphite) at Chinon, Saint-Laurent des Eaux and Bugey and the PWR reactor at Chooz A, - The storage silos at Saint-Laurent, where the sleeves for the fuel assemblies of reactors SLA1 and SLA2 are stored, corresponding to approximately 2000 tonnes of graphite, - The Creys-Malville reactor, FBR (fast breeder reactor) shut down in accordance with a government decision, which is currently undergoing decommissioning. At the current stage, our feedback from the dismantling operations carried out on nuclear facilities is based on (i) the work carried out or in progress that will make it possible to achieve the equivalent of IAEA level 2 in the

  10. The retinoic acid-metabolizing enzyme Cyp26b1 regulates CD4 T cell differentiation and function.

    Directory of Open Access Journals (Sweden)

    Alistair Chenery

    Full Text Available The vitamin A metabolite retinoic acid (RA has potent immunomodulatory properties that affect T cell differentiation, migration and function. However, the precise role of RA metabolism in T cells remains unclear. Catabolism of RA is mediated by the Cyp26 family of cytochrome P450 oxidases. We examined the role of Cyp26b1, the T cell-specific family member, in CD4(+ T cells. Mice with a conditional knockout of Cyp26b1 in T cells (Cyp26b1 (-/- mice displayed normal lymphoid development but showed an increased sensitivity to serum retinoids, which led to increased differentiation under both inducible regulatory T (iTreg cell- and TH17 cell-polarizing conditions in vitro. Further, Cyp26b1 expression was differentially regulated in iTreg and TH17 cells. Transfer of naïve Cyp26b1 (-/- CD4(+ T cells into Rag1 (-/- mice resulted in significantly reduced disease in a model of T cell-dependent colitis. Our results show that T cell-specific expression of Cyp26b1 is required for the development of T cell-mediated colitis and may be applicable to the development of therapeutics that target Cyp26b1 for the treatment of inflammatory bowel disease.

  11. Assessment of aflatoxin B1 in livestock feed and feed ingredients by high-performance thin layer chromatography

    Directory of Open Access Journals (Sweden)

    Korrapati Kotinagu

    2015-12-01

    Full Text Available Aim: Detection of aflatoxin B1 in Livestock compound Feed and feed ingredients by high-performance thin layer chromatography (HPTLC. Materials and Methods: Chromatography was performed on HPTLC silica gel 60 F 254, aluminum sheets by CAMAG automatic TLC sampler 4, with mobile phase condition chloroform:acetone:water (28:4:0.06. Extraction of aflatoxin B1 from samples was done as per AOAC method and screening and quantification done by HPTLC Scanner 4 under wavelength 366 nm. Results: A total of 97 livestock feed (48 and feed ingredients (49 samples received from different livestock farms and farmers were analyzed for aflatoxin B1of which 29 samples were contaminated, constituting 30%. Out of 48 livestock compound feed samples, aflatoxin B1 could be detected in 16 samples representing 33%, whereas in livestock feed ingredients out of 49 samples, 13 found positive for aflatoxin B1 representing 24.5%. Conclusion: HPTLC assures good recovery, precision, and linearity in the quantitative determination of aflatoxin B1 extracted from Livestock compound feed and feed ingredients. As more number of feed and feed ingredients are contaminated with aflatoxin B1 which causes deleterious effects in both animal and human beings, so there is a need for identifying the source of contamination, executing control measures, enabling better risk assessment techniques, and providing economic benefits.

  12. Securin and not CDK1/cyclin B1 regulates sister chromatid disjunction during meiosis II in mouse eggs.

    Science.gov (United States)

    Nabti, Ibtissem; Reis, Alexandra; Levasseur, Mark; Stemmann, Olaf; Jones, Keith T

    2008-09-15

    Mammalian eggs remain arrested at metaphase of the second meiotic division (metII) for an indeterminate time before fertilization. During this period, which can last several hours, the continued attachment of sister chromatids is thought to be achieved by inhibition of the protease separase. Separase is known to be inhibited by binding either securin or Maturation (M-Phase)-Promoting Factor, a heterodimer of CDK1/cyclin B1. However, the relative contribution of securin and CDK/cyclin B1 to sister chromatid attachment during metII arrest has not been assessed. Although there are conditions in which either CDK1/cyclinB1 activity or securin can prevent sister chromatid disjunction, principally by overexpression of non-degradable cyclin B1 or securin, we find here that separase activity is primarily regulated by securin and not CDK1/cyclin B1. Thus the CDK1 inhibitor roscovitine and an antibody we designed to block the interaction of CDK1/cyclin B1 with separase, both failed to induce sister disjunction. In contrast, securin morpholino knockdown specifically induced loss of sister attachment, that could be restored by securin cRNA rescue. During metII arrest separase appears primarily regulated by securin binding, not CDK1/cyclin B1. PMID:18639540

  13. Beneficial effects of kinin B1 receptor antagonism on plasma fatty acid alterations and obesity in Zucker diabetic fatty rats.

    Science.gov (United States)

    Talbot, Sébastien; Dias, Jenny Pena; El Midaoui, Adil; Couture, Réjean

    2016-07-01

    Kinins are the endogenous ligands of the constitutive B2 receptor (B2R) and the inducible B1 receptor (B1R). Whereas B2R prevents insulin resistance, B1R is involved in insulin resistance and metabolic syndrome. However, the contribution of B1R in type 2 diabetes associated with obesity remains uncertain. The aim of the present study was to examine the impact of 1-week treatment with a selective B1R antagonist (SSR240612, 10 mg/kg per day, by gavage) on hyperglycemia, hyperinsulinemia, leptinemia, body mass gain, and abnormal plasma fatty acids in obese Zucker diabetic fatty (ZDF) rats. Treatment with SSR240612 abolished the body mass gain and reduced polyphagia, polydipsia, and plasma fatty acid alterations in ZDF rats without affecting hyperglycemia, hyperinsulinemia, and hyperleptinemia. The present study suggests that the upregulated B1R plays a role in body mass gain and circulating fatty acid alterations in ZDF rats. However, mechanisms other than B1R induction would be implicated in glucose metabolism disorder in ZDF rats, based on the finding that SSR240612 did not reverse hyperglycemia and hyperinsulinemia. PMID:27172260

  14. Expression of a Splice Variant of CYP26B1 in Betel Quid-Related Oral Cancer

    Directory of Open Access Journals (Sweden)

    Ping-Ho Chen

    2014-01-01

    Full Text Available Betel quid (BQ is a psychostimulant, an addictive substance, and a group 1 carcinogen that exhibits the potential to induce adverse health effects. Approximately, 600 million users chew a variety of BQ. Areca nut (AN is a necessary ingredient in BQ products. Arecoline is the primary alkaloid in the AN and can be metabolized through the cytochrome P450 (CYP superfamily by inducing reactive oxygen species (ROS production. Full-length CYP26B1 is related to the development of oral pharyngeal cancers. We investigated whether a splice variant of CYP26B1 is associated with the occurrence of ROS related oral and pharyngeal cancer. Cytotoxicity assays were used to measure the effects of arecoline on cell viability in a dose-dependent manner. In vitro and in vivo studies were conducted to evaluate the expression of the CYP26B1 splice variant. The CYP26B1 splice variant exhibited lower expression than did full-length CYP26B1 in the human gingival fibroblast-1 and Ca9-22 cell models. Increased expression of the CYP26B1 splice variant was observed in human oral cancer tissue compared with adjacent normal tissue, and increased expression was observed in patients at a late tumor stage. Our results suggested that the CYP26B1 splice variant is associated with the occurrence of BQ-related oral cancer.

  15. Reactor Engineering Division annual report

    International Nuclear Information System (INIS)

    Research and development activities in the Division of Reactor Engineering in fiscal 1981 are described. The work of the Division is closely related to development of multipurpose Very High Temperature Gas Cooled Reactor and fusion reactor, and development of Liquid Metal Fast Breeder Reactor carried out by Power Reactor and Nuclear Fuel Development Corporation. Contents of the report are achievements in fields such as nuclear data and group constants, theoretical method and code development, integral experiment and analysis, shielding, reactor and nuclear instrumentation, reactor control and diagnosis, and fusion reactor technology, and activities of the Committee on Reactor Physics. (author)

  16. Altered expression of apoptotic genes in response to OCT4B1 suppression in human tumor cell lines.

    Science.gov (United States)

    Mirzaei, Mohammad Reza; Najafi, Ali; Arababadi, Mohammad Kazemi; Asadi, Malek Hosein; Mowla, Seyed Javad

    2014-10-01

    OCT4B1 is a newly discovered spliced variant of OCT4 which is primarily expressed in pluripotent and tumor cells. Based on our previous studies, OCT4B1 is significantly overexpressed in tumors, where it endows an anti-apoptotic property to tumor cells. However, the mechanism by which OCT4B1 regulates the apoptotic pathway is not yet elucidated. Here, we investigated the effects of OCT4B1 suppression on the expression alteration of 84 genes involved in apoptotic pathway. The AGS (gastric adenocarcinoma), 5637 (bladder tumor), and U-87MG (brain tumor) cell lines were transfected with OCT4B1 or irrelevant siRNAs. The expression level of apoptotic genes was then quantified using a human apoptosis panel-PCR kit. Our data revealed an almost similar pattern of alteration in the expression profile of apoptotic genes in all three studied cell lines, following OCT4B1 suppression. In general, the expression of more than 54 apoptotic genes (64 % of arrayed genes) showed significant changes. Among these, some up-regulated (CIDEA, CIDEB, TNFRSF1A, TNFRSF21, TNFRSF11B, TNFRSF10B, and CASP7) and down-regulated (BCL2, BCL2L11, TP73, TP53, BAD, TRAF3, TRAF2, BRAF, BNIP3L, BFAR, and BAX) genes had on average more than tenfold gene expression alteration in all three examined cell lines. With some minor exceptions, suppression of OCT4B1 caused upregulation of pro-apoptotic and down-regulation of anti-apoptotic genes in transfected tumor cells. Uncovering OCT4B1 down-stream targets could further elucidate its part in tumorigenesis, and could lead to finding a new approach to combat cancer, based on targeting OCT4B1. PMID:25008565

  17. Characterization of an Additional Splice Acceptor Site Introduced into CYP4B1 in Hominoidae during Evolution.

    Directory of Open Access Journals (Sweden)

    Eva M Schmidt

    Full Text Available CYP4B1 belongs to the cytochrome P450 family 4, one of the oldest P450 families whose members have been highly conserved throughout evolution. The CYP4 monooxygenases typically oxidize fatty acids to both inactive and active lipid mediators, although the endogenous ligand(s is largely unknown. During evolution, at the transition of great apes to humanoids, the CYP4B1 protein acquired a serine instead of a proline at the canonical position 427 in the meander region. Although this alteration impairs P450 function related to the processing of naturally occurring lung toxins, a study in transgenic mice suggested that an additional serine insertion at position 207 in human CYP4B1 can rescue the enzyme stability and activity. Here, we report that the genomic insertion of a CAG triplet at the intron 5-exon 6 boundary in human CYP4B1 introduced an additional splice acceptor site in frame. During evolution, this change occurred presumably at the stage of Hominoidae and leads to two major isoforms of the CYP4B1 enzymes of humans and great apes, either with or without a serine 207 insertion (insSer207. We further demonstrated that the CYP4B1 enzyme with insSer207 is the dominant isoform (76% in humans. Importantly, this amino acid insertion did not affect the 4-ipomeanol metabolizing activities or stabilities of the native rabbit or human CYP4B1 enzymes, when introduced as transgenes in human primary cells and cell lines. In our 3D modeling, this functional neutrality of insSer207 is compatible with its predicted location on the exterior surface of CYP4B1 in a flexible side chain. Therefore, the Ser207 insertion does not rescue the P450 functional activity of human CYP4B1 that has been lost during evolution.

  18. LMFBR type reactor

    Energy Technology Data Exchange (ETDEWEB)

    Kanbe, Mitsuru

    1997-04-04

    An LMFBR type reactor comprises a plurality of reactor cores in a reactor container. Namely, a plurality of pot containing vessels are disposed in the reactor vessel and a plurality of reactor cores are formed in a state where an integrated-type fuel assembly is each inserted to a pot, and a coolant pipeline is connected to each of the pot containing-vessel to cool the reactor core respectively. When fuels are exchanged, the integrated-type fuel assembly is taken out together with the pot from the reactor vessel in a state where the integrated-type fuel assembly is immersed in the coolants in the pot as it is. Accordingly, coolants are supplied to each of the pot containing-vessel connected with the coolant pipeline and circulate while cooling the integrated-type fuel assembly for every pot. Then, when the fuels are exchanged, the integrated type fuel assembly is taken out to the outside of the reactor together with the pot by taking up the pot from the pot-containing vessel. Then, neutron economy is improved to thereby improve reactor power and the breeding ratio. (N.H.)

  19. 78 FR 27442 - Advisory Committee on Reactor Safeguards (ACRS); Meeting of the ACRS Subcommittee on Fukushima...

    Science.gov (United States)

    2013-05-10

    ... were published in the Federal Register on October 18, 2012, (77 FR 64146- 64147). Detailed meeting... COMMISSION Advisory Committee on Reactor Safeguards (ACRS); Meeting of the ACRS Subcommittee on Fukushima; Notice of Meeting The ACRS Subcommittee on Fukushima will hold a meeting on May 23, Room T-2B1,...

  20. Synthesis and Antibacterial Activities of Novel Imidazo[2,1-b]-1,3,4-thiadiazoles

    Directory of Open Access Journals (Sweden)

    Kamal F. M. Atta

    2011-06-01

    Full Text Available 2-Amino-5-(2-aryl-2H-1,2,3-triazol-4-yl-1,3,4-thiadiazoles 2-4 have been synthesized by the reaction of 2-aryl-2H-1,2,3-triazole-4-carboxylic acids 1 with thiosemicarbazide. Their reaction with phenacyl (p-substituted phenacyl bromides led to formation of the respective 6-aryl-2-(2-aryl-2H-1,2,3-triazol-4-ylimidazo[2,1-b]-1,3,4-thiadiazoles 5. Reactivity of the latter fused ring towards reaction with different electrophilic reagents afforded the corresponding 5-substituted derivatives 6-8. The structure of the above compounds was confirmed from their spectral characteristics. Some of these compounds were found to possess slight to moderate activity against the microorganisms Staphylococcus aureus, Candida albicans, Pseudomonas aeruginosa, and Escherichia coli.

  1. Science applications of the multi-FOV lidar for ATMOS-B1/ERM

    Science.gov (United States)

    Sugimoto, Nobuo; Liu, Zhaoyan; Voelger, Peter; Shimizu, Atsushi; Sasano, Yasuhiro; Asai, Kazuhiro; Ishizu, Mitsuo; Itabe, Toshikasu; Imai, Tadashi

    2001-02-01

    A new multi-FOV space-borne lidar named "A-lidar" is being studied by the National Space Development Agency of Japan (NASDA) for the earth radiation mission proposed as a joint program with the European Space Agency (ESA). The mission is named "EarthCARE". It was formerly called ATMOS-B1 or ERM. The lidar has a two-wavelength transmitter (1064 nm and 532 nm), a dual polarization receiver at 1064 nm, and a multi-field-of-view (multi-FOV) receiver at 532 nm. The multi-FOV feature of A-lidar will enable us to solve the multiple scattering problems with space lidar measurements of profiles of clouds and aerosols. The multi-FOV feature can also be used for characterization of aerosols.

  2. Cytochrome P3-450 cDNA encodes aflatoxin B1-4-hydroxylase.

    Science.gov (United States)

    Faletto, M B; Koser, P L; Battula, N; Townsend, G K; Maccubbin, A E; Gelboin, H V; Gurtoo, H L

    1988-09-01

    Aflatoxin B1 (AFB1), a potent hepatocarcinogen and ubiquitous dietary contaminant in some countries, is detoxified to aflatoxin M1 (AFM1) via cytochrome P-450-mediated AFB1-4-hydroxylase. Genetic studies in mice have demonstrated that the expression of AFB1-4-hydroxylase is regulated by the aryl hydrocarbon locus and suggested that different cytochrome P-450 isozymes catalyze AFB1-4-hydroxylase and aryl hydrocarbon hydroxylase activities. We have now examined lysates from mammalian cells infected with recombinant vaccinia viruses containing expressible cytochrome P1-450 or P3-450 cDNAs for their ability to metabolize AFB1 to AFM1. Our results show that cytochrome P3-450 cDNA specifies AFB1-4-hydroxylase. This is the first direct assignment of a specific cytochrome P-450 to an AFB1 detoxification pathway. This finding may have relevance to the dietary modulation of AFB1 hepatocarcinogenesis.

  3. The microfocus small-angle X-ray scattering at SSRF BL16B1

    CERN Document Server

    Hua, Wenqiang; Zhou, Ping; Li, Xiuhong; Bian, Fenggang; Wang, Jie

    2016-01-01

    Offering high-brilliance X-ray beams on micrometer length scales, the microfocus SAXS at SSRF BL16B1 was established with a KB mirror system for studying small sample volumes, or probing micro-scopic morphologies. The SAXS minimum q value was 0.1nm^-1 with a flux of 1.5 x 10^10photons/s. Two position-resolved scanning experimental methods was combined with microfocus SAXS that include STXM and CT. The experimental results of a standard sample was presented to illustrate the performance of the microfocus SAXS method. Because of the significant smearing effect in the horizontal direction, an effective and easy-to-use desmearing procedure for two-dimensional SAXS pattern based on the blind deconvolution was developed and the deblurring results demonstrated the good restoration effect for the defocus image.

  4. Discovery of a Centrifugal Magnetosphere Around the He-Strong Magnetic B1 Star ALS 3694

    CERN Document Server

    Shultz, Matt; Rivinius, Thomas; Sikora, James

    2014-01-01

    We report the results of 6 nights of Canada-France-Hawaii Telescope spectropolarimetric ESPaDOnS observations of the He-strong, magnetic B1 type star ALS 3694. The longitudinal magnetic field is approximately 2 kG in all 6 observations, showing essentially no variation between nights. The H$\\alpha$ line displays variable emission on all nights, peaking at high velocities ($\\sim 3 v\\sin{i}$). Given the presence of a strong ($B_{\\rm d}>$6 kG) magnetic field, and the similarity of the emission profile to that of other magnetic B-type stars, we interpret the emission as a consequence of a centrifugal magnetosphere.

  5. Effect of frequency and environment on fatigue-crack propagation of SA533B-1 steel

    International Nuclear Information System (INIS)

    The effects of a decrease in the frequency of cyclic loading on the fatigue-crack propagation characteristics of SA533B-1 steel in various environments were investigated. Frequency levels of 10 Hz,1.0 Hz and 0.1 Hz were employed in laboratory air, distilled water and a 3.5% NaCl solution. As the loading frequency was decreased, statistically significant increases in the fatigue-crack growth rates for the distilled water and salt water environments, as compared to those measured in laboratory air, were observed. These increases in growth rates were limited to certain ranges of stress intensity range values depending upon the frequency level being tested. A hydrogen embrittlement mechanism is proposed to explain the increase in growth rates based upon a fractographic analysis. (author)

  6. Aflatoxin B1, zearalenone and deoxynivalenol in feed ingredients and complete feed from central China.

    Science.gov (United States)

    Liu, Jie; Sun, Lvhui; Zhang, Jiacai; Guo, Jiao; Chen, Lei; Qi, Desheng; Zhang, Niya

    2016-06-01

    Between 2012 and 2014, 2528 feed ingredient and complete feed samples were collected from central China. Numbers of 2083, 255 and 190 samples were analysed for aflatoxin B1 (AFB1), zearalenone (ZEN) and deoxynivalenol (DON), respectively, by high-performance liquid chromatography in combination with UV or fluorescence detection. The incidence rates of AFB1, ZEN and DON contamination of feed ingredients and complete feeds were 33.9%, 90.2% and 77.4%, respectively. The percentage of positive samples for AFB1 ranged from 13.1% to 97.1%. Cottonseed meal presented the most serious contamination by AFB1. ZEN and DON contamination levels of feeds ranged from 50% to 100%, indicating serious contamination over the studied 3-year period. This study demonstrates that AFB1, ZEN and DON contamination of feeds in central China is serious and differs over the years. Feeds are mostly contaminated with ZEN, followed by DON and AFB1. PMID:26771914

  7. Dimeric N-terminal segment of human surfactant protein B (dSP-B(1-25)) has enhanced surface properties compared to monomeric SP-B(1-25).

    OpenAIRE

    Veldhuizen, E J; Waring, A J; Walther, F. J.; Batenburg, J.J.; van Golde, L M; Haagsman, H.P.

    2000-01-01

    Surfactant protein B (SP-B) is a 17-kDa dimeric protein produced by alveolar type II cells. Its main function is to lower the surface tension by inserting lipids into the air/liquid interface of the lung. SP-B's function can be mimicked by a 25-amino acid peptide, SP-B(1-25), which is based on the N-terminal sequence of SP-B. We synthesized a dimeric version of this peptide, dSP-B(1-25), and the two peptides were tested for their surface activity. Both SP-B(1-25) and dSP-B(1-25) showed good l...

  8. Schistosome asparaginyl endopeptidase (legumain) is not essential for cathepsin B1 activation in vivo.

    Science.gov (United States)

    Krautz-Peterson, Greice; Skelly, Patrick J

    2008-05-01

    Schistosomes are parasitic platyhelminths that constitute an important public health problem. Adult parasites live in the vasculature of their vertebrate hosts where they consume blood. Ingested blood proteins are degraded by a proteolytic cascade. One of the best characterized schistosome proteases is cathepsin B1 (SmCB1 or Sm31). This protein is synthesized as a large 38 kDa precursor form which is proteolytically cleaved to yield a mature, active 31 kDa enzyme. A second schistosome protease--the asparaginyl endopeptidase SmAE (also known as Sm32, or schistosome legumain), has been proposed to proteolytically convert the 38 kDa precursor SmCB1 into its mature form. Recombinant activated SmAE has been shown to trans-process SmCB1 into the mature, catalytic form in vitro. In the present study, our aim was to test the hypothesis that in vivo SmAE likewise processes SmCB1 into its active form. To do this, expression of the SmAE gene was suppressed in adult Schistosoma mansoni using RNA interference (RNAi). The results of these experiments show that, even in the absence of detectable SmAE protein, SmCB1 is fully processed and active and support the assertion that SmAE is not essential to activate SmCB1 in vivo. The data indicate that our original hypothesis is incorrect and that SmAE is not pivotal in the in vivo conversion of cathepsin B1 into its mature, active form.

  9. Limited subsolidus diffusion in type B1 CAI: Evidence from Ti distribution in spinel

    Science.gov (United States)

    Meeker, G. P.; Quick, J. E.; Paque, Julie M.

    1993-01-01

    Most models of calcium aluminum-rich inclusions (CAI) have focused on early stages of formation by equilibrium crystallization of a homogeneous liquid. Less is known about the subsolidus cooling history of CAI. Chemical and isotopic heterogeneties on a scale of tens to hundreds of micrometers (e.g. MacPherson et al. (1989) and Podosek, et al. (1991)) suggest fairly rapid cooling with a minimum of subsolidus diffusion. However, transmission electron microscopy indicates that solid state diffusion may have been an important process at a smaller scale (Barber et al. 1984). If so, chemical evidence for diffusion could provide constraints on cooling times and temperatures. With this in mind, we have begun an investigation of the Ti distribution in spinels from two type B1 CAI from Allende to determine if post-crystallization diffusion was a significant process. The type B1 CAIs, 3529Z and 5241 have been described by Podosek et al. (1991) and by El Goresy et al. (1985) and MacPherson et al. (1989). We have analyzed spinels in these inclusions using the electron microprobe. These spinels are generally euhedral, range in size from less than 10 to 15 micron and are poikilitically enclosed by millimeter-sized pyroxene, melilite, and anorthite. Analyses were obtained from both the mantles and cores of the inclusions. Compositions of pyroxene in the vicinity of individual spinel grains were obtained by analyzing at least two points on opposite sides of the spinel and averaging the compositions. The pyroxene analyses were obtained within 15 microns of the spinel-pyroxene interface. No compositional gradients were observed within single spinel crystals. Ti concentrations in spinels included within pyroxene, melilite, and anorthite are presented.

  10. CSTR中维生素B1对B-Z反应影响的动力学模型%The Dynamic Model with the Effects of Vitamin B1 on The B-Z Reaction in CSTR

    Institute of Scientific and Technical Information of China (English)

    蒋文; 刘恩

    2005-01-01

    基于维生素B1与Ce4+的螯合效应,借助于B-Z反应的FKN机理,建立了流动体系(CSTR)中维生素B1螯合效应对B-Z反应影响的动力学模型,数值模拟分析与实验结果定性一致.

  11. Control rod cluster drop time anomaly Guandong nuclear power station (Daya bay) and Electricite de France nuclear power stations (1450 MWe N4 Series); Anomalie de temps de chute des grappes de controle centrale de guang dong (daya bay) et centrales d`electricite de France (Palier N4-1450 MWE)

    Energy Technology Data Exchange (ETDEWEB)

    Olivera, J.J.; Naury, S.; Tricot, N.; Tran Dai, P.; Gama, J.M.

    1996-12-31

    The anomaly of control rod cluster drop time revealed at Guandong Nuclear Power Station in Daya Bay and in the Chooz B1 pilot unit for the N4 series, led to the replacement of the M1 type control rod cluster guide tubes with 1300 MWe PWR type guide tubes, adapted to the geometry of the Guandong reactors and the 1450 MWe reactors of the N4 series. The comparison of the drop times obtained with the 1300 MWe type control rod cluster guide 1300 MWe type control rod cluster guide tubes gave satisfactory results. These met the safety criterion for N4 series control rod cluster drop times (2.15 under hot shutdown conditions). The drop time tests which will be carried out in middle of and at the end of cycle 1 of Chooz B1 should make it possible to finally validate the solution already successfully implemented at Guandong. However, this anomaly has revealed the limits of representativeness of the experimental test loops with regard to the real reactor configuration. In view of this, it has been deemed necessary to ask Electricite de France to pursue its analysis both on the understanding of the phenomena which led to this anomaly and on the limits of the representativeness of the experimental test loops. (authors).

  12. Determination of Aflatoxin B1 in Oil Plants by LC -MS/MS%LC—MS/MS测定植物油脂中黄曲霉毒素B1

    Institute of Scientific and Technical Information of China (English)

    吕飞; 朱事康; 余优军; 张奇华; 沓世远; 周宇

    2012-01-01

    An analytical method for the determination of aflatoxin B1 content in oil plants by LC - MS/MS is employed. Aflatoxin B1 testing generally uses HPLC with fluorescence detector, before column derivative, or pillars derivative, the operation is tedious, low sensi- tivity. The method adopts LC -MS/MS detection, methanol water extraction,the aflatoxin B1 immune affinity column cleansing,metha- nol capacity, LC -MS/MS detection. This method is more simple, rapid, sensitive and accurate.%建立LC—MS/MS检测植物油脂中黄曲霉毒素B1的含量。黄曲霉毒素B1的检测通常情况下都是用液相色谱检测法带荧光检测器,柱前衍生,或是柱后衍生,操作比较繁琐,灵敏度低。本法采用Lc—MS/MS检测,甲醇水提取后,经黄曲霉毒素B1免疫亲和柱,甲醇定容,LC—MS/MS检测。此法操作简便、快速、灵敏、准确。

  13. Expressions and clinical significance of survivin and cyclinB1 in basal cell carcinoma of eyelid%眼睑基底细胞癌中Survivin和CyclinB1的表达

    Institute of Scientific and Technical Information of China (English)

    贾君; 付汛安; 张端莲

    2011-01-01

    目的:探讨眼睑基底细胞癌(basal cell carcinoma,BCC)组织中Survivin和CyclinB1的表达.方法:收集武汉市中心医院和武汉大学中南医院病理科2002/2009年手术切除及活检的眼睑BCC标本共20例,另取癌周围正常组织5例作对照.所有标本均经40g/L甲醛固定,常规HE染色,光镜观察确诊.采用HPIAS-2000高清晰度彩色病理图文报告管理系统对Survivin和CyclinB1在细胞浆或胞核的表达进行定量分析.结果:眼睑BCC组织中Survivin和CyclinB1呈高表达,癌旁组织中Survivin和CyclinB1呈低表达.两种组织中Survivin和CyclinB1的平均光密度及阳性面积率的差异有显著性意义(P<0.05).结论:Survivin和CyclinB1的异常表达对眼睑BCC的发生、发展起重要作用.

  14. Crystal structures of the coil 2B fragment and the globular tail domain of human lamin B1

    Energy Technology Data Exchange (ETDEWEB)

    Ruan, Jianbin; Xu, Chao; Bian, Chuanbing; Lam, Robert; Wang, Jia-Pey; Kania, Joanna; Min, Jinrong; Zang, Jianye (Toronto); (UST - China)

    2012-07-18

    We present here the crystal structures of human lamin B1 globular tail domain and coiled 2B domain, which adopt similar folds to Ig-like domain and coiled-coil domain of lamin A, respectively. Despite the overall similarity, we found an extra intermolecular disulfide bond in the lamin B1 coil 2B domain, which does not exist in lamin A/C. In addition, the structural analysis indicates that interactions at the lamin B1 homodimer interface are quite different from those of lamin A/C. Thus our research not only reveals the diversely formed homodimers among lamin family members, but also sheds light on understanding the important roles of lamin B1 in forming the nuclear lamina matrix.

  15. One piece reactor removal

    International Nuclear Information System (INIS)

    Japan Research Reactor No.3 (JRR-3) was the first reactor consisting of 'Japanese-made' components alone except for fuel and heavy water. After reaching its initial critical state in September 1962, JRR-3 had been in operation for 21 years until March 1983. It was decided that the reactor be removed en-bloc in view of the work schedule, cost and management of the reactor following the removal. In the special method developed jointly by the Japanese Atomic Energy Research Institute and Shimizu Construction Co., Ltd., the reactor main unit was cut off from the building by continuous core boring, with its major components bound in the block with biological shield material (heavy concrete), and then conveyed and stored in a large waste store building constructed near the reactor building. Major work processes described in this report include the cutting off, lifting, horizontal conveyance and lowering of the reactor main unit. The removal of the JRR-3 reactor main unit was successfully carried out safely and quickly by the en-block removal method with radiation exposure dose of the workers being kept at a minimum. Thus the high performance of the en-bloc removal method was demonstrated and, in addition, valuable knowhow and other data were obtained from the work. (Nogami, K.)

  16. Reactor Materials Research

    Energy Technology Data Exchange (ETDEWEB)

    Van Walle, E

    2001-04-01

    The activities of the Reactor Materials Research Department of the Belgian Nuclear Research Centre SCK-CEN in 2000 are summarised. The programmes within the department are focussed on studies concerning (1) fusion, in particular mechanical testing; (2) Irradiation Assisted Stress Corrosion Cracking (IASCC); (3) nuclear fuel; and (4) Reactor Pressure Vessel Steel (RPVS)

  17. Light water reactor program

    Energy Technology Data Exchange (ETDEWEB)

    Franks, S.M.

    1994-12-31

    The US Department of Energy`s Light Water Reactor Program is outlined. The scope of the program consists of: design certification of evolutionary plants; design, development, and design certification of simplified passive plants; first-of-a-kind engineering to achieve commercial standardization; plant lifetime improvement; and advanced reactor severe accident program. These program activities of the Office of Nuclear Energy are discussed.

  18. 08B1-1: an automated beamline for macromolecular crystallography experiments at the Canadian Light Source.

    Science.gov (United States)

    Fodje, Michel; Grochulski, Pawel; Janzen, Kathryn; Labiuk, Shaunivan; Gorin, James; Berg, Russ

    2014-05-01

    Beamline 08B1-1 is a recently commissioned bending-magnet beamline at the Canadian Light Source. The beamline is designed for automation and remote access. Together with the undulator-based beamline 08ID-1, they constitute the Canadian Macromolecular Crystallography Facility. This paper describes the design, specifications, hardware and software of beamline 08B1-1. A few scientific results using data obtained at the beamline will be highlighted.

  19. Simultaneous detection of cyclopiazonic acid and aflatoxin B1 by HPLC in methanol/water mobile phase

    OpenAIRE

    Soares, Célia Maria Gonçalves; Freitas-Silva, O.; Abrunhosa, Luís; Venâncio, Armando

    2009-01-01

    A simple procedure for the simultaneous detection of cyclopiazonic acid (CPA) and aflatoxin B1 from fungal extracts is presented, using a methanol and water mobile phase and fluorescence detection. This methodology has been tested with standard solutions of both mycotoxins CPA and Aflatoxin B1 and with methanolic extracts of Aspergillus section Flavi strains, previously characterized for their mycotoxin production profile. Previously available methodology required the use of two different c...

  20. Screening for Coding Variants in FTO and SH2B1 Genes in Chinese Patients with Obesity

    Science.gov (United States)

    Huang, Xiaodong; Yang, Peirong; Li, Juan; Ding, Yu; Yao, Ru-en; Geng, Juan; Shen, Yongnian; Shen, Yiping; Fu, Qihua; Yu, Yongguo

    2013-01-01

    Objective To investigate potential functional variants in FTO and SH2B1 genes among Chinese children with obesity. Methods Sanger sequencing of PCR products of all FTO and SH2B1 exons and their flanking regions were performed in 338 Chinese Han children with obesity and 221 age- and sex-matched lean controls. Results A total of seven and five rare non-synonymous variants were identified in FTO and SH2B1, respectively. The overall frequencies of FTO and SH2B1 rare non-synonymous variants were similar in obese and lean children (2.37% and 0.90% vs. 1.81% and 1.36%, P>0.05). However, four out of the seven variants in FTO were novel and all were unique to obese children (p>0.05). None of the novel variants was consistently being predicted to be deleterious. Four out of five variants in SH2B1 were novel and one was unique to obese children (p>0.05). One variant (L293R) that was consistently being predicted as deleterious in SH2B1 gene was unique to lean control. While rare missense mutations were more frequently detected in girls from obesity as well as lean control than boys, the difference was not statistically significant. In addition, it's shown that the prevalence of rare missense mutations of FTO as well as SH2B1 was similar across different ethnic groups. Conclusion The rare missense mutations of FTO and SH2B1 did not confer risks of obesity in Chinese Han children in our cohort. PMID:23825611