WorldWideScience

Sample records for chimiotherapie 5 fluoro-uracile

  1. Concomitant bid radiotherapy with cisplatin and 5-fluorouracil in unresectable carcinoma of the pharynx: 10 year's experience at the Centre Antoine Lacassagne; Radiotherapie bifractionnee et chimiotherapie par cisplatine et 5-fluoro-uracile concomitantes dans les carcinomes epidermoides localement evolues non resecables du pharynx: dix ans d'experience au centre Antoine Lacassagne

    Energy Technology Data Exchange (ETDEWEB)

    Magne, N.; Pivot, X.; Marcy, P.Y.; Chauvel, P.; Courdi, A.; Dassonville, O.; Possonnet, G.; Vallicioni, J.; Ettore, F.; Falewee, M.N.; Milano, G.; Santini, J.; Lagrange, J.L.; Schneider, M.; Demard, F.; Bensadoun, R.J. [Centre Antoine-Lacassagne, 06 - Nice (France)

    2001-08-01

    Patients suffering from locally advanced unresectable squamous cell carcinoma of the oropharynx and hypopharynx treated with radiotherapy alone have a poor prognosis. More than 70% of patients die within 5 years mainly due to local recurrences. The aim of this study was to evaluate retrospectively the Antoine Lacassagne Cancer Center's experience in a treatment by concomitant bid radiotherapy and chemotherapy. Evaluation was based on analysis of the toxicity, the response rates, the survival, and the clinical prognostic factors. From 1992 to 2000, 92 consecutive patients were treated in our single institution. All of them had stage IV, unresectable squamous cell carcinoma of the pharynx and they received continuous bid radiotherapy (two daily fractions of 1.2 Gy, 5 days a week, with a 6-h minimal internal between fractions). Total radiotherapy dose was 80.4 Gy on the oropharynx and 75.6 Gy on the hypopharynx. Two or three chemotherapy courses of cisplatin (CP)-5-fluorouracil (5FU) were given during radiotherapy at 21 -day intervals (third not delivered after the end of the radiotherapy). CP dose was 100 mg/m{sup 2} (day 1) and 5-FU was given as 6-day continuous infusion (750 mg/m{sup 2}/day at 1. course; 430 mg/m{sup 2}/day at 2. and 3. courses). Special attention was paid to supportive care, particularly in terms of enteral nutrition and mucositis prevention by low-level laser energy. Acute toxicity was marked and included WHO grade III/IV mucositis (89%, 16% of them being grade IV), WHO grade III dermatitis (72%) and grade III/IV neutropenia (61%). This toxicity was significant but manageable with optimised supportive care, and never led to interruption of treatment for more than 1 week, although there were two toxic deaths. Complete global response rate at 6 months was 74%. Overall global survival at 1 and 3 years was 72% and 50% respectively, with a median follow-up of 17 months. Prognostic factors for overall were the Karnofsky index (71% survival at 3

  2. Neo-adjuvant chemoradiotherapy by 5-fluoro-uracil and oxaliplatine for the locally evolved rectum cancer: study of the toxicity and the histological response; Chimioradiotherapie neoadjuvante par 5-fluoro-uracile et oxaliplatine pour les cancers du rectum localement evolues: etude de la toxicite et de la reponse histologique

    Energy Technology Data Exchange (ETDEWEB)

    Le Scodan, R.; Miranda, O.; Henni, M.; Durdux, C.; Housset, M. [HEGP, Dept. de Radiotherapie, 75 - Paris (France); Landi, B. [HEGP, Dept. de Gastroenterologie, 75 - Paris (France); Berger, A. [HEGP, Dept. Chirurgie Viscerale, 75 - Paris (France); Dousset, B. [Hopital Cochin, Dept. de Chirurgie Viscerale, 75 - Paris (France); Brezault, C. [Hopital Cochin, Dept. Gastroenterologie, 75 - Paris (France); Cote, J.F. [HEGP, Dept. d' anatomopathologie, 75 - Paris (France)

    2006-11-15

    The neo-adjuvant chemoradiotherapy by 5-fluoro-uracil and oxaliplatine, for the locally evolved rectum cancers, has a certain efficiency in term of histological response with an acceptable acute toxicity. The study of prediction factors to the response to chemoradiotherapy is in progress. (N.C.)

  3. Predictive factors for survival after bi-fractionated radiotherapy with or without cisplatin and 5-fluoro-uracil (BiRCF trial) for a unresectable pharyngeal cancer; Facteurs predictifs pour la survie apres radiotherapie bifractionnee avec ou sans cisplatine et 5-fluoro-uracile (essai BiRCF) pour cancer pharynge non resecable

    Energy Technology Data Exchange (ETDEWEB)

    Borchiellini, D.; Benezery, K.; Dassonville, O.; Marcy, P.Y.; Chateau, Y.; Poissonnet, G.; Etienne-Grimaldi, M.C.; Peyrade, F.; Thariat, J. [Centre Antoine-Lacassagne, 06 - Nice (France); Bensadoun, R. [CHU, 86 - Poitiers (France)

    2010-10-15

    The objective of this study was to determine the predictive factors for a long term survival and local-areal control for patients suffering from an unresectable pharyngeal cancer and treated according to the BiRCF trial. The authors indicate the different types of tumours among the 59 concerned patients, the different treatments, and analyse the tumour and ganglionary response, the cancer steadiness or advance, late effects, the relapse rates (global, local, areal), the survival rate by 5 years, the late toxicity. A uni-factorial analysis is performed. Short communication

  4. Chemo radioimmunotherapy with 5-fluorouracil, cisplatin and interferon-{alpha} in pancreatic and peri-ampullary cancer: Results of a feasibility study; Chimioradiotherapie et immunotherapie avec 5-fluoro-uracile, cisplatine et interferon-{alpha} dans les cancers du pancreas et periampullaires: resultats d'une etude de faisabilite

    Energy Technology Data Exchange (ETDEWEB)

    Nitsche, M.; Christiansen, H.; Hermann, R.M.; Hess, C.F. [Goettingen Univ., Dept. of Radiation Oncology (Germany); Horstmann, O.; Becker, H. [Goettingen Univ., Dept. of Surgery (Germany); Pradier, O. [Centre Hospitalier Universitaire, Dept. de cancerologie, 29 - Brest (France); Schmidberger, H. [Mainz Univ., Dept. of Radiation Oncology (Germany)

    2008-12-15

    Background: Recent studies give rise to the hypothesis, that adjuvant chemo radioimmunotherapy with 5-fluorouracil (5-F.U.), cisplatin and interferon-a (I.F.N.-a) might be a possible new treatment of pancreatic cancer in resected patients. We report the up-to-now experience at our institution. Patients and methods: Eleven patients with histological diagnosis of localized carcinoma of the pancreas (n = 7) or peri-ampullary (n = 4) were prospectively analyzed. Four patients were deemed unresectable because of local invasion of adjacent organs (neo-adjuvant setting) and seven patients underwent curative resection (adjuvant setting). Eight patients were classified as T3 carcinomas and three T4 carcinomas. Fifty-five per cent (6/11) of the patients presented with positive lymph node involvement. One histological Grade I, six Grade II and three Grade III were detected. External conformal irradiation to a total dose of 50.4 Gy with 1.8 Gy per day was delivered. All patients received a concomitant chemotherapy with continuous 5-F.U. 200 mg/m{sup 2} per day on 28 treatment days and intravenous bolus cisplatin 30 mg/m{sup 2} per week (Day 2, 9, 16, 23, 30). A recombinant r-I.F.N.-a was administered on three days weekly during Week one to five of the radiotherapy course as subcutaneous injections with 3*3 Mio. I.U. weekly. Results: The four-year overall survival rate for all patients was 55%. In the neo-adjuvant group, three of four patients died due to progressive disease; in the adjuvant group, combined chemo radioimmunotherapy lead to controlled disease in five of seven patients. The overall toxicity was well-managed. Conclusion: Our data strengthens the hypothesis of concomitant chemo radioimmunotherapy with 5-F.U., I.F.N.-a and cisplatin as a possible new treatment of pancreatic cancer in resected patients. (authors)

  5. Locally advanced unresectable pancreatic cancer: Induction chemoradiotherapy followed by maintenance gemcitabine versus gemcitabine alone: Definitive results of the 2000-2001 FFCD/SFRO phase III trial; Cancer du pancreas localement evolue non resecable: chimioradiotherapie d'induction suivie de chimiotherapie par gemcitabine contre chimiotherapie exclusive par gemcitabine: resultats definitifs de l'etude de phase III 2000-2001de la FFCD et de la SFRO

    Energy Technology Data Exchange (ETDEWEB)

    Barhoumi, M.; Mornex, F. [EA 3738, departement de radiotherapie-oncologie, centre hospitalier Lyon-Sud, 165, chemin du Grand-Revoyet, 69310 Pierre-Benite (France); Bonnetain, F. [EA 4184, unite de biostatistiques et d' epidemiologie, centre Georges-Francois-Leclerc, 21034 Dijon cedex (France); Inserm UMR 866, faculte de medecine, 21078 Dijon cedex (France); Universite de Bourgogne, BP 27877, 21078 Dijon cedex (France); Rougier, P. [Service d' hepato-gastro-enterologie oncologie digestive, centre hospitalier Ambroise-Pare, 9, avenue Charles-de-Gaulle, 92100 Boulogne-Billancourt (France); Mariette, C. [Service de chirurgie digestive et generale, rez-de-jardin-aile-ouest, hopital Claude-Huriez, 59037 Lille cedex (France); Bouche, O. [CHU, 51092 Reims cedex (France); Bosset, J.F. [Service de radiotherapie, CHU de Besancon, 25030 Besancon cedex (France); Aparicio, T. [Service de gastroenterologie, hopital Avicenne, AP-HP, 93000 Bobigny (France); Mineur, L. [Service de radiotherapie oncologie digestive, institut Sainte-Catherine, 84082 Avignon cedex 2 (France); Azzedine, A. [Centre hospitalier Henri-Duffaut, 84902 Avignon (France); Hammel, P. [Service de gastroenterologie pancreatologie, hopital Beaujon, 92110 Clichy (France); Butel, J. [Hopital d' Abbeville, 80142 Abbeville (France); Stremsdoerfer, N. [Service d' hepatogastroenterologie, centre hospitalier Pierre-Oudot, 38317 Bourgoin-Jallieu (France); Maingon, P. [Departement de radiotherapie, centre Georges-Francois-Leclerc, 21079 Dijon cedex (France); Bedenne, L. [Inserm UMR 866, faculte de medecine, 21078 Dijon cedex (France); Universite de Bourgogne, 21078 Dijon cedex (France); Service d' hepatogastroenterologie, CHU Le-Bocage, 21034 Dijon cedex (France); Chauffert, B. [Inserm UMR 866, faculte de medecine, 21078 Dijon cedex (France); Universite de Bourgogne, 21078 Dijon cedex (France); Departement d' oncologie medicale, centre Georges-Francois-Leclerc, 21079 Dijon cedex (France)

    2011-06-15

    Purpose. - To compare chemo-radiation with systemic chemotherapy to chemotherapy alone in locally advanced pancreatic cancer. Patients and methods. - One hundred and nineteen patients with locally advanced pancreatic cancer, with World Health Organization performance status of zero to two were randomly assigned to either the induction chemo-radiation group (60 Gy, 2 Gy/fraction; concomitant 5-fluoro-uracil infusion, 300 mg/m{sup 2} per day, days 1-5 for 6 weeks; cisplatin, 20 mg/m{sup 2} per day, days 1-5 during weeks 1 and 5) or the induction gemcitabine group (GEM: 1000 mg/m{sup 2} weekly for 7 weeks). Maintenance gemcitabine (1000 mg/m{sup 2} weekly, 3/4 weeks) was given in both arms until disease progression or toxicity. Results. - Overall survival was shorter in the chemo-radiation than in the gemcitabine arm (median survival 8.6 [99% confidence interval 7.1-11.4] and 13 months [8,9,9-18], p = 0.03). One-year survival was, respectively, 32 and 53%. These results were confirmed in a per-protocol analysis for patients who received 75% or more of the planned dose of radiotherapy. More overall grades 3-4 toxic effects were recorded in the chemo-radiation arm, both during induction (36 versus 22%) and maintenance (32 versus 18%). Conclusion. - This intensive induction schedule of chemo-radiation was more toxic and less effective than gemcitabine alone. (authors)

  6. [Modeling 5-FU clearance during a chronomodulated infusion].

    Science.gov (United States)

    Kwiatkowski, F; Chevalier, V; Chevrier, R; Richard, D; Cure, H; Chollet, P

    2003-06-01

    Drugs pharmacokinetic control is a usual practice in case of flat continuous infusions. It enables among others, to modulate delivered doses when drug concentrations in blood appear too high. With chronotherapy, this possibility becomes more difficult because of sinusoidal outflows of infusion. We propose here a method that enables this follow-up, established through the study of 21 metastatic colorectal cancer patients, treated with a chronomodulated infusion of high dose 5-fluoro-uracil (5-FU) and folinic acid. This pharmacokinetic follow-up permitted the modelisation of 5-FU clearance and the calculation of an index, which was, in our study, correlated to the treatment response and also to main encountered toxicities.

  7. ACTA-EVER lecture 2007 - The retinal pigment epithelium: friend or foe?

    DEFF Research Database (Denmark)

    La Cour, Morten

    2008-01-01

    far. We report on a drug delivery system under development where a prodrug of the antimetabolite 5-fluoro-uracil (5-FU) is suspended in the silicone oil used as a surgical device in the treatment of proliferative vitreoretinopathy (PVR). The theoretical advantage of this approach is that it allows...... for long contact times between therapeutic, and non-toxic, concentrations of 5-FU and the RPE Udgivelsesdato: 2008/9...

  8. Adjuvant chemotherapy followed by conformal chemoradiotherapy in gastric carcinoma; Chimiotherapie adjuvante suivie d'une chimioradiotherapie conformationnelle dans les cancers de l'estomac

    Energy Technology Data Exchange (ETDEWEB)

    Bouchbika, Z.; Quero, L.; Kouto, H.; Hennequin-Baruch, V.; Sergent, G.; Maylin, C.; Hennequin, C. [Hopital Saint-Louis, Service de Cancerologie-Radiotherapie, 75 - Paris (France); Gornet, J.M. [Hopital Saint-Louis, Service de Gastroenterologie, 75 - Paris (France); Munoz, N. [Hopital Saint-Louis, Service de chirurgie, 75 - Paris (France); Cojean-Zelek, I.; Houdart, R. [Hopital de la Croix Saint-Simon, 75 - Paris (France); Panis, Y. [Hopital Beaujon, Service de Chirurgie Digestive, 92 - Clichy (France); Valleur, P. [Hopital Lariboisiere, Service de Chirurgie Digestive, 75 - Paris (France)

    2008-12-15

    Purpose: Analysis of the feasibility and results of adjuvant chemotherapy followed by conformal chemoradiotherapy after surgery for gastric carcinoma. Patients and methods Twenty-six patients (R0 or R1) were treated postoperatively by three cycles of 5-fluorouracil (5-FU) and cisplatin, followed by a concomitant association of LV5FU2 chemotherapy with a conformal radiotherapy of 45 Gy. Results: The tumor was classified pT3-T4 in 77% of the patients and 92.5% had a nodal involvement (pN1: 54%; pN2: 31%). Feasibility (1) Adjuvant chemotherapy: nausea/vomiting grade II/III: 12 patients (48%); neutropenia grade III/IV: two patients; completed in all patients, except one. (2) Chemoradiotherapy: nausea/vomiting grade II/III: 10 patients; diarrhea grade II/3: two patients; oesophagitis grade II/III: two patients; myocardial infarction/pulmonary embolism: two patients. All patients except one received the planned dose of 45 Gy. Radiotherapy was interrupted in six cases, with a median duration of 14 days. Survival: with a median follow-up of 30 months, 65% of the patients were alive without disease; median survival was 32 months. Conclusion: This postoperative schedule was judged feasible. It allowed the deliverance of a more intensified chemotherapy than the classical schedule. Its clinical benefit must be evaluated in a phase III trial. (authors)

  9. Minutes of the 48. meeting of the American Society for Therapeutic Radiology and Oncology (ASTRO); Compte-rendu de la 48. reunion de l'American Society for Therapeutic Radiology and Oncology (ASTRO)

    Energy Technology Data Exchange (ETDEWEB)

    Simon, J.M.; Mazeron, J.J. [Groupe Hospitalier de la Pitie-Salpetriere, APHP, Service de Radiotherapie Oncologique, 75 - Paris (France)

    2007-05-15

    Four parts are treated in this article: Cancers of the O.R.L. sphere, prostate cancers, breast cancer and anal channel. About the O.R.L. sphere cancers, Comparison between several works are made: american and European tests that conclude to the superiority of a chemotherapy using cisplatin on a classical radiotherapy after excision of epidermoid carcinomas of the O.R.L. sphere. Two other tests, one from Hong Kong and the other one from Singapore, are related; The first test studied a concomitant chemotherapy face to an adjuvant chemotherapy in locally evolved nasopharynx cancer. The second one ( Singapore) has compared radiotherapy and radiotherapy with concomitant chemotherapy by cisplatin. Concerning the prostate cancer, the question of dose escalation is developed, followed by a comparison between radiotherapy and hormonotherapy with goserelin. About the breast cancer, two canadian tests are related: the first one concerns the comparison between a conformal radiotherapy with intensity modulation a classical radiotherapy with two tangential beams. The results are in favour of R.C.M.I ( conformal radiotherapy with intensity modulation). The second tests compared a chemotherapy with tamoxifen with and without radiotherapy, the conclusions are in favour of chemotherapy with radiotherapy. The last part was devoted to the anal channel, and compared two chemotherapy with radiotherapy, one using 5-fluoro-uracil and mitomycin, the second one 5-fluoro-uracil and cisplatin. The treatment with 5-fluoro-uracil and mitomycin stays the preferred one. (N.C.)

  10. Management of inflammatory breast cancer after neo-adjuvant chemotherapy; Traitement locoregional du cancer du sein inflammatoire apres chimiotherapie neo-adjuvante

    Energy Technology Data Exchange (ETDEWEB)

    Abrous-Anane, S.; Daveau, C.; Dendale, R.; Campana, F.; Kirova, Y.; Fourquet, A.; Bollet, M.A. [Service d' onco-radiotherapie, institut Curie, 26, rue d' Ulm, 75005 Paris cedex 05 (France); Savignoni, A.; Gautier, C. [Service de biostatistique, institut Curie, 26, rue d' Ulm, 75248 Paris cedex 05 (France); Pierga, J.Y. [Service d' oncologie medicale, institut Curie, 26, rue d' Ulm, 75248 Paris cedex 05 (France); Reyal, F. [Service de chirurgie, institut Curie, 26, rue d' Ulm, 75248 Paris cedex 05 (France)

    2011-12-15

    Purpose. - To assess the benefit of breast surgery for inflammatory breast cancer. Patients and methods. - This retrospective series was based on 232 patients treated for inflammatory breast cancer. All patients received primary chemotherapy followed by either exclusive radiotherapy (118 patients, 51%) or surgery with or without radiotherapy (114 patients, 49%). The median follow-up was 11 years. Results. - The two groups were comparable apart from fewer tumors smaller than 70 mm (43% vs 33%, P = 0.003), a higher rate of clinical stage N2 (15% vs 5%, P = 0.04) and fewer histopathological grade 3 tumors (46% vs 61%, P < 0.05) in the no-surgery group. The addition of surgery was associated with a significant improvement in locoregional disease control (P = 0.04) but with no significant difference in overall survival rates or disease-free intervals. Late toxicities were not significantly different between the two treatment groups except for a higher rate of fibrosis in the no-surgery group (P < 0.0001), and more lymphedema in the surgery group (P = 0.002). Conclusion. - Our data suggest an improvement in locoregional control in patients treated by surgery, in conjunction with chemotherapy and radiotherapy, for inflammatory breast cancer. (authors)

  11. Chemotherapy or radio-chemotherapy for advanced adenocarcinoma of the oesophagus and cardiac orifice; Adenocarcinomes du bas oesophage et du cardia: quelle chimiotherapie ou chimioradiotherapie dans le traitement des recidives et des metastases

    Energy Technology Data Exchange (ETDEWEB)

    Seitz, J.F.; Duffaud, F.; Dahan, L.; Ries, P.; Ville, E.; Laugier, R. [Centre Hospitalier Universitaire de la Timone, 13 - Marseille (France)

    2001-11-01

    Adenocarcinomas of esophagus and cardia represent in France approximately 20 to 40% of the esophagus cancers. They have a high risk to develop lymph nodes metastases and liver metastases. Currently, only 50 to 70% of patients may benefit from surgical curative resection at diagnosis, but more than 50% of them will recur. The standard of treatment of these metastatic adenocarcinomas is chemotherapy. Three large randomized comparative studies, between chemotherapy and supportive care, showed that chemotherapy significantly extends the median of survival (from 3-4 months to 10-12 months) and improves the quality of life. Currently, the combination of epirubicin-cisplatin-continuous 5FU (ECF) is the most effective regimen but it is difficult to administer and tolerate because of the long continuous 5FU infusion. In France, the most commonly used combination regimen still associates 5FU and cisplatin. New drugs (such as docetaxel, CPT11, oxaliplatin) used alone or in combination, especially with 5U, are very promising. Radio-chemotherapy is the preferred treatment for locoregional recurrences, because it improves dysphagia and enables to obtain complete tumor responses. Current results from concomitant radio-chemotherapy studies for esophagus cancer, based on 5FU alone, 5FU-cisplatin or 5FU-mitomycin, given as preoperative treatment or as exclusive treatment, support to use radio-chemotherapy for the treatment of loco-regional recurrences after surgical resection. Nevertheless, the optimal radio-chemotherapy schedule still remain to be defined (dose, duration, splitting of radiotherapy, choice of anticancer drugs). (authors)

  12. Concurrent administration of adjuvant chemotherapy and radiotherapy after breast-conservative surgery enhances late toxicities; La chimiotherapie concomitante de la radiotherapie augmente la toxicite tardive apres chirurgie conservatrice du cancer du sein

    Energy Technology Data Exchange (ETDEWEB)

    Toledano, A. [Hopital Tenon, Service d' oncologie-radiotherapie 75 - Paris (France); Garaud, P.; Body, G.; Le Floch, O.; Calais, G. [Centre Hospitalier Universitaire Bretonneau, 37 - Tours (France); Serin, D. [Institut Sainte-Catherine, 84 - Avignon (France); Fourquet, A. [Institut Curie, 75 - Paris (France); Bosset, J.F.; Miny-Buffet, J. [Centre Hospitalier Universitaire Minjoz, 25 - Besancon (France); Favre, A. [Centre Hospitalier Universitaire La Source, 45 - Orleans (France); Azria, D. [Centre de Lutte Contre le Cancer Val d' Aurelle, 34 Montpellier (France)

    2006-06-15

    In 1996, a multicenter randomized study comparing after breast-conservative surgery. sequential vs concurrent adjuvant chemotherapy (CT) with radiation therapy (RT) was initiated (ARCOSEIN study). Seven hundred sixteen patients were included in this trial. After a median follow-up of 6.7 (4.3 -9) years, we decided to prospectively evaluate the late effects of these two strategies. Patients and methods - A total of 297 patients were asked to follow-up from the five larger including institutions. Seventy-two percent (214 patients) were eligible for late toxicity. After breast-conserving surgery with axillary dissection, patients were treated either with sequential treatment with CT first followed by RT (arm A) or CT administered concurrently with RT (arm B). In all patients, CT regimen combined mitoxantrone (12 mg/m{sup 2}). 5-FU (500 mg/m{sup 2}), and cyclophosphamide (500 mg/m{sup 2}), 6 cycles (day 1-day 21). In arm B, patients received concurrently the first 3 cycles of CT with RT. In arm A, RT started 3 to 5 weeks after the 6. cycle of CT. Conventional RT was delivered to the whole breast using a 2 Gy-fraction protocol to a total dose of 50 Gy ({+-} boost to the primary tumour bed). The assessment of toxicity was blinded to treatment and was graded by the radiation oncologist according to the LENT-SOMA scale. Skin pigmentation was also evaluated using a personal 5-points scoring system (excellent, good, moderate, poor, very poor). Results - Among the 214 evaluated patients, 107 were treated in each arm. The two populations were homogeneous for patients', tumors' and treatment characteristics. Subcutaneous fibrosis (SF), telangiectasia (T), skin pigmentation (SP), and breast atrophy (BA) were significantly increased in arm B. Twenty patients experienced grade superior or equal to 2 (SF) in arm B vs five in arm A (P 0.003). Twenty-five and seven patients showed grade superior or equal to 2 (T) in ann B and A, respectively (P = 0.001). Forty-four and

  13. Radiotherapy and concomitant chemotherapy by cisplatin, 5-fluorouracil and mitomycin C in locally advanced oropharynx carcinomas: results on a test in phase II. Radiotherapie et chimiotherapie concomitante par cisplatine (CDDP), 5-fluorouracile (5FU) et mitomycine C (MMC) dans les cancers localement evolues de l'oropharynx: resultats d'un essai de phase II

    Energy Technology Data Exchange (ETDEWEB)

    Berger, C.; Chapet, S.; Reynaud-Bougnoux, A.; Calais, G.; Le Floch, O. (Hopital Bretonneau, 37 - Tours (France))

    1994-01-01

    After exclusive irradiation the prognosis of advanced oropharynx carcinomas is bad. To improve the response to the tumoral treatment, a test in phase II was made, associating irradiation and concomitant chemotherapy. The results show that this association allow a high rate of complete remissions at the end of the treatment, but with a severe digestive and hematological toxicity.

  14. Primary and secondary prevention of acute complications of radiotherapy of head and neck cancers; Prevention primaire et secondaire des complications aigues de la radiotherapie des cancers de la tete et du cou

    Energy Technology Data Exchange (ETDEWEB)

    Lambrexhe, M.; Frederick, B.; Burie, D.; Cavuto, C.; Rob, L.; Rasquin, I.; Coiffier, N.; Untereiner, M. [Centre national de Radiotherapie, Centre Francois-Baclesse (CFB), Esch-sur-Alzette (Luxembourg)

    2009-10-15

    Purpose: the standard treatment of head and neck cancers associates a 70 Gy irradiation and weekly concomitant chemotherapy by 5-fluoro-uracils and cisplatin or targeted therapy by Erbitux. A retrospective study realised at the Francois Baclesse center in 2004-2005 for 84 patients suffering of ear-nose-throat cancers whom treatment was a concomitant chemoradiotherapy, showed the noxious effects of the treatment on the patients nutritional situation: weight loss for 90% of patients; temporary interruption or definitive stop of radiotherapy for 28% of patients. based on this observation, a preventive approach of the nutritional risk was implemented. The objective was to reduce the malnutrition risk linked to radiotherapy associated to chemotherapy or to the targeted therapy. (N.C.)

  15. Mediastinal radiotherapy after multidrug chemotherapy and prophylactic cranial irradiation in patients with SCLC - treatment results after long-term follow-up and literature overview; Radiotherapie mediastinale apres chimiotherapie et irradiation prophylactique de l'encephale chez des patients atteints d'un carcinome bronchique a petites cellules - Resultats et revue de la litterature

    Energy Technology Data Exchange (ETDEWEB)

    Herrmann, M.K.A.; Bloch, E.; Overbeck, T.; Wolff, H.A.; Hille, A.; Hess, C.F.; Christiansen, H. [Department of Radiotherapy, University Hospital Goettingen, Robert-Koch-Str. 40, 37075 Goettingen (Germany); Koerber, W. [Department of Pneumology, Weende Hospital, Section Lenglern, Pappelweg 5, 37120 Bovenden-Lenglern (Germany); Vorwerk, H. [Department of Hematology and Oncology, University Hospital Goettingen, Robert-Koch-Str. 40, 37075 Goettingen (Germany); Muller, M.; Pradier, O. [Department de cancerologie, CHU Morvan, 5, avenue Foch, 29200 Brest cedex (France)

    2011-04-15

    Introduction. - Curative therapy for patients with small-cell lung cancer (SCLC) is based on multidrug chemotherapy combinations and radiotherapy. After a long time follow-up, the aim of the study was to evaluate the efficacy and toxicity of sequential chemo-radiotherapy and the effect of prophylactic cranial irradiation (PCI). Methods. - From 1995-2005, 96 patients with SCLC (64 limited-disease [LD], 32 extensive-disease [ED]; median age 61 years [range 39-79]) were treated at our department with varying chemotherapy regimens and sequential mediastinal radiotherapy (50 Gy + 10 Gy boost in case of residual disease after chemotherapy). Afterwards, 15 patients with LD, good general condition and at least partial response after local treatment received PCI (30 Gy). Results. - After a median follow-up of 78.6 months, 20 patients remained alive (20.8%, median survival time 18.2 months). The 2-/5-year overall survival rates were 33.8% and 12.6%, the 2-/5-year loco-regional control rates were 30.3% and 24.5%, respectively. Distant metastases occurred in 43 patients (24 cerebral). Cerebral metastasis occurred in 6.7% and 27.2% of the patients with PCI and without PCI respectively. Only tumor stage showed a statistically significant impact on overall survival and loco-regional control in multivariate analysis. Radiotherapy was well tolerated. Grade 3/4 toxicity occurred in seven patients. Prognosis of patients with SCLC remains poor. Administration of PCI in selected patients bears a decrease in the incidence of cerebral metastases. Alternative chemotherapy schemes as well as irradiation schemes and techniques should be the substance of future randomized trials. (authors)

  16. Locally advanced non inflammatory breast cancer treated by combined chemotherapy and preoperative irradiation: updated results in a series of 120 patients; Cancer du sein localement evolue non inflammatoire traite par association de chimiotherapie et de radiotherapie a dose preoperatoire: reactualisation des resultats d'une serie de 120 patientes

    Energy Technology Data Exchange (ETDEWEB)

    Lerouge, D.; Touboul, E.; Moureau-Zabotto, L. [Hopital Tenon AP-HP, Service d' oncologie-radiotherapie, 75 - Paris (France); Lefran, J.P.; Blondon, J. [Hopital Pitie-Salpetriere AP-HP, Service de chirurgie generale et gynecologique, 75 - Paris (France); Genestie, C. [Hopital Pitie-Salpetriere AP-HP, Service d' anatomopathologie, 75 - Paris (France)

    2004-06-01

    vs. {>=}6 cm in diameter, p = 0.008), and tumour response after induction chemotherapy and preoperative irradiation (clinically complete response + partial response vs. non-response, p = 0.0015). In the non conservative breast treatment group, of the 32 patients with no change in clinical tumour size after induction chemotherapy, the 10-year metastatic disease-free survival rate was 59% with only one local relapse. Arm lymphedema was noted in 17% (14 of 81) following axillary dissection and in 2.5% (1 of 39) without axillary dissection. Cosmetic results were satisfactory in 70% of patients treated by irradiation alone and in 51.5% of patients after wide excision and irradiation. Conclusion. - Despite the poor prognosis of patients with locally advanced non inflammatory breast cancer resistant to primary anthracycline-based regimen, aggressive locoregional management using preoperative irradiation and mastectomy with axillary dissection offers a possibility of long term survival with low local failure rate for patients without extensive nodal disease. On the other hand, the rate of local failure seems to be high in patients with clinical partial tumour response following induction chemotherapy and breast-conserving treatment combining preoperative irradiation and large wide excision. (authors)

  17. Conservative treatment of anal canal carcinoma with external radiotherapy and interstitial brachytherapy, with or without chemotherapy: long-term results; Traitement conservateur des cancers du canal anal par irradiation suivie de curietherapie interstitielle, avec ou sans chimiotherapie: resultats a long terme

    Energy Technology Data Exchange (ETDEWEB)

    Berger, C.; Felix-Faure, C.; Chauvet, B.; Vincent, P.; Alfonsi, M.; Coudurier, P.; Plat, F.; Reboul, F. [Clinique Sainte-Catherine, 84 - Avignon (France)

    1999-12-01

    Purpose: a retrospective analysis of conservative treatment of anal canal cancers with external radiation therapy and interstitial brachytherapy with or without chemotherapy. Patients and methods: from 1986 to 1996, 69 patients were treated with external radiotherapy (40 Gy/20 fractions) and interstitial brachytherapy (20 Gy) after a mean interval of six weeks for a localized epidermoid carcinoma of the anal canal. Patients who did not complete the whole therapeutic sequence were not included. Forty-five patients received additional 5-fluorouracil- and/or mitomycin C-based chemotherapy regimen. Results: acute toxicity was acceptable. Complete response rate was 81%. Actuarial local control rate was at two and five years, 65% and 59% respectively (median follow-up: eight years). At two, five and ten years, actuarial colostomy rate was 26%, 33% and 33% respectively, and colostomy-free survival rates 61%, 47% and 37%. Overall survival at two, five and ten years was 81%, 65% and 53% respectively. Distant metastases occurred in 11 patients (16%). Prognostic factors for overall survival were performance status (PS) (79% survival at five years for patients with PS 0 versus 50% for patients with PS 1-3, P = 0.04) and tumor stage (80% at five years for T1-T2 versus 53% for T3-T4, P = 0.03). Overall treatment time less than 12 weeks and time interval between external radiotherapy and brachytherapy inferior than six weeks were associated with a better local control (P = 0.05). In multivariate analysis, these prognostic factors were not significant. Conclusion: these results confirm the efficacy of external radiotherapy and brachytherapy in the treatment of small anal canal cancers, and point out the need for improving treatment outcome of larger tumors. (author)

  18. Safety and radiation-enhancing effect of sodium glycididazole in loco regionally advanced laryngeal cancers previously treated with platinum-containing chemotherapy regimens: a preliminary report; Tolerance et effet radiosensibilisateur du sodium glycididazole chez des patients atteints de cancer du larynx localement evolue ayant prealablement recu une chimiotherapie a base de cisplatine: rapport preliminaire

    Energy Technology Data Exchange (ETDEWEB)

    Zeng, Y.C.; Wu, R.; Xu, Z.G.; Zhang, X.Y.; Wu, L.N.; Wang, Y.M.; Zheng, W.; Chen, X.D.; Chi, F.; Zhang, Z.Y.; Li, X.; Jin, X.Y.; Chen, W.; Wang, S.L.; Xiao, F.D.; Wang, E.Y.; Dong, X.Q.; Jia, M.X.; Li, Y. [China Medical Univ., Dept. of Medical Oncology, Shengjing Hospital, Shenyang, PR (China); Fan, G.L. [Harbin First Hospital, Dept. of Otorhinolaryngology, PR (China); Hao, S.H.; Zhang, L.B.; Zhang, H.B. [General Hospital of Shenyang Military Region, Dept. of Nuclear Medicine and Radiology, Shenyang, PR (China); Xia, H.H.X. [Novartis Pharmaceuticals Corporation, East Hanover, New Jersey (United States)

    2010-01-15

    Purpose: To determine the safety and radiation-enhancing effect of sodium glycididazole in laryngeal squamous cell carcinoma (stage T3-4,N0-3,M0) with conventional radiotherapy. Patients and methods: Patients with locoregional advanced laryngeal cancer (stage T3-4,N0-3,M0) were included: group 1(control, n = 30)were not administered of sodium glycididazole; group 2 (test, n = 30) received sodium glycididazole at a dose of 700 mg/m2 intravenous infusion 30 minutes before radiotherapy three times a week. Surrogate end-points of efficacy were tumor and nodal size. Safety parameters were vomiting, nausea, mucositis, laryngeal edema, esophagus and skin reaction, dysphagia, dyspnea, neurological deficit. Patients were evaluated weekly during treatment for 7 weeks and thereafter monthly for 3 months. Results: In the test, the overall response rate was 88.89% (95% CI, 71.00-97.00%) at 7 weeks and 92.59% (95% CI, 76.00 to 99.00%) at 1 month of follow-up. In the control, the overall response rate was 62.5% (95% CI, 41.00 to 81.00%) at 7 weeks and 58.33% (95% CI, 37.00 to 78.00%) at 1 month of follow-up. The short-term locoregional response rate was better in the test group at 7 weeks (p = 0.027) and at 1 month (p = 0.005) of follow-up. The test group had significantly more nausea and vomiting in weeks 1 (p = 0.047), 2 (p = 0.007), and 3 (p = 0.01) of treatment. Conclusions: The study indicates sodium glycididazole is an effective radiation-enhancing agent that improves short-term locoregional control and is well tolerated in patients with loco regionally advanced laryngeal cancer. (authors)

  19. Treatment of patients with unresectable squamous head and neck cancer with induction chemotherapy followed by hyperfractionated radiotherapy; Traitement de patients atteints d'un cancer irresecable de la tete et du cou avec une chimiotherapie d'induction suivie d'une radiotherapie hyperfractionnee

    Energy Technology Data Exchange (ETDEWEB)

    Mesia, R.; Majem, M.; Barretina Ginesta, M.P.; Montes, A.; Cardenal, F. [Institut Catala d' Oncologia-Duran i Reynals, Dept. of Medical Oncology, L' Hospitalet de LLobregat-Barcelona (Spain); Galiana, R.; Guedea, F. [Institut Catala d' Oncologia-Duran i Reynals, Dept. of Radiation Oncology, L' Hospitalet de LLobregat-Barcelona (Spain); Manos, M. [Institut Catala d' Oncologia-Duran i Reynals, Dept. of ENT, L' Hospitalet de LLobregat-Barcelona (Spain); Monner, A. [Institut Catala d' Oncologia-Duran i Reynals, Dept. of Dept. of Maxillofacial Surgery, L' Hospitalet de LLobregat-Barcelona (Spain); Perez, J. [Institut Catala d' Oncologia-Duran i Reynals, Clinical Investigation Unit, L' Hospitalet de LLobregat-Barcelona (Spain)

    2008-03-15

    Purpose: the contribution of induction chemotherapy (CT) followed by hyperfractionated radiotherapy (h.f.R.T.) in unresectable squamous head and neck cancer has been evaluated in a single institution as an assistancial protocol. Patients and methods: from March 1994 to June 2000 all consecutive patients with unresectable disease were treated with four courses of platin plus fluorouracil based CT followed by h.f.R.T.. Tumor resectability and response was assessed by a multidisciplinary committee. Results: ninety-nine patients (pts) were treated. All of them had stage IV-M0 disease: 67 T4, 88 N2-N3. Tumor location: 62 oropharynx, 22 hypopharynx, eight oral cavity and seven larynx. Tumor response at the end of treatment: 61 patients complete response, 17 partial response, two stable disease, 10 progressive disease and nine unevaluated. With a median follow-up of 70 months the 5-year loco-regional control and overall survival was 30.3% (95% CI: 21.9-38.6) and 21.6% (95% CI: 13.4-29.8), respectively. Loco-regional control and overall survival is significantly influenced by prior response to induction CT. Main grade 3-4 toxicity related to CT was stomatitis, but there were five patients with an ischemic event. Grade 3-4 acute toxicity related to h.f.R.T.: 47 stomatitis, 20 epithelitis. Chronic toxicity related to h.f.R.T.: six emergency tracheotomies due to laryngeal edema, five pneumonia and one mucous/soft-tissue necrosis. There were eight toxic related deaths. Conclusion: induction CT followed by h.f.R.T. might increase the overall survival rate in unresectable disease. H.f.R.T. resulted in a high rate of acute toxicity and its use would not be warranted in those patients with no response to induction CT who had a low probability of long-term control. (authors)

  20. In Silico Screening, Synthesis and In Vitro Evaluation of Some Quinazolinone and Pyridine Derivatives as Dihydrofolate Reductase Inhibitors for Anticancer Activity

    Directory of Open Access Journals (Sweden)

    A. G. Nerkar

    2009-01-01

    Full Text Available Dihydrofolate reductase (DHFR is the important target for anticancer drugs belonging to the class of antimetabolites as the enzyme plays important role in the de novo purine synthesis. We here report the in silico screening to obtain best fit molecules as DHFR inhibitors, synthesis of some ʻbest fitʼ quinazolinone from 2-phenyl-3-(substituted-benzilidine-amino quinazolinones (Quinazolinone Shiff's bases QSB1-5 and pyridine-4-carbohydrazide Shiff's bases (ISB1-5 derivatives and their in vitro anticancer assay. Synthesis of the molecules was performed using microwave assisted synthesis. The structures of these molecules were elucidated by IR and 1H-NMR. These compounds were then subjected for in vitro anticancer evaluation against five human cancer cell-lines for anticancer cyto-toxicity assay. Methotrexate (MTX was used as standard for this evaluation to give a comparable inhibition of the cell proliferation by DHFR inhibition. Placlitaxel, adriamycin and 5-fluoro-uracil were also used as standard to give a comparable activity of these compounds with other mechanism of anticancer activity. ISB3 (4-(N, N-dimethyl-amino-phenyl Schiff''s base derivative of pyridine carbohydrazide showed equipotent activity with the standards used in in vitro anticancer assay as per the NCI (National Cancer Institute guidelines.

  1. Primary small-cell neuroendocrine carcinoma of the duodenum – a case report and review of literature

    Directory of Open Access Journals (Sweden)

    Nagai Hideo

    2004-08-01

    Full Text Available Abstract Background Small-cell neuroendocrine carcinoma in the duodenum is an extremely rare neoplasm with poor prognosis. Case presentation A 57-year-old man presented with sudden onset gastrointestinal bleeding and fainting attacks. Duodenoscopy and hypotonic duodenography revealed a 3 × 3 cm protruding tumor with ulcerations situated opposite the ampulla of Vater in the second part of the duodenum. Local excision of the tumor was performed, followed by adjuvant chemotherapy with 5-fluoro uracil and leucovorin. Examination of the tumor by immunohistochemistry and electron microscopy indicated it to be neuroendocrine in nature, expressing synaptophysin and AE1/AE3, and containing dense core granules. The patient showed no sign of recurrence and has been disease-free for more than 48 months after surgery. Conclusions Most cases of small-cell neuroendocrine carcinoma in the duodenum show rapid progression of the disease, and even radical surgery with or without chemotherapy do not prevent death. We report a rare subtype of small-cell neuroendocrine carcinoma. This subtype appears to have a much better prognosis, and may be amenable to local excision, if the lesion is away from the ampulla of Vater.

  2. [Granular cell tumor: report of a complicated vulvar localization of pulmonary metastases].

    Science.gov (United States)

    Tawfiq, N; Sabri, S; Saiss, K; Bouchbika, Z; Benchekroun, N; Jouhadi, H; Sahraoui, S; Benider, A

    2013-11-01

    Granular cell tumour, or Abrikossoff's tumour, is a rare, ubiquitous tumour, with mostly benign evolution. The malignant forms represent 1-3% of the cases. The vulvar localization is exceptional. We report the case of a 28-year-old patient who presented a vulvar Abrikossoff's tumour. Initially considered benign, the tumour was treated by exclusive local surgery. Five months later, the tumour showed a malignant transformation. The tumour size was 14cm in its major axis with the presence of not systematized scattered mitoses, PS 100 was positive at 100% and Ki 67 to 20%. Because of malignant and economic excision of the neoplasm, the patient received adjuvant radiotherapy. After 20 months, the patient had a local recurrence and lung metastasis, supporting the diagnosis of malignancy. She received two chemotherapy regimens of 5-fluoro-uracil/cisplatin and pacliatxel/carboplatin without any response. Following the failure of chemotherapy, the patient received symptomatic medical treatment. This observation leads to advocate an aggressive surgical treatment and strict supervision of all granular cell tumours.

  3. Radiotherapy for glioblastomas: from radiobiology to concomitant chemotherapy; Radiotherapie des glioblastomes: de la radiobiologie a la chimiotherapie concomitante

    Energy Technology Data Exchange (ETDEWEB)

    Simon, J.M.; Toubiana, T.; Lang, P.; Taillibert, S.; Mazeron, J.J. [Groupe Hospitalier Pitie-Salpetriere, Assistance Publique-Hopitaux de Paris, Service d' Oncologie Radiotherapique, 75 - Paris (France); Taillibert, S. [Groupe Hospitalier Pitie-Salpetriere, Assistance Publique-Hopitaux de Paris, Federation de Neurologie Mazarin, 75 - Paris (France)

    2005-09-15

    Primary signet ring cell carcinoma of urinary bladder is a rare tumor; accounting for approximately 0,24% of all bladder malignancies. In this study, we report a case of a 58-year old man who consulted for complaints of gross hematuria, the bladder biopsied showed signet ring cell carcinoma; the exploration of gastrointestinal tract did not reveal any other tumor localizations. A total cysto-prostatectomy was performed followed by radiotherapy. The aim of this study is to determine the anatomo-clinical, therapy and evolution characteristics of this rare tumor. (authors)

  4. Durability 5; Taikyusei 5

    Energy Technology Data Exchange (ETDEWEB)

    Hisada, Makoto [Niigata University, Niigata (Japan)

    1998-09-10

    The research report of 5 titles on material property of concrete bridge by durability of the concrete which abundantly used coal ash, frozen water quantity of the concrete which receives the action of sea water and pore structure, isothermal adsorption curve of the surface layer concrete, moisture conductivity, field study of ASR damage concrete structure in the Noto district and confession for a long time in this session was made. By replacing the coal ash to outside x 10 % 75 %, Kishida et al. showed being effective under the marine environment for the increase in compression strength and chloride ions osmotic fragility in the age in the long term. By distribution of the melting temperature of the mortar inside and change of class pore structure of the hardening body inside, O et al. did the description on the mechanism in the sea water action of scaling phenomena with the freezing of the concrete. Yuasa et al. by the difference of water cement ratio and drying commencing time, moisture content, release of humid heat quantity and moisture conductivity in the concrete inside changed, and it was shown that this change originated for the difference of the pore quantity of the hardening body inside. Tori et al. introduced research report on field study of ASR damage concrete structure in the Noto district which passed through common use start post-10{approx}25 and it indicated the possibility in which in addition, the expansion by ASR will continue in future too. MATSUSHITA et al. introduced the survey result of the concrete for bridge pier removed in the disassembly in passing through about 60 after common use, and it did the report that used concrete was sufficiently durable in investigation point of time. The concrete removed in the disassembly is very contrastive, though it is durable it, by passing through the concrete in which the already important damage becomes tangible and long years, while it will be used in future. The importance of the philosophy in the

  5. 5 temaer

    DEFF Research Database (Denmark)

    Brix, Anders; Kural, René

    2004-01-01

    De 5 temaer er konklusionen på projektet Fremtidens Mødekoncept med deltagelse af 8 virksomheder og 5 videnmiljøer......De 5 temaer er konklusionen på projektet Fremtidens Mødekoncept med deltagelse af 8 virksomheder og 5 videnmiljøer...

  6. C5HIO5W

    Science.gov (United States)

    Mikhova, B. M.

    This document is part of Subvolume D5 `Chemical Shifts and Coupling Constants for Carbon-13. Part 5: Organometallic Compounds' of Volume 35 `Nuclear Magnetic Resonance Data' of Landolt-Börnstein Group III: `Condensed Matter'.

  7. 5-HTP

    Science.gov (United States)

    ... taking 5-HTP by mouth does not help symptoms of Alzheimer's disease. Anxiety. Evidence on the effects of 5-HTP for anxiety is unclear. Early research shows that taking 25-150 mg of ... anxiety symptoms in people with anxiety disorders. However, other early ...

  8. CHAPTER 5

    African Journals Online (AJOL)

    admin

    only selection criteria used by both meat and wool producers, as some traits such as ..... correlations among subjectively assessed conformation traits (Table 5) ..... of economic importance in Afrino sheep, owing to the fact that the extent of ...

  9. Figure5

    Data.gov (United States)

    U.S. Environmental Protection Agency — This is an R statistics package script that allows the reproduction of Figure 5. The script includes the links to large NetCDF files that the figures access for O3,...

  10. Plot 5

    DEFF Research Database (Denmark)

    Lund, Inger-Lise; Hermansen, Anne-Mette; Ferdinand, Trine

    Danskfaglig vejledning informerer om de tanker, der ligger til grund for Plot 5, og beskriver danskfaget ud fra nyere forskning inden for fagets mange delområder. Kapitelvejledning introducerer bogens tekster, forklarer hensigten med kapitlernes opgaver, giver forslag til undervisningen og brugen...

  11. Plot 5

    DEFF Research Database (Denmark)

    Lund, Inger-Lise; Hermansen, Anne-Mette; Ferdinand, Trine

    Danskfaglig vejledning informerer om de tanker, der ligger til grund for Plot 5, og beskriver danskfaget ud fra nyere forskning inden for fagets mange delområder. Kapitelvejledning introducerer bogens tekster, forklarer hensigten med kapitlernes opgaver, giver forslag til undervisningen og brugen...

  12. The white blood cell line: changes induced in mice by hypergravity

    Science.gov (United States)

    Goldstein, Orna; Ishay, Jacob S.

    The effect of hypergravity on the white blood cell (WBC) line of mice was investigated by use of horizontal centrifuge. Several sets of experiments were performed, in which the parameters measured were the WBC and differential cell count in the peripheral blood. In another experiment, lymphocyte counts from the spleen, lymph nodes, and the thymus were measured. The needed samples were taken from the mice during a stay of 7-40 days under a hypergravity of 1.6G. The test groups that were placed on the arms of the centrifuge (1.6G) were compared with stationary control groups (1G) and a rotating control group located at the center of the centrifuge (1G). Such a comparison revealed the test animals to be deficient on all counts, to wit, showing a decrease in total number of WBC's, a decrease in lymphocyte number in the peripheral blood and a decrease in the number of lymphocyte in the spleen and thymus. The decrease of lymphocytes in peripheral blood was characterized by two different slopes - an early and temporary decrease at the first days of the experiment evident in both test and rotating control groups followed by a temporary increase, and a later persistent decrease, evident only in the test group, while in the rotating control lymphocyte counts reverted to normal. There were no significant differences in monocyte or neutrophil counts, except for a temporary increase in the number of neutrophils which peaked on the seventh day. In order to evaluate the effect of hypergravity on restoration of hematopoiesis following hematopoietic suppression, 5-fluoro-uracil (5-FU) was administered i.v. to both the experimental and control mice. Suppression of bone marrow was observed in all groups injected with 5-FU, but while there was later an increase in cell counts in the control groups, there was no such increase in the test group subjected to hypergravity.

  13. Quality of Life and Neutropenia in Patients with Early Stage Breast Cancer: A Randomized Pilot Study Comparing Additional Treatment with Mistletoe Extract to Chemotherapy Alone

    Directory of Open Access Journals (Sweden)

    Wilfried Tröger

    2009-01-01

    Full Text Available Background: Chemotherapy for breast cancer often deteriorates quality of life, augments fatigue, and induces neutropenia. Mistletoe preparations are frequently used by cancer patients in Central Europe. Physicians have reported better quality of life in breast cancer patients additionally treated with mistletoe preparations during chemotherapy. Mistletoe preparations also have immunostimulant properties and might therefore have protective effects against chemotherapy-induced neutropenia.Patients and Methods: We conducted a prospective randomized open label pilot study with 95 patients randomized into three groups. Two groups received Iscador® M special (IMS or a different mistletoe preparation, respectively, additionally to chemotherapy with six cycles of cyclophosphamide, adriamycin, and 5-fluoro-uracil (CAF. A control group received CAF with no additional therapy. Here we report the comparison IMS (n = 30 vs. control (n = 31. Quality of life including fatigue was assessed with the European Organization for Research and Treatment of Cancer Quality of Life Questionnaire (EORTC-QLQ-C30. Neutropenia was defined as neutrophil counts <1,000/µl and assessed at baseline and one day before each CAF cycle.Results: In the descriptive analysis all 15 scores of the EORTC-QLQ-C30 showed better quality of life in the IMS group compared to the control group. In 12 scores the differences were significant (p < 0.02 and nine scores showed a clinically relevant and significant difference of at least 5 points. Neutropenia occurred in 3/30 IMS patients and in 8/31 control patients (p = 0.182.Conclusions: This pilot study showed an improvement of quality of life by treating breast cancer patients with IMS additionally to CAF. CAF-induced neutropenia showed a trend to lower frequency in the IMS group.

  14. [5]Radialene.

    Science.gov (United States)

    Mackay, Emily G; Newton, Christopher G; Toombs-Ruane, Henry; Lindeboom, Erik Jan; Fallon, Thomas; Willis, Anthony C; Paddon-Row, Michael N; Sherburn, Michael S

    2015-11-25

    The [n]radialenes are a unique family of fundamental [n]-membered carbocyclic structures with radiating alkenes, which have attracted significant synthetic and theoretical attention. Whereas [3]-, [4]-, and [6]radialenes have been prepared and studied, all efforts to synthesize the five-membered ring compound have thus far met with failure. Here we describe the first synthesis of the fundamental hydrocarbon [5]radialene, C10H10. Our approach was a departure from previous radialene syntheses in that it utilized a low-temperature decomplexation of a stable organometallic compound, rather than high-temperature elimination or rearrangement. Our strategy was guided by analysis of previous radialene syntheses, which indicated rapid decomposition in oxygen, and ab initio calculations, which revealed an extraordinary susceptibility of [5]radialene to undergo Diels-Alder dimerization/polymerization. The origin of this susceptibility was traced to a small distortion energy associated with the formation of the transition structure geometry from the relaxed reactant monomers and to a narrow HOMO-LUMO gap.

  15. Prospective study of alveolar bone resorption after radiotherapy and chemotherapy. Etude prospective de la resorption osseuse alveolaire apres radiotherapie et chimiotherapie

    Energy Technology Data Exchange (ETDEWEB)

    Libersa, P. (Faculte de Chirurgie Dentaire, 59 - Lille (France)); Prevost, B.; Mirabel, X.; Poissonnier, B.; Demaille, A. (Centre de Lutte Contre le Cancer Oscar-Lambret, 59 - Lille (France)); Laude, M. (Laboratoire de craniologie humaine et comparee, 80 - Amiens (France))

    1993-01-01

    A prospective comparative study of the alveolar bone resorption after teeth extraction was achieved in a series of 79 patients in order to analyze macroscopically the possible consequences of radiotherapy and chemotherapy on the toothless edges. After quarterly coronal and sagittal X-rays for two years, this study enhances quite a similar vertical resorption for the radiation and chemotherapy-treated patients as well as for the witness patients. The alveolar bone resorption progression also appears unaltered by anti cancerous treatments. In both cases, a resorption stabilization can be clearly seen after 6 months according to dental extractions. The vertical alveolar bone resorption is more important in incisor and canin regions. The anti cancerous treatments may not have significant disastrous consequences as fas as available bone amount is concerned, on a post prosthetic restoration.

  16. Spinocerebellar Ataxia Type 5 (SCA5)

    Science.gov (United States)

    NATIONAL ATAXIA FOUNDATION FREQUENTLY ASKED QUESTIONS ABOUT ... Spinocerebellar Ataxia Type 5 (SCA5) What is spinocerebellar ataxia type 5? Spinocerebellar ataxia type 5 is one specific type of ataxia among a group of ...

  17. 5 CFR 2500.5 - Derivative classification.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 3 2010-01-01 2010-01-01 false Derivative classification. 2500.5 Section 2500.5 Administrative Personnel OFFICE OF ADMINISTRATION, EXECUTIVE OFFICE OF THE PRESIDENT INFORMATION SECURITY REGULATION § 2500.5 Derivative classification. The Office of Administration serves only as...

  18. 36 CFR 5.5 - Commercial photography.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 1 2010-07-01 2010-07-01 false Commercial photography. 5.5... COMMERCIAL AND PRIVATE OPERATIONS § 5.5 Commercial photography. (a) Motion pictures, television. Before any... Federal Regulations. (b) Still photography. The taking of photographs of any vehicle, or other articles...

  19. THERM 5 / WINDOW 5 NFRC simulation manual

    Energy Technology Data Exchange (ETDEWEB)

    Mitchell, Robin; Kohler, Christian; Arasteh, Dariush; Carmody, John; Huizenga, Charlie; Curcija, Dragan

    2003-06-01

    This document, the ''THERM 5/WINDOW 5 NFRC Simulation Manual', discusses how to use the THERM and WINDOW programs to model products for NFRC certified simulations and assumes that the user is already familiar with those programs. In order to learn how to use these programs, it is necessary to become familiar with the material in both the ''THERM User's Manual'' and the ''WINDOW User's Manual''. In general, this manual references the User's Manuals rather than repeating the information. If there is a conflict between either of the User Manual and this ''THERM 5/''WINDOW 5 NFRC Simulation Manual'', the ''THERM 5/WINDOW 5 NFRC Simulation Manual'' takes precedence. In addition, if this manual is in conflict with any NFRC standards, the standards take precedence. For example, if samples in this manual do not follow the current taping and testing NFRC standards, the standards not the samples in this manual, take precedence.

  20. Advances in Astroparticle Physics (5/5)

    CERN Document Server

    CERN. Geneva

    2016-01-01

    Astroparticle physics is in an era of rapid progress. New observations challenge theory on several different fronts. We will analyze a few prominent examples, putting special emphasis on the connection with fundamental particle physics. Session 5: Shedding light on dark matter with precision cosmology

  1. HTML5 digital classroom

    CERN Document Server

    Osborn, Jeremy

    2011-01-01

    This training package - complete with full-color book and instructional video - is the easiest way to learn HTML5!HTML5 boasts extensive new features that allow you to create dynamic web pages and present users with amazing multimedia experiences, and this one-of-a-kind training package is your guide to creating websites that wow! HTML5 Digital Classroom provides step-by-step instruction to help you gain the essential HTML5 knowledge you need to master the latest HTML5 specifications. This book-and-video package will have you creating web pages and web applications using HTML5, styling using

  2. LAURA Users Manual: 5.5-64987

    Science.gov (United States)

    Mazaheri, Alireza; Gnoffo, Peter A.; Johnston, Christopher O.; Kleb, William L.

    2013-01-01

    This users manual provides in-depth information concerning installation and execution of LAURA, version 5. LAURA is a structured, multi-block, computational aerothermodynamic simulation code. Version 5 represents a major refactoring of the original Fortran 77 LAURA code toward a modular structure afforded by Fortran 95. The refactoring improved usability and maintain ability by eliminating the requirement for problem dependent recompilations, providing more intuitive distribution of functionality, and simplifying interfaces required for multi-physics coupling. As a result, LAURA now shares gas-physics modules, MPI modules, and other low-level modules with the Fun3D unstructured-grid code. In addition to internal refactoring, several new features and capabilities have been added, e.g., a GNU standard installation process, parallel load balancing, automatic trajectory point sequencing, free-energy minimization, and coupled ablation and flowfield radiation.

  3. 5G Spectrum Sharing

    OpenAIRE

    Nekovee, Maziar; Rudd, Richard

    2017-01-01

    In this paper an overview is given of the current status of 5G industry standards, spectrum allocation and use cases, followed by initial investigations of new opportunities for spectrum sharing in 5G using cognitive radio techniques, considering both licensed and unlicensed scenarios. A particular attention is given to sharing millimeter-wave frequencies, which are of prominent importance for 5G.

  4. concrete5 for developers

    CERN Document Server

    Uzayr, Sufyan bin

    2014-01-01

    Whether you have had some previous experience with concrete5 or are entirely new to it, this book will help you understand all that you need to know in order to get started with concrete5 development. A background in PHP is required; some knowledge of HTML/CSS is needed in order to fully grasp the concepts underlying concrete5 theme development.

  5. Sun Ultra 5

    CERN Multimedia

    1998-01-01

    The Sun Ultra 5 is a 64-bit personal computer based on the UltraSPARC microprocessor line at a low price. The Ultra 5 has been declined in several variants: thus, some models have a processor with less cache memory to further decrease the price of the computer.

  6. Epistemology: 5 Questions

    DEFF Research Database (Denmark)

    Epistemology: 5 Questions is a collection of short interviews based on 5 questions presented to some of the most influential and prominent scholars in epistemology. We hear their views on epistemology with particular emphasis on the intersection between mainstream and formal approaches to the field......; the aim, scope, the future direction of epistemology and how their work fits in these respects...

  7. Main: LEGUMINBOXLEGA5 [PLACE

    Lifescience Database Archive (English)

    Full Text Available LEGUMINBOXLEGA5 S000060 17-May-1998 (last modified) kehi legumin box in legA 5' legumin gene promoter in le...gumin; legumin; pea; tobacco; promoter; seed; pea (Pisum sativum); tobacco (Nicotiana tabacum); Vicia faba; TCCATAGCCATGCAWRCTGMAGAATGTC ...

  8. Spark-hdf5

    Energy Technology Data Exchange (ETDEWEB)

    2016-07-05

    The spark-hdf5 package is an extension to the Apache Spark program to allow native access to HDF5 files. It allows users to query the structured files using SQL-like syntax, and can parallelize large queries across several workers.

  9. 5 Nigerian Veterinary Journal

    African Journals Online (AJOL)

    Staphylococcus species was (5.1%), and. Clostridium ... denon1inatio11s revealed highest counts for. N5 notes (1.59 x ... currency notes to humans through food chain. (Feglo and ..... impairment of body function and hence, death. (Oshim ...

  10. concrete5 Beginner's Guide

    CERN Document Server

    Laubacher, Remo

    2011-01-01

    This book is part of Packt's Beginner's Guide series. You will be guided through the set up of a Concrete5 site with step-by-step practical examples. This book is ideal for developers who would like to build their first site with Concrete5. Some k

  11. Editorial Introduction - Issue 5

    Directory of Open Access Journals (Sweden)

    Emily Lynema

    2008-12-01

    Full Text Available Welcome to the 5th issue of the Code4Lib Journal. We've come a long way in just over a year! We hope you take a few minutes to celebrate those accomplishments with us as you explore issue 5 and read about the innovations, ideas, and experiences shared there. Let's learn from each other.

  12. Xcode 5 developer reference

    CERN Document Server

    Wentk, Richard

    2014-01-01

    Design, code, and build amazing apps with Xcode 5 Thanks to Apple's awesome Xcode development environment, you can create the next big app for Macs, iPhones, iPads, or iPod touches. Xcode 5 contains gigabytes of great stuff to help you develop for both OS X and iOS devices - things like sample code, utilities, companion applications, documentation, and more. And with Xcode 5 Developer Reference, you now have the ultimate step-by-step guide to it all. Immerse yourself in the heady and lucrative world of Apple app development, see how to tame the latest features and functions, and find loads of

  13. National 5 physics

    CERN Document Server

    Baillie, Arthur

    2013-01-01

    A full course textbook for the new National 5 Physics syllabus!. This book is designed to act as a valuable resource for pupils studying National 5. Physics. It provides a core text which adheres closely to the SQA syllabus, with. each section of the book matching a unit of the syllabus, and each chapter. corresponding to a content area. It is an ideal - and comprehensive - teaching and. learning resource for National 5 Physics. In addition to the core text, the book. contains a variety of special features: For Interest, Research Tasks, Activities, Questions, Worked Examples, and Consolidation

  14. HTML5 Canvas

    CERN Document Server

    Fulton, Steve

    2011-01-01

    No matter what platform or tools you use, the HTML5 revolution will soon change the way you build web applications, if it hasn't already. HTML5 is jam-packed with features, and there's a lot to learn. This book gets you started with the Canvas element, perhaps HTML5's most exciting feature. Learn how to build interactive multimedia applications using this element to draw, render text, manipulate images, and create animation. Whether you currently use Flash, Silverlight, or just HTML and JavaScript, you'll quickly pick up the basics. Practical examples show you how to create various games and

  15. concrete5 cookbook

    CERN Document Server

    Strack, David

    2013-01-01

    The Cookbook-style recipes allow you to go both directly to your topic of interest or follow topics throughout a chapter to gain in-depth knowledge. This practical Cookbook will cater to the needs of both intermediate and advanced concrete5 developers.This book is geared towards intermediate to advanced PHP developers who would like to learn more about the concrete5 content management system. Developers already familiar with concrete5 will learn new time-saving tricks and will find the book to be a great reference tool.

  16. 5th Aug 2010

    African Journals Online (AJOL)

    sgopalakrishnan

    2010-08-05

    Aug 5, 2010 ... to produce biocontrol and plant growth-promoting (PGP) substances were further evaluated for PGP ... microorganisms, bacteria and fungi have received ..... compost concentration and proximity to root affect the distribution of.

  17. UJAS 5.pmd

    African Journals Online (AJOL)

    ACSS

    be concluded that the participatory variety selection acts as an entry point into the farming communities ..... 5. -. -. Total. 54. 30. 14. 8. Table 3. Frequency (%) of selection criteria used in the selection process by gender .... The fact that the on-.

  18. Chapter 5. Morphology: Pronouns

    OpenAIRE

    Nesset, Tore

    2015-01-01

    Have you ever wondered whether the so-called reflexive postfix ‑ся is related to the reflexive pronoun себя? Do you know the etymology of сейчас and сегодня? And do you know where the н in the pronoun comes from in prepositional phrases like к нему ‘to him’? Answers to these and many other questions are offered in this chapter, which explores the declension of personal pronouns (sections 5.1 and 5.2), demonstrative pronouns (section 5.3), possessive pronouns (section 5.4), вьсь ‘all’ (section...

  19. DSM5 DEBATE

    National Research Council Canada - National Science Library

    2010-01-01

    If Dr Frances were a thoughtful critic of the DSM5, he could at least have studied the detailed literature reviews and the stated rationales for the changes-easily accessible along with the proposed...

  20. DSM-5 field survey

    DEFF Research Database (Denmark)

    Lochner, Christine; Grant, Jon E; Odlaug, Brian Lawrence

    2012-01-01

    The aim of this multisite field survey was to examine the DSM-IV-TR criteria, proposed DSM-5 diagnostic criteria, as well as a number of possible additional diagnostic criteria, in patients with hair-pulling disorder (HPD, or trichotillomania).......The aim of this multisite field survey was to examine the DSM-IV-TR criteria, proposed DSM-5 diagnostic criteria, as well as a number of possible additional diagnostic criteria, in patients with hair-pulling disorder (HPD, or trichotillomania)....

  1. Unit 5. Thermodynamics (Summary)

    OpenAIRE

    Beléndez Vázquez, Augusto

    2012-01-01

    Summary of the "Unit 5. Thermodynamics" of course "Physical Foundations of Engineering I". Degree in Sound and Image Engineering, in Telecommunications. Polytechnic School of the University of Alicante Resumen del "Tema 5. Termodinámica" de la asignatura "Fundamentos Físicos de la Ingeniería I". Grado en Ingeniería en Sonido e Imagen en Telecomunicaciones. Escuela Politécnica Superior. Universidad de Alicante.

  2. Effects of 5-FU.

    Science.gov (United States)

    Wigmore, Peter M; Mustafa, Sarah; El-Beltagy, Maha; Lyons, Laura; Umka, Jariya; Bennett, Geoff

    2010-01-01

    5-fluorouracil (5-FU) is a chemotherapeutical agent used to treat cancers including breast and colorectal. Working as an antimetabolite to prevent cell proliferation, it primarily inhibits the enzyme thymidylate synthase blocking the thymidine formation required for DNA synthesis. Although having a relatively short half-life (fog" These accounts have come primarily from patients undergoing treatment for breast cancer who report symptoms including confusion and memory impairment, which can last for months to years. Psychometric studies of patients have suffered from confounding variables, which has led to the use of rodent models to assess the cognitive effects of this drug. Researchers have used behavioral and physiological tests including the Morris water maze, novel object location/recognition tests, shock motivated T-maze, sensory gating and conditioning, to investigate the effect of this drug on cognition. The variety of cognitive tests and the difference in dosing and administration of 5-FU has led to varied results, possibly due to the different brain regions associated with each test and the subtlety of the drug's effect, but overall these studies indicates that 5-FU has a negative effect on memory, executive function and sensory gating. 5-FU has also been demonstrated to have biochemical and structural changes on specific regions of the brain. Evidence shows it can induce apoptosis and depress cell proliferation in the neurogenic regions of the adult brain including the sub granular zone (SGZ) within the hippocampus and in oligodendrocyte precursor populations within white matter tracts. Furthermore, investigations indicate levels ofdoublecortin, a marker for newly formed neurons and brain derived neurotrophic factor, a cell survival modulator, are also reduced by 5-FU in the SGZ. Thus, 5-FU appears to have a lasting negative impact on cognition and to affect cellular and biochemical markers in various brain regions. Further work is needed to understand the

  3. Snow White 5 Trench

    Science.gov (United States)

    2008-01-01

    This image was acquired by NASA's Phoenix Mars Lander's Robotic Arm Camera on the 35th Martian day of the mission, or Sol 34 (June 29, 2008), after the May 25, 2008, landing. This image shows the trench informally called 'Snow White 5.' The trench is 4-to-5 centimeters (about 1.5-to-1.9 inches) deep, 24 centimeters (about 9 inches) wide and 33 centimeters (13 inches) long. Snow White 5 is Phoenix's current active digging area after additional trenching, grooming, and scraping by Phoenix's Robotic Arm in the last few sols to trenches informally called Snow White 1, 2, 3, and 4. Near the top center of the image is the Robotic Arm's Thermal and Electrical Conductivity Probe. Snow White 5 is located in a patch of Martian soil near the center of a polygonal surface feature, nicknamed 'Cheshire Cat.' The digging site has been named 'Wonderland.' This image has been enhanced to brighten shaded areas. The Phoenix Mission is led by the University of Arizona, Tucson, on behalf of NASA. Project management of the mission is by NASA's Jet Propulsion Laboratory, Pasadena, Calif. Spacecraft development is by Lockheed Martin Space Systems, Denver.

  4. SIT-5 system development.

    Science.gov (United States)

    Hyman, J., Jr.

    1972-01-01

    A 5-cm structurally integrated ion thruster (SIT-5) has been developed for attitude control and stationkeeping of synchronous satellites. With two-dimension thrust-vectoring grids, a first generation unit has demonstrated a thrust of 0.56 mlb at a beam voltage of 1200 V, total mass efficiency of 64%, and electrical efficiency of 46.8%. Structural integrity is demonstrated with a dielectric-coated grid for shock (30 G), sinusoidal (9 G), and random (19.9 G rms) accelerations. System envelope is 31.8 cm long by 13.9 cm flange bolt circle, with a mass of 8.5 kg, including 6.2 kg mercury propellant. Characteristics of a second-generation unit indicate significant performance gains.

  5. HTML5 Media

    CERN Document Server

    Powers, Shelley

    2011-01-01

    If you're a web developer or designer familiar with CSS and JavaScript, this tightly focused introduction shows you how to add HTML5 media elements to your web pages, and how to provide custom controls for letting web visitors interact with the content. You'll also learn how to provide subtitles and captions, using file formats that work in browsers now. This book includes code samples and downloadable examples to help you take full advantage of audio and video in your web pages. Ensure your audio or video works in all browsers that support HTML5 media elementsLearn about widely supported me

  6. DSM-5 field survey

    DEFF Research Database (Denmark)

    Lochner, Christine; Grant, Jon E; Odlaug, Brian Lawrence

    2012-01-01

    Pathologic skin picking (skin picking disorder [SPD]) is a prevalent and disabling condition, which has received increasing study. It is timely to consider including SPD in DSM-5. The aim of this field survey was to investigate possible diagnostic criteria for SPD.......Pathologic skin picking (skin picking disorder [SPD]) is a prevalent and disabling condition, which has received increasing study. It is timely to consider including SPD in DSM-5. The aim of this field survey was to investigate possible diagnostic criteria for SPD....

  7. Mathematics year 5 answers

    CERN Document Server

    Alexander, Serena; Poggo, Tammy

    2014-01-01

    Features the complete set of answers to the exercises in Mathematics Year 5, to save you time marking work and enable you to identify areas requiring further attention. The book includes diagrams and workings where necessary, to ensure pupils understand how to present their answers. Also available from Galore Park www.galorepark.co.uk :. - Mathematics Year 5. - Mathematics Year 6. - 11+ Maths Practice Exercises. - 11+ Maths Revision Guide. - 10-Minute Maths Tests Workbook Age 8-10. - 10-Minute Maths Tests Workbook Age 9-11. - Mental Arithmetic Workbook Age 8-10. - Mental Arithmetic Workbook Ag

  8. 5-Bromophthalazine hemihydrate

    Directory of Open Access Journals (Sweden)

    Mingjian Cai

    2012-08-01

    Full Text Available The title compound, C8H5BrN2·0.5H2O, is a phthalazine derivative synthesized from 3-bromobenzene-1,2-dicarbaldehyde and hydrazine. The molecule is essentially planar, the deviation from the mean plane of the phthalazine ring being 0.015 (3 Å. The O atom of the solvent water molecule is situated on a twofold rotation axis. In the crystal, O—H...N hydrogen bonds and short N...Br [2.980 (3 Å] contacts lead to the formation of a two-dimensional network parallel to (101.

  9. RADTRAN 5 user guide.

    Energy Technology Data Exchange (ETDEWEB)

    Kanipe, Frances L.; Neuhauser, Karen Sieglinde

    2003-07-01

    This User Guide for the RADTRAN 5 computer code for transportation risk analysis describes basic risk concepts and provides the user with step-by-step directions for creating input files by means of either the RADDOG input file generator software or a text editor. It also contains information on how to interpret RADTRAN 5 output, how to obtain and use several types of important input data, and how to select appropriate analysis methods. Appendices include a glossary of terms, a listing of error messages, data-plotting information, images of RADDOG screens, and a table of all data in the internal radionuclide library.

  10. Rendering HTML5 illustration

    CERN Document Server

    David, Matthew

    2010-01-01

    Scalable Vector Graphics (SVG) and CANVAS are two new tools introduced in HTML5 that you can use to add illustration and interactive animation to your Web pages. Understand why there are two different formats, how you can use them, and where they can be used today. HTML 5, is the first major update to the core language of the Web in over a decade The focus of this book is on innovations that most directly effect Web site design and multimedia integration The companion Web site features working demonstrations and tutorial media for hands-on p

  11. HTML5 Canvas Cookbook

    CERN Document Server

    Rowell, Eric

    2011-01-01

    Written in cookbook style, this book offers a wide array of techniques for building HTML5 Canvas applications. Each recipe contains step-by-step instructions followed by analysis of what was done in each task and other useful information. The book is designed so that you can read it chapter by chapter, or you can look at the list of recipes and refer to them in no particular order. This book is geared towards web developers who are familiar with HTML and JavaScript. It is written for both beginners and seasoned HTML5 developers with a good working knowledge of JavaScript.

  12. Eesti - Soome turismikaubamaja -5%

    Index Scriptorium Estoniae

    2006-01-01

    Turismikonverentsil "Eesti - Soome turismikaubamaja -5%" analüüsiti Eesti ja Soome vahelisi turismivõimalusi ning seati sihte edaspidiseks. Ülevaade Reilika Lelovi (Turismimaailm OÜ), Pauli Santala (Finnish Consulting Group), Tarja Vaakanaineni (Tallink Finland Vice Managing), Ain Hinsbergi (Turismimaailm OÜ), Jari Auraneni (Go Finland Oy) ja Mikko Saviko (The Baltic Guide) ettekannetest

  13. Fine 5 lavastab Venemaal

    Index Scriptorium Estoniae

    2013-01-01

    Tantsuteatru Fine 5 koreograafid Tiina Ollesk ja Rene Nõmmik toovad Jekaterinburgis välja lavastuse "... and Red", esitajaks Venemaa nimekas nüüdistantsutrupp Provintsialnõje Tantsõ. Lavastuses kõlab Taavo Remmeli kontrabassiimprovisatsioon "12.12.2006"

  14. Qt 5 blueprints

    CERN Document Server

    Huang, Symeon

    2015-01-01

    If you are a programmer looking for a truly cross-platform GUI framework to help you save your time by side-stepping the incompatibility between different platforms and building applications using Qt 5 for multiple targets, then this book is most certainly intended for you. It is assumed that you have a basic programming experience of C++ and fundamental knowledge about Qt.

  15. 20.5.Epilepsy

    Institute of Scientific and Technical Information of China (English)

    1992-01-01

    920184 Clinical analysis of 25 cases ofchronic alcoholic intoxication with epilepsy.PANG Zhixing (庞治兴),et al.Dept Psychol,1stTeaching Hosp.Norman Bethune Med Univ,130021 Chin J Nerv & Ment Dis 1991; 17 (5):289-291.The clinical manifestations of 25 cases (male)

  16. 5G wireless technologies

    CERN Document Server

    Alexiou, Angeliki

    2017-01-01

    Mobile data traffic is expected to exceed traffic from wired devices in the next couple of years. This book presents a roadmap of 5G, from advanced radio technologies to innovative resource management approaches and novel network architectures and system concepts.

  17. Game Theory: 5 Questions

    DEFF Research Database (Denmark)

    Hendricks, Vincent F.

    Game Theory is a collection of short interviews based on 5 questions presented to some of the most influential and prominent scholars in game theory. We hear their views on game theory, its aim, scope, use, the future direction of game theory and how their work fits in these respects....

  18. Reference: LEGUMINBOXLEGA5 [PLACE

    Lifescience Database Archive (English)

    Full Text Available LEGUMINBOXLEGA5 Baumlein H, Wobus U, Pustell J, Kafatos FC The legumin gene family:... structure of a B type gene of Vicia faba and a possible legumin gene specific regulatory element. Nucleic Acids Res 14:2707-2720 (1986) PubMed: 3960730; GenBank: X03677; ...

  19. Reference: LEGUMINBOXLEGA5 [PLACE

    Lifescience Database Archive (English)

    Full Text Available LEGUMINBOXLEGA5 Shirsat A, Wilford N, Croy R, Boulter D Sequences responsible for t...he tissue specific promoter activity of a pea legumin gene in tobacco. Mol Gen Genet 215:326-331 (1989) PubMed: 2710102; ...

  20. Eesti - Soome turismikaubamaja -5%

    Index Scriptorium Estoniae

    2006-01-01

    Turismikonverentsil "Eesti - Soome turismikaubamaja -5%" analüüsiti Eesti ja Soome vahelisi turismivõimalusi ning seati sihte edaspidiseks. Ülevaade Reilika Lelovi (Turismimaailm OÜ), Pauli Santala (Finnish Consulting Group), Tarja Vaakanaineni (Tallink Finland Vice Managing), Ain Hinsbergi (Turismimaailm OÜ), Jari Auraneni (Go Finland Oy) ja Mikko Saviko (The Baltic Guide) ettekannetest

  1. Imeilus Fine 5

    Index Scriptorium Estoniae

    2017-01-01

    Vaba Lava teatrikeskuse laval esineb Fine 5 oma lavastusega "Imeilus". Tiina Ollesk ja Renee Nõmmik, tantsulavastuse autorid on koreograafid, õppejõud, lavastajad ja kogemustega tantsijad. 29. jaanuaril korraldavad Tiina Ollesk ja Renee Nõmmik Tallinna Ülikoolis kaasaegse liikumismõtlemise töötoa, mis on pühendatud lavastusele "Imeilus"

  2. Game Theory: 5 Questions

    DEFF Research Database (Denmark)

    Hendricks, Vincent F.

    Game Theory is a collection of short interviews based on 5 questions presented to some of the most influential and prominent scholars in game theory. We hear their views on game theory, its aim, scope, use, the future direction of game theory and how their work fits in these respects....

  3. Mastering HTML5 forms

    CERN Document Server

    Gupta, Gaurav

    2013-01-01

    This tutorial will show you how to create stylish forms, not only visually appealing, but interactive and customized, in order to gather valuable user inputs and information.Enhance your skills in building responsive and dynamic web forms using HTML5, CSS3, and related technologies. All you need is a basic understanding of HTML and PHP.

  4. Wave Star C5

    DEFF Research Database (Denmark)

    Kramer, Morten; Kristensen, Tom Sten

    Design pile loads in this document are based on the Morison equation. In Chapter 3 and 4 the background for the design loads provided in Chapter 5 are given. In the remaining chapters from Chapter 6 and onward discussions and explanations of the results are given. A historical list of activities ...

  5. Fine 5 lavastab Venemaal

    Index Scriptorium Estoniae

    2013-01-01

    Tantsuteatru Fine 5 koreograafid Tiina Ollesk ja Rene Nõmmik toovad Jekaterinburgis välja lavastuse "... and Red", esitajaks Venemaa nimekas nüüdistantsutrupp Provintsialnõje Tantsõ. Lavastuses kõlab Taavo Remmeli kontrabassiimprovisatsioon "12.12.2006"

  6. Audi S5

    Institute of Scientific and Technical Information of China (English)

    陈庆

    2007-01-01

    奥迪在国内一向以行政车的面貌出现,但是并不表示其缺乏运动系列。借此次媒体激情试驾会之机,奥迪展示了S3、S5、S8等性能车系,并且还有RS4、R8、IT等随行参照,阵容可谓豪华。而其中最让我感兴趣的,无疑就是这部街道悍将S5

  7. Big Bang 5

    CERN Document Server

    Apolin, Martin

    2007-01-01

    Physik soll verständlich sein und Spaß machen! Deshalb beginnt jedes Kapitel in Big Bang mit einem motivierenden Überblick und Fragestellungen und geht dann von den Grundlagen zu den Anwendungen, vom Einfachen zum Komplizierten. Dabei bleibt die Sprache einfach, alltagsorientiert und belletristisch. Der Band 5 RG behandelt die Grundlagen (Maßsystem, Größenordnungen) und die Mechanik (Translation, Rotation, Kraft, Erhaltungssätze).

  8. TANK 5 SAMPLING

    Energy Technology Data Exchange (ETDEWEB)

    Vrettos, N; William Cheng, W; Thomas Nance, T

    2007-11-26

    Tank 5 at the Savannah River Site has been used to store high level waste and is currently undergoing waste removal processes in preparation for tank closure. Samples were taken from two locations to determine the contents in support of Documented Safety Analysis (DSA) development for chemical cleaning. These samples were obtained through the use of the Drop Core Sampler and the Snowbank Sampler developed by the Engineered Equipment & Systems (EES) group of the Savannah River National Laboratory (SRNL).

  9. At UA5

    CERN Multimedia

    1980-01-01

    One of the two 6 m long streamer chambers for experiment UA5. The absorber plates used for neutrak particle conversion are visible. On the left and right sides of the frame can be seen the fiducial marks and the optical pattern used for adjusting the optics and checking the spatial esolution. The wires on top constitute a calibration grid for spatial reconstruction. See Annual Report 1979 p. 80, Fig. 12, and Annual Report 1980 p. 70, Fig. 6.

  10. 5. Faye.pmd

    African Journals Online (AJOL)

    sulaiman.adebowale

    5 sept. 2007 ... truire sans cesse, utilise le genre comme outil d'analyse. Rappelons ...... Tous les être humains, dès la naissance, sont soumis à l'apprentissage d'une infinité de .... Une idée majeure préside à la naissance du problème économique : celle de ..... Le genre dans les stratégies d'auto-insertion des femmes.

  11. TANK 5 SAMPLING

    Energy Technology Data Exchange (ETDEWEB)

    Vrettos, N; William Cheng, W; Thomas Nance, T

    2007-11-26

    Tank 5 at the Savannah River Site has been used to store high level waste and is currently undergoing waste removal processes in preparation for tank closure. Samples were taken from two locations to determine the contents in support of Documented Safety Analysis (DSA) development for chemical cleaning. These samples were obtained through the use of the Drop Core Sampler and the Snowbank Sampler developed by the Engineered Equipment & Systems (EES) group of the Savannah River National Laboratory (SRNL).

  12. Spring 5 & reactive streams

    CERN Document Server

    CERN. Geneva; Clozel, Brian

    2017-01-01

    Spring is a framework widely used by the world-wide Java community, and it is also extensively used at CERN. The accelerator control system is constituted of 10 million lines of Java code, spread across more than 1000 projects (jars) developed by 160 software engineers. Around half of this (all server-side Java code) is based on the Spring framework. Warning: the speakers will assume that people attending the seminar are familiar with Java and Spring’s basic concepts. Spring 5.0 and Spring Boot 2.0 updates (45 min) This talk will cover the big ticket items in the 5.0 release of Spring (including Kotlin support, @Nullable and JDK9) and provide an update on Spring Boot 2.0, which is scheduled for the end of the year. Reactive Spring (1h) Spring Framework 5.0 has been released - and it now supports reactive applications in the Spring ecosystem. During this presentation, we'll talk about the reactive foundations of Spring Framework with the Reactor project and the reactive streams specification. We'll al...

  13. Social Epistemology: 5 Questions

    DEFF Research Database (Denmark)

    Social Epistemology: 5 Questions is a collection of interviews with some of the world’s most influential scholars working on social epistemology from a range of disciplinary perspectives. We hear their views on social epistemology; its aim, scope, use, broader intellectual environment, future...... direction, and how the work of the interviewees fits in these respects. Interviews with David Bloor, Cristina Bicchieri, Richard Bradley, Lorraine Code, Hans van Ditmarsch, Miranda Fricker, Steve Fuller, Sanford Goldberg, Alvin Goldman, Philip Kitcher, Martin Kusch, Jennifer Lackey, Helen E. Longino, Philip...

  14. SU(5) & A4

    CERN Document Server

    Urbano, Alfredo

    2009-01-01

    The introduction of a Flavour Symmetry can represent an interesting way in which one can try to find an answer to some intriguing problems in Flavour Physics, like the hierarchy between the fermion masses or the particular values of mixing angles. In the meantime the necessity to set this symmetry in a realistic context grows up; this context should be able to enlarge our incomplete knowledge of fundamental interactions as described in the framework of the Standard Model. Following this direction a merging between A(4) and SU(5) can be possible.

  15. HTML5 Geolocation

    CERN Document Server

    Holdener, Anthony

    2011-01-01

    Truly revolutionary: now you can write geolocation applications directly in the browser, rather than develop native apps for particular devices. This concise book demonstrates the W3C Geolocation API in action, with code and examples to help you build HTML5 apps using the "write once, deploy everywhere" model. Along the way, you get a crash course in geolocation, browser support, and ways to integrate the API with common geo tools like Google Maps. Learn how geo information is gathered from different sources, depending on the deviceDiscover how coordinate systems work, including geodetic syst

  16. ngc 6882/5

    Directory of Open Access Journals (Sweden)

    J. H. Peña

    2008-01-01

    Full Text Available Se presenta fotometría fotoeléctrica uvby−β del cúmulo abierto NGC 6882/5. Mediante la ya probada técnica fotoeléctrica de determinación de distancias, encontramos que existen al menos dos acumulaciones diferenciables de estrellas en la dirección del cúmulo. Se lleva a cabo una breve discusión sobre la naturaleza de las estrellas previamente determinadas como variables.

  17. Ajax with PHP 5

    CERN Document Server

    Curioso, Andrew

    2007-01-01

    "Ajax with PHP 5" is a detailed overviewof how to use PHP technologies to createinteractive, fault-tolerant, and responsiveweb applications. This Short Cut first concentrates on thefundamentals of Ajax. Then it coversserving (or providing) content formattedin both XML and JSON. Finally, we completely immerse ourselvesin the Ajax world and write twoPHP applications that use each markuplanguage on both the client and server. We encourage you to use the classes andexamples given to produce your own richWeb 2.0-style applications.

  18. GT赛车5

    Institute of Scientific and Technical Information of China (English)

    雷电

    2009-01-01

    参加这场名为“Gran Turismo”的庞大赛事真的很辛苦,这是第五届了,然而我作为一个拥有超越常人的驾驶经验的专业车手,仍旧举步为艰。赛程所跨越的时间实在是太长了,宣传手册早在5年前就派发到世界各个著名车队的办事处;

  19. National 5 maths

    CERN Document Server

    Alcorn, David

    2013-01-01

    Teach lessons that suit the individual needs of your students with this SQA endorsed and flexibly structured resource that provides a suggested approach through all three units. This 'without answers' version textbook completely covers the latest National 5 syllabus. Each chapter includes summaries of key points and worked examples with explanatory notes showing how skills are applied. Section Reviews presented in non-calculator and calculator formats provide students with the opportunity to consolidate skills acquired over a number of chapters. There are plenty of exercises and invaluable exa

  20. /sup 5/He radioactivity

    Energy Technology Data Exchange (ETDEWEB)

    Poenaru, D.N.; Ivascu, M. (Institute for Physics and Nuclear Engineering, Bucharest (Romania))

    1984-07-01

    The disintegration of a metastable nuclear state by emission of a light particle can be considered to be a very asymmetric fission process. An approximation of the potential barrier in the overlapping region of the two fragments leads to an analytic relationship for the life-time, allowing us to handle a large number of cases to search for new kinds of radioactivities. In this way, it is predicted that some nuclei with Z=83-92, N=127-137 and 97-105, 145-157 are able to decay spontaneously by emission of /sup 5/He particles. A tentative optimistic estimation leads to the result that only 15 radionuclides should have partial life-times in the range 10/sup 14/-10/sup 38/ years; all others, except some superheavies, are longer lived. The best candidate is /sup 213/Po for which the daughter is a double magic nucleus. Smaller life-times, with a better chance to be experimentally confirmed have some ..beta..-delayed /sup 5/He emitters, as for example /sup 155/Yb, /sup 175/Pt, /sup 209 -217/Ra, /sup 9 -11/Be, /sup 13 -14/B, /sup 13 -17/C and /sup 19 -21/O.

  1. Delineamentos (1/5(5³ Desings (1/5(5³

    Directory of Open Access Journals (Sweden)

    Armando Conagin

    1977-01-01

    Full Text Available É descrita a análise estatística de um grupo especial de fatoriais fracionados (1/5 (5³, utilizando os modelos quadráticos e com raiz quadrada; tal estudo foi desenvolvido pelos autores visando principalmente sua aplicação em experimentos agronômicos com fertilizantes. Estes delineamentos fatoriais se originaram da superposição de três dos quatro quadrados latinos ortogonais 5x5, sendo obtidos três conjuntos básicos, designados por Tipo I, II, III, Tipo I, II, IV e Tipo I, III, IV; o último deles é apresentado: 111 245 324 453 532 222 351 435 514 143 333 412 541 125 254 444 523 152 231 315 555 134 213 342 42 O modelo quadrático com dez parâmetros é dado por: Yijk = b0x0 +b li x li + b lj x lj + b lk x lk + b2i x2i + b2j x2j + b2k x2k + + b lilj x lilj + b lilk x lilk + b ljlk x ljlk + x ijk em que x lm = a1 + Xm, x2m = a2 + g2Xm + X²m , com m= i,j,k; os níveis em cada fator variam de 1 a 5; com as condições de ortogonalidade Sx lm=0, Sx2m=0, Sx lm x2m=0, resulta Sxlm=-3+Xm e Sx2m= 7-6Xm+X²m, de onde se tem: x l1=-2; x l2=-1; x l3=0; x l4=1; x l5=2; x21=2; x22=-1; x23=-2; x24=-1; x25=2, para cada índice i,j,k. O coeficiente linear para cada fator pode ser estimado independentemente; os coeficientes quadráticos e das interações linear x linear são estimados a partir de uma matriz simétrica completa 6x6. Consequentemente, na análise da variância as somas de quadrados dos componentes lineares são independentes, mas as somas de quadrados dos componentes quadráticos e das interações são confundidas e, por isso, testadas conjuntamente. Se a contribuição de um fator e sua interação com os outros são negligíveis, podem ser calculadas estimativas independentes dos coeficientes linear e quadrático dos outros dois fatores e sua interação correspondente. Por outro lado, se todos os fatores são importantes mas suas interações são negligíveis, os coeficientes lineares e quadráticos de cada fator são estimados

  2. Constitution, 5 May 1989.

    Science.gov (United States)

    1989-01-01

    This document contains provisions of Cambodia's Constitution of May 5, 1989. Article 7 gives men and women equal rights in marriage and the family, calls for monogamous marriages, and affords social protection to mothers and children. Article 8 guides parent-child relationships. The 14th article defines state property, and the 15th gives citizens full rights to own, use, and inherit land. The use of agricultural and forested land can only be changed with permission. Article 22 assigns educational responsibilities to the state, including free elementary education and a gradual expansion of higher education. Adult literacy classes are also promoted. Article 26 guarantees free medical consultations, and article 27 gives women a 90-day paid maternity leave. Breast-feeding women are also given special privileges. Article 33 guarantees the right to pay equity and to social security benefits. Article 36 grants the freedom to travel, the inviolability of homes, and privacy in correspondence of all types.

  3. 5-Amino-1-naphthol

    Directory of Open Access Journals (Sweden)

    Agnieszka Czapik

    2009-11-01

    Full Text Available In the title compound, C10H9NO, the amino and the hydroxy groups act both as a single donor and a single acceptor in hydrogen bonding. In the crystal, molecules are connected via chains of intermolecular ...N—H...O—H... interactions, forming a two-dimensional polymeric structure resembling the hydrogen-bonded molecular assembly found in the crystal structure of naphthalene-1,5-diol. Within this layer, molecules related by a translation along the a axis are arranged into slipped stacks via π–π stacking interactions [interplanar distance = 3.450 (4 Å]. The amino N atom shows sp3 hybridization and the two attached H atoms are located on the same side of the aromatic ring.

  4. Renormalizable SU(5) Unification

    CERN Document Server

    Perez, Pavel Fileviez

    2016-01-01

    We propose a simple renormalizable grand unified theory based on the SU(5) gauge symmetry where the neutrino masses are generated at the quantum level through the Zee mechanism. In this model the same Higgs needed to correct the mass relation between charged leptons and down-type quarks plays a crucial role to generate neutrino masses. We show that in this model one can satisfy the constrains coming from the unification of gauge couplings and the mechanism for neutrino masses is discussed in detail. We find an interesting relation between the neutrino masses and the charged fermion masses. The predictions for proton decay are discussed in order to understand the testability at current and future experiments such as Hyper-Kamiokande. This simple theory predicts a light colored octet which could give rise to exotic signatures at the LHC.

  5. The 5C Model

    DEFF Research Database (Denmark)

    Friis, Silje Alberthe Kamille; Gelting, Anne Katrine Gøtzsche

    2014-01-01

    , and sketching. As teachers of philosophy of science and design methods at a design school, we are invested in the following question: How might we expand design students’ understanding of the many ways in which knowledge is produced during a design process? How can we help students actively experience......During a design process, designers produce knowledge in many ways. An ever-expanding field, design continuously includes new approaches from other fields such as anthropology, business, and innovation, which are implemented side by side with traditional design approaches e.g. prototyping...... the approaches and reach a new level of conscious action when designing? Informed by theories of design thinking, knowledge production, and learning, we have developed a model, the 5C model, accompanied by 62 method cards. Examples of how the model has been applied in an educational setting are provided...

  6. Extended helical tomo-therapy and concomitant chemotherapy for an uterine cervix carcinoma: dosimetry parameters and hematological toxicity; Tomotherapie helicoidale etendue et chimiotherapie concomitante pour un cancer du col de l'uterus: parametres dosimetriques et toxicite hematologique

    Energy Technology Data Exchange (ETDEWEB)

    Haddad, H.; Thomas, L.; Belhomme, S.; Chemin, A.; Caron, J.; Dejean, C.; Kantor, G.; Richaud, P. [Institut Bergonie, Dept. de Radiotherapie, 33 - Bordeaux (France); Floquet, A.; Guyon, F. [Institut Bergonie, Dept. de Chirurgie, 33 - Bordeaux (France)

    2009-10-15

    the extended tomo-therapy associated to concomitant chemotherapy is feasible and allows a dose escalation at the ganglions level. It is necessary to continue to study the dosimetry parameters at the hematopoietic marrow level that are predictive for a hematological toxicity. (N.C.)

  7. Contribution to the study of markers in lungs carcinogenesis and analysis of factors predicting the benefit of chemotherapy; Contribution a l'etude de marqueurs de la carcinogenese bronchique et analyse de facteurs predictifs du benefice de la chimiotherapie

    Energy Technology Data Exchange (ETDEWEB)

    Olaussen, K.A

    2006-06-15

    A better definition of early bio markers in lung carcinogenesis should enhance the development of molecular means to perform screening, diagnostic, and chemo-prevention of patients at high risk of lung cancer. We studied epigenetic deregulation of multiple promoters (p16(INK4a), HOX A9, MAGE A 1 et MAGE B2) in sputum samples from smokers at high risk and from patients with non-small cell lung cancer (N.S.C.L.C.). This molecular test, based on easily accessible sample,s can be modulated according to the aims of the investigator (e.g. screening or confirmation of diagnosis). Secondly, we have studied two candidate proteins as predictive markers of the benefit of adjuvant chemotherapy in patients with resected lung cancer. The multivariate analysis shows that tumor expression of the catalytic sub-unit of telomerase is not able to predict survival in patients included in the lAL T study' of adjuvant chemotherapy. However, tumor expression of the DNA repair protein ERCC1 identifies a sub-group of patients (ERCC1 negative) whose chances of survival are increased by 35% by means of cisplatin-based adjuvant chemotherapy. Further, tumor ERCC1 expression has a positive prognostic value in the non-treated control group. The need for a deeper understanding in cancerology of the physiological role of the ERCC1 endonuclease is discussed in this thesis. (author)

  8. Postoperative radiotherapy after laser surgery with or without chemotherapy in head and neck evolved cancers; Radiotherapie postoperatoire apres chirurgie laser avec ou sans chimiotherapie dans les cancers evolues de la tete et du cou

    Energy Technology Data Exchange (ETDEWEB)

    Ryll, L.; Pradier, O. [Centre Hospitalier Universitaire Morvan, Dept. de Cancerologie, Brest (France); Nitsche, M.; Christiansen, H.; Hess, C. [Universitatsklinikum, Dept. de Cancerologie, Goettingen (Germany)

    2007-11-15

    We compared concurrent combination chemoradiotherapy and adjuvant radiotherapy after laser surgery in patients with stage 3/4 non metastatic squamous cell head and neck cancer. Combination chemotherapy and concurrent irradiation after laser surgery was not superior to surgery and postoperative radiotherapy for resectable advanced squamous cell head and neck cancer. However, the collective is small, and the follow-up to short to conclude. (authors)

  9. The DNA repair complex DNA-PK, a pharmacological target in cancer chemotherapy and radiotherapy; Le complexe de reparation de l'ADN DNA-PK, une cible pharmacologique en chimiotherapie et radiotherapie anticancereuse

    Energy Technology Data Exchange (ETDEWEB)

    Salles, B.; Calsou, P.; Frit, P.; Muller, C. [Institut de Pharmacologie et Biologie Structurale (IPBS), UMR CNRS 5089, 31 - Toulouse (France)

    2006-05-15

    A line of investigation in the search for sensitizing tumor cells to chemotherapy or radiotherapy relies on the selection of DNA repair inhibitors. In the area of DNA repair mechanisms, DNA-dependent protein kinase (DNA-PK) represents a key complex. Indeed DNA-PK is involved in the non-homologous end joining (NHEJ) process that corresponds to the major activity responsible for cell survival after ionizing radiation or chemotherapeutic treatment producing DNA double strand breaks. DNA-PK belongs to the PI3-K related kinase family and specific inhibitors have been recently selected and evaluated as radio- and chemo-sensitizers. These drugs, along with other ways to inhibit the DSBs repair process, are presented and discussed. (authors)

  10. Nasopharyngeal angio-fibroma with intracranial extension: Situating the chemotherapy-radiotherapy association; L'angiofibrome nasopharyngien avec extension intracranienne: place de l'association chimiotherapie-radiotherapie

    Energy Technology Data Exchange (ETDEWEB)

    Belcadhia, M.; Mania, R.; Harzallah, M.; Bouzouita, K. [CHU Farhat-Hached de Sousse, Service d' ORL et de Chirurgie Cervicofaciale, Sousse (Tunisia); Bouaouina, N. [CHU Farhat-Hached de Sousse, Service de Radiotherapie, Sousse (Tunisia)

    2008-09-15

    Nasopharyngeal angio-fibroma is a locally aggressive, although histologically benign, vascular neoplasm. This neoplasm accounts for 0.05% of head and neck tumours and affects almost exclusively male adolescents. Surgery is considered as the primary treatment of nasopharyngeal angio-fibroma. Other treatment modalities such as radiotherapy and chemotherapy are still recommended for intracranial extension involving the cavernous sinus or the internal carotid artery. We report a rare case of nasopharyngeal angio-fibroma, further complicated with a Kennedy syndrome in a 34 year-old women. The treatment consisted in a chemotherapy (adriamycin, decarbazine) followed by radiotherapy. We discuss the relevance and outcome of the association chemotherapy-radiotherapy in the treatment of nasopharyngeal angio-fibroma with a consistent intracranial extension (stage III B of Arch Otolaryngol Head Neck Surg 122 (2003) 122-129). (authors)

  11. Verification and Validation of RADTRAN 5.5.

    Energy Technology Data Exchange (ETDEWEB)

    Osborn, Douglas.; Weiner, Ruth F.; Mills, George Scott; Hamp, Steve C.

    2005-02-01

    This document contains a description of the verification and validation process used for the RADTRAN 5.5 code. The verification and validation process ensured the proper calculational models and mathematical and numerical methods were used in the RADTRAN 5.5 code for the determination of risk and consequence assessments. The differences between RADTRAN 5 and RADTRAN 5.5 are the addition of tables, an expanded isotope library, and the additional User-Defined meteorological option for accident dispersion. 3

  12. 5-HT system and cognition.

    Science.gov (United States)

    Meneses, A

    1999-12-01

    The study of 5-hydroxytryptamine (5-HT) system has benefited from the identification, classification and cloning of multiple 5-HT receptors (5-HT1 to 5-HT7). Growing evidence suggests that 5-HT is important in learning and memory and all its receptors might be implicated in this. Actually, 5-HT pathways, 5-HT reuptake site/transporter complex and 5-HT receptors show regional distribution in brain areas implicated in learning and memory. Likewise, the stimulation or blockade of presynaptic 5-HT1A, 5-HT1B, 5-HT(2A/2C) and 5-HT3 receptors, postsynaptic 5-HT(2B/2C) and 5-HT4 receptors and 5-HT uptake/transporter sites modulate these processes. Available evidence strongly suggests that the 5-HT system may be important in normal function, the treatment and/or pathogenesis of cognitive disorders. Further investigation will help to specify the 5-HT system nature involvement in cognitive processes, pharmacotherapies, their mechanisms and action sites and to determine under which conditions they could operate. In this regard, it is probable that selective drugs with agonists, neutral antagonist, agonists or inverse agonist properties for 5-HT1A, 5-HT(1B/1D), 5-HT(2A/2B/2C), 5-HT4 and 5-HT7 receptors could constitute a new therapeutic opportunity for learning and memory alterations.

  13. LNA 5'-phosphoramidites for 5'→3'-oligonucleotide synthesis

    DEFF Research Database (Denmark)

    Madsen, Andreas Stahl; Kumar, Santhosh T.; Wengel, Jesper

    2010-01-01

    Hereby we report an efficient synthesis of LNA thymine and LNA 5-methylcytosine 5′-phosphoramidites, allowing incorporation of LNA thymine and LNA 5-methylcytosine into oligonucleotides synthesized in the 5′→3′ direction. Key steps include regioselective enzymatic benzoylation of the 5′-hydroxy...

  14. Constitution, 5 October 1988.

    Science.gov (United States)

    1989-01-01

    This document contains major provisions of the constitution adopted by Brazil on 5 October 1988. This constitution seeks to promote the welfare of all citizens without discrimination. The equality of all citizens is guaranteed, and the equal rights of women are specifically mentioned. Property rights are also guaranteed and defined. Female inmates are granted the right to remain with their children while breast feeding. Workers are guaranteed a minimum wage, a family allowance for dependents, maternity/paternity leave, specific incentives to protect the labor market for women, retirement benefits, free day care for preschool-age children, pay equity, and equal rights between tenured and sporadically employed workers. Agrarian reform provisions are given, including the authority to expropriate land. Social and economic policies to promote health are called for, and public health services are to be decentralized, to be integrated, and to foster community participation. Pension plan and social assistance provisions are outlined as are duties of the state in regard to education. The amount of money to be dedicated to education is set out, and a national educational plan is called for to achieve such goals as the eradication of illiteracy, the universalization of school attendance, the improvement of instruction, and the provision of vocational training. Specific measures are set out to protect and preserve the environment. Family policy deals with issues of marriage, the definition of a family, divorce, the right to family planning services, and the deterrence of domestic violence. Social protection provisions cover mothers and children, handicapped persons, and protection of minors. Finally, the customs and rights of Indians are protected, with special provisions given to protect land tenure and to protect the rights of Indians in water resource development and prospecting and mining activities.

  15. Catatonia in DSM-5.

    Science.gov (United States)

    Tandon, Rajiv; Heckers, Stephan; Bustillo, Juan; Barch, Deanna M; Gaebel, Wolfgang; Gur, Raquel E; Malaspina, Dolores; Owen, Michael J; Schultz, Susan; Tsuang, Ming; van Os, Jim; Carpenter, William

    2013-10-01

    Although catatonia has historically been associated with schizophrenia and is listed as a subtype of the disorder, it can occur in patients with a primary mood disorder and in association with neurological diseases and other general medical conditions. Consequently, catatonia secondary to a general medical condition was included as a new condition and catatonia was added as an episode specifier of major mood disorders in DSM-IV. Different sets of criteria are utilized to diagnose catatonia in schizophrenia and primary mood disorders versus neurological/medical conditions in DSM-IV, however, and catatonia is a codable subtype of schizophrenia but a specifier for major mood disorders without coding. In part because of this discrepant treatment across the DSM-IV manual, catatonia is frequently not recognized by clinicians. Additionally, catatonia is known to occur in several conditions other than schizophrenia, major mood disorders, or secondary to a general medical condition. Four changes are therefore made in the treatment of catatonia in DSM-5. A single set of criteria will be utilized to diagnose catatonia across the diagnostic manual and catatonia will be a specifier for both schizophrenia and major mood disorders. Additionally, catatonia will also be a specifier for other psychotic disorders, including schizoaffective disorder, schizophreniform disorder, brief psychotic disorder, and substance-induced psychotic disorder. A new residual category of catatonia not otherwise specified will be added to allow for the rapid diagnosis and specific treatment of catatonia in severely ill patients for whom the underlying diagnosis is not immediately available. These changes should improve the consistent recognition of catatonia across the range of psychiatric disorders and facilitate its specific treatment.

  16. Nanomedical science and laser-driven particle acceleration: promising approaches in the prethermal regime

    Science.gov (United States)

    Gauduel, Y. A.

    2017-05-01

    A major challenge of spatio-temporal radiation biomedicine concerns the understanding of biophysical events triggered by an initial energy deposition inside confined ionization tracks. This contribution deals with an interdisciplinary approach that concerns cutting-edge advances in real-time radiation events, considering the potentialities of innovating strategies based on ultrafast laser science, from femtosecond photon sources to advanced techniques of ultrafast TW laser-plasma accelerator. Recent advances of powerful TW laser sources ( 1019 W cm-2) and laser-plasma interactions providing ultra-short relativistic particle beams in the energy domain 5-200 MeV open promising opportunities for the development of high energy radiation femtochemistry (HERF) in the prethermal regime of secondary low-energy electrons and for the real-time imaging of radiation-induced biomolecular alterations at the nanoscopic scale. New developments would permit to correlate early radiation events triggered by ultrashort radiation sources with a molecular approach of Relative Biological Effectiveness (RBE). These emerging research developments are crucial to understand simultaneously, at the sub-picosecond and nanometric scales, the early consequences of ultra-short-pulsed radiation on biomolecular environments or integrated biological entities. This innovating approach would be applied to biomedical relevant concepts such as the emerging domain of real-time nanodosimetry for targeted pro-drug activation and pulsed radio-chimiotherapy of cancers.

  17. Protein: MPA5 [TP Atlas

    Lifescience Database Archive (English)

    Full Text Available MPA5 Pyrimidine biosynthesis Tb927.5.3810 Orotidine-5-phosphate decarboxylase/orota...te phosphoribosyltransferase, putative 999953 Trypanosoma brucei brucei (strain 927/4 GUTat10.1) 3657490 Q57U85 ...

  18. Protein: MPA5 [TP Atlas

    Lifescience Database Archive (English)

    Full Text Available MPA5 Pyrimidine biosynthesis Tc00.1047053507059.60 Orotidine-5-phosphate decarboxyl...ase/orotate phosphoribosyltransferase, putative 353153 Trypanosoma cruzi (strain CL Brener) 3542677 Q4DBC5 ...

  19. Main: ATHB5ATCORE [PLACE

    Lifescience Database Archive (English)

    Full Text Available B5 and ATHB6 exhibit identical DNA binding specificities; ATHB5 forms heterodimers with oth...er class I HDzip proteins; See also S000475; Homeodomein-leucine zipper; HDzip; ATHB5; class I; HDZip I; Arabidopsis thaliana CAATNATTG ... ...ATHB5ATCORE S000371 05-November-2005 (last modified) kehi Consensus binding sequenc...e for Arabidopsis (A.T.) class I HDzip (Homeodomein-leucine zipper) protein, ATHB5; ATHB5 protein forms dimers in solution; ATH

  20. Statistical Properties of the E(5) and X(5) Symmetries

    CERN Document Server

    Shu, J; Liu, Y X; Shu, Jing; Jia, Hong-Bo; Liu, Yu-Xin

    2002-01-01

    We study the energy level statistics of the states in E(5) and X(5) transitional dynamical symmetries. The calculated results indicate that the statistics of E(5) symmetry is regular and follows Poisson statistics, while the statistics of X(5) symmetry involves two maxima in the nearest neighbor level spacing distribution $P(s)$ and the $\\Delta_{3}$ statistics follows the GOE statistics. It provides an evidence that the X(5) symmetry is at the critical point exhibiting competing degree of freedom.

  1. 5-HTP hypothesis of schizophrenia.

    Science.gov (United States)

    Fukuda, K

    2014-01-01

    To pose a new hypothesis of schizophrenia that affirms and unifies conventional hypotheses. Outside the brain, there are 5-HTP-containing argyrophil cells that have tryptophan hydroxylase 1 without l-aromatic amino acid decarboxylase. Monoamine oxidase in the liver and lung metabolize 5-HT, rather than 5-HTP, and 5-HTP freely crosses the blood-brain barrier, converting to 5-HT in the brain. Therefore I postulate that hyperfunction of 5-HTP-containing argyrophil cells may be a cause of schizophrenia. I investigate the consistency of this hypothesis with other hypotheses using a deductive method. Overactive 5-HTP-containing argyrophil cells produce excess amounts of 5-HTP. Abundant 5-HTP increases 5-HT within the brain (linking to the 5-HT hypothesis), and leads to negative feedback of 5-HT synthesis at the rate-limiting step catalysed by tryptophan hydroxylase 2. Owing to this negative feedback, brain tryptophan is further metabolized via the kynurenine pathway. Increased kynurenic acid contributes to deficiencies of glutamate function and dopamine activity, known causes of schizophrenia. The 5-HTP hypothesis affirms conventional hypotheses, as the metabolic condition caused by acceleration of tryptophan hydroxylase 1 and suppression of tryptophan hydroxylase 2, activates both 5-HT and kynurenic acid. In order to empirically test the theory, it will be useful to monitor serum 5-HTP and match it to different phases of schizophrenia. This hypothesis may signal a new era with schizophrenia treated as a brain-gut interaction. Copyright © 2013 Elsevier Ltd. All rights reserved.

  2. 6 CFR 5.5 - Timing of responses to requests.

    Science.gov (United States)

    2010-01-01

    ... INFORMATION Freedom of Information Act § 5.5 Timing of responses to requests. (a) In general. Components... true and correct to the best of that person's knowledge and belief, explaining in detail the basis for...

  3. Synthesis of 5-Deoxy-5-Acyloxyiminoavermectin B1 Derivatives

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    Four 5-deoxy-5-acyloxyiminoavermectin B1 derivatives 4a~d were synthesized via three steps from avermectin B1 and their biological activities were tested against Heliothis armigera,Laphygma exigua and Musca domestica.

  4. 5-minute Gridded Global Relief Data (ETOPO5)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Earth topography five minute grid (ETOPO5) is a gridded data base of worldwide elevations derived from several sources at a resolution of 5 minutes of latitude and...

  5. Mission Planning System Increment 5 (MPS Inc 5)

    Science.gov (United States)

    2016-03-01

    2016 Major Automated Information System Annual Report Mission Planning System Increment 5 ( MPS Inc 5) Defense Acquisition Management Information...Retrieval (DAMIR) UNCLASSIFIED MPS Inc 5 2016 MAR UNCLASSIFIED 2 Table of Contents Common Acronyms and Abbreviations for MAIS Programs 3...U.S.C- United States Code USD(AT&L) - Under Secretary of Defense for Acquisition, Technology, & Logistics MPS Inc 5 2016 MAR UNCLASSIFIED 3 Col

  6. Main: HY5AT [PLACE

    Lifescience Database Archive (English)

    Full Text Available HY5AT S000345 16-Feb-2001 (last modified) seki G box; Binding site of Arabidopsis bZIP protein... HY5; HY5 is constitutively nuclear localized and is involved in light regulation of transcriptio...nal activity of the promoters containing the G-box; See S000041, S000042, S000229; HY5 abundance peaks in early seedlin...g development, consistent with its role in promoting photomorphogenesi...s; HY5 stability and activity is regulated by phosphorylation in its COP1 binding domain; HY5 regulates stimulus-in

  7. MEK5 suppresses osteoblastic differentiation

    Energy Technology Data Exchange (ETDEWEB)

    Kaneshiro, Shoichi [Department of Orthopaedic Surgery, Japan Community Health Care Organization Osaka Hospital, 4-2-78 Fukushima, Fukushima Ward, Osaka City, Osaka 553-0003 (Japan); Department of Orthopaedic Surgery, Graduate School of Medicine, Osaka University, 2-2 Yamadaoka, Suita, Osaka 565-0871 (Japan); Otsuki, Dai; Yoshida, Kiyoshi; Yoshikawa, Hideki [Department of Orthopaedic Surgery, Graduate School of Medicine, Osaka University, 2-2 Yamadaoka, Suita, Osaka 565-0871 (Japan); Higuchi, Chikahisa, E-mail: c-higuchi@umin.ac.jp [Department of Orthopaedic Surgery, Graduate School of Medicine, Osaka University, 2-2 Yamadaoka, Suita, Osaka 565-0871 (Japan)

    2015-07-31

    Extracellular signal-regulated kinase 5 (ERK5) is a member of the mitogen-activated protein kinase (MAPK) family and is activated by its upstream kinase, MAPK kinase 5 (MEK5), which is a member of the MEK family. Although the role of MEK5 has been investigated in several fields, little is known about its role in osteoblastic differentiation. In this study, we have demonstrated the role of MEK5 in osteoblastic differentiation in mouse preosteoblastic MC3T3-E1 cells and bone marrow stromal ST2 cells. We found that treatment with BIX02189, an inhibitor of MEK5, increased alkaline phosphatase (ALP) activity and the gene expression of ALP, osteocalcin (OCN) and osterix, as well as it enhanced the calcification of the extracellular matrix. Moreover, osteoblastic cell proliferation decreased at a concentration of greater than 0.5 μM. In addition, knockdown of MEK5 using siRNA induced an increase in ALP activity and in the gene expression of ALP, OCN, and osterix. In contrast, overexpression of wild-type MEK5 decreased ALP activity and attenuated osteoblastic differentiation markers including ALP, OCN and osterix, but promoted cell proliferation. In summary, our results indicated that MEK5 suppressed the osteoblastic differentiation, but promoted osteoblastic cell proliferation. These results implied that MEK5 may play a pivotal role in cell signaling to modulate the differentiation and proliferation of osteoblasts. Thus, inhibition of MEK5 signaling in osteoblasts may be of potential use in the treatment of osteoporosis. - Highlights: • MEK5 inhibitor BIX02189 suppresses proliferation of osteoblasts. • MEK5 knockdown and MEK5 inhibitor promote differentiation of osteoblasts. • MEK5 overexpression inhibits differentiation of osteoblasts.

  8. 5SRNAdb: an information resource for 5S ribosomal RNAs.

    Science.gov (United States)

    Szymanski, Maciej; Zielezinski, Andrzej; Barciszewski, Jan; Erdmann, Volker A; Karlowski, Wojciech M

    2016-01-04

    Ribosomal 5S RNA (5S rRNA) is the ubiquitous RNA component found in the large subunit of ribosomes in all known organisms. Due to its small size, abundance and evolutionary conservation 5S rRNA for many years now is used as a model molecule in studies on RNA structure, RNA-protein interactions and molecular phylogeny. 5SRNAdb (http://combio.pl/5srnadb/) is the first database that provides a high quality reference set of ribosomal 5S RNAs (5S rRNA) across three domains of life. Here, we give an overview of new developments in the database and associated web tools since 2002, including updates to database content, curation processes and user web interfaces. © The Author(s) 2015. Published by Oxford University Press on behalf of Nucleic Acids Research.

  9. Protein: MPA5 [TP Atlas

    Lifescience Database Archive (English)

    Full Text Available MPA5 Pyrimidine biosynthesis Tb927.5.3800 Glutamine hydrolysing (Not ammonia-depend...ent) carbomoyl phosphate synthase, putative 999953 Trypanosoma brucei brucei (strain 927/4 GUTat10.1) 3657492 Q57U86 ...

  10. 5-HTP efficacy and contraindications

    Directory of Open Access Journals (Sweden)

    Hinz M

    2012-07-01

    Full Text Available Marty Hinz,1 Alvin Stein,2 Thomas Uncini31Clinical Research, NeuroResearch Clinics, Inc, Cape Coral, 2Stein Orthopedic Associates, Plantation, FL, USA; 3University Medical Center Mesabi Hibbing, MN, USAAbstract: L-5-hydroxytryptophan (5-HTP is the immediate precursor of serotonin. It is readily synthesized into serotonin without biochemical feedback. This nutrient has a large and strong following who advocate exaggerated and inaccurate claims relating to its effectiveness in the treatment of depression and a number of other serotonin-related diseases. These assertions are not supported by the science. Under close examination, 5-HTP may be contraindicated for depression in some of the very patients for whom promoters of 5-HTP advocate its use.Keywords: 5-HTP, 5-hydroxytryptophan, L-5-HTP, L-5-hydroxytryptophan

  11. 46 CFR Sec. 5 - Accounting.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 8 2010-10-01 2010-10-01 false Accounting. Sec. 5 Section 5 Shipping MARITIME... Sec. 5 Accounting. The General Agent shall record the amounts of compensation paid from the NSA... Accounting Office, at which time the Maritime Administration will take custody of the records....

  12. The stereodynamics of 5,5'-disubstituted BIPHEPs.

    Science.gov (United States)

    Maier, Frank; Trapp, Oliver

    2013-02-01

    We investigated the stereodynamics of 5,5'-substituted tropos BIPHEP ligands (2,2'-bis(diphenylphosphino)-biphenyls) by enantioselective dynamic high-performance liquid chromatography (DHPLC) to elucidate the influence of the substitution pattern and electronics of the substituents (methyl, methoxy, and hydroxyl groups). By temperature-dependent dynamic HPLC measurements the activation parameters ΔG(╪), ΔH(╪), and ΔS(╪) could be determined with high precision, revealing that the activation barrier of these 5,5'-substituted BIPHEP ligands ranges in a narrow band between 87.8 and 93.0 kJ mol(-1), making them highly attractive as deracemizable dynamic chiral ligands in asymmetric catalysis. Interestingly, the activation parameters are highly influenced by a hydroxyl or methoxy group in the 5,5'-position of the BIPHEP ligands. Copyright © 2012 Wiley Periodicals, Inc.

  13. Crystal structure of 5-hydroxy-5-propylbarbituric acid

    Directory of Open Access Journals (Sweden)

    Thomas Gelbrich

    2015-11-01

    Full Text Available Molecules of the title compound, C7H10N2O4, systematic name 5-hydroxy-5-propylpyrimidine-2,4,6(1H,3H,5H-trione, form a hydrogen-bonded framework which is based on three independent hydrogen bonds, N—H...O(carbonyl, N—H...O(hydroxy and O—H...O(carbonyl. This framework has the topology of the 5-connected nov net. Each molecule is linked to five other molecules via six hydrogen bonds, and the descriptor of the hydrogen-bonded structure is F65[44.66-nov]. The crystal packing is isostructural with that of the previously reported 5-hydroxy-5-ethyl analogue.

  14. Flash CS5.5 The Missing Manual

    CERN Document Server

    Grover, Chris

    2011-01-01

    You can build everything from simple animations to full-fledged iOS and Android apps with Flash CS5.5, but learning this complex program can be difficult-unless you have this fully updated, bestselling guide. Learn how to create gorgeous Flash effects even if you have no programming experience. With Flash CS5.5: The Missing Manual, you'll move from the basics to power-user tools with ease. Learn animation basics. Discover how to turn simple ideas into stunning animations.Master Flash's tools. Learn the animation and effects tools with clear explanations and hands-on examples.Use 3D effects. R

  15. The role of interleukin-5 (IL-5 in vivo: studies with IL-5 deficient mice

    Directory of Open Access Journals (Sweden)

    Klaus I Matthaei

    1997-12-01

    Full Text Available Eosinophil recruitment is a characteristic feature of a number of pathological conditions and was the topic of the recent International Symposium on allergic inflammation, asthma, parasitic and infectious diseases (Rio de Janeiro, June 3-5, 1996. Since interleukin5 (IL5 is believed to regulate the growth, differentiation and activation of eosinophils (Coffman et al. 1989, Sanderson 1992, the role of eosinophils and IL5 are closely linked. Although IL5 specifically regulates eosinophilia in vivo and this is its most well established activity, it is becoming clear that IL5 also has other biological effects. The recent derivation of an IL5 deficient mouse (Kopf et al. 1996, provides a model for exploring not only the role of IL5 and eosinophils but also other novel activities of IL5. Of note is that although the IL5 deficient mice cannot elicit a pronounced eosinophilia in response to inflammatory stimulation following aeroallergen challenge or parasite infection they still produce basal levels of eosinophils that appear to be morphologically and functionally normal. However, the basal levels of eosinophils appear insufficient for normal host defence as IL5 deficiency has now been shown to compromise defence against several helminth infections. In addition, IL5 deficient mice appear to have functional deficiencies in B-1 B lymphocytes and in IgA production.

  16. Clinical phenotype of 5 females with a CDKL5 mutation

    NARCIS (Netherlands)

    Stalpers, X.L.; Spruijt, L.; Yntema, H.G.; Verrips, A.

    2012-01-01

    Mutations in the X-linked cyclin dependent kinase like 5 (CDKL5) gene have been reported in approximately 80 patients since the first description in 2003. The clinical presentation partly corresponds with Rett syndrome, considering clinical features as intellectual disability, hypotonia, and poor vi

  17. Genetic variation in KCNA5

    DEFF Research Database (Denmark)

    Christophersen, Ingrid E; Olesen, Morten S; Liang, Bo

    2012-01-01

    (Kur). Three studies have identified loss-of-function mutations in KCNA5 in patients with idiopathic AF. We hypothesized that early-onset lone AF is associated with high prevalence of genetic variants in KCNA5 and KCNAB2.Methods and resultsThe coding sequences of KCNA5 and KCNAB2 were sequenced in 307 patients......AimsGenetic factors may be important in the development of atrial fibrillation (AF) in the young. KCNA5 encodes the potassium channel a-subunit K(V)1.5, which underlies the voltage-gated atrial-specific potassium current I(Kur). KCNAB2 encodes K(V)ß2, a ß-subunit of K(V)1.5, which increases I...

  18. IL-5 and IL-5 receptor in asthma

    Directory of Open Access Journals (Sweden)

    Kotsimbos ATC

    1997-01-01

    Full Text Available Eosinophils, along with mast cells are key cells involved in the innate immune response against parasitic infection whereas the adaptive immune response is largely dependent on lymphocytes. In chronic parasitic disease and in chronic allergic disease, IL-5 is predominantly a T cell derived cytokine which is particularly important for the terminal differentiation, activation and survival of committed eosinophil precursors. The human IL-5 gene is located on chromosome 5 in a gene cluster that contains the evolutionary related IL-4 family of cytokine genes. The human IL-5 receptor complex is a heterodimer consisting of a unique a subunit (predominantly expressed on eosinophils and a beta subunit which is shared between the receptors for IL-3 & GM-CSF (more widely expressed. The a subunit is required for ligand-specific binding whereas association with the beta subunit results in increased binding affinity. The alternative splicing of the alphaIL-5R gene which contains 14 exons can yield several alphaIL-5R isoforms including a membrane-anchored isoform (alphaIL-5Rm and a soluble isoform (alphaIL-5Rs. Cytokines such as IL-5 produce specific and non-specific cellular responses through specific cell membrane receptor mediated activation of intracellular signal transduction pathways which, to a large part, regulate gene expression. The major intracellular signal transduction mechanism is activation of non-receptor associated tyrosine kinases including JAK and MAP kinases which can then transduce signals via a novel family of transcriptional factors named signal transducers and activators of transcription (STATS. JAK2, STAT1 and STAT 5 appear to be particularly important in IL-5 mediated eosinophil responses. Asthma is characterized by episodic airways obstruction, increased bronchial responsiveness, and airway inflammation. Several studies have shown an association between the number of activated T cells and eosinophils in the airways and abnormalities

  19. 2-Amino-5-chloropyridinium nitrate

    Directory of Open Access Journals (Sweden)

    Donia Zaouali Zgolli

    2009-11-01

    Full Text Available The title structure, C5H6ClN2+·NO3−, is held together by extensive hydrogen bonding between the NO3− ions and 2-amino-5-chloropyridinium H atoms. The cation–anion N—H...O hydrogen bonds link the ions into a zigzag- chain which develops parallel to the b axis. The structure may be compared with that of the related 2-amino-5-cyanopyridinium nitrate.

  20. 5-HTP efficacy and contraindications.

    Science.gov (United States)

    Hinz, Marty; Stein, Alvin; Uncini, Thomas

    2012-01-01

    L-5-hydroxytryptophan (5-HTP) is the immediate precursor of serotonin. It is readily synthesized into serotonin without biochemical feedback. This nutrient has a large and strong following who advocate exaggerated and inaccurate claims relating to its effectiveness in the treatment of depression and a number of other serotonin-related diseases. These assertions are not supported by the science. Under close examination, 5-HTP may be contraindicated for depression in some of the very patients for whom promoters of 5-HTP advocate its use.

  1. HTML5 24-Hour Trainer

    CERN Document Server

    Lowery, Joseph W

    2011-01-01

    Comprehensive written and interactive instruction for learning HTML5 HTML is the core technology for building websites. Today, with HTML5 opening the Internet to new levels of rich content and dynamic interactivity, developers are looking for information to learn and utilize HTML5. HTML5 24-Hour Trainer provides that information, giving new and aspiring web developers the knowledge they need to achieve early success when building websites. Covers the most basic aspects of a web page, including a brief introduction to Cascading Style Sheets (CSS) Provides lessons that are backed up by prof

  2. Dreamweaver CS5 digital classroom

    CERN Document Server

    Osborn, Jeremy; Heald, Greg

    2013-01-01

    Learning Dreamweaver is a dream with this instructional book-and-video training package! Dreamweaver CS5 Digital Classroom covers Dreamweaver CS5 and Dreamweaver CS5.5. Adobe Dreamweaver allows you to easily create robust Web sites without needing extensive programming knowledge or skills. The latest version of Dreamweaver boasts enhanced capabilities and this exciting book-and-downloadable video training package makes learning the new features of Dreamweaver less intimidating. Sixteen self-paced lessons explain how to design, develop, and maintain a fully functioning si

  3. Chaperoning 5S RNA assembly.

    Science.gov (United States)

    Madru, Clément; Lebaron, Simon; Blaud, Magali; Delbos, Lila; Pipoli, Juliana; Pasmant, Eric; Réty, Stéphane; Leulliot, Nicolas

    2015-07-01

    In eukaryotes, three of the four ribosomal RNAs (rRNAs)—the 5.8S, 18S, and 25S/28S rRNAs—are processed from a single pre-rRNA transcript and assembled into ribosomes. The fourth rRNA, the 5S rRNA, is transcribed by RNA polymerase III and is assembled into the 5S ribonucleoprotein particle (RNP), containing ribosomal proteins Rpl5/uL18 and Rpl11/uL5, prior to its incorporation into preribosomes. In mammals, the 5S RNP is also a central regulator of the homeostasis of the tumor suppressor p53. The nucleolar localization of the 5S RNP and its assembly into preribosomes are performed by a specialized complex composed of Rpf2 and Rrs1 in yeast or Bxdc1 and hRrs1 in humans. Here we report the structural and functional characterization of the Rpf2-Rrs1 complex alone, in complex with the 5S RNA, and within pre-60S ribosomes. We show that the Rpf2-Rrs1 complex contains a specialized 5S RNA E-loop-binding module, contacts the Rpl5 protein, and also contacts the ribosome assembly factor Rsa4 and the 25S RNA. We propose that the Rpf2-Rrs1 complex establishes a network of interactions that guide the incorporation of the 5S RNP in preribosomes in the initial conformation prior to its rotation to form the central protuberance found in the mature large ribosomal subunit. © 2015 Madru et al.; Published by Cold Spring Harbor Laboratory Press.

  4. MD5算法研究%MD5 Algorithm

    Institute of Scientific and Technical Information of China (English)

    张裔智; 赵毅; 汤小斌

    2008-01-01

    随着网络技术的迅速发展,信息加密技术已成为保障网络安全的一种重要手段,加密算法已经成为人们的一个研究热点.本文对MD5算法进行了深入研究,介绍MD5算法的产生背景、应用及其算法流程,并提出了MD5算法的一个改进方案.

  5. Chaperoning 5S RNA assembly

    National Research Council Canada - National Science Library

    Madru, Clément; Lebaron, Simon; Blaud, Magali; Delbos, Lila; Pipoli, Juliana; Pasmant, Eric; Réty, Stéphane; Leulliot, Nicolas

    2015-01-01

    ...—are processed from a single pre-rRNA transcript and assembled into ribosomes. The fourth rRNA, the 5S rRNA, is transcribed by RNA polymerase III and is assembled into the 5S ribonucleoprotein particle (RNP...

  6. Protein: MPA5 [TP Atlas

    Lifescience Database Archive (English)

    Full Text Available MPA5 Pyrimidine biosynthesis Tb927.5.3830 Dihydroorotate_dehydrogenase Dihydroorota...te dehydrogenase (fumarate) Dihydroorotate oxidase 999953 Trypanosoma brucei brucei (strain 927/4 GUTat10.1) 3657493 Q57U83 2B4G ...

  7. Your Baby's Growth: 5 Months

    Science.gov (United States)

    ... to Be Smart About Social Media Your Baby's Growth: 5 Months KidsHealth > For Parents > Your Baby's Growth: 5 Months Print A A A What's in ... your child's birth, the doctor has been recording growth in weight, length, and head size (circumference) during ...

  8. Challenges to 5G standardization

    DEFF Research Database (Denmark)

    Mihovska, Albena D.; Prasad, Ramjee

    2013-01-01

    Interoperable, ubiquitous and dynamic are key objectives for fifth-generation (5G) communication systems and applications. These characteristics are also at the core of the main challenges that researchers, manufacturers, regulators and standardization bodies face when designing targeted strategies...... for the successful deployment of 5G enabling technologies....

  9. Main: ANAERO5CONSENSUS [PLACE

    Lifescience Database Archive (English)

    Full Text Available ANAERO5CONSENSUS S000481 05-November-2005 (last modified) kehi One of 16 motifs fou...ty et al., 2005); Arbitrary named ANAERO5CONSENSUS by the PLACEdb curator; See also S000477, S000478, S00047

  10. 5G Wireless Communication Systems

    Directory of Open Access Journals (Sweden)

    Saddam Hossain

    2013-10-01

    Full Text Available As a subscriber becomes more aware of the mobile phone technology, he/she will seek for anappropriate package all together, including all the advanced features of a cellular phone can have. Hence, the search for new technology is always the main intention of the prime cell phone giants to out innovate their competitors. In addition, the main purpose of the fifth generation wireless networks (5G Wireless networks is planned to design the best wireless world that is free from limitations and hindrance of the previous generations.5G technologies will change the way most high bandwidth users access their Mobile Radio Communication (MRC. So, this paper represents, great evolution of 1G (First Generation to 4G yield 5G, introduction to 5G technologies, why there is a need for 5G, advantages of 5G networks technology, exceptional applications, Quality of Service (QoS, 5G network architecture-The MasterCore as well as hardware and software for the 5GMasterCore technology

  11. 1,5-Diaminotetrazolium chloride

    Directory of Open Access Journals (Sweden)

    Ling-Qiao Meng

    2010-04-01

    Full Text Available The title compound, CH5N6+·Cl−, crystallized with two indepedent 1,5-diaminotetrazolium cations and two independent chloride anions in the asymmetric unit. In the crystal, there are a number of N—H...Cl hydrogen-bonding interactions, which generate a three-dimensional network.

  12. Reference: HY5AT [PLACE

    Lifescience Database Archive (English)

    Full Text Available HY5AT Chattopadhyay S, Ang LH, Puente P, Deng XW, Wei N Arabidopsis bZIP protein HY5 dire...ctly interacts with light-responsive promoters in mediating light control of gene expression Plant Cell 10:673-683 (1998) PubMed: 9596629; ...

  13. 14 CFR Section 5 - [Reserved

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Section 5 Section 5 Aeronautics and Space OFFICE OF THE SECRETARY, DEPARTMENT OF TRANSPORTATION (AVIATION PROCEEDINGS) ECONOMIC REGULATIONS UNIFORM SYSTEM OF ACCOUNTS AND REPORTS FOR LARGE CERTIFICATED AIR CARRIERS Balance Sheet Classifications Section...

  14. 5G: 2020 and Beyond

    DEFF Research Database (Denmark)

    Prasad, Ramjee

    he future society would be ushered in a new communication era with the emergence of 5G. 5G would be significantly different, especially, in terms of architecture and operation in comparison with the previous communication generations (4G, 3G...). This book discusses the various aspects...

  15. Challenges to 5G standardization

    DEFF Research Database (Denmark)

    Mihovska, Albena D.; Prasad, Ramjee

    2013-01-01

    Interoperable, ubiquitous and dynamic are key objectives for fifth-generation (5G) communication systems and applications. These characteristics are also at the core of the main challenges that researchers, manufacturers, regulators and standardization bodies face when designing targeted strategies...... for the successful deployment of 5G enabling technologies....

  16. Probability and Statistics: 5 Questions

    DEFF Research Database (Denmark)

    Probability and Statistics: 5 Questions is a collection of short interviews based on 5 questions presented to some of the most influential and prominent scholars in probability and statistics. We hear their views on the fields, aims, scopes, the future direction of research and how their work fits...

  17. 新BMW X5

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    日前,宝马中国宣布,新BMW X5即第二代BMW X5的中期技术升级版携BMW X5 xDrive50i和BMW X5 xDrive35i两款车型进入中国市场,市场售价分别为164.8万元起和88.7万元起。通过BMW高效动力策略(EfflcienlDvnamlcs)的实施,新BMW X5在显著改善性能的同时,其耗油量和排放水平与前代车型相比平均降低了近10%。

  18. Fatigue behavior of unirradiated V-5Cr-5Ti

    Energy Technology Data Exchange (ETDEWEB)

    Gieseke, B.G.; Stevens, C.O.; Grossbeck, M.L. [Oak Ridge National Lab., TN (United States)

    1995-04-01

    The objective of this research is to determine the low cycle fatigue behavior of V-5Cr-5Ti alloys for a range of temperatures and the extent of environmental effects at ambient temperatures. The results of in-vacuum low cycle fatigue tests are presented for unirradiated V-5Cr-5Ti tested at room temperature, 240, and 400{degree}C. A comparison of the fatigue data generated in rough and high vacuums shows that a pronounced environmental degradation of the fatiuge properties exists in this alloy at room temperature. Fatigue life was reduced by as much as 84%. Cyclic stress range data and SEM observations suggest that this reduction is due to a combination of increases in rates of crack initiation and subsequent growth. The relative contribution of each difference is dependent upon the strain range.

  19. Understanding a Father-Daughter Succession Case: Applying the 5+5+5 Bernelli Model

    Directory of Open Access Journals (Sweden)

    Leann Mischel

    2011-01-01

    Full Text Available Problem statement: Research on father-daughter succession in family businesses has only recently begun to get some traction. Still, examples of these situations often elude researchers. Futhermore, there has not been adequate attention paid to how children are raised in family businesses and how they learn to be entrepreneurial. Approach: This study outlines a father-daughter succession case in this unique American setting-the Appalachian Mountains of West Virginia. West Virginia offers an opportunity to examine family businesses embedded in the Appalachian culture-one where much of the popular and scholarly literature contend that deficiencies have contributed to, or reinforced, economic poverty and backwardness. These ideals are now being challenged and this case offers evidence of reversal. We also use the Bernelli 5+5+5 Model as a lens through which to examine the daughter’s entrepreneurial growth in this case. Results: The Bernelli 5+5+5 Model allowed us to structure the daughter’s experiences and better understand how she got to be such a successful successor. Conclusion/Recommendations: We recommend that the Bernelli 5+5+5 Model be used as a framework to view succession in family businesses. The Model also serves as a lens through which to view and better understand how children raised in family businesses become more successful entrepreneurs as adults.

  20. HTML 5 up and running

    CERN Document Server

    Pilgrim, Mark

    2010-01-01

    If you don't know about the new features available in HTML5, now's the time to find out. This book provides practical information about how and why the latest version of this markup language will significantly change the way you develop for the Web. HTML5 is still evolving, yet browsers such as Safari, Mozilla, Opera, and Chrome already support many of its features -- and mobile browsers are even farther ahead. HTML5: Up & Running carefully guides you though the important changes in this version with lots of hands-on examples, including markup, graphics, and screenshots. You'll learn how to

  1. La5Zn2Sn

    Directory of Open Access Journals (Sweden)

    Igor Oshchapovsky

    2011-11-01

    Full Text Available A single crystal of pentalanthanum dizinc stannide, La5Zn2Sn, was obtained from the elements in a resistance furnace. It belongs to the Mo5SiB2 structure type, which is a ternary ordered variant of the Cr5B3 structure type. The space is filled by bicapped tetragonal antiprisms from lanthanum atoms around tin atoms sharing their vertices. Zinc atoms fill voids between these bicapped tetragonal antiprisms. All four atoms in the asymmetric unit reside on special positions with the following site symmetries: La1 (..m; La2 (4/m..; Zn (m.2m; Sn (422.

  2. The blue light indicator in rubidium 5S-5P-5D cascade excitation

    Science.gov (United States)

    Raja, Waseem; Ali, Md. Sabir; Chakrabarti, Alok; Ray, Ayan

    2017-07-01

    The cascade system has played an important role in contemporary research areas related to fields like Rydberg excitation, four wave mixing and non-classical light generation, etc. Depending on the specific objective, co or counter propagating pump-probe laser experimental geometry is followed. However, the stepwise excitation of atoms to states higher than the first excited state deals with increasingly much fewer number of atoms even compared to the population at first excited level. Hence, one needs a practical indicator to study the complex photon-atom interaction of the cascade system. Here, we experimentally analyze the case of rubidium 5S → 5P → 5D as a specimen of two-step excitation and highlight the efficacy of monitoring one branch, which emits 420 nm, of associated cascade decay route 5D → 6P → 5S, as an effective monitor of the coherence in the system.

  3. Protein: MPA5 [TP Atlas

    Lifescience Database Archive (English)

    Full Text Available MPA5 Redox regulation SDHA SDH2, SDHFP1 SDHA Succinate dehydrogenase [ubiquinone] flavoprotein... subunit, mitochondrial Flavoprotein subunit of complex II 9913 Bos taurus 281480 P31039 ...

  4. Protein: MPA5 [TP Atlas

    Lifescience Database Archive (English)

    Full Text Available MPA5 Pyrimidine biosynthesis Tc00.1047053511647.4 Glutamine-dependent carbamoyl-pho...sphate synthetase, putative 353153 Trypanosoma cruzi (strain CL Brener) 3540844 Q4D6X8 2209850 ...

  5. Paraphilic diagnoses in DSM-5.

    Science.gov (United States)

    Krueger, Richard B; Kaplan, Meg S

    2012-01-01

    The DSM-5 has been under revision since 1999 and is scheduled for publication in 2013. This article will review the major proposed modifications of the Paraphilias. The information reviewed was obtained from PubMed, PsychInfo, the DSM-5.org website and other sources and reviewed. Pedohebephilia, Hypersexual Disorder and Paraphilic Coercive Disorder are new proposed diagnoses. Paraphilias have been assigned their own chapter in DSM- 5 and a distinction has been made between Paraphilias and Paraphilic Disorders. Victim numbers have been included in diagnosis of paraphilias that involve victims and remission and severity measures have been added to all paraphilias. Transvestic Disorder can apply to males or females, Fetishistic Disorder now includes partialism, and Sexual Masochism Disorder has Asphyxiophilia as a specifier. This study is based on a literature review and influenced by the knowledge and biases of the authors. The Paraphilic Disorders Section of the DSM-5 represents a significant departure from DSMIV-TR.

  6. Fine 5 kolib Kumu lavale

    Index Scriptorium Estoniae

    2006-01-01

    Kumu kunstimuuseumi auditooriumis toimub 21. veebruaril Fine 5 kaasaegse tantsu etendus "Panus". Esinevad Tiina Ollesk, Irina Pähn, žonglöör Dimitri Kruus, disainer Rain Saukas ja muusik Mattias Siitan

  7. Conformity Adequacy Review: Region 5

    Science.gov (United States)

    Resources are for air quality and transportation government and community leaders. Information on the conformity SIP adequacy/inadequacy of state implementation plans (SIPs) in EPA Region 5 (IL, IN, MI, OH, WI) is provided here.

  8. Fine 5 kolib Kumu lavale

    Index Scriptorium Estoniae

    2006-01-01

    Kumu kunstimuuseumi auditooriumis toimub 21. veebruaril Fine 5 kaasaegse tantsu etendus "Panus". Esinevad Tiina Ollesk, Irina Pähn, žonglöör Dimitri Kruus, disainer Rain Saukas ja muusik Mattias Siitan

  9. 2002 Rose Site 5P

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Underwater Site 5P was established off Rose Atoll, American Samoa by Dr. James Maragos, U.S. Fish & Wildlife Service, on February 20, 2002. With a start point...

  10. 2004 Rose Site 5P

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Underwater Site 5P was established off Rose Atoll, American Samoa by Dr. James Maragos, U.S. Fish & Wildlife Service, on February 20, 2002. With a start point...

  11. 2000 Johnston Site 5P

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Underwater Site 5P was established at Johnston Atoll by Dr. James Maragos, U.S. Fish & Wildlife Service, on July 2, 2000. With a start point (meter 0) at...

  12. Crystal structure of Ca5Nb5O17

    Science.gov (United States)

    Guevarra, J.; van Smaalen, S.; Rotiroti, N.; Paulmann, C.; Lichtenberg, F.

    2005-09-01

    The crystal structure of Ca5Nb5O17, an n=5 member of the homologous series AnBnO, at room temperature has been determined by single-crystal X-ray diffraction using synchrotron radiation with a CCD area detector. The structure is monoclinic with spacegroup P21/c ( b unique) and lattice parameters a=7.7494(3) Å, b=5.4928(1) Å, c=32.241(1) Å, and β=96.809(4)∘. It consists of perovskite-like slabs of corner-sharing NbO6 octahedra separated by an interslab region, where the octahedra on opposite sides of the gap do not share oxygen atoms resulting in an extra layer of oxygen atoms with respect to the ideal perovskite structure. The slabs are five octahedra wide. Ca atoms within the slabs occupy 12-fold coordinated sites whereas those at the borders show irregular coordination environments. The distortion of the octahedra increases from the center to the borders of the slabs. The computed valences for the Nb ions are very close to 5 at the borders while smaller values were obtained for sites in the middle of the slabs which suggests that the electrical conduction takes place predominantly in the middle of the slabs.

  13. Eg5 steps it up!

    Directory of Open Access Journals (Sweden)

    Fordyce Polly M

    2006-12-01

    Full Text Available Abstract Understanding how molecular motors generate force and move microtubules in mitosis is essential to understanding the physical mechanism of cell division. Recent measurements have shown that one mitotic kinesin superfamily member, Eg5, is mechanically processive and capable of crosslinking and sliding microtubules in vitro. In this review, we highlight recent work that explores how Eg5 functions under load, with an emphasis on the nanomechanical properties of single enzymes.

  14. Spring Framework 5: Themes & Trends

    CERN Document Server

    CERN. Geneva

    2017-01-01

    Spring Framework 5.0/5.1, scheduled for release in early/late 2017, focuses on several key themes: reactive web applications based on Reactive Streams, comprehensive support for JDK 9 and HTTP/2, as well as the latest API generations in the Enterprise Java ecosystem. This talk presents the overall story in the context of wider industry trends, highlighting Spring’s unique programming model strategy.

  15. N′-(2-Hydroxy-5-nitrobenzylidenebenzenesulfonohydrazide

    Directory of Open Access Journals (Sweden)

    Hapipah M. Ali

    2008-08-01

    Full Text Available The molecule of the title compound, C13H11N3O5S, shows a phenyl group and an almost planar intramolecularly hydrogen-bonded N′-(2-hydroxy-5-phenylebenzylidenehydrazino group disposed about the S atom. Adjacent molecules are linked by N—H...Onitro hydrogen bonds, producing a linear chain that runs along the b axis of the unit cell.

  16. 5G: 2020 and Beyond

    DEFF Research Database (Denmark)

    Prasad, Ramjee

    he future society would be ushered in a new communication era with the emergence of 5G. 5G would be significantly different, especially, in terms of architecture and operation in comparison with the previous communication generations (4G, 3G...). This book discusses the various aspects of the arc...... System for Dynamically Operating Mega Communications (WISDOM) Millimeter Waves and Spectrum Management Cyber Security Device to Device Communication...

  17. 5-HTP efficacy and contraindications

    OpenAIRE

    Hinz M; Stein A; Uncini T

    2012-01-01

    Marty Hinz,1 Alvin Stein,2 Thomas Uncini31Clinical Research, NeuroResearch Clinics, Inc, Cape Coral, 2Stein Orthopedic Associates, Plantation, FL, USA; 3University Medical Center Mesabi Hibbing, MN, USAAbstract: L-5-hydroxytryptophan (5-HTP) is the immediate precursor of serotonin. It is readily synthesized into serotonin without biochemical feedback. This nutrient has a large and strong following who advocate exaggerated and inaccurate claims relating to its effectiveness in the treatment of...

  18. Instantons on the 5-sphere and M5-branes

    CERN Document Server

    Kim, Hee-Cheol; Kim, Seok

    2012-01-01

    We calculate the partition functions of supersymmetric gauge theories on S^5, which acquire non-perturbative contributions from instanton loops wrapping its Hopf fiber. The instantons on the CP^2 base equivariantly localize to 3 fixed points of SU(3) Cartans. Using our results, we study the index of the 6d (2,0) theory. We first study the partition functions of maximal SYM with AD(E) gauge groups, which agree with the gravity dual indices on AdS_7 in the large N limits. We also show that the most general partition function of the Abelian theory agrees with the index for a free 6d tensor supermultiplet. We explain possible ambiguities in our 5d approach, role of maximal SUSY, and the Wilson loops on S^5 dual to M2-brane Wilson surfaces in AdS_7.

  19. Microstructure and tensile creep resistance of Mg-5.5%Zn-(0.7%, 1.5%, 3.5%, 7.5%)Y alloys

    Institute of Scientific and Technical Information of China (English)

    陈刚; 张艳斌; 夏伟军; 陈鼎

    2015-01-01

    The tensile creep resistance of Mg-5.5%Zn-(0.7%, 1.5%, 3.5%, 7.5%)Y (mass fraction, %) gravity-casting alloys was investigated systematically. The corresponding physical models were established for analyzing the microstructure evolution and creep mechanism. The results show that four second phases are found in Mg-5.5%Zn-(0.7%, 1.5%, 3.5%, 7.5%)Y alloys, including Mg3ZnY, Mg3Zn6Y, Mg3Zn3Y2 and Mg7Zn3, where the rare earth rich phase (Mg3ZnY, Mg3Zn6Y, Mg3Zn3Y2) with high melting point can more effectively improve the creep resistance properties of alloys than Mg7Zn3. With the increasing of Y content, the creep resistance of alloys is improved correspondingly. The alloys with (1.5%, 3.5%)Y addition exhibit high creep resistance at temperatures from 175 °C to 200 °C and load from 55 MPa to 70 MPa. The 7.5%Y added alloy presents excellent creep resistance even at 275 °C and 55 MPa. The second phase which shows discontinuous distribution at the grain boundary of (0.7%, 1.5%, 3.5%)Y added alloys has preferred orientation and clogs in triple junctions of grain boundary. Simultaneously, the arrangement of second phase particles along tensile direction and the formation of denuded zones are observed during the creep process. Moreover, the crack initiates in these areas and propagates along grain boundary. Compared with discontinuous second phase, the continuous skeleton-like second phase of 7.5%Y added alloy at grain boundary has a better effect on improving the creep resistance properties of alloys.

  20. Microstructure and tensile creep resistance of Mg-5.5%Zn-(0.7%, 1.5%, 3.5%, 7.5%)Y alloys

    Institute of Scientific and Technical Information of China (English)

    陈刚; 张艳斌; 夏伟军; 陈鼎

    2015-01-01

    The tensile creep resistance of Mg-5.5%Zn-(0.7%, 1.5%, 3.5%, 7.5%)Y(mass fraction, %) gravity-casting alloys was investigated systematically. The corresponding physical models were established for analyzing the microstructure evolution and creep mechanism. The results show that four second phases are found in Mg-5.5%Zn-(0.7%, 1.5%, 3.5%, 7.5%)Y alloys, including Mg3 Zn Y, Mg3Zn6 Y, Mg3Zn3Y2 and Mg7Zn3, where the rare earth rich phase(Mg3Zn Y, Mg3Zn6 Y, Mg3Zn3Y2) with high melting point can more effectively improve the creep resistance properties of alloys than Mg7Zn3. With the increasing of Y content, the creep resistance of alloys is improved correspondingly. The alloys with(1.5%, 3.5%)Y addition exhibit high creep resistance at temperatures from 175 °C to 200 °C and load from 55 MPa to 70 MPa. The 7.5%Y added alloy presents excellent creep resistance even at 275 °C and 55 MPa. The second phase which shows discontinuous distribution at the grain boundary of(0.7%, 1.5%, 3.5%)Y added alloys has preferred orientation and clogs in triple junctions of grain boundary. Simultaneously, the arrangement of second phase particles along tensile direction and the formation of denuded zones are observed during the creep process. Moreover, the crack initiates in these areas and propagates along grain boundary. Compared with discontinuous second phase, the continuous skeleton-like second phase of 7.5%Y added alloy at grain boundary has a better effect on improving the creep resistance properties of alloys.

  1. Big Bang Day: 5 Particles - 5. The Next Particle

    CERN Multimedia

    Franck Close

    2008-01-01

    Simon Singh looks at the stories behind the discovery of 5 of the universe's most significant subatomic particles: the Electron, the Quark, the Anti-particle, the Neutrino and the "next particle". 5. The Next Particle The "sparticle" - a super symmetric partner to all the known particles could be the answer to uniting all the known particles and their interactions under one grand theoretical pattern of activity. But how do researchers know where to look for such phenomena and how do they know if they find them? Simon Singh reviews the next particle that physicists would like to find if the current particle theories are to ring true.

  2. CLASSIFICATION OF COMPLETE 5-PARTITE GRAPHS AND CHROMATICITY OF 5-PARTITE GRAPHSWITH 5n VERTICES

    Institute of Scientific and Technical Information of China (English)

    ZhaoHaixing; LiuRuying; ZhangShenggui

    2004-01-01

    For a graph G,P(G,λ)denotes the chromatic polynomial of G. Two graphs G and H are said to be chromatically equivalent,denoted by G-H,if P(G,λ)=p(H,λ). Let[G]= {H|H-G}. If [G]={G},then G is said to be chromatically unique. For a complete 5-partite graph G with 5n vertices, define θ(G)=(a(G,6)-2n+1-2n-1+5)/2n-2,where a(G,6) denotes the number of 6-independent partitions of G. In this paper, the authors show that θ(G)≥0 and determine all graphs with θ(G)= 0, 1, 2, 5/2, 7/2, 4, 17/4. By using these results the chromaticity of 5-partite graphs of the form G-S with θ(G)=0,1,2,5/2,7/2,4,17/4 is investigated,where S is a set of edges of G. Many new chromatically unique 5-partite graphs are obtained.

  3. Cyclic guanidines as dual 5-HT5A/5-HT7 receptor ligands: optimising brain penetration.

    Science.gov (United States)

    Peters, Jens-Uwe; Lübbers, Thomas; Alanine, Alexander; Kolczewski, Sabine; Blasco, Francesca; Steward, Lucinda

    2008-01-01

    The optimisation of molecular properties within a series of 2-amino dihydroquinazoline 5-HT5A/5-HT7 receptor ligands resulted in a significantly improved brain-to-plasma ratio, enhancing the pharmacological utility of these compounds. By modulating the lipophilicity and pKa, a 20-fold increase in brain-to-plasma ratio could be achieved, leading to micromolar brain concentrations after oral administration. The enantiomers of one representative of this series of improved compounds were separated, and the configuration of the eutomer was determined by X-ray crystallography.

  4. 2010 Audi A5 and S5 Cabriolet

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    只要是Audi的车款,只要是带上了“s”标志,那就意味着动力被大大提升。Audi S5是Audi A5 的运动版车型。与09款Infiniti G37和宝马BMW 3系硬顶敞篷不同的是,全新一代Audi S5敞篷车采用了电动折叠软顶敞篷,较结构复杂且自重较大的硬顶敞篷运行起来更加简便。据称,全新一代Audi S5 Cabriolet将搭载新款3.0V6涡轮增压引擎,最大功率与最大扭矩分别为216kW与420Nm。

  5. 5 CFR 1315.5 - Accelerated payment methods.

    Science.gov (United States)

    2010-01-01

    ... Section 1315.5 Administrative Personnel OFFICE OF MANAGEMENT AND BUDGET OMB DIRECTIVES PROMPT PAYMENT... disasters (as defined in the Robert T. Stafford Disaster Relief Act and Emergency Assistance, Pub. L. 93-288... earlier than seven days prior to the payment due date in accordance with agency regulations or policies. ...

  6. Phosphodiesterase 5 inhibitors (PDE5i) and pulmonary embolism

    NARCIS (Netherlands)

    Gerritsen, R.F.; Bijl, A.; Van Puijenbroek, E.P.

    2009-01-01

    Introduction: PDE5i-related arterial thromboembolism is described in literature. Published venous thrombotic events are limited to one case of pulmonary embolism (tadalafil) and of recurrent deep venous thrombosis (DVT) related to sildenafil. Aim of the study: Presentation of two cases of vardenafil

  7. Chromosome 5 and Parkinson disease.

    Science.gov (United States)

    Foroud, Tatiana; Pankratz, Nathan; Martinez, Maria

    2006-10-01

    Parkinson disease (PD) is the second most common neurodegenerative disorder. Despite the identification of five causative genes, the majority of PD etiology is still unknown. A region on chromosome 5q is one of the few regions of the genome found linked in multiple studies of familial PD. Analyses were performed using genotypic data from two independent research studies to evaluate rigorously the evidence of linkage on chromosome 5. The combined sample consisting of 1238 affected individuals from 569 multiplex PD families were genotyped for a common set of 20 microsatellite markers spanning an 80 cM region on chromosome 5q. Two disease models were employed and model-free linkage analyses were performed to detect linkage to a PD susceptibility gene and also to detect linkage to a quantitative phenotype, age of onset of PD. There was little evidence of linkage using either a narrower or broader disease definition (lod <0.5). Analyses employing age of onset of PD as the phenotype produced a lod score of 1.8. These results in a very large sample of familial PD suggest that it is unlikely that a PD susceptibility gene is located on chromosome 5q. Evidence for a locus contributing to the age of onset of PD is modest at best (empirical P-value=0.07).

  8. Synthesis and Crystal Structure of Diethyl 5-Acetoxy-3-(4-chlorophenyl)-4,5-dihydroisoxazol-5-yl-5-phosphonate

    Institute of Scientific and Technical Information of China (English)

    SHANG Zhi-Qiang; CHEN Ru-Yu; HUANG You

    2006-01-01

    The crystal structure of the title compound, diethyl 5-acetoxy-3-(4-chlorophenyl)-4,5-dihydroisoxazol-5-yl-5-phosphonate (Ci5H19ClNO6P, Mr = 375.73), has been synthesized by the treatment of nitrile oxides and 1-acetyloxy-vinylphosphonate under very mild conditions in good yields, and determined by single-crystal X-ray diffraction. The crystal belongs to monoclinic, space group C2/c with a = 16.914(10), b = 10.567(7), c = 21.927(13)(A),β = 110.249(11)°, V= 3677(4)(A)3,Z = 8, Dc = 1.358 g/cm3, F(000) = 1568, μ(MoKa) = 0.324 mm-1, S = 1.011, the final R = 0.0661and wR = 0.1556. The X-ray analytic results showed that the dihedral angle between the phenyl group and the isoxazoline ring is 10.7°.

  9. HTML5 The Missing Manual

    CERN Document Server

    MacDonald, Matthew

    2011-01-01

    HTML5 is more than a markup language-it's a dozen independent web standards all rolled into one. Until now, all it's been missing is a manual. With this thorough, jargon-free guide, you'll learn how to build web apps that include video tools, dynamic drawings, geolocation, offline web apps, drag-and-drop, and many other features. HTML5 is the future of the Web, and with this book you'll reach it quickly. The important stuff you need to know: Structure web pages in a new way. Learn how HTML5 helps make web design tools and search engines work smarter.Add audio and video without plugins. Build

  10. La5Zn2Sn

    Science.gov (United States)

    Oshchapovsky, Igor; Pavlyuk, Volodymyr; Dmytriv, Grygoriy; Chumak, Igor; Ehrenberg, Helmut

    2011-01-01

    A single crystal of penta­lanthanum dizinc stannide, La5Zn2Sn, was obtained from the elements in a resistance furnace. It belongs to the Mo5SiB2 structure type, which is a ternary ordered variant of the Cr5B3 structure type. The space is filled by bicapped tetra­gonal anti­prisms from lanthanum atoms around tin atoms sharing their vertices. Zinc atoms fill voids between these bicapped tetra­gonal anti­prisms. All four atoms in the asymmetric unit reside on special positions with the following site symmetries: La1 (..m); La2 (4/m..); Zn (m.2m); Sn (422). PMID:22219730

  11. Observations for CMIP5 Simulations

    Science.gov (United States)

    Teixeira, J.; Waliser, D.; Crichton, D.; Braverman, A.; Boland, S.; Williams, D.; Gleckler, P.; Taylor, K.; Potter, J.

    2012-01-01

    The objective of this is to provide the community of researchers that will access and evaluate the Coupled Model Intercomparison Project Phase 5 (CMIP5) model results access to analogous, analogous sets in terms of periods, variables, temporal/spatial frequency, sets of observational data. A collaborative effort between JPL/NASA and PCMDI is underway to provide the community of researchers that will access and evaluate the CMIP5 model results access to analogous sets of observational data. A number of NASA satellite data sets have been identified that have model equivalents. Thus far: AIRS, MLS, TES, QuikSCAT, CloudSat, Topex/Poseidon, CERES, TRMM, AMSR-E have been identified.

  12. 2-Amino-5-chloropyridinium trifluoroacetate

    Directory of Open Access Journals (Sweden)

    Madhukar Hemamalini

    2010-04-01

    Full Text Available The asymmetric unit of the title salt, C5H6ClN2+·C2F3O2−, contains two independent 2-amino-5-chloropyridinium cations and two independent trifluoroacetate anions. The F atoms of both anions are disordered over two sets of positions, with occupancy ratios of 0.672 (12:0.328 (12 and 0.587 (15:0.413 (15. In the crystal, the cations and anions are linked via N—H...O and C—H...O hydrogen bonds, forming a two-dimensional network parallel to (001.

  13. 5S IN QUALITY MANAGEMENT

    Directory of Open Access Journals (Sweden)

    BOCA GRATIELA DANA

    2015-07-01

    Full Text Available The fundamental principles of organization are customer satisfaction, eliminating waste, achieving a continuous flow in production and continuous improvement. The 5S method is a structured program for implementation the standardization and organization, simplifies the environment of the workplace (Gemba, reduce losses and unnecessary activities, and improve quality efficiency and safety. Keeping the workplace clean, providing a good working environment and promote productivity, reducing costs, ensure security and removes all types of losses. The case study present the 5S method as a tool which can be used efficiently to keep those things necessary for the proper conduct of the organization and the elimination of unless things.

  14. iOS 5 Essentials

    CERN Document Server

    Daniel, Steven F

    2012-01-01

    Each chapter will take you through a new major feature of iOS 5. You will learn how to integrate each feature into your applications. If you ever wanted to learn about the latest features of iOS 5 and learn how to incorporate Twitter, iCloud and Core Image framework effects functionality into your applications, then this book is for you. You should have a good knowledge of programming experience with Objective-C, and have used Xcode 4. iPhone programming experience is not required.

  15. Teach Yourself VISUALLY HTML5

    CERN Document Server

    Wooldridge, Mike

    2011-01-01

    Make mark-up language more manageable with this visual guide HTML5 is the next-generation of web standard mark-up language, and among other things, it offers amazing new avenues for incorporating multimedia into your sites. What easier way to master all of HTML5's new bells and whistles than with a guide that shows you, screenshot by screenshot, just what to do? Over a hundred tasks that web designers need to know most are explained using, full-color screenshots and how-to steps. From the easy stuff like revised new header and footer elements to complex updates such as canvas and audio, this

  16. HTML5 rich media foundation

    CERN Document Server

    David, Matthew

    2010-01-01

    Learn about the new ways in which video and audio can be easily embedded into your HTML5 Web pages. Discover how you can create new Web media content and how JavaScript, CSS, and SVG can be integrated to create a compelling, rich media foundation for your work. HTML 5, is the first major update to the core language of the Web in over a decade The focus of this book is on innovations that most directly effect Web site design and multimedia integration The companion Web site features working demonstrations and tutorial media for hands-on pract

  17. Tetraquabis(5-fluorosaccharinatonickel(II

    Directory of Open Access Journals (Sweden)

    Larnelle Peterson

    2009-04-01

    Full Text Available In the centrosymmetric title complex, [Ni(C7H3FNO3S2(H2O4], the NiII atom exhibits a slightly distorted trans-NiN2O4 octahedral coordination. The nitrogen donors are provided by two 5-fluorosaccharinate ligands and the oxygen donors are provided by four water molecules. The crystal structure features O—H...O and bifurcated O—H...(F,O hydrogen bonds, the latter involving the F atom of the 5-fluorosaccharinate ligand.

  18. Epidermoid carcinomas of the anal canal treated with definitive radiation therapy in a series of 305 patients; Carcinomes epidermoides du canal anal traites par irradiation a visee curative: a propos de 305 patients

    Energy Technology Data Exchange (ETDEWEB)

    Deniaud-Alexandre, E.; Touboul, E.; Huang, R.; Qu, S.H.; Pene, F.; Schlienger, M. [Hopital Tenon, Service d' Oncologie-Radiotherapie, 75 - Paris (France); Tiret, E.; Parc, R. [Hopital Saint-Antoine, Service de Chirurgie Digestive, 75 - Paris (France); Sezeur, A. [Hopital des Diaconesses, Service de Chirurgie Generale, 75 - Paris (France); Houry, S. [Hopital Tenon AP-HP, Service de Chirurgie Digestive, 75 - Paris (France); Gallot, D. [Groupe Hospitalier Bichat-Claude-Bernard, Service de Chirurgie Generale et Digestive B, 75 - Paris (France)

    2003-08-01

    Purpose. - To identify prognostic factors and treatment toxicity in a series of epidermoid cancers of the anal canal without evident metastasis. Patients and methods. - Between June 1972 and January 1997, 305 patients (pts) were treated with curative-intent radiation therapy (RT). The T-stages according to the 1987 UICC classification were: 26 T1, 141 T2, 104 T3, and 34 T4. There were 49 pts with nodal involvement at presentation. Pretreatment anal function scoring according to our in-house system was: 22 scored 0, 182 scored 1, 74 scored 2, 7 scored 3. 11 scored 4, and 9 not available pts. The treatment started with external beam RT (EBRT) in 303 pts (median dose: 45 Gy). After a rest period of 4 to 6 weeks, a boost of 20 Gy was delivered by EBRT in 279 pts and by interstitial {sup 192}Ir brachytherapy (Bcy) in 17 pts. Seven pts received only one course of EBRT (mean dose: 49.5 Gy) and 2 pts were treated with interstitial {sup 192}Ir Bcy alone (55 and 60 Gy, respectively). concomitant chemotherapy (5-fluoro-uracil and either mitomycin C or cisplatin) was delivered to 19 pts. Mean follow-up was 103 months. Results. - At the end of RT local tumor clinical complete response (cCR) rate was 80%. Out of 61 non responders or local progressive tumors 27 (44%) were salvaged with abdomino-perineal resection (APR). The rate of local tumor relapse (LR) was 12%. Out of 37 LTR, 20 (54%) were salvaged with APR and one with interstitial {sup 192}Ir Bcy. The overall local tumor control (LC) rate with or without salvage local treatment was 84%. LC rate with a good anal function scoring (score 0 and 1) was 56.5%0. Among 181/186 available pts who preserved their anus, 94% had a good anal function scoring. For a subgroup of 15 pts with length tumor <2 cm-N0, the LC rate after the end of RT was 100% the LC rate with or without local salvage treatment was 100%, and among 13 available pts who preserved their anus, the anal function scoring was good in 12 pts (92%). The 10-years disease

  19. 图K(5m,5)的自同态的自同态谱%On the Andomorphism Spectrum of K(5m,5)

    Institute of Scientific and Technical Information of China (English)

    余鋆

    2012-01-01

    In this paper, we obtain that Aut(K(5m, 5)) ≈D5m,sEnd(k(5m, 5))=Aut(k(5m, 5) and End(K(5m,5)) =qEnd(K(5m, 5)), where Ds. is the dihedral group of order 5m. Furthermore, we solve some enumerative problems of End(K(5m, 5)), and give the endomorphism spectrum of k(5m, 5).%从循环完全图K(5m,5)的结构出发,得到Aut(K(5m,5))≈D5m,其中D5m是5m阶的二面体群,sEnd(k(5m,5))=Aut(k(5m,5),End(K(5m,5))=qEnd(K(5m,5))。同时也解决了End(K(5m,5))的一些记数问题,给出了此类图的自同态谱。

  20. Protein: FBB5 [TP Atlas

    Lifescience Database Archive (English)

    Full Text Available FBB5 RNA silencing TARBP2 TRBP TARBP2 RISC-loading complex subunit TARBP2 TAR RNA-binding protein... 2, Trans-activation-responsive RNA-binding protein 9606 Homo sapiens Q15633 6895 3ADL 2CPN 3LLH 6895 21080422 ...

  1. Protein: FBA5 [TP Atlas

    Lifescience Database Archive (English)

    Full Text Available FBA5 VSP(voltage-sensor containing phosphatase) ptenb pten Novel protein similar to...og B (Mutated in multiple advanced cancers 1), Phosphatase and tensin-like protein B short splice variant 7955 Danio rerio Q7ZZ56 ...

  2. Protein: FBB5 [TP Atlas

    Lifescience Database Archive (English)

    Full Text Available FBB5 RNA silencing TNRC6A CAGH26, KIAA1460, TNRC6 TNRC6A Trinucleotide repeat-containing gene 6A protein... CAG repeat protein 26, EMSY interactor protein, GW182 autoantigen, Glycine-tryptophan protein of 182 kDa 9606 Homo sapiens Q8NDV7 27327 27327 19398495 ...

  3. Protein: MPA5 [TP Atlas

    Lifescience Database Archive (English)

    Full Text Available MPA5 Pyrimidine biosynthesis Tc00.1047053511643.20 Dihydroorotate_dehydrogenase Dih...ydroorotate dehydrogenase, putative 353153 Trypanosoma cruzi (strain CL Brener) 3544065 Q4DEJ0 2DJX 2DJL, 2E68, 2DJX, 2E6D, 2E6A, 2E6F 18808149 ...

  4. DSM-5: problems and suggestions.

    Science.gov (United States)

    Birgegård, Andreas; Groß, Gaby; de Man Lapidoth, Joakim; Norring, Claes

    2013-01-01

    The upcoming DSM5 will impact clinical work and research substantially, and we here point to a few problems that may have been overlooked. These concern inconsistencies and lack of clarity, and the future "not elsewhere classified" atypical anorexia nervosa category. We propose solutions in the form of working definitions and operationalizations to facilitate clinical implementation as well as streamline research.

  5. Protein: FBA5 [TP Atlas

    Lifescience Database Archive (English)

    Full Text Available FBA5 VSOP(voltage sensor-only protein1) HVCN1 VSOP, VSX1 Voltage-gated hydrogen cha...nnel 1 Hydrogen voltage-gated channel 1, Voltage sensor domain-only protein 7719 Ciona intestinalis 778897 Q1JV40 ...

  6. Protein: FBA5 [TP Atlas

    Lifescience Database Archive (English)

    Full Text Available FBA5 VSOP(voltage sensor-only protein1) HVCN1 VSOP Voltage-gated hydrogen channel 1... Hydrogen voltage-gated channel 1, Voltage sensor domain-only protein 9606 Homo sapiens Q96D96 84329 3A2A 18583477, 19285483 ...

  7. 5'adenosinmonofosfataktiveret proteinkinase og livsstilssygdomme

    DEFF Research Database (Denmark)

    Richter, Erik; Kiens, Bente; Wojtaszewski, Jørgen

    2006-01-01

    5'adenosinmonofosfataktiveret proteinkinase (AMPK) er et enzym, der aktiveres, når cellers energistatus trues, og det aktiverer energigivende processer, mens energiforbrugende processer hæmmes. AMPK er også involveret i regulering af genekspression og i appetitregulering. Farmakologisk aktivering...

  8. På sporet af 5. C

    DEFF Research Database (Denmark)

    Krøgholt, Ida; Christoffersen, Erik Exe

    2016-01-01

    Borgerscener er landsdelsscenernes niche. Præmissen for scenerne er at bruge teatermediet til at skildre mennesker i deres autentiske liv, og i Lars Ole 5. C på Aarhus Teater leges der med Niels Malmros’ film fra 1973, som 10 århusianske børn i 12 årsalderen bruger som filter for deres egne...

  9. DISSOCIATIVE DISORDERS IN DSM-5

    NARCIS (Netherlands)

    Spiegel, David; Loewenstein, Richard J.; Lewis-Fernandez, Roberto; Sar, Vedat; Simeon, Daphne; Vermetten, Eric; Cardena, Etzel; Dell, Paul F.

    Background: We present recommendations for revision of the diagnostic criteria for the Dissociative Disorders (DDs) for DSM-5. The periodic revision of the DSM provides an opportunity to revisit the assumptions underlying specific diagnoses and the empirical support, or lack of it, for the defining

  10. Unity 5 for Android essentials

    CERN Document Server

    Cogut, Valera

    2015-01-01

    This book is perfect for game developers who want to learn how to develop, optimize, and publish games for Android devices in a quick and easy manner using Unity 5. This book assumes a basic knowledge of game design concepts and/or some experience with other game technologies such as Unreal Engine 4, CryEngine, or GameMaker.

  11. HTML5 Mobile Development Cookbook

    CERN Document Server

    Chuan, Shi

    2012-01-01

    The book is written in a cookbook style, presenting examples in the style of recipes, allowing you to go directly to your topic of interest, or follow topics throughout a chapter to gain in-depth knowledge. Developers keen to create HTML5 mobile websites that are fast and responsive across a whole range of mobile devices.

  12. Main: SORLIP5AT [PLACE

    Lifescience Database Archive (English)

    Full Text Available SORLIP5AT S000486 18-November-2005 (last modified) kehi one of Sequences Over-Repre...sented in Light-Induced Promoters (SORLIPs) in Arabidopsis; Computationally identified phyA-induced motifs; ...See also S000482, S000483, S000484, S000485 (all SORLIPs), and also S000487, S000488, S000489, S000490 (all SOR

  13. Pantothenic acid (Vitamin B5)

    Science.gov (United States)

    ... vitamin B5 (pantothenic acid), vitamin B6 (pyridoxine), vitamin B12 (cyanocobalamin), and folic acid. However, some products do ... Pantothenas, Calcium D-Pantothenate, Calcium Pantothenate, Complexe de Vitamines B, D-Calcium Pantothenate, D-Panthenol, D-Panthénol, ...

  14. WAJM 29(5).pmd

    African Journals Online (AJOL)

    user1

    ABSTRACT. BACKGROUND: One in ten patients on anticancer medication ... METHODS: Records of 20 cancer patients with febrile neutro- penia (FN) ... duration of fever and overall treatment outcome were also assessed. RESULTS: .... 5. 4. 3. 2. 1. 0. Breast. Naspharyngeal Cancer. Anus. Tongue. Mandible. Endometrium ...

  15. Editorial, Volume 5, Issue 1

    Directory of Open Access Journals (Sweden)

    Kristy L. Archuleta

    2014-08-01

    Full Text Available Welcome to Volume 5, Issue 1 of the Journal of Financial Therapy! In this issue, four scholarly papers are presented along with two profiles and a book review. These four papers address very important issues, such as mental health therapists’ competency in working with financial issues, financial stress of college students, parental messages about money, and financial advice media.

  16. Protein: FBB5 [TP Atlas

    Lifescience Database Archive (English)

    Full Text Available FBB5 RNA silencing EIF2C1 AGO1 EIF2C1 Protein argonaute-1 Eukaryotic translation in...itiation factor 2C 1, Putative RNA-binding protein Q99 9606 Homo sapiens Q9UL18 26523 1SI3, 1SI2 26523 Q9UL18 ...

  17. Oke et al (5).cdr

    African Journals Online (AJOL)

    Timothy Ademakinwa

    2Department of Water Resources Management and Agricultural Meteorology,. Federal ... INTRODUCTION. Groundwater ... isolated areas where soils may be shallow and field ... identified within the watershed are the high forest ..... Environmental Hydrology 14 (5):1-16. Agbo, J.U. ... the Department of Physics, Tai Solarin.

  18. På sporet af 5. C

    DEFF Research Database (Denmark)

    Krøgholt, Ida; Christoffersen, Erik Exe

    2016-01-01

    Borgerscener er landsdelsscenernes niche. Præmissen for scenerne er at bruge teatermediet til at skildre mennesker i deres autentiske liv, og i Lars Ole 5. C på Aarhus Teater leges der med Niels Malmros’ film fra 1973, som 10 århusianske børn i 12 årsalderen bruger som filter for deres egne...

  19. DISSOCIATIVE DISORDERS IN DSM-5

    NARCIS (Netherlands)

    Spiegel, David; Loewenstein, Richard J.; Lewis-Fernandez, Roberto; Sar, Vedat; Simeon, Daphne; Vermetten, Eric; Cardena, Etzel; Dell, Paul F.

    2011-01-01

    Background: We present recommendations for revision of the diagnostic criteria for the Dissociative Disorders (DDs) for DSM-5. The periodic revision of the DSM provides an opportunity to revisit the assumptions underlying specific diagnoses and the empirical support, or lack of it, for the defining

  20. Dissociative disorders in DSM-5

    NARCIS (Netherlands)

    Spiegel, David; Loewenstein, Richard J.; Lewis-Fernandez, Roberto; Sar, Vedat; Simeon, Daphne; Vermetten, Eric; Cardena, Etzel; Dell, Paul F.

    2011-01-01

    Background: We present recommendations for revision of the diagnostic criteria for the Dissociative Disorders (DDs) for DSM-5. The periodic revision of the DSM provides an opportunity to revisit the assumptions underlying specific diagnoses and the empirical support, or lack of it, for the defining

  1. mGluR5

    DEFF Research Database (Denmark)

    Mølck, Christina; Harpsøe, Kasper; Gloriam, David E

    2014-01-01

    Since its discovery in 1992, mGluR5 has attracted significant attention and been linked to several neurological and psychiatric diseases. Ligand development was initially focused on the orthosteric binding pocket, but lack of subtype selective ligands changed the focus to the transmembrane...... allosteric binding pocket. This strategy has resulted in several drug candidates in clinical testing. In the present article we explore the orthosteric and allosteric binding pockets in terms of structure and ligand recognition across the mGluR subtypes and groups, and discuss the clinical potential...... of ligands targeting these pockets. We have performed binding mode analyses of non- and group-selective orthosteric ligands based on molecular docking in mGluR crystal structures and models. For the analysis of the allosteric binding pocket we have combined data from all mGluR5-mutagenesis studies...

  2. Pellissier H5 hydrostatic level

    CERN Document Server

    Imfeld, H L

    2003-01-01

    Conventional spirit leveling using double scale invar rods has been in use at SLAC for some time as the standard method of obtaining very precise height difference information. Typical accuracy of +- 100 (micro)m and better can routinely be achieved. Procedures and software have evolved to the point where the method is relatively fast and reliable. However, recent projects such as the Final Focus Test Beam have pushed the requested vertical positioning tolerances for alignment of quadrupoles to the 30 mu m level. It is apparent that conventional spirit leveling cannot achieve this level of accuracy. To meet the challenge, the alignment group contracted with Pellissier, Inc. to develop a portable hydrostatic leveling system. The H5 grew out of this development effort and is expected to provide the needed accuracy and ease of use required for such vertical positioning projects. The H5 hydrostatic level is a portable instrument that under ideal operating conditions will provide elevation differences with an accu...

  3. [Cardiac toxicity of 5-fluorouracil].

    Science.gov (United States)

    Fournier, C; Benahmed, M; Blondeau, M

    1989-02-01

    A 67 year-old patient receives 5-fluorouracil for vocal chord cancer. During the perfusion, atypical angina pain occurs, accompanied with offset of ST above the baseline in standard leads and in V4 through V6. The pain subsides spontaneously in 45 minutes. These ECG alterations are followed 48 hours later by diffuse inverted T waves with lengthened QT. Cardiac ultrasonography and isotopic angiography do not show any abnormality of the left ventricular function, but myocardial tomoscintigraphy with labelled thallium show a lower hypofixation on exertion. The cardiac toxicity of 5-fluorouracil is in frequent. It is usually believed that it involves a coronary spasm, as suggested by the ECG tracing in the reported cases. The incident, which may be painful or painless, may result in a myocardial infarction or even sudden death during the perfusion. Therefore, it is advisable to discontinue the treatment as soon as an angina-type pain occurs.

  4. 5G Wireless Communication Systems

    OpenAIRE

    Saddam Hossain

    2013-01-01

    As a subscriber becomes more aware of the mobile phone technology, he/she will seek for anappropriate package all together, including all the advanced features of a cellular phone can have. Hence, the search for new technology is always the main intention of the prime cell phone giants to out innovate their competitors. In addition, the main purpose of the fifth generation wireless networks (5G Wireless networks) is planned to design the best wireless world that is free from limitations...

  5. DSM-5 Boom o esperanza

    OpenAIRE

    2013-01-01

    After fourteen years of review, the expected update of the Diagnostic and Statistical Manual of Mental Disorders (DSM) has generated great controversy among psychiatrists and psychologists around the world. So far, it is known that the new version (DSM-5), officially presented for the first time in May 18 of this year as part of the annual meeting of the American Psychiatric Association (APA), will be available in Spanish language at the beginning of 2014. However, the reviews and comments fo...

  6. Crack Propagation of Corona 5.

    Science.gov (United States)

    1986-07-01

    for 5 minutes and air cooled. Annealed panels were then descaled by grit blasting and pickled in nitric-hydrofluoric mixed acid to remove the oxygen...enriched surface layer of metal. The anneal, grit blast, and pickle were repeated after each cycle of cold rolling. In general, the cold rolling went...F. /Yolton Research Engineer Approved by: 1J. H. Moll Technical Director P/M & Titanium . E. J. Dulis President _ 76 mbk. SRockwell International

  7. Main: SORLREP5AT [PLACE

    Lifescience Database Archive (English)

    Full Text Available SORLREP5AT S000490 18-November-2005 (last modified) kehi one of Sequences Over-Repr...esented in Light-Repressed Promoters (SORLREPs) in Arabidopsis; Computationally identified phyA-repressed mo...tifs; See also S000487, S000488, S000489 (all SORLREPs); and also S000482, S000483, S000484, S000485, S000486 (all SORLIPs); phyA; phytochrome; light; Arabidopsis thaliana TTGCATGACT ...

  8. MCNP(TM) Version 5.

    Energy Technology Data Exchange (ETDEWEB)

    Cox, L. J. (Lawrence J.); Barrett, R. F. (Richard F.); Booth, Thomas Edward; Briesmeister, Judith F.; Brown, F. B. (Forrest B.); Bull, J. S. (Jeffrey S.); Giesler, G. C. (Gregg Carl); Goorley, J. T. (John T.); Mosteller, R. D. (Russell D.); Forster, R. A. (R. Arthur); Post, S. E. (Susan E.); Prael, R. E. (Richard E.); Selcow, Elizabeth Carol,; Sood, A. (Avneet)

    2002-01-01

    The Monte Carlo transport workhorse, MCNP, is undergoing a massive renovation at Los Alamos National Laboratory (LANL) in support of the Eolus Project of the Advanced Simulation and Computing (ASCI) Program. MCNP Version 5 (V5) (expected to be released to RSICC in Spring, 2002) will consist of a major restructuring from FORTRAN-77 (with extensions) to ANSI-standard FORTRAN-90 with support for all of the features available in the present release (MCNP-4C2/4C3). To most users, the look-and-feel of MCNP will not change much except for the improvements (improved graphics, easier installation, better online documentation). For example, even with the major format change, full support for incremental patching will still be provided. In addition to the language and style updates, MCNP V5 will have various new user features. These include improved photon physics, neutral particle radiography, enhancements and additions to variance reduction methods, new source options, and improved parallelism support (PVM, MPI, OpenMP).

  9. Comparing earthquake models for the Corinth rift for Mw>=5.5/6/6.5 (Greece)

    Science.gov (United States)

    Boiselet, Aurélien; Scotti, Oona; Lyon-Caen, Hélène; Ford, Mary; Meyer, NIcolas; Bernard, Pascal

    2013-04-01

    The Corinth rift (Greece) is identified as a site of major importance for earthquake studies in Europe, producing one of the highest seismic activity and strain in the Euro-Mediterranean region. It is characterized by an asymmetrical structure, with the most active normal faults dipping north and a north-south extension rate measured by GPS increasing from 0.6 mm/year in the eastern part of the rift to 15 mm/year in the western part. Frequent seismic swarms and destructive earthquakes are observed in this area. The Corinth rift Laboratory (CRL, http://crlab.eu) european project investigates fault mechanics, its relationship with earthquakes, fluid flow and the related hazards in the western part of the rift, covering an area about 50 km by 40 km, between the city of Patras to the west and the city of Aigion to the east. As part of this project, within the CRL-SISCOR group, we construct earthquake forecast models (EFM) for M>=5.5/6/6.5 events of the Corinth rift area based on the in-depth seismotectonic studies available for this region. We first present the methodology used to construct the earthquake and fault databases and to quantify the associated uncertainties. We then propose EFM following two approaches: one based on the definition of seimotectonic areas with similar geologic or strain characteristics, the second one based on the definition of fault sources mapped at the surface as well as blind ones. In order to compute the probability of occurrence for M>=5.5/6/6.5 for seismotectonic areas, we analyse two earthquake catalogues available for Greece (National Observatory of Athens, Thessaloniki), apply two declustering methods (Reasenberg and Gardner) to construct a Poissonian earthquake catalogue and test the influence of the minimal magnitude (3.5; 4.0). We compare the impact of maximum magnitude and corner magnitude (Kagan 1997, 2002) estimations. We then apply the Weichert method to estimate the probability of occurrence of M>=5.5/6/6.5 based on

  10. 3,3′,5,5′-Tetranitrobiphenyl

    Directory of Open Access Journals (Sweden)

    M. A. Avery

    2009-05-01

    Full Text Available The title compound, C12H6N4O8, is a biphenyl system that was synthesized as a building block for a new series of antimalarial compounds. The aromatic rings are oriented at a dihedral angle of 45.5 (2°, and intermolecular short O...O contacts form a chain along the b axis. The strength of the interactions involved in this chain cause one of the rings to be slightly distorted, with the torsion angle between the nitro groups being 23.4 (2°, whereas, in the other ring, both nitro systems are parallel, forming an angle of 9.6 (2° with the plane of the aromatic ring to which they are bound. Furthermore, the three ring C atoms around the ring–ring linkage belong to a plane inclined by 4.5 (1° in relation to the plane containing the other three C atoms, i.e. (NO2–C—C—C(NO2. This distortion of the ring causes uncommonly short intermolecular O...O [3.038 (2 Å] and O...C [3.000 (4 and 3.214 (1 Å] contacts.

  11. The EGS5 Code System

    Energy Technology Data Exchange (ETDEWEB)

    Hirayama, Hideo; Namito, Yoshihito; /KEK, Tsukuba; Bielajew, Alex F.; Wilderman, Scott J.; U., Michigan; Nelson, Walter R.; /SLAC

    2005-12-20

    In the nineteen years since EGS4 was released, it has been used in a wide variety of applications, particularly in medical physics, radiation measurement studies, and industrial development. Every new user and every new application bring new challenges for Monte Carlo code designers, and code refinements and bug fixes eventually result in a code that becomes difficult to maintain. Several of the code modifications represented significant advances in electron and photon transport physics, and required a more substantial invocation than code patching. Moreover, the arcane MORTRAN3[48] computer language of EGS4, was highest on the complaint list of the users of EGS4. The size of the EGS4 user base is difficult to measure, as there never existed a formal user registration process. However, some idea of the numbers may be gleaned from the number of EGS4 manuals that were produced and distributed at SLAC: almost three thousand. Consequently, the EGS5 project was undertaken. It was decided to employ the FORTRAN 77 compiler, yet include as much as possible, the structural beauty and power of MORTRAN3. This report consists of four chapters and several appendices. Chapter 1 is an introduction to EGS5 and to this report in general. We suggest that you read it. Chapter 2 is a major update of similar chapters in the old EGS4 report[126] (SLAC-265) and the old EGS3 report[61] (SLAC-210), in which all the details of the old physics (i.e., models which were carried over from EGS4) and the new physics are gathered together. The descriptions of the new physics are extensive, and not for the faint of heart. Detailed knowledge of the contents of Chapter 2 is not essential in order to use EGS, but sophisticated users should be aware of its contents. In particular, details of the restrictions on the range of applicability of EGS are dispersed throughout the chapter. First-time users of EGS should skip Chapter 2 and come back to it later if necessary. With the release of the EGS4 version

  12. ALMA Band 5 Cartridge Performance

    Science.gov (United States)

    Billade, Bhushan; Lapkin, I.; Nystrom, O.; Sundin, E.; Fredrixon, M.; Finger, R.; Rashid, H.; Desmaris, V.; Meledin, D.; Pavolotsky, A.; Belitsky, Victor

    2010-03-01

    Work presented here concerns the design and performance of the ALMA Band 5 cold cartridge, one of the 10 frequency channels of ALMA project, a radio interferometer under construction at Atacama Desert in Chile. The Band 5 cartridge is a dual polarization receiver with the polarization separation performed by orthomode transducer (OMT). For each polarization, Band 5 receiver employs sideband rejection (2SB) scheme based on quadrature layout, with SIS mixers covering 163-211 GHz with 4-8 GHz IF. The LO injection circuitry is integrated with mixer chip and is implemented on the same substrate, resulting in a compact 2SB assembly. Amongst the other ALMA bands, the ALMA Band 5 being the lowest frequency band that uses all cold optics, has the largest mirror. Consequently, ALMA Band 5 mirror along with its support structure leaves very little room for placing OMT, mixers and IF subsystems. The constraints put by the size of cold optics and limited cartridge space, required of us to revise the original 2SB design and adopt a design where all the components like OMT, mixer, IF hybrid, isolators and IF amplifier are directly connected to each other without using any co-ax cables in-between. The IF subsystem uses the space between 4 K and 15 K stage of the cartridge and is thermally connected to 4 K stage. Avoiding co-ax cabling required use of custom designed IF hybrid, furthermore, due to limited cooling capacity at 4 K stage, resistive bias circuitry for the mixers is moved to 15 K stage and the IF hybrid along with an integrated bias-T is implemented using superconducting micro-strip lines. The E-probes for both LO and RF waveguide-to-microstrip transitions are placed perpendicular to the wave direction (back-piece configuration). The RF choke at the end of the probes provides a virtual ground for the RF/LO signal, and the choke is DC grounded to the chassis. The on-chip LO injection is done using a microstrip line directional coupler with slot-line branches in the

  13. Considering PTSD for DSM-5.

    Science.gov (United States)

    Friedman, Matthew J; Resick, Patricia A; Bryant, Richard A; Brewin, Chris R

    2011-09-01

    This is a review of the relevant empirical literature concerning the DSM-IV-TR diagnostic criteria for PTSD. Most of this work has focused on Criteria A1 and A2, the two components of the A (Stressor) Criterion. With regard to A1, the review considers: (a) whether A1 is etiologically or temporally related to the PTSD symptoms; (b) whether it is possible to distinguish "traumatic" from "non-traumatic" stressors; and (c) whether A1 should be eliminated from DSM-5. Empirical literature regarding the utility of the A2 criterion indicates that there is little support for keeping the A2 criterion in DSM-5. The B (reexperiencing), C (avoidance/numbing) and D (hyperarousal) criteria are also reviewed. Confirmatory factor analyses suggest that the latent structure of PTSD appears to consist of four distinct symptom clusters rather than the three-cluster structure found in DSM-IV. It has also been shown that in addition to the fear-based symptoms emphasized in DSM-IV, traumatic exposure is also followed by dysphoric, anhedonic symptoms, aggressive/externalizing symptoms, guilt/shame symptoms, dissociative symptoms, and negative appraisals about oneself and the world. A new set of diagnostic criteria is proposed for DSM-5 that: (a) attempts to sharpen the A1 criterion; (b) eliminates the A2 criterion; (c) proposes four rather than three symptom clusters; and (d) expands the scope of the B-E criteria beyond a fear-based context. The final sections of this review consider: (a) partial/subsyndromal PTSD; (b) disorders of extreme stress not otherwise specified (DESNOS)/complex PTSD; (c) cross- cultural factors; (d) developmental factors; and (e) subtypes of PTSD. © 2010 Wiley-Liss, Inc.

  14. Reference Model 5 (RM5): Oscillating Surge Wave Energy Converter

    Energy Technology Data Exchange (ETDEWEB)

    Yu, Y. H. [National Renewable Energy Lab. (NREL), Golden, CO (United States); Jenne, D. S. [National Renewable Energy Lab. (NREL), Golden, CO (United States); Thresher, R. [National Renewable Energy Lab. (NREL), Golden, CO (United States); Copping, A. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Geerlofs, S. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Hanna, L. A. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)

    2015-01-01

    This report is an addendum to SAND2013-9040: Methodology for Design and Economic Analysis of Marine Energy Conversion (MEC) Technologies. This report describes an Oscillating Water Column Wave Energy Converter (OSWEC) reference model design in a complementary manner to Reference Models 1-4 contained in the above report. A conceptual design for a taut moored oscillating surge wave energy converter was developed. The design had an annual electrical power of 108 kilowatts (kW), rated power of 360 kW, and intended deployment at water depths between 50 m and 100 m. The study includes structural analysis, power output estimation, a hydraulic power conversion chain system, and mooring designs. The results were used to estimate device capital cost and annual operation and maintenance costs. The device performance and costs were used for the economic analysis, following the methodology presented in SAND2013-9040 that included costs for designing, manufacturing, deploying, and operating commercial-scale MEC arrays up to 100 devices. The levelized cost of energy estimated for the Reference Model 5 OSWEC, presented in this report, was for a single device and arrays of 10, 50, and 100 units, and it enabled the economic analysis to account for cost reductions associated with economies of scale. The baseline commercial levelized cost of energy estimate for the Reference Model 5 device in an array comprised of 10 units is $1.44/kilowatt-hour (kWh), and the value drops to approximately $0.69/kWh for an array of 100 units.

  15. Differential neuroprotective effects of 5'-deoxy-5'-methylthioadenosine.

    Directory of Open Access Journals (Sweden)

    Beatriz Moreno

    Full Text Available BACKGROUND: 5'-deoxy-5'-methylthioadenosine (MTA is an endogenous compound produced through the metabolism of polyamines. The therapeutic potential of MTA has been assayed mainly in liver diseases and, more recently, in animal models of multiple sclerosis. The aim of this study was to determine the neuroprotective effect of this molecule in vitro and to assess whether MTA can cross the blood brain barrier (BBB in order to also analyze its potential neuroprotective efficacy in vivo. METHODS: Neuroprotection was assessed in vitro using models of excitotoxicity in primary neurons, mixed astrocyte-neuron and primary oligodendrocyte cultures. The capacity of MTA to cross the BBB was measured in an artificial membrane assay and using an in vitro cell model. Finally, in vivo tests were performed in models of hypoxic brain damage, Parkinson's disease and epilepsy. RESULTS: MTA displays a wide array of neuroprotective activities against different insults in vitro. While the data from the two complementary approaches adopted indicate that MTA is likely to cross the BBB, the in vivo data showed that MTA may provide therapeutic benefits in specific circumstances. Whereas MTA reduced the neuronal cell death in pilocarpine-induced status epilepticus and the size of the lesion in global but not focal ischemic brain damage, it was ineffective in preserving dopaminergic neurons of the substantia nigra in the 1-methyl-4-phenyl-1,2,3,6-tetrahydro-pyridine (MPTP-mice model. However, in this model of Parkinson's disease the combined administration of MTA and an A2A adenosine receptor antagonist did produce significant neuroprotection in this brain region. CONCLUSION: MTA may potentially offer therapeutic neuroprotection.

  16. Manga studio 5 beginner's guide

    CERN Document Server

    Rhodes, Richard

    2014-01-01

    Using a step-by-step approach, this book will lead you through the process of building up complex, multi-page comic/Manga art, along with industry insights along the way. ""Manga Studio Beginner's Guide"" is for beginners in comic creation. The more you know about how comics are made, the better you will be, but it's not essential to get the most out of this book. Even if you're a professional comic artist, this book will get you up to speed on using Manga Studio 5.

  17. Main: FBB5 [TP Atlas

    Lifescience Database Archive (English)

    Full Text Available FBB5 Elucidation of the mechanism of high-order cellular functions achieved by non-coding RNAs Non-codin...g RNA-protein complexes Osamu Nureki Institute of Medical Science, The University of To...kyo - Among RNA molecules, there are functional RNAs called non-coding RNAs (ncRNAs) that are not translated into protein...their functions - Elucidation of ncRNAs functions could contribute to the understanding of fundamental biolo...gy as well as biomedical applications - We have succeeded in the structure determination of a variety of tRN

  18. 5-Dimensional Extended Space Model

    OpenAIRE

    Tsipenyuk, D. Yu.; Andreev, V. A.

    2006-01-01

    We put forward an idea that physical phenomena have to be treated in 5-dimensional space where the fifth coordinate is the interval S. Thus, we considered the (1+4) extended space G(T;X,Y,Z,S). In addition to Lorentz transformations (T;X), (T;Y), (T;Z) which are in (1+3)-dimensional Minkowski space, in the proposed (1+4)d extended space two other types of transformations exist in planes (T,S); (X,S), (Y,S), (Z,S) that converts massive particles into massless and vice versa. We also consider e...

  19. National 5 maths with answers

    CERN Document Server

    Alcorn, David

    2013-01-01

    Teach lessons that suit the individual needs of your classroom with this SQA endorsed and flexibly structured resource that provides a suggested approach through all three units. This 'with answers' version textbook completely covers the latest National 5 syllabus. Each chapter includes summaries of key points and worked examples with explanatory notes showing how skills are applied. Section Reviews presented in non-calculator and calculator formats provide students with the opportunity to consolidate skills acquired over a number of chapters. There are plenty of exercises and invaluable exam

  20. Advances in magnetic resonance 5

    CERN Document Server

    Waugh, John S

    2013-01-01

    Advances in Magnetic Resonance, Volume 5 deals with the interpretation of ESR spectra and provides descriptions of experimental apparatus. This book discusses the halogen hyperfine interactions; organic radicals in single crystals; pulsed-Fourier-transform nuclear magnetic resonance spectrometer; and inhomogenizer and decoupler. The spectrometers for multiple-pulse NMR; weak collision theory of relaxation in the rotating frame; and spin Hamiltonian for the electron spin resonance of irradiated organic single crystals are also deliberated. This text likewise covers the NMR in helium three and m

  1. National 5 maths with answers

    CERN Document Server

    Alcorn, David

    2013-01-01

    Teach lessons that suit the individual needs of your classroom with this SQA endorsed and flexibly structured resource that provides a suggested approach through all three units.- Covers the new specification with all the new topics in the SQA examinations- Provides thorough exam preparation, with graded Practice Exercises- Organised to make it easy to plan, manage and monitor student progressThis 'with answers' version textbook completely covers the latest National 5 syllabus. Each chapter includes summaries of key points and worked examples with explanatory not

  2. 75 FR 23574 - Airworthiness Directives; CFM International, S.A. CFM56-5B1/P, -5B2/P, -5B3/P, -5B3/P1, -5B4/P...

    Science.gov (United States)

    2010-05-04

    ..., S.A. CFM56-5B1/P, - 5B2/P, -5B3/P, -5B3/P1, -5B4/P, -5B5/P, -5B6/P, -5B7/P, -5B8/P, -5B9/P, -5B1/2P... Docket Operations office between 9 a.m. and 5 p.m., Monday through Friday, except Federal holidays. The... CFM International, S.A. CFM56-5B1/P, - 5B2/P, -5B3/P, -5B3/P1, -5B4/P, -5B5/P,......

  3. 40 CFR 721.5645 - Pentane 1,1,1,2,3,4,4,5,5,5,-decafluoro.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Pentane 1,1,1,2,3,4,4,5,5,5... Specific Chemical Substances § 721.5645 Pentane 1,1,1,2,3,4,4,5,5,5,-decafluoro. (a) Chemical substance and significant new uses subject to reporting. (1) The chemical substance identified as pentane 1,1,1,2,3,4,4,5,5...

  4. Electrochemical and photoelectrochemical oxidation of 5-hydroxymethylfurfural to 2,5-furandicarboxylic acid and 2,5-diformylfuran

    Energy Technology Data Exchange (ETDEWEB)

    Choi, Kyoung-Shin; Cha, Hyun Gil

    2017-03-21

    Electrochemical and photoelectrochemical cells for the oxidation of 5-hydroxymethylfurfural to 2,5-furandicarboxylic acid and/or 2,5-diformylfuran are provided. Also provided are methods of using the cells to carry out the electrochemical and photoelectrochemical oxidation of 5-hydroxymethylfurfural to 2,5-furandicarboxylic acid and/or 2,5-diformylfuran.

  5. Electrochemical and photoelectrochemical oxidation of 5-hydroxymethylfurfural to 2,5-furandicarboxylic acid and 2,5-diformylfuran

    Science.gov (United States)

    Choi, Kyoung-Shin; Cha, Hyun Gil

    2017-03-21

    Electrochemical and photoelectrochemical cells for the oxidation of 5-hydroxymethylfurfural to 2,5-furandicarboxylic acid and/or 2,5-diformylfuran are provided. Also provided are methods of using the cells to carry out the electrochemical and photoelectrochemical oxidation of 5-hydroxymethylfurfural to 2,5-furandicarboxylic acid and/or 2,5-diformylfuran.

  6. Domain Walls in SU(5)

    CERN Document Server

    Poghosian, L E; Pogosian, Levon; Vachaspati, Tanmay

    2000-01-01

    We consider the Grand Unified SU(5) model with a small or vanishing cubic term in the adjoint scalar field in the potential. This gives the model an approximate or exact Z$_2$ symmetry whose breaking leads to domain walls. The simplest domain wall has the structure of a kink across which the Higgs field changes sign ($\\Phi \\to -\\Phi$) and inside which the full SU(5) is restored. The kink is shown to be perturbatively unstable for all parameters. We then construct a domain wall solution that is lighter than the kink and show it to be perturbatively stable for a range of parameters. The symmetry in the core of this domain wall is smaller than that outside. The interactions of the domain wall with magnetic monopole is discussed and it is shown that magnetic monopoles with certain internal space orientations relative to the wall pass through the domain wall. Magnetic monopoles in other relative internal space orientations are likely to be swept away on collision with the domain walls, suggesting a scenario where ...

  7. Metal complexes with 5-aminotetrazole

    Energy Technology Data Exchange (ETDEWEB)

    Lavrenova, L.G.; Larionov, S.V.; Grankina, Z.A.; Ikorskij, V.N. (AN SSSR, Novosibirsk. Inst. Neorganicheskoj Khimii)

    1983-01-01

    Nitrate and chloride complexes of Co(2), Ni(2), Cu(2), Cd(2), Hg(2), Pb(2) with 5 aminotetrazole (ATE) and compounds Zn(ATE')/sub 2/ and Cd(ATEE')/sub 2/, where ATE' is a 5 aminotetrazole anion, were prepared. On the base of spectroscopic data (spectrophotometry, IR- spectra, EPR and magnetic measurements assumptions on M(2) coordination in complexes are made. Most probably ATE is a bridge ligand which is toined by two nitrogen atoms to various M(2) ions. In Co(2), Ni(2) and Cu(ATE)/sub 3/-Cl/sub 2/ compounds the metal has a distorted actahedral coordination and forms MN/sub 6/ unit, which suggests the interaction of metal ions with ATE nitrogen atoms along the Z-axis. In the Cu(ATE)/sub 2/(NO/sub 3/)/sub 2/ octahedral complex the CuN/sub 4/O/sub 2/ coordination unit is realized at the expense of participation of nitratogroups in coordination.

  8. EPIDURAL ANESTHESIA BUPIVACAINE 0.5%+ KCL 5 MEQ/L VS BUPIVACAINE 0.5%

    Directory of Open Access Journals (Sweden)

    F ALAVI

    2000-03-01

    Full Text Available Background. Although epidural anesthesia is a Successful method for most surgical procedures on lower extremities and lower abdomen. It is not so favorable because of it's slow onset and differential sensory and motor block. In order to solve this problem effects of additive KCl (5 meq/L into Bupivacaine 0.5 percent according to onset, intensity, duration of block and homodynamic changes during epidural anesthesia will be investigated through the present study. Methods. All the ASA I or II patients at medical centers of Isfahan university of medical sciences throughout 1378, candidate for elective Surgical procedures on lower extremities and lower abdomen with no contraindication for epidural anesthesia were Subdivided into Case (35 patients and Control (35 patients groups in a random manner to perform a double blind clinical trial. Epidural anesthesia applied to cases (by Bupivacaine 0.5 percent+ KCl 5meq/L and controls (by Bupivacaine 0.5 percent. Under identical conditions, data indicating basic MAP, basic heart rate and their changes as well as the onset, duration and intensity of motor and sensory block, were obtained and recorded by the anesthesiologist. Quantitative & qualitative variables were examined by T.test and X2 test respectively. Findings. Sensory onset for cases (8.22±1.43Min was faster than controls (11.56±1.45Min (P<0.005. Motor onset for cases (12.77 ± 1.83Min was faster than controls (20.24±1.71Min (P < 0.005. Sensory duration for cases (l86.34±8.37 Min was longer than controls (162.17±7.47Min (P<0.005. Motor duration for cases (106.25±13.50 Min was longer than controls (77.60 ± 9.94Min (P < 0.005.Intensity of sensory block for cases was greater than controls (P < 0.01. Intensity of motor block for cases was greater than controls (P < 0.001. Mean heart rate changes for cases (7.28±9.37 percent and controls (7 ± 8 percent were not different (P < 0.8. Mean decrease in MAP for cases (20.17 ± 2.10n percent was

  9. Balanced {C_4, C_5}-Quatrefoil Systems

    OpenAIRE

    USHIO, Kazuhiko

    2004-01-01

    In graph theory, the decomposition problems of graphs are very important topics. Various types of decompositions of many graphs can be seen in the literature of gaph theory. We give the necessary and sufficient condition for the existence of a balanced {C_4, C_5}-quatrefoil decomposition of K_n for each of (C_4, C_4, C_4, C_4)-quatrefoil, (C_4, C_4, C_4, C_5)-quatrefoil, (C_4, C_4, C_5, C_5)-quatrefoil, (C_4, C_5, C_5, C_5)-quatrefoil, and (C_5, C_5, C_5, C_5)-quatrefoil. These decompositions...

  10. 5.1.Viral disease

    Institute of Scientific and Technical Information of China (English)

    1993-01-01

    930226 Cloning and characterization of thegenome of human papilloma virus type 16 inChina.ZHANG Wei (张伟),et al.Cancer In-stit,CAMS,Beijing,100021.Natl Med J Chin1993;73(4):229—231.The cloning and characterization of a wholegenome of human papillomavirus type 16 (7.9kb) and a 5.4kb subgenomic fragment werestudied.They were cloned after insertion inplasmid pAt153,using its unique BamH1 site.The full—length genome and subgenomic frag-ment were designated HPV16Z and HPV16F re-spectively.After analysis by 16 endonucleases,no new restriction site was found in HPV16Z incomparison with the standard strain.A newBamH1 site was observed at the 750 bp position

  11. [Anxiety disorders in DSM-5].

    Science.gov (United States)

    Márquez, Miguel

    2014-01-01

    The fifth edition of Diagnostic and Statistical Manual, the DSM-5 appeared officially in May 2013 during the development of the 166th Annual Meetingof the American Psychiatric Association (APA) in San Francisco. The drafting process was long and complex; much of the debate became public so that the expectations were great. And it must be said that the new edition did not disappoint, as many changes were made in relation to their predecessors. In Chapter of Anxiety Disorders, which is reviewed in this article, the changes were significant. Obsessive-compulsive disorder and Stress-related disorders were excluded and new clinical pictures, such as separation anxiety disorder and selective mutism, were included. And took place was the long awaited split between panic disorder and agoraphobia, now two separate disorders.

  12. Multiplicity in 5 Msun Stars

    CERN Document Server

    Evans, Nancy Remage

    2011-01-01

    Multiwavelength opportunities have provided important new insights into the properties of binary/multiple 5 Msun stars. The combination of cool evolved primaries and hot secondaries in Cepheids (geriatric B stars) has yielded detailed information about the distribution of mass ratios. It has also provided a surprisingly high fraction of triple systems. Ground-based radial velocity orbits combined with satellite data from Hubble, FUSE, IUE, and Chandra can provide full information about the systems, including the masses. In particular, X-ray observations can identify low mass companions which are young enough to be physical companions. These multiwavelength observations provide important tests for star formation scenarios including diffenences between high and low mass results and differences between close and wide binaries.

  13. On rank 5 projective planes

    Directory of Open Access Journals (Sweden)

    Otto Bachmann

    1984-01-01

    Full Text Available In this paper we continue the study of projective planes which admit collineation groups of low rank (Kallaher [1] and Bachmann [2,3]. A rank 5 collineation group of a projective plane ℙ of order n≠3 is proved to be flag-transitive. As in the rank 3 and rank 4 case this implies that is ℙ not desarguesian and that n is (a prime power of the form m4 if m is odd and n=m2 with m≡0mod4 if n is even. Our proof relies on the classification of all doubly transitive groups of finite degree (which follows from the classification of all finite simple groups.

  14. Asignaturas pendientes del DSM-5

    OpenAIRE

    Artigas, Josep, 1948-; Paula Pérez, Isabel, 1970-

    2015-01-01

    El presente artículo analiza las críticas generadas a partir de la publicación del Manual diagnóstico y estadístico de los trastornos mentales, quinta edición (DSM-5), ya anunciadas parcialmente durante las últimas fases de su elaboración. Una parte de las críticas se ha centrado en los cambios de los criterios diagnósticos para determinados trastornos y en la incorporación al DSM de nuevas entidades. Sin embargo, otra vertiente crítica va dirigida a la falta de validez de los diagnósticos de...

  15. 5-foot Vertical Wind Tunnel

    Science.gov (United States)

    1932-01-01

    The researcher is sitting above the exit cone of the 5-foot Vertical Wind Tunnel and is examining the new 6-component spinning balance. This balance was developed between 1930 and 1933. It was an important advance in the technology of rotating or rolling balances. As M.J. Bamber and C.H. Zimmerman wrote in NACA TR 456: 'Data upon the aerodynamic characteristics of a spinning airplane may be obtained in several ways; namely, flight tests with full-scale airplanes, flight tests with balanced models, strip-method analysis of wind-tunnel force and moment tests, and wind-tunnel tests of rotating models.' Further, they note: 'Rolling-balance data have been of limited value because it has not been possible to measure all six force and moment components or to reproduce a true spinning condition. The spinning balance used in this investigation is a 6-component rotating balance from which it is possible to obtain wind-tunnel data for any of a wide range of possible spinning conditions.' Bamber and Zimmerman described the balance as follows: 'The spinning balance consists of a balance head that supports the model and contains the force-measuring units, a horizontal turntable supported by streamline struts in the center of the jet and, outside the tunnel, a direct-current driving motor, a liquid tachometer, an air compressor, a mercury manometer, a pair of indicating lamps, and the necessary controls. The balance head is mounted on the turntable and it may be set to give any radius of spin between 0 and 8 inches.' In an earlier report, NACA TR 387, Carl Wenzinger and Thomas Harris supply this description of the tunnel: 'The vertical open-throat wind tunnel of the National Advisory Committee for Aeronautics ... was built mainly for studying the spinning characteristics of airplane models, but may be used as well for the usual types of wind-tunnel tests. A special spinning balance is being developed to measure the desired forces and moments with the model simulating the actual

  16. Sibelius 5 来了

    Institute of Scientific and Technical Information of China (English)

    电音研究所

    2008-01-01

    @@ 与Digidesign大家庭的所有产品一样,Sibelius 5打谱软件带来了最新技术与用户所要求的改进--现在它使用更加方便了. 在介绍新功能之前,让我们回顾一下历史.在Sibelius加入Avid家庭后,我们为Pro Tools 7.3加入了一个方便的功能叫"发送到Sibelius",可以在"File"目录中选择"发送到Sibelius",然后Pro Tools会自动弹出Sibehus.

  17. F-5M DTA Program

    Directory of Open Access Journals (Sweden)

    Daniel Ferreira V. Mattos

    2009-01-01

    Full Text Available The Brazilian F-5 was submitted to avionics and weapons upgrade. This “new” aircraft has proven to be heavier and more capable. A comprehensive damage tolerance analysis is being performed to evaluate how the new mission profiles and weight distribution may affect the airframe structural integrity. Operational data were collected at the Brazilian Air Force Bases where the fighter is flown. Software was developed in order to acquire, filter and analyze flight data. This data was used for comparison between the pre and post modernization mission profiles and to determine the stress level in each of the known aircraft fatigue critical locations (FCL. The results show that the change in aircraft weight and balance and the new operational profile can significantly change the inspection intervals of certain fatigue critical locations of the structure. A preliminary result for the horizontal tail has shown that this component will have a much more restrictive maintenance schedule to assure flight safety.

  18. VMWare Workstation 6.5

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    VMware Workstation 6.5近日正式发布。该版本的最大亮点在于支持虚拟环境中的3D加速,和新增的Unity模式。前者能够给虚拟环境提供更好的性能和表现,而后者能够提供一种在虚拟机和宿主机之间的无缝应用模式。另外,在易用性方面也有了很大的提高,Linux下具备了更好的图形化配置界面,NAT网络性能和文件共享、USB设备性能方面也有了很大的提高。

  19. DSM-5: ATTENUATED PSYCHOSIS SYNDROME?

    Directory of Open Access Journals (Sweden)

    Eduardo Fonseca-Pedrero

    2013-09-01

    Full Text Available Psychotic syndrome includes several devastating mental disorders characterized by a rupture of higher mental functions. The signs and symptoms of psychosis begin in adolescence or early adulthood and usually begin gradually and progress over time. Attenuated psychosis syndrome is a new DSM-5 diagnostic proposal which deals with identifying people at high-risk mental state (ARMS/UHR which may be a predictor of conversion to psychosis. The potential benefit would be that if psychotic disorder is treated more effectively in its early stages, it could produce a lasting beneficial effect that probably could not be achieved with later intervention. This syndrome has generated intense discussion in specialized scientific and professional forums, crisscrossing arguments in favor and against its inclusion. HRMS is preferentially evaluated in the adolescent or young adult population. HRMS evolution is associated with a higher rate of transition toward nonaffective psychosis, although it can evolve toward other mental disorders, remain stable or remit over time. Empirical evidence shows that early intervention seems to have a certain beneficial effect, although for now the results are still insufficient and contradictory. The lack of specificity of symptoms in predicting psychosis, presence of certain limitations (e.g., stigmatization, results found in early interventions and lack of empirical evidence, have led to include the attenuated psychosis syndrome in the DSM-5 Appendix III. The main benefits and limitations of including this supposed category, possible lessons learned from this type of study and future lines of action are discussed in the light of these findings.

  20. TASK 2.5.5 NATURAL EXPOSURE TESTING IN CALIFORNIA

    Energy Technology Data Exchange (ETDEWEB)

    Miller, William A [ORNL; Cheng, Mengdawn [ORNL; New, Joshua Ryan [ORNL; Ronnen, Levinson [Lawrence Berkeley National Laboratory (LBNL); Akbari, Hashem [Lawrence Berkeley National Laboratory (LBNL); Berhahl, Paul [Lawrence Berkeley National Laboratory (LBNL)

    2010-03-01

    Airborne particulate matter that settles on a roof can either reflect or absorb incoming solar radiation, dependent on the chemical content and size of the particles. These light scattering and absorption processes occur within a few microns of the surface, and can affect the solar reflectance of the roof. Wilkes et al. (2000) tested 24 different roof coatings on a low-slope test stand and observed about a 25% decrease in the solar reflectance of white-coated and aluminum-coated surfaces as the time of exposure increased; however, the decrease leveled off after 2 years. SPRI Inc. and its affiliates studied the effect of climatic exposure on the surface properties of white thermoplastic single-ply membranes and determined that membranes lose from 30 to 50% of their reflectance over 3 years (Miller et al. 2002). The CMRC and its affiliates AISI, NamZAC, MBMA, MCA and NCCA exposed unpainted and painted metal roofing on both steep- and low-slope test roofs and found that after 3 years, the painted polyvinylidene fluoride (PVDF) metal roofs lost less than 5% of their original reflectance (Miller et al. 2004). The results of the three different weathering studies are very interesting in terms of their solar reflectance after 3 years of exposure. The white thermoplastic membrane and white ceramic coating with white topcoat had original reflectance measures that were about 20 percentage points higher than the painted metal; however, after 3-years of field exposure the solar reflectance of the painted metal exceeds that of the thermoplastic membrane and equals that of the coating. The long-term loss of reflectance appears driven by the ability of the particulate matter to cling to the roof and resist being washed off by wind and or rain. Miller et al. (2002) discovered that aerosol deposition introduced biomass of complex microbial consortia onto the test roofs and the combination of contaminants and biomass accelerated the loss of solar reflectance for the thermoplastic

  1. MEK5/ERK5 signaling inhibition increases colon cancer cell sensitivity to 5-fluorouracil through a p53-dependent mechanism

    Science.gov (United States)

    Pereira, Diane M.; Simões, André E. S.; Gomes, Sofia E.; Castro, Rui E.; Carvalho, Tânia; Rodrigues, Cecília M. P.; Borralho, Pedro M.

    2016-01-01

    The MEK5/ERK5 signaling pathway is emerging as an important contributor to colon cancer onset, progression and metastasis; however, its relevance to chemotherapy resistance remains unknown. Here, we evaluated the impact of the MEK5/ERK5 cascade in colon cancer cell sensitivity to 5-fluorouracil (5-FU). Increased ERK5 expression was correlated with poor overall survival in colon cancer patients. In colon cancer cells, 5-FU exposure impaired endogenous KRAS/MEK5/ERK5 expression and/or activation. In turn, MEK5 constitutive activation reduced 5-FU-induced cytotoxicity. Using genetic and pharmacological approaches, we showed that ERK5 inhibition increased caspase-3/7 activity and apoptosis following 5-FU exposure. Mechanistically, this was further associated with increased p53 transcriptional activation of p21 and PUMA. In addition, ERK5 inhibition increased the response of HCT116 p53+/+ cells to 5-FU, but failed to sensitize HCT116 p53−/− cells to the cytotoxic effects of this chemotherapeutic agent, suggesting a p53-dependent axis mediating 5-FU sensitization. Finally, ERK5 inhibition using XMD8-92 was shown to increase the antitumor effects of 5-FU in a murine subcutaneous xenograft model, enhancing apoptosis while markedly reducing tumor growth. Collectively, our results suggest that ERK5-targeted in hibition provides a promising therapeutic approach to overcome resistance to 5-FU-based chemotherapy and improve colon cancer treatment. PMID:27144434

  2. Environmental Monitoring Plan, Revision 5

    Energy Technology Data Exchange (ETDEWEB)

    Gallegos, G M; Blake, R G; Bertoldo, N A; Campbell, C G; Coty, J; Folks, K; Grayson, A R; Jones, H E; Nelson, J C; Revelli, M A; Wegrecki, T; Williams, R A; Wilson, K

    2010-01-27

    The purpose of environmental monitoring is to promote the early identification of, and response to, potential adverse environmental impacts associated with Lawrence Livermore National Laboratory (LLNL) operations. Environmental monitoring supports the Integrated Safety Management System (ISMS), International Organization for Standardization (ISO) 14001 Environmental Management Systems standard, and U. S. Department of Energy (DOE) Order 450.1A, Environmental Protection Program. Specifically, in conformance with DOE Order 450.1A, Attachment 1, paragraph 1(b)(5), environmental monitoring enables LLNL to detect, characterize, and respond to releases from LLNL activities; assess impacts; estimate dispersal patterns in the environment; characterize the pathways of exposure to members of the public; characterize the exposures and doses to individuals and to the population; and to evaluate the potential impacts to the biota in the vicinity of LLNL. Environmental monitoring also serves to demonstrate compliance with permits and other regulatory requirements. The Environmental Monitoring Plan (EMP) addresses the sample collection and analytical work supporting environmental monitoring to ensure the following: (1) A consistent system for collecting, assessing, and documenting environmental data of known and documented quality. (2) A validated and consistent approach for sampling and analysis of samples to ensure laboratory data meets program-specific needs and requirements within the framework of a performance-based approach for analytical laboratory work. (3) An integrated sampling approach to avoid duplicative data collection. Until its cancellation in January 2003, DOE Order 5400.1 required the preparation of an environmental monitoring plan. Neither DOE Order 450.1A nor the ISO 14001 standard are as prescriptive as DOE Order 5400.1, in that neither expressly requires an EMP. However, LLNL continues to prepare the EMP because it provides an organizational framework for

  3. L-5HTP treatment and serum 5-HT level after L-5-HTP loading on depressed patients.

    Science.gov (United States)

    Kaneko, M; Kumashiro, H; Takahashi, Y; Hoshino, Y

    1979-01-01

    Based on 5-HT hypothesis, L-5-HTP (150 or 300 mg/day) was given orally to 18 depressed patients. The global estimates were 2 very much improved; 8 much improved; 3 minimally improved, and 5 unchanged. The action of L-5-HTP was usually rapid. The elevation of the serum 5-HT level 1 week after L-5-HTP administration was relatively lower in the 5-HTP nonresponder group, compared with the responders. The chronological change of the serum 5-HT level in depressed patients after an oral loading dose of 3 mg/kg of L-5-HTP showed a gradual and slight elevation, compared with manic and normal groups. It seemed that the therapeutic effect of L-5-HTP on responders was related to lower 5-HT level in the brain for their pathogenesis, and that there was a metabolic disturbance of L-5-HTP into 5-HT in some depressed patients.

  4. The Deceptively Simple Thermolysis of Trivalent Permethyltitanocene Derivatives (η5-C5Me5)2TiR. Formation of a Tetramethylfulvene Titanium Compound (η6-C5Me4CH2)(η5-C5Me5)Ti and RH, Catalyzed by Permethyltitanocene Hydride, (η5-C5Me5)2TiH

    NARCIS (Netherlands)

    Luinstra, Gerrit A.; Teuben, Jan H.

    1992-01-01

    The complexes Cp*2TiR (Cp* = η5-C5Me5; R = Me, Et, n-Pr, C2H3, CH2CMe3, Ph) undergo thermolysis to yield the fulvene complex Cp*FvTi (Fv = η6-C5Me4CH2) and RH. Kinetic measurements and deuterium labeling studies show that the decomposition is catalyzed by Cp*2TiH, which is formed either by β-hydroge

  5. THE DECEPTIVELY SIMPLE THERMOLYSIS OF TRIVALENT PERMETHYLTITANOCENE DERIVATIVES (ETA-5-C5ME5)2TIR - FORMATION OF A TETRAMETHYLFULVENE TITANIUM COMPOUND (ETA-6-C5ME4CH2)(ETA-5-C5ME5)TI AND RH, CATALYZED BY PERMETHYLTITANOCENE HYDRIDE, (ETA-5-C5ME5)2TIH

    NARCIS (Netherlands)

    LUINSTRA, GA; TEUBEN, JH

    1992-01-01

    The complexes Cp*2TiR (Cp* = eta-5-C5Me5; R = Me, Et, n-Pr, C2H3, CH2CMe3, Ph) undergo thermolysis to yield the fulvene complex Cp*FvTi (Fv = eta-6-C5Me4CH2) and RH. Kinetic measurements and deuterium labeling studies show that the decomposition is catalyzed by Cp*2TiH, which is formed either by

  6. The Deceptively Simple Thermolysis of Trivalent Permethyltitanocene Derivatives (η5-C5Me5)2TiR. Formation of a Tetramethylfulvene Titanium Compound (η6-C5Me4CH2)(η5-C5Me5)Ti and RH, Catalyzed by Permethyltitanocene Hydride, (η5-C5Me5)2TiH

    NARCIS (Netherlands)

    Luinstra, Gerrit A.; Teuben, Jan H.

    1992-01-01

    The complexes Cp*2TiR (Cp* = η5-C5Me5; R = Me, Et, n-Pr, C2H3, CH2CMe3, Ph) undergo thermolysis to yield the fulvene complex Cp*FvTi (Fv = η6-C5Me4CH2) and RH. Kinetic measurements and deuterium labeling studies show that the decomposition is catalyzed by Cp*2TiH, which is formed either by

  7. 5th European Turbulence Conference

    CERN Document Server

    1995-01-01

    Under the auspices of the Euromech Committee, the Fifth European Turbulence Conference was held in Siena on 5-8 July 1994. Following the previous ETC meeting in Lyon (1986), Berlin (1988), Stockholm (1990) and Delft (1992), the Fifth ETC was aimed at providing a review of the fundamental aspects of turbulence from a theoretical, numerical and experimental point of view. In the magnificent town of Siena, more than 250 scientists from all over the world, spent four days discussing new ideas on turbulence. As a research worker in the field of turbulence, I must say that the works presented at the Conference, on which this book is based, covered almost all areas in this field. I also think that this book provides a major opportunity to have a complete overview of the most recent research works. I am extremely grateful to Prof. C. Cercignani, Dr. M. Loffredo, and Prof. R. Piva who, as members of the local organizing committee, share the success of the Conference. I also want to thank Mrs. Liu' Catena, for her inva...

  8. Some thoughts on ICPD+5.

    Science.gov (United States)

    AbouZahr, C

    1999-01-01

    This article concerns the International Conference on Population and Development (ICPD) held in Cairo in 1994. The 1960s were the years when the UNFPA was conceived and established with a mandate to raise awareness about the population problem and to assist developing countries in addressing these problems. At that time, the topics of discussion were focused on population bombs, demographic entrapment, scarcity of food, water, and renewable resources. The concern on population dates back much further of course to Malthus and his contemporaries and their analysis of the relationship between population growth and food availability. Many population programs and policies were implemented to address the population problems in developing countries such as the rapid increase in availability of technologies for reducing fertility. In contrast, the present Cairo agenda paid more attention to women's empowerment, autonomy and the improvement of their political, social, economic and health status for the attainment of sustainable development. The trend towards the feminist agenda explains the continuing tensions, so vociferously expressed during the ICPD+5 process, between conservatives and progressive groups.

  9. Dissociative disorders in DSM-5.

    Science.gov (United States)

    Spiegel, David; Lewis-Fernández, Roberto; Lanius, Ruth; Vermetten, Eric; Simeon, Daphne; Friedman, Matthew

    2013-01-01

    The rationale, research literature, and proposed changes to the dissociative disorders and conversion disorder in the fifth edition of the Diagnostic and Statistical Manual of Mental Disorders (DSM-5) are presented. Dissociative identity disorder will include reference to possession as well as identity fragmentation, to make the disorder more applicable to culturally diverse situations. Dissociative amnesia will include dissociative fugue as a subtype, since fugue is a rare disorder that always involves amnesia but does not always include confused wandering or loss of personality identity. Depersonalization disorder will include derealization as well, since the two often co-occur. A dissociative subtype of posttraumatic stress disorder (PTSD), defined by the presence of depersonalization or derealization in addition to other PTSD symptoms, is being recommended, based upon new epidemiological and neuroimaging evidence linking it to an early life history of adversity and a combination of frontal activation and limbic inhibition. Conversion disorder (functional neurological symptom disorder) will likely remain with the somatic symptom disorders, despite considerable dissociative comorbidity.

  10. DSM-5 and paraphilic disorders.

    Science.gov (United States)

    First, Michael B

    2014-01-01

    Given that paraphilic disorders are diagnosed largely in forensic settings, virtually every significant change in the criteria has forensic implications. Several controversial changes were considered during the DSM-5 revision process, but most were ultimately not included in the published text. However, any changes that make it easier to assign a paraphilic disorder diagnosis to an individual must be considered with caution. Criterion A for paraphilic disorders has been changed to reduce one potential risk that could result in false-positive diagnoses (i.e., allowing evaluators to diagnose a paraphilic disorder based entirely on the presence of sexual acts). In contrast, many of the other changes including some of those in the text, make it easier to diagnose a specific paraphilia and thus increase the risk of false-positive diagnoses. Since the assignment of a paraphilic disorder diagnosis can result in adverse legal consequences, the actual forensic impact of the changes will depend on how the legal system incorporates these new definitions into statutes and case law. © 2014 American Academy of Psychiatry and the Law.

  11. Paraphilias in the DSM-5.

    Science.gov (United States)

    Beech, Anthony R; Miner, Michael H; Thornton, David

    2016-01-01

    This review summarizes and critically examines the changes in how the Diagnostic and Statistical Manual of Mental Disorders (DSM) characterizes paraphilias. Attention is paid to the diagnostic options that were included in DSM-5, the decision not to include criterion sets for two additional disorders (paraphilic coercive disorder and hypersexual behavior disorder), and the further decision not to modify the diagnosis of pedophilic to pedohebephilic disorder. The three most significant changes are (a) the move to distinguish paraphilias from paraphilic disorders (allowing unusual sexual interests to be studied by researchers but only regarded as disorders when they cause distress or dysfunction), (b) introducing criteria describing paraphilic disorders as being in remission (when they no longer cause distress or dysfunction), and (c) clarifying the relationship between behavior and paraphilias. Concerns are noted about the forensic use of diagnoses and the lack of funding for field trials in this revision of the DSM. Suggestions are given for future directions in order to further research efficacy and clinical diagnosis.

  12. 5. Rostock bioenergy forum. Proceedings; 5. Rostocker Bioenergieforum. Tagungsband

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2011-07-01

    Within the 5th Rostock bioenergy forum at 2nd and 3rd November, 2011, in Rostock (Federal Republic of Germany) the following lectures were held: (1) International developments in the range of bioenergy (Frank Scholwin); (2) Grassland power Havelland - An analysis of potentials (Sven Schicketanz); (3) MixBioPells: Improvement of the market relevance of alternative biomass mix pellets in Europe (Thomas Zang); (4) Energetic utilization of Paludi biomass (Matthias Ahlhaus); (5) Supply of wood-based bioenergy sources by means of agro-forestry systems (Christian Boehm); (6) Results from experiments with rapidly growing tree species after eighteen years of management in Guelzow (A. Gurgel); (7) Landscape conservation materials - Optimization of the supply of sustainable raw materials by means of implementation of biomass farms (R. Wirkner); (8) Biomass as an energy source - An efficiency comparison from the view of land use (W. Grosse); (9) State of the art of the advancement of stationary fluidized-bed systems with low performance from the view of the engineering design (C. Boehme); (10) Classification and implementation of wood ashes (R. Schraegle); (11) Estimation of the sustainable biomass potential from grasslands of Brandenburg (C. Schleier); (12) Optimization of a regional production of bioalcohol from biogenic residues (M. Buck); (13) Results of the project BioWtL for the use of biogenic residues and wastes in the rapid pyrolysis for the economy of forces (M. Kroeger); (14) Characterization of gaseous primary products of the rapid pyrolysis of biomass (T. Streibel); (15) Vegetable oils as a fuel - DIN 51605 and DIN SPEC 51623 (E. Remmele); (16) Use of rapeseed oils in diesel engines (V. Wichmann); (17) Operation of tractors with rapeseed oil - Experiences and potential of optimization (H.M. Paulsen); (18) Ignition behaviour of different vegetable oils (P. Emberger); (19) Unwanted interactions of biofuel components with engine lubricating oils - Important

  13. Cyclic guanidines as dual 5-HT5A/5-HT7 receptor ligands: structure-activity relationship elucidation.

    Science.gov (United States)

    Peters, Jens-Uwe; Lübbers, Thomas; Alanine, Alexander; Kolczewski, Sabine; Blasco, Francesca; Steward, Lucinda

    2008-01-01

    The optimisation of affinity and selectivity in a novel series of dual 5-HT5A/5-HT7 receptor ligands is described. Brain penetrant 2-aminodihydroquinazolines with low nanomolar affinities were identified.

  14. Alterations of 5-Hydroxymethylcytosine in Human Cancers

    Directory of Open Access Journals (Sweden)

    Ali Yesilkanal

    2013-06-01

    Full Text Available Prior to 2009, 5-methylcytosine (5-mC was thought to be the only biologically significant cytosine modification in mammalian DNA. With the discovery of the TET enzymes, which convert 5-methylcytosine (5-mC to 5-hydroxymethylcytosine (5-hmC, however, intense interest has emerged in determining the biological function of 5-hmC. Here, we review the techniques used to study 5-hmC and evidence that alterations to 5-hmC physiology play a functional role in the molecular pathogenesis of human cancers.

  15. 46 CFR 95.50-5 - Classification.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Classification. 95.50-5 Section 95.50-5 Shipping COAST... Details § 95.50-5 Classification. (a) Hand portable fire extinguishers and semiportable fire extinguishing... extinguishing systems are set forth in Table 95.50-5(c). Table 95.50-5(c) Classification Type Size Soda-acid...

  16. 10 CFR 5.310 - Recruitment.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 1 2010-01-01 2010-01-01 false Recruitment. 5.310 Section 5.310 Energy NUCLEAR REGULATORY... FINANCIAL ASSISTANCE Discrimination on the Basis of Sex in Admission and Recruitment Prohibited § 5.310 Recruitment. (a) Nondiscriminatory recruitment. A recipient to which §§ 5.300 through 5.310 apply shall not...

  17. 22 CFR 5.1 - Introduction.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Introduction. 5.1 Section 5.1 Foreign Relations DEPARTMENT OF STATE GENERAL ORGANIZATION § 5.1 Introduction. The sections in this part 5 are issued pursuant to section 3 of the Administrative Procedure Act, 5 U.S.C. 552, effective July 4, 1967....

  18. 47 CFR 5.71 - License period.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 1 2010-10-01 2010-10-01 false License period. 5.71 Section 5.71...) Applications and Licenses § 5.71 License period. (a) The regular license period for stations in the Experimental Radio Service is either 2 or 5 years. An applicant desiring to apply for a 5-year license...

  19. Advances in DNA methylation: 5-hydroxymethylcytosine revisited

    DEFF Research Database (Denmark)

    Dahl, Christina; Grønbæk, Kirsten; Guldberg, Per

    2011-01-01

    Mammalian DNA contains two modified cytosine bases; 5-methylcytosine (5mC) and 5-hydroxymethylcytosine (5hmC). Both of these have been known for decades but have received very different levels of attention in the scientific literature. 5mC has been studied extensively, and its role as an epigenet...

  20. Synthesis, characterisation, stereochemistry and antimicrobial activity of 5 -piperazino- and 5-morpholinoacetyl-2,2,4-trimethyl-1, 5-benzodiazepines

    Indian Academy of Sciences (India)

    S Ponnuswamy; A Akila; D Deepa Rajakumari; V Shreevidhyaa Suressh; G Usha

    2015-11-01

    Three 1,5-benzodiazepines viz., 5-chloroacetyl-, 5-piperazinoacetyl- and N5 -morpholinoacetyl-2,2,4-trimethyl-1H-1,5-benzodiazepines have been synthesized. The structural characterisation and the conformational preferences of the compounds have been carried out using IR, 1D and 2D NMR spectral data. The NMR spectral data show that the -acetyltetrahydro-1,5-benzodiazepines prefer to exist in boat conformation with exo orientation of >C=O at 5 position in the solution state. The X-ray crystal structure of 5-morpholinoacetyl-2,2,4-trimethyl-1H-1,5-benzodiazepine also supports boat conformation in the solid state. The antimicrobial activity for -acetyltetrahydro-1,5-benzodiazepines have been carried out. -morpholinoacetyl-2,2,4-trimethyl-1H-1,5-benzodiazepine demonstrated better antibacterial and antifungal activities.

  1. Serotonin (5-HT) 5-HT2A Receptor (5-HT2AR):5-HT2CR Imbalance in Medial Prefrontal Cortex Associates with Motor Impulsivity.

    Science.gov (United States)

    Anastasio, Noelle C; Stutz, Sonja J; Fink, Latham H L; Swinford-Jackson, Sarah E; Sears, Robert M; DiLeone, Ralph J; Rice, Kenner C; Moeller, F Gerard; Cunningham, Kathryn A

    2015-07-15

    A feature of multiple neuropsychiatric disorders is motor impulsivity. Recent studies have implicated serotonin (5-HT) systems in medial prefrontal cortex (mPFC) in mediating individual differences in motor impulsivity, notably the 5-HT2AR receptor (5-HT2AR) and 5-HT2CR. We investigated the hypothesis that differences in the ratio of 5-HT2AR:5-HT2CR protein expression in mPFC would predict the individual level of motor impulsivity and that the engineered loss of the 5-HT2CR would result in high motor impulsivity concomitant with elevated 5-HT2AR expression and pharmacological sensitivity to the selective 5-HT2AR antagonist M100907. High and low impulsive rats were identified in a 1-choice serial reaction time task. Native protein levels of the 5-HT2AR and the 5-HT2CR predicted the intensity of motor impulsivity and the 5-HT2AR:5-HT2CR ratio in mPFC positively correlated with levels of premature responses in individual outbred rats. The possibility that the 5-HT2AR and 5-HT2CR act in concert to control motor impulsivity is supported by the observation that high phenotypic motor impulsivity associated with a diminished mPFC synaptosomal 5-HT2AR:5-HT2CR protein:protein interaction. Knockdown of mPFC 5-HT2CR resulted in increased motor impulsivity and triggered a functional disruption of the local 5-HT2AR:5-HT2CR balance as evidenced by a compensatory upregulation of 5-HT2AR protein expression and a leftward shift in the potency of M100907 to suppress impulsive behavior. We infer that there is an interactive relationship between the mPFC 5-HT2AR and 5-HT2CR, and that a 5-HT2AR:5-HT2CR imbalance may be a functionally relevant mechanism underlying motor impulsivity.

  2. Serotonin (5-HT) regulates neurite outgrowth through 5-HT1A and 5-HT7 receptors in cultured hippocampal neurons.

    Science.gov (United States)

    Rojas, Paulina S; Neira, David; Muñoz, Mauricio; Lavandero, Sergio; Fiedler, Jenny L

    2014-08-01

    Serotonin (5-HT) production and expression of 5-HT receptors (5-HTRs) occur early during prenatal development. Recent evidence suggests that, in addition to its classical role as a neurotransmitter, 5-HT regulates neuronal connectivity during mammalian development by modulating cell migration and neuronal cytoarchitecture. Given the variety of 5-HTRs, researchers have had difficulty clarifying the specific role of each receptor subtype in brain development. Signalling mediated by the G-protein-coupled 5-HT1A R and 5-HT7 R, however, has been associated with neuronal plasticity. Thus, we hypothesized that 5-HT promotes neurite outgrowth through 5-HT1A R and 5-HT7 R. The involvement of 5-HT1A R and 5-HT7 R in the morphology of rat hippocampal neurons was evaluated by treating primary cultures at 2 days in vitro with 5-HT and specific antagonists for 5-HT1A R and 5-HT7 R (WAY-100635 and SB269970, respectively). The stimulation of hippocampal neurons with 100 nM 5-HT for 24 hr produced no effect on either the number or the length of primary neurites. Nonetheless, after 5HT7 R was blocked, the addition of 5-HT increased the number of primary neurites, suggesting that 5HT7 R could inhibit neuritogenesis. In contrast, 5-HT induced secondary neurite outgrowth, an effect inhibited by 1 μM WAY-100635 or SB269970. These results suggest that both serotonergic receptors participate in secondary neurite outgrowth. We conclude that 5-HT1A R and 5-HT7 R regulate neuronal morphology in primary hippocampal cultures by promoting secondary neurite outgrowth.

  3. The effect of oral 5-HTP administration on 5-HTP and 5-HT immunoreactivity in monoaminergic brain regions of rats.

    Science.gov (United States)

    Lynn-Bullock, Christina P; Welshhans, Kristy; Pallas, Sarah L; Katz, Paul S

    2004-05-01

    5-Hydroxytryptophan (5-HTP), which is the rate-limiting precursor in serotonin (5-hydroxytryptamine (5-HT)) biosynthesis, is used as an oral supplement to enhance serotonin levels in humans. To evaluate its effects on serotonin levels and localization, 5-hydroxytryptophan was administered to Sprague-Dawley rats either orally or via intraperitoneal injection. 5-Hydroxytryptophan-immunoreactivity was co-localized with serotonin-immunoreactivity in the serotonergic dorsal raphe nucleus of control animals and this was not changed in animals given 5-hydroxytryptophan. Oral 5-HTP administration increased the intensity of both 5-HTP and serotonin immunoreactivity in raphe neurons. However, 5-HTP treatment also caused ectopic 5-hydroxytryptophan-immunoreactivity and serotonin-immunoreactivity in normally dopaminergic neurons of the substantia nigra par compacta. Serotonin-immunoreactivity was confined to neurons that also displayed amino acid decarboxylase immunoreactivity, but in a small percentage of substantia nigra neurons, serotonin immunoreactivity was not co-localized with tyrosine hydroxylase-immunoreactivity. The intensity of the immunoreactivity to serotonin and 5-hydroxytryptophan in the substantia nigra was maximal within 2h of 5-hydroxytryptophan administration and returned to control levels by 24h. This time course mirrored changes in HPLC measurements of 5-hydroxytryptophan, serotonin, and the metabolite 5-hydroxyindoleacetic acid (5-HIAA) in the urine. 5-Hydroxytryptophan administration did not cause ectopic appearance of either serotonin or 5-hydroxytryptophan in the noradrenergic locus coeruleus. These results suggest that a single oral dose of 5-HTP increases the 5-HTP and serotonin content of serotonergic neurons and causes the transient ectopic appearance of serotonin in some normally non-serotonergic neurons.

  4. 46 CFR 76.50-5 - Classification.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 3 2010-10-01 2010-10-01 false Classification. 76.50-5 Section 76.50-5 Shipping COAST... Classification. (a) Hand portable fire extinguishers and semiportable fire extinguishing systems shall be... extinguishing systems are set forth in table 76.50-5(c). Table 76.50-5(c) Classification Type Size Soda acid...

  5. 49 CFR 396.5 - Lubrication.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 5 2010-10-01 2010-10-01 false Lubrication. 396.5 Section 396.5 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL MOTOR CARRIER SAFETY ADMINISTRATION... § 396.5 Lubrication. Every motor carrier shall ensure that each motor vehicle subject to its control...

  6. 24 CFR 3280.5 - Data plate.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 5 2010-04-01 2010-04-01 false Data plate. 3280.5 Section 3280.5... MANUFACTURED HOME CONSTRUCTION AND SAFETY STANDARDS General § 3280.5 Data plate. Each manufactured home shall bear a data plate affixed in a permanent manner near the main electrical panel or other readily...

  7. 41 CFR 101-5.302 - Objective.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Objective. 101-5.302 Section 101-5.302 Public Contracts and Property Management Federal Property Management Regulations System... 5.3-Federal Employee Health Services § 101-5.302 Objective. It is the objective of GSA to provide...

  8. 12 CFR 541.5 - Commercial paper.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 5 2010-01-01 2010-01-01 false Commercial paper. 541.5 Section 541.5 Banks and Banking OFFICE OF THRIFT SUPERVISION, DEPARTMENT OF THE TREASURY DEFINITIONS FOR REGULATIONS AFFECTING FEDERAL SAVINGS ASSOCIATIONS § 541.5 Commercial paper. The term commercial paper means any note, draft, or...

  9. Zeolite 5A Catalyzed Etherification of Diphenylmethanol

    Science.gov (United States)

    Cooke, Jason; Henderson, Eric J.; Lightbody, Owen C.

    2009-01-01

    An experiment for the synthetic undergraduate laboratory is described in which zeolite 5A catalyzes the room temperature dehydration of diphenylmethanol, (C[subscript 6]H[subscript 5])[subscript 2]CHOH, producing 1,1,1',1'-tetraphenyldimethyl ether, (C[subscript 6]H[subscript 5])[subscript 2]CHOCH(C[subscript 6]H[subscript 5])[subscript 2]. The…

  10. 37 CFR 350.5 - Time.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Time. 350.5 Section 350.5... RULES AND PROCEDURES GENERAL ADMINISTRATIVE PROVISIONS § 350.5 Time. (a) Computation. To compute the due... reasons why there is good cause for the delay; (5) The justification for the amount of additional...

  11. 32 CFR 155.5 - Responsibilities.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 1 2010-07-01 2010-07-01 false Responsibilities. 155.5 Section 155.5 National... SECURITY CLEARANCE PROGRAM § 155.5 Responsibilities. (a) The Assistant Secretary of Defense of Command... responsibilities. (19) Designate the Director, DOHA, to implement paragraphs (b)(5) through (b)(18) of this...

  12. 7 CFR 1126.5 - Distributing plant.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 9 2010-01-01 2009-01-01 true Distributing plant. 1126.5 Section 1126.5 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements... Handling Definitions § 1126.5 Distributing plant. See § 1000.5....

  13. 7 CFR 1007.5 - Distributing plant.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 9 2010-01-01 2009-01-01 true Distributing plant. 1007.5 Section 1007.5 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements... Handling Definitions § 1007.5 Distributing plant. See § 1000.5....

  14. 7 CFR 1131.5 - Distributing plant.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 9 2010-01-01 2009-01-01 true Distributing plant. 1131.5 Section 1131.5 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements... Handling Definitions § 1131.5 Distributing plant. See § 1000.5....

  15. 7 CFR 1006.5 - Distributing plant.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 9 2010-01-01 2009-01-01 true Distributing plant. 1006.5 Section 1006.5 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements... Handling Definitions § 1006.5 Distributing plant. See § 1000.5....

  16. 7 CFR 1001.5 - Distributing plant.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 9 2010-01-01 2009-01-01 true Distributing plant. 1001.5 Section 1001.5 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements... Handling Definitions § 1001.5 Distributing plant. See § 1000.5....

  17. 7 CFR 1005.5 - Distributing plant.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 9 2010-01-01 2009-01-01 true Distributing plant. 1005.5 Section 1005.5 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements... Handling Definitions § 1005.5 Distributing plant. See § 1000.5....

  18. 7 CFR 1032.5 - Distributing plant.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 9 2010-01-01 2009-01-01 true Distributing plant. 1032.5 Section 1032.5 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements... Handling Definitions § 1032.5 Distributing plant. See § 1000.5....

  19. 7 CFR 1124.5 - Distributing plant.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 9 2010-01-01 2009-01-01 true Distributing plant. 1124.5 Section 1124.5 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements... Regulating Handling Definitions § 1124.5 Distributing plant. See § 1000.5....

  20. 7 CFR 1030.5 - Distributing plant.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 9 2010-01-01 2009-01-01 true Distributing plant. 1030.5 Section 1030.5 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements... Handling Definitions § 1030.5 Distributing plant. See § 1000.5....

  1. 7 CFR 1033.5 - Distributing plant.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 9 2010-01-01 2009-01-01 true Distributing plant. 1033.5 Section 1033.5 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements... Handling Definitions § 1033.5 Distributing plant. See § 1000.5....

  2. 32 CFR 776.5 - Judicial conduct.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 5 2010-07-01 2010-07-01 false Judicial conduct. 776.5 Section 776.5 National Defense Department of Defense (Continued) DEPARTMENT OF THE NAVY MISCELLANEOUS RULES PROFESSIONAL CONDUCT... § 776.5 Judicial conduct. To the extent that it does not conflict with statutes, regulations, or this...

  3. 7 CFR 305.5 - Treatment requirements.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 5 2010-01-01 2010-01-01 false Treatment requirements. 305.5 Section 305.5... SERVICE, DEPARTMENT OF AGRICULTURE PHYTOSANITARY TREATMENTS Chemical Treatments § 305.5 Treatment requirements. (a) Certified facility. The fumigation treatment facility must be certified by APHIS. Facilities...

  4. 27 CFR 5.62 - Definition.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Definition. 5.62 Section 5.62 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE... Definition. As used in §§ 5.61 through 5.66 of this part, the term “advertisement” includes any written...

  5. 42 CFR 498.5 - Appeal rights.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 5 2010-10-01 2010-10-01 false Appeal rights. 498.5 Section 498.5 Public Health... PROGRAM General Provisions § 498.5 Appeal rights. (a) Appeal rights of prospective providers. (1) Any...) Appeal rights of providers. Any provider dissatisfied with an initial determination to terminate...

  6. 46 CFR 151.40-5 - Construction.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 5 2010-10-01 2010-10-01 false Construction. 151.40-5 Section 151.40-5 Shipping COAST... LIQUID HAZARDOUS MATERIAL CARGOES Temperature or Pressure Control Installations § 151.40-5 Construction. Construction of machinery or equipment, such as heat exchangers, condensers, piping, etc., associated...

  7. The cell biology of TRIM5α.

    Science.gov (United States)

    Lukic, Zana; Campbell, Edward M

    2012-03-01

    The tripartite motif (TRIM)-containing proteins are involved in many cellular functions such as cell signaling, apoptosis, cell differentiation, and immune modulation. TRIM5 proteins, including TRIM5α and TRIM-Cyp, are known to possess antiretroviral activity against many different retroviruses. Besides being retroviral restriction factors, TRIM5 proteins participate in other cellular functions that have recently emerged in the study of TRIM5α. In this review, we discuss properties of TRIM5α such as cytoplasmic body formation, protein turnover, and trafficking. Also, we discuss recent insights into innate immune modulation mediated by TRIM5α, highlighting the various functions TRIM5α has in cellular processes.

  8. IFITM5 mutations and osteogenesis imperfecta.

    Science.gov (United States)

    Hanagata, Nobutaka

    2016-03-01

    Interferon-induced transmembrane protein 5 (IFITM5) is an osteoblast-specific membrane protein that has been shown to be a positive regulatory factor for mineralization in vitro. However, Ifitm5 knockout mice do not exhibit serious bone abnormalities, and thus the function of IFITM5 in vivo remains unclear. Recently, a single point mutation (c.-14C>T) in the 5' untranslated region of IFITM5 was identified in patients with osteogenesis imperfecta type V (OI-V). Furthermore, a single point mutation (c.119C>T) in the coding region of IFITM5 was identified in OI patients with more severe symptoms than patients with OI-V. Although IFITM5 is not directly involved in the formation of bone in vivo, the reason why IFITM5 mutations cause OI remains a major mystery. In this review, the current state of knowledge of OI pathological mechanisms due to IFITM5 mutations will be reviewed.

  9. Ab Initio Investigation on Structural, Elastic and Electronic Properties of η-Phase Cu4.5Ni1Au0.5Sn5 and Cu5Ni1Sn4.5In0.5 Intermetallic Compounds

    Science.gov (United States)

    Li, Xuezheng; Ma, Yong; Zhou, Wei; Wu, Ping

    2017-10-01

    The structural, elastic and electronic properties of quaternary intermetallic compounds η-Cu4.5Ni1Au0.5Sn5 and η-Cu5Ni1Sn4.5In0.5 are investigated by an ab initio method. The calculated heat of formation determines preferential occupancy sites for Ni, Au and In atoms which lead to thermodynamically stable compounds. Variation of lattice constants reveals that the change of atomic bonding has a directional discrepancy in η-Cu4.5Ni1Au0.5Sn5; the polycrystalline moduli obtained from single-crystal elastic stiffness show an increase after both Ni/Au and Ni/In additions. Also, the anisotropy of Young's modulus and shear modulus is significantly weakened in η-Cu4.5Ni1Au0.5Sn5. The density of states and maps of charge density distribution suggest that the atomic bonding in the quaternary intermetallic compounds is strengthened by the addition of Ni and Au but weakened by the addition of In.

  10. Why are SiX5(-) and GeX5(-) (X = F, Cl) stable but not CF5(-) and CCl5(-)?

    Science.gov (United States)

    Marchaj, Marzena; Freza, Sylwia; Skurski, Piotr

    2012-03-01

    The possible existence of the CF(5)(-), CCl(5)(-), SiF(5)(-), SiCl(5)(-), GeF(5)(-), and GeCl(5)(-) anions has been investigated using ab initio methods. The species containing Si and Ge as central atoms were found to adopt the D(3h)-symmetry trigonal bipyramidal equilibrium structures whose thermodynamic stabilities were confirmed by examining the most probable fragmentation channels. The ab initio re-examination of the electronic stabilities of the SiF(5)(-), SiCl(5)(-), GeF(5)(-), and GeCl(5)(-) anions [using the OVGF(full) method with the 6-311+G(3df) basis set] led to the very large vertical electron detachment (VDE) energies of 9.316 eV (SiF(5)(-)) and 9.742 eV (GeF(5)(-)), whereas smaller VDEs of 6.196 and 6.452 eV were predicted for the SiCl(5)(-) and GeCl(5)(-) species, respectively. By contrast, the high-symmetry and structurally compact anionic CF(5)(-) and CCl(5)(-) systems cannot exist due to the strongly repulsive potential predicted for the X(-) (F(-) or Cl(-)) approaching the CX(4) (CF(4) or CCl(4)). The formation of weakly bound CX(4)···X(-) (CF(4)···F(-) and CCl(4)···Cl(-)) anionic complexes (consisting of pseudotetrahedral neutral CX(4) with the weakly tethered X(-)) might be expected at low temperatures (approaching 0 K), whereas neither CX(5)(-) (CF(5)(-), CCl(5)(-)) systems nor CX(4)···X(-) (CF(4)···F(-) and CCl(4)···Cl(-)) complexes can exist in the elevated temperatures (above 0K) due to their susceptibility to the fragmentation (leading to the X(-) loss). © 2012 American Chemical Society

  11. Astronomical forcing of Northwest African climate and glacial history during the late Messinian (6.5-5.5 Ma)

    NARCIS (Netherlands)

    Laan, E. van der; Hilgen, F.J.; Lourens, L.J.; De Kaenel, E.; Gaboardi, S.; Iaccarino, S.

    2012-01-01

    High-resolution physical, chemical and biological-based climate proxies from the Ain el Beida (AEB) section in Atlantic Morocco reveal the imprint of the three main orbital parameters precession (19–23 kyr), obliquity (41 kyr) and eccentricity (95–125 and 400 kyr) between 6.5 and 5.5 million years b

  12. Avian Influenza A (H5N1)

    Centers for Disease Control (CDC) Podcasts

    2009-05-27

    In this podcast, CDC's Dr. Tim Uyeki discusses H5N1, a subtype of influenza A virus. This highly pathogenic H5N1 virus doesn't usually infect people, although some rare infections with H5N1 viruses have occurred in humans. We need to use a comprehensive strategy to prevent the spread of H5N1 virus among birds, including having human health and animal health work closely together.  Created: 5/27/2009 by Emerging Infectious Diseases.   Date Released: 5/27/2009.

  13. Pro HTML5 with Visual Studio 2012

    CERN Document Server

    Collins, Mark

    2012-01-01

    Pro HTML5 with Visual Studio 2012 is written to help ASP .NET developers make the leap to the inevitable and exciting world of HTML5. The growing HTML5 specifications promises to revolutionize the way web sites are developed with an impressive set of built-in client-side features. The use of HTML5 as a preferred development language in Windows 8, along with growing support from the major browser vendors, is likely to make HTML5 the de-facto standard for all future web development. The number of HTML5-capable phones alone is estimated to top 1 billion by 2013. Many professional web developers w

  14. 26 CFR 5c.168(f)(8)-5 - Term of lease.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 14 2010-04-01 2010-04-01 false Term of lease. 5c.168(f)(8)-5 Section 5c.168(f)(8)-5 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) TEMPORARY INCOME TAX REGULATIONS UNDER THE ECONOMIC RECOVERY TAX ACT OF 1981 § 5c.168(f)(8)-5...

  15. Lipase Catalyzed Enantioselective Transesterification of 5-Acyloxy-2(5H)-Furanones

    NARCIS (Netherlands)

    Deen, Hanneke van der; Hof, Robert P.; Oeveren, Arjan van; Kellogg, Richard M.; Feringa, Bernard

    1994-01-01

    Several lipases catalyse the transesterification of gamma-acyloxyfuranones in organic solvents with high enantioselectivities. This method has been used for the kinetic resolution of 5-acetoxy-2(5H)-furanone, 5-acetoxy-4-methyl-2(5H)-furanone and 5-propionyloxy-2(5H)-furanone, in e.e.'s ranging from

  16. Data of evolutionary structure change: 1I5OA-3GD5C [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1I5OA-3GD5C 1I5O 3GD5 A C ANPLYQKHIISINDLSRDDLNLVLATAAKLKANPQPELL...KHKVIASCFFEASTRTRLSFETSMHRLGASVVGFSDSANTSLGKKGETLADTISVISTYVDAIVMAHPQEGAARLATEFSGNVPVLNAGDGSNQHPTQTLLDLFTIQETQGRLDNLHVAMVGD...YAHYAG-IPVINALT-DHEHPCQVVADLLTIRENFGRLAGLKLAYVGDG--NNVAHSLLLGCAKVG-MSIAVATPEGFTPDPAVSARASEIAGRTGAEVQILRDPFEA...ine> ALA CA 282 TRP CA 350 3GD5 C 3GD5C ARASEIAGRTGAEV

  17. Data of evolutionary structure change: 1I5OA-3GD5E [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1I5OA-3GD5E 1I5O 3GD5 A E ANPLYQKHIISINDLSRDDLNLVLATAAKLKANPQPELL...KHKVIASCFFEASTRTRLSFETSMHRLGASVVGFSDSANTSLGKKGETLADTISVISTYVDAIVMAHPQEGAARLATEFSGNVPVLNAGDGSNQHPTQTLLDLFTIQETQGRLDNLHVAMVGD...YAHYAG-IPVINALT-DHEHPCQVVADLLTIRENFGRLAGLKLAYVGDG--NNVAHSLLLGCAKVG-MSIAVATPEGFTPDPAVSARASEIAGRTGAEVQILRDPFEA.../line> ALA CA 282 TRP CA 350 3GD5... E 3GD5E ARASEIAGRTGA

  18. Synthesis and Characterization of the Chiral Skeleton Cluster [NiRuMo(CO)5(μ3-S)(η5-C5H5)(η5-C5H4COCH3)

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    The new chiral cluster [NiRuMo(CO)5(μ3-S)(η5-C5H5(5-C5H4COCH3)] 3 was synthesized by the reaction of precursor [CoRuMo(CO)8(μ3-S(η5-C5H4COCH3)] 1 with NiCp2 2 in refluxing THF. It was characterized by C/H elemental analysis, IR and 1H NMR. Molecular structure of cluster 3 was determined by single-crystal X-ray analyses. Crystal data: triclinic, space group Pī with the following crystallographic parameters: a = 7.9606(8), b = 8.5604(9), c = 14.779(2)A, = 93.908(2), = 105.057(2), = 101.463(2)°, C17H12O6MoNiRuS, Mr = 600.0(5), Z = 2, V = 945.5(2)A3, Dc = 2.108 g/cm3, = 2.568 mm-1, 2 max 2.00σ(I).

  19. Structural basis of LaDR5, a novel agonistic anti-death receptor 5 (DR5 monoclonal antibody, to inhibit DR5/TRAIL complex formation

    Directory of Open Access Journals (Sweden)

    Qiao Chunxia

    2012-07-01

    Full Text Available Abstract Background As a member of the TNF superfamily, TRAIL could induce human tumor cell apoptosis through its cognate death receptors DR4 or DR5, which can induce formation of the death inducing signaling complex (DISC and activation of the membrane proximal caspases (caspase-8 or caspase-10 and mitochondrial pathway. Some monoclonal antibodies against DR4 or DR5 have been reported to have anti-tumor activity. Results In this study, we reported a novel mouse anti-human DR5 monoclonal antibody, named as LaDR5, which could compete with TRAIL to bind DR5 and induce the apoptosis of Jurkat cells in the absence of second cross-linking in vitro. Using computer-guided molecular modeling method, the 3-D structure of LaDR5 Fv fragment was constructed. According to the crystal structure of DR5, the 3-D complex structure of DR5 and LaDR5 was modeled using molecular docking method. Based on distance geometry method and intermolecular hydrogen bonding analysis, the key functional domain in DR5 was predicted and the DR5 mutants were designed. And then, three mutants of DR5 was expressed in prokaryotic system and purified by affinity chromatograph to determine the epitope of DR5 identified by LaDR5, which was consistent with the theoretical results of computer-aided analysis. Conclusions Our results demonstrated the specific epitope located in DR5 that plays a crucial role in antibody binding and even antineoplastic bioactivity. Meanwhile, revealed structural features of DR5 may be important to design or screen novel drugs agonist DR5.

  20. VTORTHO_0_5M_PAN

    Data.gov (United States)

    Vermont Center for Geographic Information — The VTORTHO_0_5M_PAN data is a composite dataset that includes the latest pancromatic (black and white) orthophotography (orthophoto) at 1:5000 scale (0.5 meter...

  1. 10 CFR 5.500 - Employment.

    Science.gov (United States)

    2010-01-01

    ...) Application. The provisions of §§ 5.500 through 5.550 apply to: (1) Recruitment, advertising, and the process..., leave for persons of either sex to care for children or dependents, or any other leave; (7)...

  2. Main: 1RD5 [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1RD5 トウモロコシ Corn Zea mays L. Tryptophan Synthase Alpha Chain, Chloroplast Precursor...VPDLPYVAAHSLWSEAKNNNLELVLLTTPAIPEDRMKEITKASEGFVYLVSVNGVTGPRANVNPRVESLIQEVKKVTNKPVAVGFGISKPEHVKQIAQWGADGVIIGSAMVRQLGEAASPKQGLRRLEEYARGMKNALP corn_1RD5.jpg ...

  3. Main: 1FK5 [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1FK5 トウモロコシ Corn Zea mays L. Nonspecific Lipid-Transfer Protein Precursor Zea Mays ...ALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRVN corn_1FK5.jpg ...

  4. Main: 1DS5 [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1DS5 トウモロコシ Corn Zea mays L. Casein Kinase Ii, Alpha Chain Name=Ack2; Zea Mays Mole...YDYSLDMWSLGCMFAGMIFRKEPFFYGHDNHDQLVKIAKVLGTDGLNVYLNKYRIELDPQLEALVGRHSRKPWLKFMNADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAENSRTRA corn_1DS5.jpg ...

  5. Main: 1DU5 [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1DU5 トウモロコシ Corn Zea mays L. Zeamatin Precursor. Name=Zlp; Zea Mays Molecule: Zeama...NNACPVFKKDEYCCVGSAANDCHPTNYSRYFKGQCPDAYSYPKDDATSTFTCPAGTNYKVVFCP corn_1DU5.jpg ...

  6. Microorganisms for the production of 5-hydroxytryptophan

    DEFF Research Database (Denmark)

    2013-01-01

    Recombinant microbial cells and methods for producing 5-hydroxytryptophan (5HTP) using such cells are described. More specifically, the recombinant microbial cell comprises an exogenous gene encoding an L-tryptophan hydroxylase, and means for providing tetrahydrobiopterin (THB). Related sequences...

  7. GR-127935-sensitive mechanism mediating hypotension in anesthetized rats: are 5-HT5B receptors involved?

    Science.gov (United States)

    Sánchez-Maldonado, Carolina; López-Sánchez, Pedro; Anguiano-Robledo, Liliana; Leopoldo, Marcello; Lacivita, Enza; Terrón, José A

    2015-04-01

    The 5-HT1B/1D receptor antagonist, GR-127935, inhibits hypotensive responses produced by the 5-HT1A, 5-HT1B/1D and 5-HT7 receptor agonist, and 5-HT5A/5B receptor ligand, 5-carboxamidotryptamine (5-CT), in rats. This work further characterized the above mechanism using more selective 5-HT1B and 5-HT1D receptor antagonists. Also, expression of 5-HT5A and 5-HT5B receptor mRNAs in blood vessels was searched by reverse transcription polymerase chain reaction. Decreases in diastolic blood pressure induced by 5-CT (0.001-10 μg/kg, intravenously) were analyzed in anesthetized rats that had received intravenous vehicle (1 mL/kg), SB-224289 (5-HT1B antagonist; 0.3 and 1.0 mg/kg), BRL15572 (5-HT1D antagonist; 0.3 and 1.0 mg/kg), SB-224289 + BRL15572 (0.3 mg/kg, each), or SB-224289 + BRL15572 (0.3 mg/kg, each) + GR-127935 (1 mg/kg). Because only the latter treatment inhibited 5-CT-induced hypotension, suggestive of a mechanism unrelated to 5-HT1B/1D receptors, the effects of antagonists/ligands at 5-HT5A (SB-699551, 1 mg/kg), 5-HT6 (SB-399885, 1 mg/kg), and 5-HT1B/1D/5A/5B/7 receptors (ergotamine, 0.1 mg/kg) on 5-CT-induced hypotension were tested. Interestingly, only ergotamine blocked 5-CT-induced responses; this effect closely paralleled that of SB-224289 + BRL-15572 + GR-127935. Neither did ergotamine nor GR-127935 inhibit hypotensive responses induced by the 5-HT7 receptor agonist, LP-44. Faint but clear bands corresponding to 5-HT5A and 5-HT5B receptor mRNAs in aorta and mesenteric arteries were detected. Results suggest that the GR-127935-sensitive mechanism mediating hypotension in rats is unrelated to 5-HT1B, 5-HT1D, 5-HT5A, 5-HT6, and 5-HT7 receptors. This mechanism, however, resembles putative 5-HT5B receptors.

  8. 39 CFR 262.5 - Systems (Privacy).

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Systems (Privacy). 262.5 Section 262.5 Postal... DEFINITIONS § 262.5 Systems (Privacy). (a) Privacy Act system of records. A Postal Service system containing... individual. (c) Computer matching program. A “matching program,” as defined in the Privacy Act, 5 U.S.C. 552a...

  9. Main: OBF5ATGST6 [PLACE

    Lifescience Database Archive (English)

    Full Text Available OBF5ATGST6 S000304 29-Sep-2003 (last modified) kehi OBF5 (ocs element binding facto...r 5) binding site found in the Arabidopsis (A.t.) GST6 gene promoter; Similar to Ocs sequence; Located betwe...site of OBF4 and OBF5; See S000305, S000346; GST; Ocs; OBF; OBP; auxin; SA; cycloheximide, Dof; TGA; pathoge

  10. Interactome of invadopodia scaffold protein TKS5

    OpenAIRE

    Kropyvko S. V.

    2015-01-01

    TKS5 is a scaffold protein that takes part in invadopodia functioning and reactive oxygen species (ROS) production. TKS5 is a critical component of invadopodia as its absence results in the loss of cancer cells ability to form these invasive structures. TKS5 is phosphorylated by SRC kinase and consequently interacts with the membrane phosphatidylinositol phosphates launching the invadopodia formation process. At later stages TKS5 regulates the actin cytoskeleton reorganization and extracellul...

  11. TEHNOLOGIJA HTML5 ZA MOBILNE APLIKACIJE

    OpenAIRE

    Cigan, Alen

    2015-01-01

    Diplomsko delo predstavlja novosti, ki jih prinaša tehnologija HTML5 za spletne strani in mobilne aplikacije. Predstavljeni so vsi najpomembnejši novi elementi in funkcije, ki so del HTML5. Opisali smo tudi glavne prednosti in slabosti ter opravili pregled zgodovine razvoja HTML-ja. Da bi prikazali prednosti tehnologije HTML5, smo razvili hibridno aplikacijo za mobilne naprave, ki je zaradi HTML5 neodvisna od mobilnega operacijskega sistema.

  12. 5-Hydroxytryptamine Receptor Subtypes and their Modulators with Therapeutic Potentials

    OpenAIRE

    Pithadia, Anand B.; Jain, Sunita M.

    2009-01-01

    5-hydroxytryptamine (5-HT) has become one of the most investigated and complex biogenic amines. The main receptors and their subtypes, e.g., 5-HTI (5-HT1A, 5-HT1B, 5-HTID, 5-HTIE and 5-HT1F), 5-HT2 (5-HT2A, 5-HT2B and 5-HT2C), 5-HT3, 5-HT4, 5-HT5 (5-HT5A, 5-HT5B), 5-HT6 and 5-HT7 have been identified. Specific drugs which are capable of either selectively stimulating or inhibiting these receptor subtypes are being designed. This has generated therapeutic potentials of 5-HT receptor modulators...

  13. 46 CFR 58.20-5 - Design.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 2 2010-10-01 2010-10-01 false Design. 58.20-5 Section 58.20-5 Shipping COAST GUARD... SYSTEMS Refrigeration Machinery § 58.20-5 Design. (a) Refrigeration machinery may be accepted for installation provided the design, material, and fabrication comply with the applicable requirements of the...

  14. 12 CFR 363.5 - Audit committees.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Audit committees. 363.5 Section 363.5 Banks and Banking FEDERAL DEPOSIT INSURANCE CORPORATION REGULATIONS AND STATEMENTS OF GENERAL POLICY ANNUAL INDEPENDENT AUDITS AND REPORTING REQUIREMENTS § 363.5 Audit committees. (a) Composition and duties....

  15. 45 CFR 601.5 - Derivative classification.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 3 2010-10-01 2010-10-01 false Derivative classification. 601.5 Section 601.5... CLASSIFICATION AND DECLASSIFICATION OF NATIONAL SECURITY INFORMATION § 601.5 Derivative classification. Distinct from “original” classification is the determination that information is in substance the same...

  16. 46 CFR 193.50-5 - Classification.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Classification. 193.50-5 Section 193.50-5 Shipping COAST... Details § 193.50-5 Classification. (a) Hand portable fire extinguishers and semiportable fire...) Classification Type Size Soda-acid and water, gals. Foam, gals. Carbon dioxide, lbs. Dry chemical, lbs. A II...

  17. 29 CFR 4002.5 - Meetings.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 9 2010-07-01 2010-07-01 false Meetings. 4002.5 Section 4002.5 Labor Regulations Relating... GUARANTY CORPORATION § 4002.5 Meetings. Regular meetings of the Board of Directors shall be held as often... Chair shall select. Special meetings of the Board of Directors shall be called by the Chair on...

  18. 12 CFR 267.5 - Meetings.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Meetings. 267.5 Section 267.5 Banks and Banking... AND PROCEDURE OF THE CONSUMER ADVISORY COUNCIL § 267.5 Meetings. (a) Time. Meetings of the Council...) Agenda. Each meeting of the Council shall be conducted in accordance with an agenda formulated...

  19. 40 CFR 5.310 - Recruitment.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Recruitment. 5.310 Section 5.310... in Admission and Recruitment Prohibited § 5.310 Recruitment. (a) Nondiscriminatory recruitment. A... recruitment and admission of students. A recipient may be required to undertake additional recruitment efforts...

  20. 10 CFR 5.510 - Recruitment.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 1 2010-01-01 2010-01-01 false Recruitment. 5.510 Section 5.510 Energy NUCLEAR REGULATORY... Prohibited § 5.510 Recruitment. (a) Nondiscriminatory recruitment and hiring. A recipient shall not discriminate on the basis of sex in the recruitment and hiring of employees. Where a recipient has been found...

  1. 40 CFR 5.510 - Recruitment.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Recruitment. 5.510 Section 5.510... in Employment in Education Programs or Activities Prohibited § 5.510 Recruitment. (a) Nondiscriminatory recruitment and hiring. A recipient shall not discriminate on the basis of sex in the recruitment...

  2. 36 CFR 297.5 - Determination.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Determination. 297.5 Section 297.5 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE WILD AND SCENIC RIVERS Water Resources Projects § 297.5 Determination. (a) The Secretary of Agriculture will consent to...

  3. 21 CFR 820.5 - Quality system.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Quality system. 820.5 Section 820.5 Food and Drugs... QUALITY SYSTEM REGULATION General Provisions § 820.5 Quality system. Each manufacturer shall establish and maintain a quality system that is appropriate for the specific medical device(s) designed or...

  4. 7 CFR 925.5 - Production area.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 8 2010-01-01 2010-01-01 false Production area. 925.5 Section 925.5 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements... SOUTHEASTERN CALIFORNIA Definitions § 925.5 Production area. Production area means Imperial County, California...

  5. 7 CFR 985.5 - Production area.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 8 2010-01-01 2010-01-01 false Production area. 985.5 Section 985.5 Agriculture... HANDLING OF SPEARMINT OIL PRODUCED IN THE FAR WEST Order Regulating Handling Definitions § 985.5 Production area. Production area means all the area within the States of Washington, Idaho, Oregon, and that...

  6. 46 CFR 189.01-5 - Posting.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Posting. 189.01-5 Section 189.01-5 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) OCEANOGRAPHIC RESEARCH VESSELS INSPECTION AND CERTIFICATION Certificate of Inspection § 189.01-5 Posting. (a) The original certificate of inspection shall, in general,...

  7. 46 CFR 91.01-5 - Posting.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Posting. 91.01-5 Section 91.01-5 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) CARGO AND MISCELLANEOUS VESSELS INSPECTION AND CERTIFICATION Certificate of Inspection § 91.01-5 Posting. (a) On vessels of over 25 gross tons, the original certificate...

  8. 46 CFR 71.01-5 - Posting.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 3 2010-10-01 2010-10-01 false Posting. 71.01-5 Section 71.01-5 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) PASSENGER VESSELS INSPECTION AND CERTIFICATION Certificate of Inspection § 71.01-5 Posting. The certificate of inspection shall be displayed under glass in a...

  9. 46 CFR 111.33-5 - Installation.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Installation. 111.33-5 Section 111.33-5 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) ELECTRICAL ENGINEERING ELECTRIC SYSTEMS-GENERAL REQUIREMENTS Power Semiconductor Rectifier Systems § 111.33-5 Installation. Each semiconductor rectifier...

  10. 31 CFR 223.5 - Business.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Business. 223.5 Section 223.5 Money... OF THE TREASURY FINANCIAL MANAGEMENT SERVICE SURETY COMPANIES DOING BUSINESS WITH THE UNITED STATES § 223.5 Business. (a) The company must engage in the business of suretyship whether or not also making...

  11. 26 CFR 1.304-5 - Control.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 4 2010-04-01 2010-04-01 false Control. 1.304-5 Section 1.304-5 Internal... TAXES Effects on Recipients § 1.304-5 Control. (a) Control requirement in general. Section 304(c)(1) provides that, for purposes of section 304, control means the ownership of stock possessing at least...

  12. 49 CFR 1185.5 - Common control.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 8 2010-10-01 2010-10-01 false Common control. 1185.5 Section 1185.5... OF TRANSPORTATION RULES OF PRACTICE INTERLOCKING OFFICERS § 1185.5 Common control. It shall not be... carriers if such carriers are operated under common control or management either: (a) Pursuant to...

  13. 12 CFR 269.5 - Elections.

    Science.gov (United States)

    2010-01-01

    ... Bank to recognize a labor organization as the exclusive collective bargaining representative without a... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Elections. 269.5 Section 269.5 Banks and... LABOR RELATIONS FOR THE FEDERAL RESERVE BANKS § 269.5 Elections. (a) Once there has been a final...

  14. 48 CFR 2030.201-5 - Waiver.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Waiver. 2030.201-5 Section 2030.201-5 Federal Acquisition Regulations System NUCLEAR REGULATORY COMMISSION GENERAL CONTRACTING REQUIREMENTS COST ACCOUNTING STANDARDS CAS Program Requirements 2030.201-5 Waiver. Requests to waive Cost...

  15. 36 CFR 5.6 - Commercial vehicles.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 1 2010-07-01 2010-07-01 false Commercial vehicles. 5.6 Section 5.6 Parks, Forests, and Public Property NATIONAL PARK SERVICE, DEPARTMENT OF THE INTERIOR COMMERCIAL AND PRIVATE OPERATIONS § 5.6 Commercial vehicles. (a) The term “Commercial vehicle” as used...

  16. 32 CFR 152.5 - Implementation.

    Science.gov (United States)

    2010-07-01

    ... JUSTICE REVIEW OF THE MANUAL FOR COURTS-MARTIAL § 152.5 Implementation. The foregoing policies and procedures providing guidelines for implementation of this part, as well as those contained in the appendix... 32 National Defense 1 2010-07-01 2010-07-01 false Implementation. 152.5 Section 152.5...

  17. 7 CFR 1424.5 - Agreement process.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Agreement process. 1424.5 Section 1424.5 Agriculture Regulations of the Department of Agriculture (Continued) COMMODITY CREDIT CORPORATION, DEPARTMENT OF AGRICULTURE LOANS, PURCHASES, AND OTHER OPERATIONS BIOENERGY PROGRAM § 1424.5 Agreement process. (a)...

  18. 44 CFR 79.5 - Application process.

    Science.gov (United States)

    2010-10-01

    ... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Application process. 79.5 Section 79.5 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT AGENCY, DEPARTMENT OF... § 79.5 Application process. (a) Applicant or grantee. (1) States will be notified of the...

  19. 22 CFR 94.5 - Application.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Application. 94.5 Section 94.5 Foreign Relations DEPARTMENT OF STATE LEGAL AND RELATED SERVICES INTERNATIONAL CHILD ABDUCTION § 94.5 Application. Any person, institution, or other body may apply to the U.S. Central Authority for assistance in...

  20. 34 CFR 5b.1 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... maintained by the Department, including but not limited to the individual's education, financial transactions... 34 Education 1 2010-07-01 2010-07-01 false Definitions. 5b.1 Section 5b.1 Education Office of the Secretary, Department of Education PRIVACY ACT REGULATIONS § 5b.1 Definitions. As used in this part:...

  1. 7 CFR 1434.5 - Eligible honey.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Eligible honey. 1434.5 Section 1434.5 Agriculture... FOR HONEY § 1434.5 Eligible honey. To be eligible for a loan, the honey must: (a) Have been produced... merchantable quality deemed by CCC to be suitable for loan; that is, the honey: (1) Is not adulterated; (2)...

  2. 29 CFR 552.5 - Casual basis.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false Casual basis. 552.5 Section 552.5 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT OF LABOR REGULATIONS APPLICATION OF THE FAIR LABOR STANDARDS ACT TO DOMESTIC SERVICE General Regulations § 552.5 Casual basis. As used in...

  3. 21 CFR 530.5 - Veterinary records.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 6 2010-04-01 2010-04-01 false Veterinary records. 530.5 Section 530.5 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) ANIMAL DRUGS, FEEDS, AND RELATED PRODUCTS EXTRALABEL DRUG USE IN ANIMALS General Provisions § 530.5 Veterinary...

  4. 12 CFR 725.5 - Capital stock.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 6 2010-01-01 2010-01-01 false Capital stock. 725.5 Section 725.5 Banks and Banking NATIONAL CREDIT UNION ADMINISTRATION REGULATIONS AFFECTING CREDIT UNIONS NATIONAL CREDIT UNION ADMINISTRATION CENTRAL LIQUIDITY FACILITY § 725.5 Capital stock. (a) The capital stock of the Facility is...

  5. 12 CFR 370.5 - Participation.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Participation. 370.5 Section 370.5 Banks and... LIQUIDITY GUARANTEE PROGRAM § 370.5 Participation. (a) Initial period. All eligible entities are covered under the temporary liquidity guarantee program for the period from October 14, 2008, through December...

  6. 49 CFR 587.5 - Incorporated materials.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 7 2010-10-01 2010-10-01 false Incorporated materials. 587.5 Section 587.5... Barrier § 587.5 Incorporated materials. (a) The drawings and specifications referred to in this regulation that are not set forth in full are hereby incorporated in this part by reference. These materials are...

  7. 40 CFR 5.540 - Advertising.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Advertising. 5.540 Section 5.540... in Employment in Education Programs or Activities Prohibited § 5.540 Advertising. A recipient shall not in any advertising related to employment indicate preference, limitation, specification,...

  8. 46 CFR 5.27 - Misconduct.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 1 2010-10-01 2010-10-01 false Misconduct. 5.27 Section 5.27 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY PROCEDURES APPLICABLE TO THE PUBLIC MARINE INVESTIGATION REGULATIONS-PERSONNEL ACTION Definitions § 5.27 Misconduct. Misconduct is human behavior which violates some...

  9. 5 CFR 1639.4 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... additional withholding; (3) Health insurance premiums; (4) Normal retirement contributions as explained in 5 CFR 581.105(e); (5) Normal life insurance premiums, excluding optional life insurance premiums; and (6... deduction of any amount required by law to be withheld, excluding any garnishment under 5 CFR parts 581,...

  10. 5 CFR 838.103 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... retiree to the United States; (2) Deducted for health benefits premiums under section 8906 of title 5, United States Code, and §§ 891.401 and 891.402 of this chapter; (3) Deducted for life insurance premiums under section 8714a(d) of title 5, United States Code; (4) Deducted for Medicare premiums; (5)...

  11. 24 CFR 91.5 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Definitions. 91.5 Section 91.5... CONSOLIDATED SUBMISSIONS FOR COMMUNITY PLANNING AND DEVELOPMENT PROGRAMS General § 91.5 Definitions. The terms... disability at the time of his or her death. Poverty level family. Family with an income below the poverty...

  12. 18 CFR 367.5 - Accounting period.

    Science.gov (United States)

    2010-04-01

    ... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Accounting period. 367.5 Section 367.5 Conservation of Power and Water Resources FEDERAL ENERGY REGULATORY COMMISSION... Instructions § 367.5 Accounting period. Each service company must keep its books on a monthly basis so that...

  13. 5 CFR 1330.401 - Purpose.

    Science.gov (United States)

    2010-01-01

    ... MANAGEMENT HUMAN RESOURCES MANAGEMENT Performance Appraisal Certification for Pay Purposes § 1330.401 Purpose. (a) This subpart implements 5 U.S.C. 5307(d), as added by section 1322 of the Chief Human Capital... Schedule under 5 U.S.C. 5307(a) and 5 CFR 530.203(a). Only employees covered by an appraisal system...

  14. 10 CFR 725.5 - Communications.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 4 2010-01-01 2010-01-01 false Communications. 725.5 Section 725.5 Energy DEPARTMENT OF ENERGY PERMITS FOR ACCESS TO RESTRICTED DATA General Provisions § 725.5 Communications. All communications concerning this part should be addressed to the Chief Health, Safety and Security Officer,...

  15. 10 CFR 170.5 - Communications.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 2 2010-01-01 2010-01-01 false Communications. 170.5 Section 170.5 Energy NUCLEAR... REGULATORY SERVICES UNDER THE ATOMIC ENERGY ACT OF 1954, AS AMENDED General Provisions § 170.5 Communications. All communications concerning the regulations in this part should be addressed to the NRC's...

  16. 23 CFR 669.5 - Objective.

    Science.gov (United States)

    2010-04-01

    ... 23 Highways 1 2010-04-01 2010-04-01 false Objective. 669.5 Section 669.5 Highways FEDERAL HIGHWAY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION ENGINEERING AND TRAFFIC OPERATIONS ENFORCEMENT OF HEAVY VEHICLE USE TAX § 669.5 Objective. The objective of this regulation is to establish realistic and...

  17. 7 CFR 227.5 - Program funding.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Program funding. 227.5 Section 227.5 Agriculture... CHILD NUTRITION PROGRAMS NUTRITION EDUCATION AND TRAINING PROGRAM General § 227.5 Program funding. (a... agencies shall maintain their present level of funding for existing nutrition education and...

  18. 7 CFR 624.5 - Coordination.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 6 2010-01-01 2010-01-01 false Coordination. 624.5 Section 624.5 Agriculture Regulations of the Department of Agriculture (Continued) NATURAL RESOURCES CONSERVATION SERVICE, DEPARTMENT OF AGRICULTURE WATER RESOURCES EMERGENCY WATERSHED PROTECTION § 624.5 Coordination. (a) If the President...

  19. 15 CFR 908.5 - Interim reports.

    Science.gov (United States)

    2010-01-01

    ... 15 Commerce and Foreign Trade 3 2010-01-01 2010-01-01 false Interim reports. 908.5 Section 908.5... SUBMITTING REPORTS ON WEATHER MODIFICATION ACTIVITIES § 908.5 Interim reports. (a) Any person engaged in a... Administrator, not later than 45 days thereafter, an interim report setting forth as of such date...

  20. 40 CFR 35.937-5 - Negotiation.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Negotiation. 35.937-5 Section 35.937-5... ASSISTANCE Grants for Construction of Treatment Works-Clean Water Act § 35.937-5 Negotiation. (a) Grantees are responsible for negotiation of their contracts for architectural or engineering services....

  1. 7 CFR 772.5 - Security maintenance.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 7 2010-01-01 2010-01-01 false Security maintenance. 772.5 Section 772.5 Agriculture Regulations of the Department of Agriculture (Continued) FARM SERVICE AGENCY, DEPARTMENT OF AGRICULTURE SPECIAL PROGRAMS SERVICING MINOR PROGRAM LOANS § 772.5 Security maintenance. (a) General. Borrowers...

  2. 47 CFR 5.73 - Experimental report.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 1 2010-10-01 2010-10-01 false Experimental report. 5.73 Section 5.73 Telecommunication FEDERAL COMMUNICATIONS COMMISSION GENERAL EXPERIMENTAL RADIO SERVICE (OTHER THAN BROADCAST) Applications and Licenses § 5.73 Experimental report. (a) Unless specifically stated as a condition of...

  3. 14 CFR 313.5 - Energy information.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Energy information. 313.5 Section 313.5... REGULATIONS IMPLEMENTATION OF THE ENERGY POLICY AND CONSERVATION ACT § 313.5 Energy information. (a) It shall... involve a major regulatory action to submit sufficient information about the energy consumption and...

  4. 45 CFR 32.5 - Hearing.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 1 2010-10-01 2010-10-01 false Hearing. 32.5 Section 32.5 Public Welfare DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL ADMINISTRATION ADMINISTRATIVE WAGE GARNISHMENT § 32.5 Hearing. (a) In general. Upon timely written request of the debtor, the Secretary shall provide a hearing...

  5. 25 CFR 135.5 - Penalty.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Penalty. 135.5 Section 135.5 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR FINANCIAL ACTIVITIES CONSTRUCTION ASSESSMENTS, CROW INDIAN IRRIGATION PROJECT Charges Assessed Against Irrigation District Lands § 135.5 Penalty. To all assessments not paid on...

  6. Main: LS5ATPR1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available LS5ATPR1 S000323 04-January-2007 (last modified) kehi LS5; A negative regulatory el...e correction was made. TGA2; LS5; LS7; SA; NPR1; TGA6; auxin; salicylic acid; root; Arabidopsis thaliana; tobacco (Nicotiana tabacum); TCTACGTCAC ...

  7. 32 CFR 1645.5 - Impartiality.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 6 2010-07-01 2010-07-01 false Impartiality. 1645.5 Section 1645.5 National Defense Other Regulations Relating to National Defense SELECTIVE SERVICE SYSTEM CLASSIFICATION OF MINISTERS OF RELIGION § 1645.5 Impartiality. Boards may not give preferential treatment to one religion...

  8. 46 CFR 56.70-5 - Material.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 2 2010-10-01 2010-10-01 false Material. 56.70-5 Section 56.70-5 Shipping COAST GUARD..., Assembly and Erection § 56.70-5 Material. (a) Filler metal. All filler metal, including consumable insert material, must comply with the requirements of section IX of the ASME Boiler and Pressure Vessel Code...

  9. 40 CFR 1612.5 - Other material.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 32 2010-07-01 2010-07-01 false Other material. 1612.5 Section 1612.5... PROCEEDINGS § 1612.5 Other material. (a) Production prohibited unless approved. Except in the case of the material referenced in § 1612.3, no employee or former employee of the CSB shall, in response to a demand...

  10. 7 CFR 1170.5 - Manufacturer.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 9 2010-01-01 2009-01-01 true Manufacturer. 1170.5 Section 1170.5 Agriculture... and Orders; Milk), DEPARTMENT OF AGRICULTURE DAIRY PRODUCT MANDATORY REPORTING § 1170.5 Manufacturer. Manufacturer means any person engaged in the business of buying milk in commerce for the purpose...

  11. 23 CFR 1335.5 - Assessment.

    Science.gov (United States)

    2010-04-01

    ... 23 Highways 1 2010-04-01 2010-04-01 false Assessment. 1335.5 Section 1335.5 Highways NATIONAL HIGHWAY TRAFFIC SAFETY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION STATE HIGHWAY SAFETY DATA IMPROVEMENTS § 1335.5 Assessment. An assessment shall— (a) Be an in-depth, formal review of a State's highway safety...

  12. 49 CFR 1019.5 - Sexual harassment.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 8 2010-10-01 2010-10-01 false Sexual harassment. 1019.5 Section 1019.5... TRANSPORTATION BOARD EMPLOYEES § 1019.5 Sexual harassment. (a) Members and employees shall not engage in harassment on the basis of sex. Unwelcome sexual advances, requests for sexual favors, and other verbal...

  13. 26 CFR 52.4682-5 - Exports.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 17 2010-04-01 2010-04-01 false Exports. 52.4682-5 Section 52.4682-5 Internal... (CONTINUED) ENVIRONMENTAL TAXES § 52.4682-5 Exports. (a) Overview. This section provides rules relating to the tax imposed under section 4681 on ozone-depleting chemicals (ODCs) that are exported. In...

  14. 45 CFR 5.35 - Time limits.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 1 2010-10-01 2010-10-01 false Time limits. 5.35 Section 5.35 Public Welfare... Denial of Records § 5.35 Time limits. (a) General. FOIA sets certain time limits for us to decide whether... time limits, but if it appears that processing your request may take longer than we would wish, we...

  15. 7 CFR 927.5 - Size.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 8 2010-01-01 2010-01-01 false Size. 927.5 Section 927.5 Agriculture Regulations of... Regulating Handling Definitions § 927.5 Size. Size means the number of pears which can be packed in a 44-pound net weight standard box or container equivalent, or as “size” means the greatest transverse...

  16. 15 CFR 806.5 - Confidentiality.

    Science.gov (United States)

    2010-01-01

    ... 15 Commerce and Foreign Trade 3 2010-01-01 2010-01-01 false Confidentiality. 806.5 Section 806.5 Commerce and Foreign Trade Regulations Relating to Commerce and Foreign Trade (Continued) BUREAU OF ECONOMIC ANALYSIS, DEPARTMENT OF COMMERCE DIRECT INVESTMENT SURVEYS § 806.5 Confidentiality....

  17. 28 CFR 27.5 - Review.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Review. 27.5 Section 27.5 Judicial... Investigating Reprisal Allegations and Ordering Corrective Action § 27.5 Review. The Complainant or the FBI may..., review by the Deputy Attorney General of that determination or order. The Deputy Attorney General...

  18. 16 CFR 1105.5 - Applications.

    Science.gov (United States)

    2010-01-01

    ... 16 Commercial Practices 2 2010-01-01 2010-01-01 false Applications. 1105.5 Section 1105.5... TO COSTS OF PARTICIPANTS IN DEVELOPMENT OF CONSUMER PRODUCT SAFETY STANDARDS § 1105.5 Applications. Applications must be submitted to the Office of the Secretary, Consumer Product Safety Commission, Washington...

  19. 7 CFR 915.5 - Avocados.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 8 2010-01-01 2010-01-01 false Avocados. 915.5 Section 915.5 Agriculture Regulations... Orders; Fruits, Vegetables, Nuts), DEPARTMENT OF AGRICULTURE AVOCADOS GROWN IN SOUTH FLORIDA Order Regulating Handling Definitions § 915.5 Avocados. Avocados means all varieties of avocados grown in...

  20. 7 CFR 1209.5 - Department.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Department. 1209.5 Section 1209.5 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING AGREEMENTS....5 Department. Department means the United States Department of Agriculture....

  1. 21 CFR 1402.5 - Appeal procedure.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 9 2010-04-01 2010-04-01 false Appeal procedure. 1402.5 Section 1402.5 Food and Drugs OFFICE OF NATIONAL DRUG CONTROL POLICY MANDATORY DECLASSIFICATION REVIEW § 1402.5 Appeal procedure. Appeals reviewed as a result of a denial will be routed to the Director of ONDCP, who will take action...

  2. 38 CFR 60.5 - Travel.

    Science.gov (United States)

    2010-07-01

    ... 38 Pensions, Bonuses, and Veterans' Relief 2 2010-07-01 2010-07-01 false Travel. 60.5 Section 60.5... TEMPORARY LODGING § 60.5 Travel. As a condition for receiving temporary lodging under this part, a veteran must be required to travel either 50 or more miles, or at least two hours from his or her home to...

  3. 36 CFR 5.1 - Advertisements.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 1 2010-07-01 2010-07-01 false Advertisements. 5.1 Section 5... AND PRIVATE OPERATIONS § 5.1 Advertisements. Commercial notices or advertisements shall not be... or advertisement is of goods, services, or facilities available within the park area and such...

  4. 20 CFR 902.5 - Appeal.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Appeal. 902.5 Section 902.5 Employees' Benefits JOINT BOARD FOR THE ENROLLMENT OF ACTUARIES RULES REGARDING AVAILABILITY OF INFORMATION § 902.5 Appeal. (a) Any person denied access to records requested under § 902.4, may within thirty days...

  5. 20 CFR 900.5 - Staff.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Staff. 900.5 Section 900.5 Employees' Benefits JOINT BOARD FOR THE ENROLLMENT OF ACTUARIES STATEMENT OF ORGANIZATION § 900.5 Staff. (a) The Executive Director advises and assists the Joint Board directly in carrying out its responsibilities...

  6. 44 CFR 5.28 - Indexes.

    Science.gov (United States)

    2010-10-01

    ... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Indexes. 5.28 Section 5.28 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT AGENCY, DEPARTMENT OF HOMELAND SECURITY... described in § 5.25. FEMA will publish quarterly and make available copies of each index or...

  7. 32 CFR 806b.5 - Personal notes.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 6 2010-07-01 2010-07-01 false Personal notes. 806b.5 Section 806b.5 National... Overview of the Privacy Act Program § 806b.5 Personal notes. The Privacy Act does not apply to personal notes on individuals used as memory aids. Personal notes may become Privacy Act records if they...

  8. 10 CFR 960.5 - Preclosure guidelines.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 4 2010-01-01 2010-01-01 false Preclosure guidelines. 960.5 Section 960.5 Energy DEPARTMENT OF ENERGY GENERAL GUIDELINES FOR THE PRELIMINARY SCREENING OF POTENTIAL SITES FOR A NUCLEAR WASTE REPOSITORY Preclosure Guidelines § 960.5 Preclosure guidelines. The guidelines in this subpart specify...

  9. 7 CFR 622.5 - Guidelines.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 6 2010-01-01 2010-01-01 false Guidelines. 622.5 Section 622.5 Agriculture... AGRICULTURE WATER RESOURCES WATERSHED PROJECTS General § 622.5 Guidelines. Guidelines for carrying out... Environmental Principles and Guidelines for Water and Related Land Resources Implementation Studies issued...

  10. 46 CFR 76.35-5 - Zoning.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 3 2010-10-01 2010-10-01 false Zoning. 76.35-5 Section 76.35-5 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) PASSENGER VESSELS FIRE PROTECTION EQUIPMENT Manual Alarm System, Details § 76.35-5 Zoning. (a) The zoning of the manual alarm system shall meet the same requirements...

  11. 46 CFR 76.27-5 - Zoning.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 3 2010-10-01 2010-10-01 false Zoning. 76.27-5 Section 76.27-5 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) PASSENGER VESSELS FIRE PROTECTION EQUIPMENT Electric Fire Detecting System, Details § 76.27-5 Zoning. (a) The fire detecting system shall be divided into...

  12. 46 CFR 76.30-5 - Zoning.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 3 2010-10-01 2010-10-01 false Zoning. 76.30-5 Section 76.30-5 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) PASSENGER VESSELS FIRE PROTECTION EQUIPMENT Pneumatic Fire Detecting System, Details § 76.30-5 Zoning. (a) The fire detecting system shall be divided into...

  13. 46 CFR 76.23-5 - Zoning.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 3 2010-10-01 2010-10-01 false Zoning. 76.23-5 Section 76.23-5 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) PASSENGER VESSELS FIRE PROTECTION EQUIPMENT Manual Sprinkling System, Details § 76.23-5 Zoning. (a) Separate zones may be used for each deck, and on any...

  14. 46 CFR 76.33-5 - Zoning.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 3 2010-10-01 2010-10-01 false Zoning. 76.33-5 Section 76.33-5 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) PASSENGER VESSELS FIRE PROTECTION EQUIPMENT Smoke Detecting System, Details § 76.33-5 Zoning. (a) The smoke detecting system shall be divided into separate zones...

  15. 14 CFR 314.5 - Major contractions.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Major contractions. 314.5 Section 314.5... REGULATIONS EMPLOYEE PROTECTION PROGRAM General § 314.5 Major contractions. A major contraction is a reduction...-month period, and includes an advance determination of major contraction as set forth in § 314.21....

  16. 22 CFR 20.5 - Survivor benefits.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Survivor benefits. 20.5 Section 20.5 Foreign Relations DEPARTMENT OF STATE PERSONNEL BENEFITS FOR CERTAIN FORMER SPOUSES § 20.5 Survivor benefits. (a... survivor benefits equal to one of the following; whichever is applicable: (1) 55 percent of the...

  17. 32 CFR 266.5 - Responsibilities.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Responsibilities. 266.5 Section 266.5 National... § 266.5 Responsibilities. (a) The Inspector General of the Department of Defense shall: (1) Serve as the... other nonprofit institutions for which the Department of Defense has assumed oversight...

  18. 47 CFR 27.5 - Frequencies.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 2 2010-10-01 2010-10-01 false Frequencies. 27.5 Section 27.5... COMMUNICATIONS SERVICES General Information § 27.5 Frequencies. (a) 2305-2320 MHz and 2345-2360 MHz bands. The following frequencies are available for WCS in the 2305-2320 MHz and 2345-2360 MHz bands: (1) Two...

  19. 49 CFR 1103.5 - Discipline.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 8 2010-10-01 2010-10-01 false Discipline. 1103.5 Section 1103.5 Transportation Other Regulations Relating to Transportation (Continued) SURFACE TRANSPORTATION BOARD, DEPARTMENT OF TRANSPORTATION RULES OF PRACTICE PRACTITIONERS General Information § 1103.5 Discipline. (a) A member of the...

  20. 15 CFR 701.5 - Confidentiality.

    Science.gov (United States)

    2010-01-01

    ... 15 Commerce and Foreign Trade 2 2010-01-01 2010-01-01 false Confidentiality. 701.5 Section 701.5 Commerce and Foreign Trade Regulations Relating to Commerce and Foreign Trade (Continued) BUREAU OF... FIRMS § 701.5 Confidentiality. (a) As provided by § 309(c) of the Defense Production Act of 1950, as...

  1. 7 CFR 1425.5 - Confidentiality.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Confidentiality. 1425.5 Section 1425.5 Agriculture Regulations of the Department of Agriculture (Continued) COMMODITY CREDIT CORPORATION, DEPARTMENT OF AGRICULTURE LOANS, PURCHASES, AND OTHER OPERATIONS COOPERATIVE MARKETING ASSOCIATIONS § 1425.5 Confidentiality...

  2. 31 CFR 129.5 - Confidentiality.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Confidentiality. 129.5 Section 129.5 Money and Finance: Treasury Regulations Relating to Money and Finance PORTFOLIO INVESTMENT SURVEY REPORTING § 129.5 Confidentiality. (a) Information collected pursuant to the Act will be kept in confidence...

  3. 15 CFR 801.5 - Confidentiality.

    Science.gov (United States)

    2010-01-01

    ... 15 Commerce and Foreign Trade 3 2010-01-01 2010-01-01 false Confidentiality. 801.5 Section 801.5 Commerce and Foreign Trade Regulations Relating to Commerce and Foreign Trade (Continued) BUREAU OF... FOREIGN PERSONS § 801.5 Confidentiality. Information collected pursuant to § 801.3 is confidential (see...

  4. 7 CFR 1219.5 - Crop year.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Crop year. 1219.5 Section 1219.5 Agriculture..., AND INFORMATION Hass Avocado Promotion, Research, and Information Order Definitions § 1219.5 Crop year. Crop year means the period from November 1 of one year through October 31 of the following year, or...

  5. 16 CFR 444.5 - State exemptions.

    Science.gov (United States)

    2010-01-01

    ... 16 Commercial Practices 1 2010-01-01 2010-01-01 false State exemptions. 444.5 Section 444.5 Commercial Practices FEDERAL TRADE COMMISSION TRADE REGULATION RULES CREDIT PRACTICES § 444.5 State exemptions. (a) If, upon application to the Federal Trade Commission by an appropriate State agency,...

  6. 10 CFR 5.410 - Comparable facilities.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 1 2010-01-01 2010-01-01 false Comparable facilities. 5.410 Section 5.410 Energy NUCLEAR... Prohibited § 5.410 Comparable facilities. A recipient may provide separate toilet, locker room, and shower facilities on the basis of sex, but such facilities provided for students of one sex shall be comparable to...

  7. 21 CFR 900.5 - Evaluation.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Evaluation. 900.5 Section 900.5 Food and Drugs... STANDARDS ACT MAMMOGRAPHY Accreditation § 900.5 Evaluation. FDA shall evaluate annually the performance of each accreditation body. Such evaluation shall include an assessment of the reports of FDA or State...

  8. 24 CFR 5.321 - Lease provisions.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Lease provisions. 5.321 Section 5... General Requirements § 5.321 Lease provisions. (a) Lease provisions. (1) PHAs which have established pet rules and project owners shall ensure that the leases for all tenants of projects for the elderly...

  9. Voedings- en eetstoornissen in de DSM-5

    NARCIS (Netherlands)

    Hoek, H W; van Elburg, Annemarie

    2014-01-01

    BACKGROUND: In the DSM-5, feeding disorders and eating disorders have been integrated into one single category. AIM: To review the rationale for changes in the criteria for feeding and eating disorders in DSM-5. METHOD: The revised criteria were drafted and formulated by a DSM-5 workgroup. Next, pro

  10. 12 CFR 368.5 - Customer information.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Customer information. 368.5 Section 368.5 Banks... GOVERNMENT SECURITIES SALES PRACTICES § 368.5 Customer information. Prior to the execution of a transaction... make reasonable efforts to obtain information concerning: (a) The customer's financial status; (b)...

  11. 22 CFR 141.5 - Compliance information.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Compliance information. 141.5 Section 141.5... DEPARTMENT OF STATE-EFFECTUATION OF TITLE VI OF THE CIVIL RIGHTS ACT OF 1964 § 141.5 Compliance information... such information, as a responsible Departmental official or his designee may determine to be...

  12. 31 CFR 128.5 - Recordkeeping requirements.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Recordkeeping requirements. 128.5 Section 128.5 Money and Finance: Treasury Regulations Relating to Money and Finance REPORTING OF INTERNATIONAL CAPITAL AND FOREIGN-CURRENCY TRANSACTIONS AND POSITIONS General Information § 128.5...

  13. 36 CFR 702.5 - Gambling.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 3 2010-07-01 2010-07-01 false Gambling. 702.5 Section 702.5 Parks, Forests, and Public Property LIBRARY OF CONGRESS CONDUCT ON LIBRARY PREMISES § 702.5 Gambling. Participation in any illegal gambling, such as the operation of gambling devices, the conduct of an illegal...

  14. 10 CFR 5.540 - Advertising.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 1 2010-01-01 2010-01-01 false Advertising. 5.540 Section 5.540 Energy NUCLEAR REGULATORY COMMISSION NONDISCRIMINATION ON THE BASIS OF SEX IN EDUCATION PROGRAMS OR ACTIVITIES RECEIVING FEDERAL... Prohibited § 5.540 Advertising. A recipient shall not in any advertising related to employment...

  15. 9 CFR 89.5 - Feeding pens.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Feeding pens. 89.5 Section 89.5... TWENTY-EIGHT HOUR LAW § 89.5 Feeding pens. (a) Stock pens and other enclosures for feeding, watering, and... same time, (2) properly designed facilities for feeding and watering the livestock, (3) reasonably...

  16. Voedings- en eetstoornissen in de DSM-5

    NARCIS (Netherlands)

    Hoek, H W; van Elburg, Annemarie

    2014-01-01

    BACKGROUND: In the DSM-5, feeding disorders and eating disorders have been integrated into one single category. AIM: To review the rationale for changes in the criteria for feeding and eating disorders in DSM-5. METHOD: The revised criteria were drafted and formulated by a DSM-5 workgroup. Next, pro

  17. 7 CFR 273.5 - Students.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Students. 273.5 Section 273.5 Agriculture Regulations... FOOD STAMP AND FOOD DISTRIBUTION PROGRAM CERTIFICATION OF ELIGIBLE HOUSEHOLDS § 273.5 Students. (a... programs regardless of whether a high school diploma is required. (b) Student Exemptions. To be...

  18. 32 CFR 887.5 - Issuing CILs.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 6 2010-07-01 2010-07-01 false Issuing CILs. 887.5 Section 887.5 National... CERTIFICATES IN LIEU OF LOST OR DESTROYED CERTIFICATES OF SEPARATION § 887.5 Issuing CILs. The issuing... requested. Individuals indicated in § 887.3 may be issued CILs prepared on one of the following forms: (a...

  19. 32 CFR 179.5 - Responsibilities.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 1 2010-07-01 2010-07-01 false Responsibilities. 179.5 Section 179.5 National Defense Department of Defense OFFICE OF THE SECRETARY OF DEFENSE CLOSURES AND REALIGNMENT MUNITIONS RESPONSE SITE PRIORITIZATION PROTOCOL (MRSPP) § 179.5 Responsibilities. Each Component shall: (a) Apply...

  20. 32 CFR 187.5 - Responsibilities.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 1 2010-07-01 2010-07-01 false Responsibilities. 187.5 Section 187.5 National Defense Department of Defense OFFICE OF THE SECRETARY OF DEFENSE ENVIRONMENT ENVIRONMENTAL EFFECTS ABROAD OF MAJOR DEPARTMENT OF DEFENSE ACTIONS § 187.5 Responsibilities. (a) The Assistant Secretary...

  1. 32 CFR 47.5 - Responsibilities.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 1 2010-07-01 2010-07-01 false Responsibilities. 47.5 Section 47.5 National Defense Department of Defense OFFICE OF THE SECRETARY OF DEFENSE PERSONNEL, MILITARY AND CIVILIAN ACTIVE DUTY SERVICE FOR CIVILIAN OR CONTRACTUAL GROUPS § 47.5 Responsibilities. (a) The Assistant Secretary...

  2. 32 CFR 86.5 - Responsibilities.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 1 2010-07-01 2010-07-01 false Responsibilities. 86.5 Section 86.5 National Defense Department of Defense OFFICE OF THE SECRETARY OF DEFENSE PERSONNEL, MILITARY AND CIVILIAN CRIMINAL HISTORY BACKGROUND CHECKS ON INDIVIDUALS IN CHILD CARE SERVICES § 86.5 Responsibilities. (a) The...

  3. 32 CFR 142.5 - Responsibilities.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 1 2010-07-01 2010-07-01 false Responsibilities. 142.5 Section 142.5 National Defense Department of Defense OFFICE OF THE SECRETARY OF DEFENSE PERSONNEL, MILITARY AND CIVILIAN COPYRIGHTED SOUND AND VIDEO RECORDINGS § 142.5 Responsibilities. Heads of DoD Components shall...

  4. 32 CFR 168a.5 - Responsibilities.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 1 2010-07-01 2010-07-01 false Responsibilities. 168a.5 Section 168a.5 National Defense Department of Defense OFFICE OF THE SECRETARY OF DEFENSE DEFENSE CONTRACTING NATIONAL DEFENSE SCIENCE AND ENGINEERING GRADUATE FELLOWSHIPS § 168a.5 Responsibilities. (a) The Deputy Director,...

  5. 32 CFR 162.5 - Responsibilities.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 1 2010-07-01 2010-07-01 false Responsibilities. 162.5 Section 162.5 National... ENHANCING CAPITAL INVESTMENT (PECI) § 162.5 Responsibilities. (a) The Assistant Secretary of Defense (Force... responsibility. (6) Use the Defense Productivity Program Office (DPPO) to: (i) Provide technical guidance...

  6. 32 CFR 67.5 - Responsibilities.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 1 2010-07-01 2010-07-01 false Responsibilities. 67.5 Section 67.5 National Defense Department of Defense OFFICE OF THE SECRETARY OF DEFENSE PERSONNEL, MILITARY AND CIVILIAN... LIEUTENANT (JUNIOR GRADE) § 67.5 Responsibilities. (a) The Assistant Secretary of Defense for Reserve...

  7. 32 CFR 144.5 - Responsibilities.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 1 2010-07-01 2010-07-01 false Responsibilities. 144.5 Section 144.5 National Defense Department of Defense OFFICE OF THE SECRETARY OF DEFENSE PERSONNEL, MILITARY AND CIVILIAN SERVICE BY MEMBERS OF THE ARMED FORCES ON STATE AND LOCAL JURIES § 144.5 Responsibilities. The Secretaries...

  8. 32 CFR 165.5 - Responsibilities.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 1 2010-07-01 2010-07-01 false Responsibilities. 165.5 Section 165.5 National Defense Department of Defense OFFICE OF THE SECRETARY OF DEFENSE DEFENSE CONTRACTING RECOUPMENT OF NONRECURRING COSTS ON SALES OF U.S. ITEMS § 165.5 Responsibilities. (a) The Comptroller of the Department...

  9. 32 CFR 104.5 - Responsibilities.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 1 2010-07-01 2010-07-01 false Responsibilities. 104.5 Section 104.5 National... UNIFORMED SERVICES § 104.5 Responsibilities. (a) The Assistant Secretary of Defense for Reserve Affairs.... chapter 43. This responsibility shall be carried out in coordination with DoL, OPM, and the...

  10. 32 CFR 50.5 - Responsibilities.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 1 2010-07-01 2010-07-01 false Responsibilities. 50.5 Section 50.5 National Defense Department of Defense OFFICE OF THE SECRETARY OF DEFENSE PERSONNEL, MILITARY AND CIVILIAN PERSONAL COMMERCIAL SOLICITATION ON DOD INSTALLATIONS General Provisions § 50.5 Responsibilities. (a) The...

  11. 32 CFR 113.5 - Responsibilities.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 1 2010-07-01 2010-07-01 false Responsibilities. 113.5 Section 113.5 National Defense Department of Defense OFFICE OF THE SECRETARY OF DEFENSE PERSONNEL, MILITARY AND CIVILIAN INDEBTEDNESS PROCEDURES OF MILITARY PERSONNEL § 113.5 Responsibilities. (a) The Under Secretary of Defense...

  12. 32 CFR 77.5 - Responsibilities.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 1 2010-07-01 2010-07-01 false Responsibilities. 77.5 Section 77.5 National Defense Department of Defense OFFICE OF THE SECRETARY OF DEFENSE PERSONNEL, MILITARY AND CIVILIAN PROGRAM TO ENCOURAGE PUBLIC AND COMMUNITY SERVICE § 77.5 Responsibilities. (a) The Under Secretary of...

  13. 32 CFR 96.5 - Responsibilities.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 1 2010-07-01 2010-07-01 false Responsibilities. 96.5 Section 96.5 National Defense Department of Defense OFFICE OF THE SECRETARY OF DEFENSE PERSONNEL, MILITARY AND CIVILIAN ACQUISITION AND USE OF CRIMINAL HISTORY RECORD INFORMATION BY THE MILITARY SERVICES § 96.5...

  14. 32 CFR 54.5 - Responsibilities.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 1 2010-07-01 2010-07-01 false Responsibilities. 54.5 Section 54.5 National Defense Department of Defense OFFICE OF THE SECRETARY OF DEFENSE PERSONNEL, MILITARY AND CIVILIAN ALLOTMENTS FOR CHILD AND SPOUSAL SUPPORT § 54.5 Responsibilities. (a) The Assistant Secretary of...

  15. 7 CFR 1000.5 - Distributing plant.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 9 2010-01-01 2009-01-01 true Distributing plant. 1000.5 Section 1000.5 Agriculture... Definitions § 1000.5 Distributing plant. Distributing plant means a plant that is approved by a duly... plants....

  16. 21 CFR 25.5 - Terminology.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 1 2010-04-01 2010-04-01 false Terminology. 25.5 Section 25.5 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL ENVIRONMENTAL IMPACT CONSIDERATIONS General Provisions § 25.5 Terminology. (a) Definitions that apply to the terms used in this...

  17. 29 CFR 5.28 - Unfunded plans.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 1 2010-07-01 2010-07-01 true Unfunded plans. 5.28 Section 5.28 Labor Office of the... the Davis-Bacon Act § 5.28 Unfunded plans. (a) The costs to a contractor or subcontractor which may be... commitment to carry out a financially responsible plan or program, are considered fringe benefits within the...

  18. 8 CFR 211.5 - Alien commuters.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Alien commuters. 211.5 Section 211.5 Aliens...: IMMIGRANTS; WAIVERS § 211.5 Alien commuters. (a) General. An alien lawfully admitted for permanent residence.... An alien commuter engaged in seasonal work will be presumed to have taken up residence in the...

  19. 43 CFR 414.5 - Water quality.

    Science.gov (United States)

    2010-10-01

    ... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Water quality. 414.5 Section 414.5 Public... APPORTIONMENT IN THE LOWER DIVISION STATES Water Quality and Environmental Compliance § 414.5 Water quality. (a) Water Quality is not guaranteed. The Secretary does not warrant the quality of water released or...

  20. 17 CFR 31.5 - Unlawful conduct.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 1 2010-04-01 2010-04-01 false Unlawful conduct. 31.5 Section 31.5 Commodity and Securities Exchanges COMMODITY FUTURES TRADING COMMISSION LEVERAGE TRANSACTIONS § 31.5 Unlawful conduct. (a) On and after April 13, 1984, it shall be unlawful for any person: (1) To...

  1. 14 CFR 300.5 - Prohibited conduct.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Prohibited conduct. 300.5 Section 300.5 Aeronautics and Space OFFICE OF THE SECRETARY, DEPARTMENT OF TRANSPORTATION (AVIATION PROCEEDINGS) PROCEDURAL REGULATIONS RULES OF CONDUCT IN DOT PROCEEDINGS UNDER THIS CHAPTER § 300.5 Prohibited conduct. No person shall...

  2. 32 CFR 1609.5 - Suspension.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 6 2010-07-01 2010-07-01 false Suspension. 1609.5 Section 1609.5 National Defense Other Regulations Relating to National Defense SELECTIVE SERVICE SYSTEM UNCOMPENSATED PERSONNEL § 1609.5 Suspension. The Director of Selective Service may suspend from duty any uncompensated...

  3. 25 CFR 558.5 - License suspension.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 2 2010-04-01 2010-04-01 false License suspension. 558.5 Section 558.5 Indians NATIONAL... MANAGEMENT OFFICIALS § 558.5 License suspension. (a) If, after the issuance of a gaming license, the... tribe shall suspend such license and shall notify in writing the licensee of the suspension and...

  4. 26 CFR 1.812-5 - Offset.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 8 2010-04-01 2010-04-01 false Offset. 1.812-5 Section 1.812-5 Internal Revenue... and Loss from Operations § 1.812-5 Offset. (a) Offset defined. Section 812(d) defines the term “offset... offset is only that portion of the increase in the operations loss deduction for the taxable year...

  5. 39 CFR 221.5 - Headquarters organization.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Headquarters organization. 221.5 Section 221.5 Postal Service UNITED STATES POSTAL SERVICE ORGANIZATION AND ADMINISTRATION GENERAL ORGANIZATION § 221.5 Headquarters organization. (a) Postmaster General—(1) Appointment. The postmaster general (PMG), the...

  6. 33 CFR 5.05 - Organization.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Organization. 5.05 Section 5.05 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY GENERAL COAST GUARD AUXILIARY § 5.05 Organization. The Auxiliary is a nonmilitary organization administered by the Commandant,...

  7. 7 CFR 2003.5 - Headquarters organization.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 15 2010-01-01 2010-01-01 false Headquarters organization. 2003.5 Section 2003.5...) ADMINISTRATIVE REGULATIONS ORGANIZATION Functional Organization of the Rural Development Mission Area § 2003.5 Headquarters organization. (a) The Rural Development Headquarters is comprised of: (1) The Office of the...

  8. 7 CFR 322.5 - General requirements.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 5 2010-01-01 2010-01-01 false General requirements. 322.5 Section 322.5 Agriculture Regulations of the Department of Agriculture (Continued) ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE BEES, BEEKEEPING BYPRODUCTS, AND BEEKEEPING EQUIPMENT Importation of...

  9. 40 CFR 148.5 - Waste analysis.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Waste analysis. 148.5 Section 148.5 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER PROGRAMS (CONTINUED) HAZARDOUS WASTE INJECTION RESTRICTIONS General § 148.5 Waste analysis. Generators of hazardous wastes that...

  10. 25 CFR 175.5 - Operations manual.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Operations manual. 175.5 Section 175.5 Indians BUREAU OF... Provisions § 175.5 Operations manual. (a) The Area Director shall establish an operations manual for the... Director shall amend the operations manual as needed. (b) The public shall be notified by the Area...

  11. 18 CFR 5.28 - Competing applications.

    Science.gov (United States)

    2010-04-01

    ... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Competing applications. 5.28 Section 5.28 Conservation of Power and Water Resources FEDERAL ENERGY REGULATORY COMMISSION... Competing applications. (a) Site access for a competing applicant. The provisions of § 16.5 of this...

  12. 32 CFR 352a.5 - Relationships.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Relationships. 352a.5 Section 352a.5 National Defense Department of Defense (Continued) OFFICE OF THE SECRETARY OF DEFENSE (CONTINUED) ORGANIZATIONAL CHARTERS DEFENSE FINANCE AND ACCOUNTING SERVICE (DFAS) § 352a.5 Relationships. (a) In the performance...

  13. 10 CFR 850.5 - Dispute resolution.

    Science.gov (United States)

    2010-01-01

    ... relief in accordance with 10 CFR part 1003, Subpart G. (b) The Office of Hearings and Appeals may not... 10 Energy 4 2010-01-01 2010-01-01 false Dispute resolution. 850.5 Section 850.5 Energy DEPARTMENT OF ENERGY CHRONIC BERYLLIUM DISEASE PREVENTION PROGRAM General Provisions § 850.5 Dispute...

  14. 10 CFR 5.515 - Compensation.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 1 2010-01-01 2010-01-01 false Compensation. 5.515 Section 5.515 Energy NUCLEAR... Activities Prohibited § 5.515 Compensation. A recipient shall not make or enforce any policy or practice that, on the basis of sex: (a) Makes distinctions in rates of pay or other compensation; (b) Results in...

  15. 33 CFR 5.55 - Compensation.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Compensation. 5.55 Section 5.55 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY GENERAL COAST GUARD AUXILIARY § 5.55 Compensation. No member of the Auxiliary shall receive any compensation for his services as...

  16. 48 CFR 2131.201-5 - Credits.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Credits. 2131.201-5 Section... PRINCIPLES AND PROCEDURES Contracts With Commercial Organizations 2131.201-5 Credits. The provisions of FAR 31.201-5 shall apply to income, rebates and other credits resulting from benefit payments that...

  17. 7 CFR 923.5 - Cherries.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 8 2010-01-01 2010-01-01 false Cherries. 923.5 Section 923.5 Agriculture Regulations... Orders; Fruits, Vegetables, Nuts), DEPARTMENT OF AGRICULTURE SWEET CHERRIES GROWN IN DESIGNATED COUNTIES IN WASHINGTON Order Regulating Handling Definitions § 923.5 Cherries. Cherries means all varieties...

  18. 45 CFR 1225.5 - Representation.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 4 2010-10-01 2010-10-01 false Representation. 1225.5 Section 1225.5 Public Welfare Regulations Relating to Public Welfare (Continued) CORPORATION FOR NATIONAL AND COMMUNITY SERVICE VOLUNTEER DISCRIMINATION COMPLAINT PROCEDURE General Provisions § 1225.5 Representation. Any aggrieved party...

  19. 7 CFR 955.5 - Vidalia onion.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 8 2010-01-01 2010-01-01 false Vidalia onion. 955.5 Section 955.5 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements... Definitions § 955.5 Vidalia onion. Vidalia onion means all varieties of Allium cepa of the hybrid...

  20. 45 CFR 1700.5 - Executive Director.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 4 2010-10-01 2010-10-01 false Executive Director. 1700.5 Section 1700.5 Public Welfare Regulations Relating to Public Welfare (Continued) NATIONAL COMMISSION ON LIBRARIES AND INFORMATION SCIENCE ORGANIZATION AND FUNCTIONS § 1700.5 Executive Director. (a) The Executive Director...

  1. 33 CFR 136.5 - Definitions

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Definitions 136.5 Section 136.5 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) MARINE POLLUTION... SOURCE; AND ADVERTISEMENT General § 136.5 Definitions (a) As used in this part, the following terms...

  2. 7 CFR 945.5 - Potatoes.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 8 2010-01-01 2010-01-01 false Potatoes. 945.5 Section 945.5 Agriculture Regulations... Orders; Fruits, Vegetables, Nuts), DEPARTMENT OF AGRICULTURE IRISH POTATOES GROWN IN CERTAIN DESIGNATED COUNTIES IN IDAHO, AND MALHEUR COUNTY, OREGON Order Regulating Handling Definitions § 945.5 Potatoes...

  3. 7 CFR 948.5 - Potatoes.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 8 2010-01-01 2010-01-01 false Potatoes. 948.5 Section 948.5 Agriculture Regulations... Orders; Fruits, Vegetables, Nuts), DEPARTMENT OF AGRICULTURE IRISH POTATOES GROWN IN COLORADO Order Regulating Handling Definitions § 948.5 Potatoes. Potatoes means and includes all varieties of Irish potatoes...

  4. 7 CFR 953.5 - Potatoes.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 8 2010-01-01 2010-01-01 false Potatoes. 953.5 Section 953.5 Agriculture Regulations... Orders; Fruits, Vegetables, Nuts), DEPARTMENT OF AGRICULTURE IRISH POTATOES GROWN IN SOUTHEASTERN STATES Order Regulating Handling Definitions § 953.5 Potatoes. Potatoes means all varieties of Irish potatoes...

  5. 7 CFR 946.5 - Potatoes.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 8 2010-01-01 2010-01-01 false Potatoes. 946.5 Section 946.5 Agriculture Regulations... Orders; Fruits, Vegetables, Nuts), DEPARTMENT OF AGRICULTURE IRISH POTATOES GROWN IN WASHINGTON Order Regulating Handling Definitions § 946.5 Potatoes. Potatoes means all varieties of Irish potatoes grown within...

  6. 7 CFR 947.5 - Potatoes.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 8 2010-01-01 2010-01-01 false Potatoes. 947.5 Section 947.5 Agriculture Regulations... Orders; Fruits, Vegetables, Nuts), DEPARTMENT OF AGRICULTURE IRISH POTATOES GROWN IN MODOC AND SISKIYOU... Definitions § 947.5 Potatoes. Potatoes means all varieties of Irish potatoes grown within the aforesaid...

  7. 25 CFR 168.5 - Grazing capacity.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Grazing capacity. 168.5 Section 168.5 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GRAZING REGULATIONS FOR THE HOPI PARTITIONED LANDS AREA § 168.5 Grazing capacity. (a) The Area Director shall prescribe the maximum number of...

  8. 33 CFR 5.07 - Administration.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Administration. 5.07 Section 5.07... § 5.07 Administration. Any authority vested in the Commandant by this part may be delegated by him to... appropriate for the functioning, organization, and internal administration of the Auxiliary....

  9. 45 CFR 5b.11 - Exempt systems.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 1 2010-10-01 2010-10-01 false Exempt systems. 5b.11 Section 5b.11 Public Welfare DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL ADMINISTRATION PRIVACY ACT REGULATIONS § 5b.11 Exempt systems. (a) General policy. The Act permits certain types of specific systems of records to be exempt from...

  10. 32 CFR 290.5 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Definitions. 290.5 Section 290.5 National Defense Department of Defense (Continued) OFFICE OF THE SECRETARY OF DEFENSE (CONTINUED) FREEDOM OF INFORMATION ACT PROGRAM DEFENSE CONTRACT AUDIT AGENCY (DCAA) FREEDOM OF INFORMATION ACT PROGRAM § 290.5...

  11. 32 CFR 272.5 - Responsibilities.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Responsibilities. 272.5 Section 272.5 National Defense Department of Defense (Continued) OFFICE OF THE SECRETARY OF DEFENSE (CONTINUED) MISCELLANEOUS ADMINISTRATION AND SUPPORT OF BASIC RESEARCH BY THE DEPARTMENT OF DEFENSE § 272.5 Responsibilities. (a) The...

  12. 32 CFR 257.5 - Responsibilities.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Responsibilities. 257.5 Section 257.5 National Defense Department of Defense (Continued) OFFICE OF THE SECRETARY OF DEFENSE (CONTINUED) MISCELLANEOUS ACCEPTANCE OF SERVICE OF PROCESS § 257.5 Responsibilities. The following responsibilities may not be...

  13. 32 CFR 247.5 - Responsibilities.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Responsibilities. 247.5 Section 247.5 National... DEPARTMENT OF DEFENSE NEWSPAPERS, MAGAZINES AND CIVILIAN ENTERPRISE PUBLICATIONS § 247.5 Responsibilities. (a... Commands shall: (1) Publish Combatant Command newspapers, if authorized. In discharging this responsibility...

  14. 32 CFR 212.5 - Responsibilities.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Responsibilities. 212.5 Section 212.5 National Defense Department of Defense (Continued) OFFICE OF THE SECRETARY OF DEFENSE (CONTINUED) MISCELLANEOUS...) INSTALLATIONS § 212.5 Responsibilities. (a) The Principal Deputy Under Secretary for Personnel and Readiness...

  15. 32 CFR 191.5 - Responsibilities.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Responsibilities. 191.5 Section 191.5 National... DOD CIVILIAN EQUAL EMPLOYMENT OPPORTUNITY (EEO) PROGRAM § 191.5 Responsibilities. (a) The Assistant... responsibilities. (7) Ensure fair, impartial, and timely investigation and resolution of complaints of...

  16. 32 CFR 223.5 - Responsibilities.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Responsibilities. 223.5 Section 223.5 National Defense Department of Defense (Continued) OFFICE OF THE SECRETARY OF DEFENSE (CONTINUED) MISCELLANEOUS DEPARTMENT OF DEFENSE UNCLASSIFIED CONTROLLED NUCLEAR INFORMATION (DOD UCNI) § 223.5 Responsibilities. (a...

  17. 32 CFR 326.5 - Responsibilities.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Responsibilities. 326.5 Section 326.5 National... NATIONAL RECONNAISSANCE OFFICE PRIVACY ACT PROGRAM § 326.5 Responsibilities. (a) The Director, NRO (DNRO... responsibilities pertaining to the Privacy Act. (4) Advises on all legal matters concerning the Privacy Act...

  18. 32 CFR 192.5 - Responsibilities.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Responsibilities. 192.5 Section 192.5 National Defense Department of Defense (Continued) OFFICE OF THE SECRETARY OF DEFENSE (CONTINUED) MISCELLANEOUS EQUAL OPPORTUNITY IN OFF-BASE HOUSING § 192.5 Responsibilities. The Secretaries of the Military...

  19. 32 CFR 235.5 - Responsibilities.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Responsibilities. 235.5 Section 235.5 National... SALE OR RENTAL OF SEXUALLY EXPLICIT MATERIAL ON DOD PROPERTY § 235.5 Responsibilities. (a) The... its responsibilities as set forth in § 235.6. (b) The Secretaries of the Military Departments shall...

  20. 32 CFR 213.5 - Responsibilities.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Responsibilities. 213.5 Section 213.5 National... SUPPORT FOR NON-FEDERAL ENTITIES AUTHORIZED TO OPERATE ON DOD INSTALLATIONS § 213.5 Responsibilities. (a... of non-Federal entities on DoD installations. (3) Assign responsibilities to the DoD Components to...