
Sample records for chile 5000-3000 ap

  1. Chile. (United States)


    The background notes on Chile provide a statistical summary of the population, geography, government, and the economy, and more descriptive text on the history, population, government, economy, defense, and foreign relations. In brief, Chile has 13.3 million Spanish Indian (Mestizos), European, and Indian inhabitants and an annual growth rate of 1.6%. 96% are literate. Infant mortality is 18/1000. 34% of the population are involved in industry and commerce, 30% in services, 19% in agriculture and forestry and fishing, 7% in construction, and 2% in mining. The major city is Santiago. The government, which gained independence in 1810, is a republic with executive, legislative, and judicial branches. There are 12 regions. There are 6 major political parties. Suffrage is universal at 18 years. Gross domestic product (GDP) is $29.2 billion. The annual growth rate is 5% and inflation is 19%. Copper, timber, fish, iron ore, nitrates, precious metals, and molybdenum are its natural resources. Agricultural products are 9% of GDP and include wheat, potatoes, corn, sugar beets, onions, beans, fruits, and livestock. Industry is 21% of GDP and includes mineral refining, metal manufacturing, food and fish processing, paper and wood products, and finished textiles. $8.3 billion is the value of exports and $7 billion of imports. Export markets are in Japan, the US, Germany, Brazil, and the United Kingdom. Chile received $3.5 billion in economic aid between 1949-85, but little in recent years. 83% live in urban centers, principally around Santiago. Congressional representation is made on the basis of elections by a unique binomial majority system. Principal government officials are identified. Chile has a diversified free market economy and is almost self-sufficient in food production. The US is a primary trading partner. 49% of Chile's exports are minerals. Chile maintains diplomatic relations with 70 countries, however, relations are strained with Argentina and Bolivia. Relations

  2. Chile. (United States)


    Chile is a long (2650 miles), narrow (250 miles at widest point) country sandwiched between the Andes mountains and the Pacific. The northern desert is rich in copper and nitrates; the temperate middle region is agricultural and supports the major cities, including Santiago, the capital, and the port of Valparaiso; and the southern region is a cold and damp area of forests, grasslands, lakes, and fjords. The country is divided into 12 administrative regions. Chile's population of 12.5 million are mainly of Spanish or Indian descent or mestizos. Literacy is 92.3%, and the national language is Spanish. Infant mortality is 18.1/1000, and life expectancy is 68.2 years. 82% of the people are urban, and most are Roman Catholics. Chile was settled by the Spanish in 1541 and attached to the Viceroyalty of Peru. Independence was won in 1818 under the leadership of Bernardo O'Higgins. In the 1880s Chile extended its sovereignty over the Strait of Magellan in the south and areas of southern Peru and Bolivia in the north. An officially parliamentary government, elected by universal suffrage, drifted into oligarchy and finally into a military dictatorship under Carlos Ibanez in 1924. Constitutional government was restored in 1932. The Christian Democratic government of Eduardo Frei (1964-70) inaugurated major reforms, including land redistribution, education, and far-reaching social and economic policies. A Marxist government under Salvador Allende lasted from 1970 to 1973 when the present military government of General Pinochet Ugarte took power, overthrew Allende, abolished the Congress, and banned political parties. It has moved the country in the direction of a free market economy but at the cost of systematic violations of human rights. A new constitution was promulgated in 1981, and congressional elections have been scheduled for October, 1989. A "National Accord for Transition to Full Democracy" was mediated by the Catholic Church in 1985. The social reforms of the

  3. Chile. (United States)


    In 1985, Chile's population stood at 12 million, with an annual growth rate of 1.7%. 1984's infant mortality rate was 20/1000 live births and life expectancy was 67 years. The literacy rate was 94%. Of the work force of 3,841,000 in 1985, 15.9% were engaged in agriculture, forestry, and fishing; 31.3% were employed in industry and commerce; 38.6% were in the service sector; 8.7% worked in mining; and 4.4% were employed in construction. Chile's military junta is scheduled to be replaced by an elected legislature in 1990. The GDP was US $19.2 billion in 1984, with an annual real growth rate of 6.3%, and per capita GDP stood at US$1590. Inflation averages 23%. Industry comprises 21% of the GDP. Longterm prospects for the Chilean economy are influenced by a high debt service ratio, very low domestic savings and investment, the prospect of little or no increase in copper prices, and continuing problems in the domestic financial sector. In 1985-88, under the International Monetary Fund macroeconomic program, Chile will strive for moderate economic growth while managing its external debt servicing burden. PMID:12178144

  4. AP Music Theory Applied (United States)

    Spieker, Matthew H.


    Some American high schools include Advanced Placement (AP) Music Theory within their course offerings. Students who pass the AP exam can receive college credit either as a music or humanities credit. An AP class, however, offers music students more than future college credit; it ultimately improves musicianship skills and promotes deeper…

  5. The AP1000 reactor

    International Nuclear Information System (INIS)

    The design of the AP1000 reactor began 20 years ago when Westinghouse launched the AP600 reactor project. In fact by re-assessing AP600's safety margins Westinghouse realized that the its power output could be raised without putting at risk its safety standard. The AP1000 was born, it yields 1100 MWe. The main AP1000's design features is its passive safety (particularly after the Fukushima accident) and its modularity. The passive safety of the AP1000 implies: -) no humane intervention needed for 72 hours at least after the incident; -) no necessity for redundant complex safety systems. The modularity means that the plant, the reactor and other buildings are constructed from a choice of 300 modular units. These units can be built off-site and fit together on site. The modularity allows more construction activities to be led simultaneously and more chances to cope with the construction schedule. The NRC has approved the operation license for 30 years of the first AP1000 being built in the Usa (Vogtle plant in Georgia). 4 AP1000 are being built in China (Sanmen and Haiyang sites) and 6 others are planned in the Usa. Westinghouse is convinced that the AP1000's passive safety makes it more attractive. Let us not forget that Westinghouse was at the origin of the concept of pressurized water reactors, an idea adopted for half the nuclear power stations in the world and for all the plants now active in France. (A.C.)

  6. Copper Bioleaching in Chile


    Juan Carlos Gentina; Fernando Acevedo


    Chile has a great tradition of producing and exporting copper. Over the last several decades, it has become the first producer on an international level. Its copper reserves are also the most important on the planet. However, after years of mineral exploitation, the ease of extracting copper oxides and ore copper content has diminished. To keep the production level high, the introduction of new technologies has become necessary. One that has been successful is bioleaching. Chile had the first...

  7. Marine Energy in Chile


    Antonio Levy


    This is the first issue of a new series dedicated to deliver concise information on energy innovation published by the Energy Innovation Center at the IDB. This issue offers a primer on the potential for marine energy in Chile. The ocean is increasingly recognized as a viable source of renewable energy, and Chile, with its long coastline, powerful waves and tidal currents, has captured the attention of marine energy proponents. While harvesting this source of energy would increase sustainabil...

  8. APS Science 2006.

    Energy Technology Data Exchange (ETDEWEB)

    Gibson, J. M.; Fenner, R. B.; Long, G.; Borland, M.; Decker, G.


    In my five years as the Director of the Advanced Photon Source (APS), I have been fortunate to see major growth in the scientific impact from the APS. This year I am particularly enthusiastic about prospects for our longer-term future. Every scientific instrument must remain at the cutting edge to flourish. Our plans for the next generation of APS--an APS upgrade--got seriously in gear this year with strong encouragement from our users and sponsors. The most promising avenue that has emerged is the energy-recovery linac (ERL) (see article on page xx), for which we are beginning serious R&D. The ERL{at}APS would offer revolutionary performance, especially for x-ray imaging and ultrafast science, while not seriously disrupting the existing user base. I am very proud of our accelerator physics and engineering staff, who not only keep the current APS at the forefront, but were able to greatly impress our international Machine Advisory Committee with the quality of their work on the possible upgrade option (see page xx). As we prepare for long-term major upgrades, our plans to develop and optimize all the sectors at APS in the near future are advancing. Several new beamlines saw first light this year, including a dedicated powder diffraction beamline (11-BM), two instruments for inelastic x-ray scattering at sector 30, and the Center for Nanoscale Materials (CNM) Nanoprobe beamline at sector 26. Our partnership in the first x-ray free-electron laser (LCLS) to be built at Stanford contributes to revolutionary growth in ultrafast science (see page xx), and we are developing a pulse chirping scheme to get ps pulses at sector 7 of the APS within a year or so. In this report, you will find selected highlights of scientific research at the APS from calendar year 2006. The highlighted work covers diverse disciplines, from fundamental to applied science. In the article on page xx you can see the direct impact of APS research on technology. Several new products have emerged from

  9. AP statistics crash course

    CERN Document Server

    D'Alessio, Michael


    AP Statistics Crash Course - Gets You a Higher Advanced Placement Score in Less Time Crash Course is perfect for the time-crunched student, the last-minute studier, or anyone who wants a refresher on the subject. AP Statistics Crash Course gives you: Targeted, Focused Review - Study Only What You Need to Know Crash Course is based on an in-depth analysis of the AP Statistics course description outline and actual Advanced Placement test questions. It covers only the information tested on the exam, so you can make the most of your valuable study time. Our easy-to-read format covers: exploring da

  10. APS Science 2009

    International Nuclear Information System (INIS)

    It is my pleasure to introduce the 2009 annual report of the Advanced Photon Source. This was a very good year for us. We operated with high reliability and availability, despite growing problems with obsolete systems, and our users produced a record output of publications. The number of user experiments increased by 14% from 2008 to more than 3600. We congratulate the recipients of the 2009 Nobel Prize in Chemistry-Venkatraman Ramakrishnan (Cambridge Institute for Medical Research), Thomas Steitz (Yale University), and Ada Yonath (Weizmann Institute) - who did a substantial amount of this work at APS beamlines. Thanks to the efforts of our users and staff, and the ongoing counsel of the APS Scientific Advisory Committee, we made major progress in advancing our planning for the upgrade of the APS (APS-U), producing a proposal that was positively reviewed. We hope to get formal approval in 2010 to begin the upgrade. With advocacy from our users and the support of our sponsor, the Office of Basic Energy Sciences in the Department of Energy (DOE) Office of Science, our operating budgets have grown to the level needed to more adequately staff our beamlines. We were also extremely fortunate to have received $7.9 M in American Recovery and Reinvestment Act ('stimulus') funding to acquire new detectors and improve several of our beamlines. The success of the new Linac Coherent Light Source at Stanford, the world's first x-ray free-electron laser, made us particularly proud since the undulators were designed and built by the APS. Among other highlights, we note that more than one-quarter of the 46 Energy Frontier Research Centers, funded competitively across the U.S. in 2009 by the DOE, included the Advanced Photon Source in their proposed work, which shows that synchrotron radiation, and the APS in particular, are central to energy research. While APS research covers everything from fundamental to applied science (reflected by the highlights in this report), the challenge

  11. APS Science 2009.

    Energy Technology Data Exchange (ETDEWEB)

    Gibson, J. M; Mills, D. M.; Gerig, R.


    It is my pleasure to introduce the 2009 annual report of the Advanced Photon Source. This was a very good year for us. We operated with high reliability and availability, despite growing problems with obsolete systems, and our users produced a record output of publications. The number of user experiments increased by 14% from 2008 to more than 3600. We congratulate the recipients of the 2009 Nobel Prize in Chemistry-Venkatraman Ramakrishnan (Cambridge Institute for Medical Research), Thomas Steitz (Yale University), and Ada Yonath (Weizmann Institute) - who did a substantial amount of this work at APS beamlines. Thanks to the efforts of our users and staff, and the ongoing counsel of the APS Scientific Advisory Committee, we made major progress in advancing our planning for the upgrade of the APS (APS-U), producing a proposal that was positively reviewed. We hope to get formal approval in 2010 to begin the upgrade. With advocacy from our users and the support of our sponsor, the Office of Basic Energy Sciences in the Department of Energy (DOE) Office of Science, our operating budgets have grown to the level needed to more adequately staff our beamlines. We were also extremely fortunate to have received $7.9 M in American Recovery and Reinvestment Act ('stimulus') funding to acquire new detectors and improve several of our beamlines. The success of the new Linac Coherent Light Source at Stanford, the world's first x-ray free-electron laser, made us particularly proud since the undulators were designed and built by the APS. Among other highlights, we note that more than one-quarter of the 46 Energy Frontier Research Centers, funded competitively across the U.S. in 2009 by the DOE, included the Advanced Photon Source in their proposed work, which shows that synchrotron radiation, and the APS in particular, are central to energy research. While APS research covers everything from fundamental to applied science (reflected by the highlights in this report

  12. [Domestic violence in Chile]. (United States)

    León, Tomás; Grez, Marcela; Prato, Juan Andrés; Torres, Rafael; Ruiz, Sergio


    According to recent surveys, there is a high prevalence of domestic violence (DV) in Chile. A systematic review was conducted in PubMed, Scielo, and Lilacs with the MesH terms "Chile", "Mental Health", "Health", "Domestic Violence", to explore the impact of DV on health in Chile. Eleven studies fulfilled the inclusion criteria. Two studies were prospective, exploring the influence of DV on maternal-infant health. Nine studies explored the influence of DV on mental health in adults. DV was associated with deranged mental health indicators specially anxiety and depressive symptoms and suicidal ideation. Similar results were observed among mothers who were victims of violence and their children. It is concluded that DV is a complex phenomenon with serious effects on health. However the number of studies on the subject is low and new follow up studies are required. Predictive models for DV and effective preventive measures are urgently needed. PMID:25424674

  13. Copper Bioleaching in Chile

    Directory of Open Access Journals (Sweden)

    Juan Carlos Gentina


    Full Text Available Chile has a great tradition of producing and exporting copper. Over the last several decades, it has become the first producer on an international level. Its copper reserves are also the most important on the planet. However, after years of mineral exploitation, the ease of extracting copper oxides and ore copper content has diminished. To keep the production level high, the introduction of new technologies has become necessary. One that has been successful is bioleaching. Chile had the first commercial operation in the world exclusively via bioleaching copper sulfides. Nowadays, all bioleaching operations run in the country contribute to an estimated 10% of total copper production. This article presents antecedents that have contributed to the development of copper bioleaching in Chile.

  14. Chile's Madam President

    Institute of Scientific and Technical Information of China (English)


    After becoming the first female to win a presidential election in the socially conservative country, Chilean President-elect Michelle Bachelet created history again when unveiling a cabinet that was absolutely gender-balanced on January 30. Following similar breakthroughs of women politicians in Liberia and Germany, what happened in Chile is considered another case of women gaining power worldwide.

  15. The Geology of Chile


    Cabrera, Lluís; Calafat, A.; Gimeno, D.; Liesa, M.; Proenza, J.; Sàbat, F.; Sáez, Alberto; Santanach, Pere


    6 páginas.-- Book review of "The Geology of Chile", by Teresa Moreno and Wes Gibbons (eds.) (2007). Geological Society. London (United Kingdom). 414 pages, 286 figures including maps, charts and pictures; 27, 5 x 21 cm, ISBN 978-1- 86239-219-9 (hardback) and ISBN 978-1-86239-220-5 (softback).

  16. Chile exploits LNG

    Energy Technology Data Exchange (ETDEWEB)


    Simultaneously with its exploitation of offshore hydrocarbon reservoirs Chile is developing the production and selling of LNG. Chile produces a large quantity of associated gas from its reservoirs at Megallanes and processes it at the Manantiales, Cullen and Posesion plants recovering propane, butane and natural gas liguids. The stripped gas is reinjected for pressure maintenance operations. With the completion of the LNG program full use of the gas will be achieved. It will totally meet the needs of combustible liquids for the central and northern parts of the country, a volume of 2200 million cu m/yr. For its treatment natural gas is sent through gas pipelines to the LNG plant at Cabo Negro. By means of a cooling process, the gas is cooled to -160 C where it becomes a liquid and its volume is reduced by a factor of 600. It is then stored in tanks at atmospheric pressure.

  17. Spent Fuel in Chile

    International Nuclear Information System (INIS)

    The government has made a complete and serious study of many different aspects and possible road maps for nuclear electric power with strong emphasis on safety and energy independence. In the study, the chapter of SFM has not been a relevant issue at this early stage due to the fact that it has been left for later implementation stage. This paper deals with the options Chile might consider in managing its Spent Fuel taking into account foreign experience and factors related to safety, economics, public acceptance and possible novel approaches in spent fuel treatment. The country’s distinctiveness and past experience in this area taking into account that Chile has two research reactors which will have an influence in the design of the Spent Fuel option. (author)

  18. APS Science 2007.

    Energy Technology Data Exchange (ETDEWEB)


    This report provides research highlights from the Advanced Photon Source (APS). Although these highlights represent less than 10% of the published work from the APS in 2007, they give a flavor of the diversity and impact of user research at the facility. In the strategic planning the aim is to foster the growth of existing user communities and foresee new areas of research. This coming year finds the APS engaged in putting together, along with the users, a blueprint for the next five years, and making the case for a set of prioritized investments in beamlines, the accelerator, and infrastructure, each of which will be transformational in terms of scientific impact. As this is written plans are being formulated for an important user workshop on October 20-21, 2008, to prioritize strategic plans. The fruit from past investments can be seen in this report. Examples include the creation of a dedicated beamline for x-ray photon correlation spectroscopy at Sector 8, the evolution of dedicated high-energy x-ray scattering beamlines at sectors 1 and 11, a dedicated imaging beamline at Sector 32, and new beamlines for inelastic scattering and powder diffraction. A single-pulse facility has been built in collaboration with Sector 14 (BioCARS) and Phil Anfinrud at the National Institutes of Health, which will offer exceptionally high flux for single-pulse diffraction. The nanoprobe at Sector 26, built and operated jointly by the Argonne Center for Nanoscale Materials and the X-ray Operations and Research (XOR) section of the APS X-ray Science Division, has come on line to define the state of the art in nanoscience.

  19. Chile: segundo tiempo Chile: Half-time

    Directory of Open Access Journals (Sweden)



    Full Text Available El artículo examina el año político chileno, ofreciendo un análisis crítico del concepto de 'segundo tiempo' autoimpuesto por la presidenta Michelle Bachelet a comienzos del 2008. Resumiendo algunas de las políticas implementadas, el trabajo cuestiona si se logró marcar una linea y dejar atrás los dos primeros y difíciles años del cuarto gobierno de la Concertación. Analizando las medidas tomadas y las encuestas de opinión pública, se encuentra que el reenfoque de las prioridades del gobierno y una complicada coyuntura externa ayudó a levantar los niveles de apoyo de la presidenta y su gobierno.The article examines the political year in Chile, offering a critical analysis of the concept of 'Second Period' which President Michelle Bachelet defined at the beginning of 2008. Summarising some of the policies implemented, the piece asks whether the government was able to draw a line, leaving behind the first, difficult two years of the Concertación s fourth government. Analyzing the measures taken and public opinion polls, the paper finds that a re-focussing of the government's priorities together with a complicated external environment helped to raise support for the president as well as her government.

  20. The APS ceramic chambers

    Energy Technology Data Exchange (ETDEWEB)

    Milton, S.; Warner, D.


    Ceramics chambers are used in the Advanced Photon Source (APS) machines at the locations of the pulsed kicker and bumper magnets. The ceramic will be coated internally with a resistive paste. The resistance is chosen to allow the low frequency pulsed magnet field to penetrate but not the high frequency components of the circulating beam. Another design goal was to keep the power density experienced by the resistive coating to a minimum. These ceramics, their associated hardware, the coating process, and our recent experiences with them are described.

  1. Primary Medical Care in Chile

    DEFF Research Database (Denmark)

    Scarpaci, Joseph L.

    Primary medical care in Chile: accessibility under military rule [Front Cover] [Front Matter] [Title Page] Contents Tables Figures Preface Chapter 1: Introduction Chapter 2: The Restructuring of Medical Care Financing in Chile Chapter 3: Inflation and Medical Care Accessibility Chapter 4: Help...

  2. Chile rural electrification cooperation

    Energy Technology Data Exchange (ETDEWEB)

    Flowers, L. [National Renewable Energy Lab., Golden, CO (United States)


    The author describes a joint program to use renewables for rural electrification projects in Chile. The initial focus was in a limited part of the country, involving wind mapping, pilot project planning, training, and development of methodologies for comparative evaluations of resources. To this point three wind hybrid systems have been installed in one region, as a part of the regional private utility, and three additional projects are being designed. Additional resource assessment and training is ongoing. The author points out the difficulties in working with utilities, the importance of signed documentation, and the need to look at these programs as long term because of the time involved in introducing such new technologies.

  3. Chile: Transantiago recargado Chile: Transantiago Reloaded

    Directory of Open Access Journals (Sweden)



    Full Text Available El 2007 fue el segundo año del gobierno de Michelle Bachelet. Se trató de un año sin elecciones; con un buen desempeño económico, a pesar de una inflación creciente en los últimos meses; y marcado por la discusión sobre escándalos de corrupción. Sin embargo, lo que más afectó al Gobierno fue la desastrosa puesta en marcha de la reforma al sistema de transporte público de la capital: Transantiago. Este puso un velo sobre los importantes avances en materias previsionales y educacionales, cuestionando no sólo la capacidad ejecutiva del Gobierno, sino que profundizando un flanco de indisciplina al interior de la coalición oficialista (Concertación; síntoma de su desgaste después de 17 años ocupando la Presidencia de Chile.The year 2007 was the second in Michelle Bachelet’s presidencial term. It was a year free of elections, exhibiting a fairly good economic performance, despite the high rate of inflation shown during the last months. Public discussion on corruption escandals was frequent; however, the most important issue was the disestrous beginning of the reform on the public transportation system of the country’s capital: Transantiago. This has placed a veil over the important achievements on the pension system and education, questioning not only the government’s capacity, but also opening and edge of indiscipline within the ruling coalition (Concertación, which is a symtom of its erosion after 17 years in the presidential office.

  4. 27 CFR 9.154 - Chiles Valley. (United States)


    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Chiles Valley. 9.154... Chiles Valley. (a) Name. The name of the viticultural area described in this section is “Chiles Valley.” (b) Approved maps. The appropriate maps for determining the boundary of the Chiles...

  5. CGM ApS Årsberetning til DANAK

    DEFF Research Database (Denmark)

    De Chiffre, Leonardo

    Denne årsberetning omfatter CGM ApS' akkrediterede virksomhed i kalenderåret 2003. Årsberetningen er udarbejdet til DANAK (Dansk Akkreditering, ErhvervsfremmeStyrelsen), som led i opfyldelsen af laboratoriets informationspligt i henhold til gældende regler.......Denne årsberetning omfatter CGM ApS' akkrediterede virksomhed i kalenderåret 2003. Årsberetningen er udarbejdet til DANAK (Dansk Akkreditering, ErhvervsfremmeStyrelsen), som led i opfyldelsen af laboratoriets informationspligt i henhold til gældende regler....

  6. AP physics B crash course

    CERN Document Server

    Howell, Rebecca


    AP Physics B Crash Course - Get a Higher Advanced Placement Score in Less Time Crash Course is perfect for the time-crunched student, the last-minute studier, or anyone who wants a refresher on the subject. Our AP Physics B Crash Course gives you: Targeted, Focused Review - Study Only What You Need to Know The Crash Course is based on an in-depth analysis of the AP Physics B course description outline and actual AP test questions. It covers only the information tested on the exam, so you can make the most of your valuable study time. Our easy-to-read format covers: mechanics, kinetic theory, t

  7. Center for Geometrisk Metrologi, CGM ApS

    DEFF Research Database (Denmark)

    De Chiffre, Leonardo

    Denne årsberetning omfatter CGM ApS' akkrediterede virksomhed i kalenderåret 2002. Årsberetningen er udarbejdet til DANAK (Dansk Akkreditering, Erhvervsfremme Styrelsen), som led i opfyldelsen af laboratoriets informationspligt i henhold til gældende regler (Teknisk Forskrift Nr. TF4 af 2000.11.0...

  8. Eso's Situation in Chile (United States)


    ESO, the European Southern Observatory, in reply to questions raised by the international media, as well as an ongoing debate about the so-called "Paranal case" in Chilean newspapers, would like to make a number of related observations concerning its status and continued operation in that country [1]. THE ESO OBSERVATORY SITES IN CHILE The European Southern Observatory, an international organisation established and supported by eight European countries, has been operating more than 30 years in the Republic of Chile. Here ESO maintains one of the world's prime astronomical observatories on the La Silla mountain in the southern part of the Atacama desert. This location is in the Fourth Chilean Region, some 600 km north of Santiago de Chile. In order to protect the La Silla site against dust and light pollution from possible future mining industries, roads and settlements, ESO early acquired the territory around this site. It totals about 825 sq. km and has effectively contributed to the preservation of its continued, excellent "astronomical" quality. Each year, more than 500 astronomers from European countries, Chile and elsewhere profit from this when they come to La Silla to observe with one or more of the 15 telescopes now located there. In 1987, the ESO Council [2] decided to embark upon one of the most prestigious and technologically advanced projects ever conceived in astronomy, the Very Large Telescope (VLT). It will consist of four interconnected 8.2-metre telescopes and will become the largest optical telescope in the world when it is ready. It is safe to predict that many exciting discoveries will be made with this instrument, and it will undoubtedly play a very important role in our exploration of the distant universe and its many mysteries during the coming decades. THE VLT AND PARANAL In order to find the best site for the VLT, ESO performed a thorough investigation of many possible mountain tops, both near La Silla and in Northern Chile. They showed

  9. Fires in Chile (United States)


    On February 5, 2002, the dense smoke from numerous forest fires stretched out over the Pacific Ocean about 400 miles south of Santiago, Chile. This true-color Moderate-resolution Imaging Spectroradiometer (MODIS) image shows the fires, which are located near the city of Temuco. The fires are indicated with red dots (boxes in the high-resolution imagery). The fires were burning near several national parks and nature reserves in an area of the Chilean Andes where tourism is very popular. Southeast of the fires, the vegetation along the banks of the Rio Negro in Argentina stands out in dark green. Image courtesy Jacques Descloitres, MODIS Land Rapid Response Team at NASA GSFC

  10. AP-42 REVISION: COKE OVENS (United States)

    The document "Compilation of Air Pollutant Emission Factors" (AP-42) has been published by the U. S. Environmental Protection Agency (EPA) since 1972. Supplements to AP-42 have been routinely published to add new emission source categories and to update existing emission factor...

  11. Final report for tank 241-AP-101, grab samples 1AP-95-1, 1AP-95-2, 1AP-95-3, 1AP-95-4, 1AP-95-5, and 1AP-95-6

    Energy Technology Data Exchange (ETDEWEB)

    Esch, R.A.


    Six supernate grab samples (1AP-95-1 through 6) and one field blank (1AP-95-7) were taken from tank 241-AP-101, on Nov. 10 and 13, 1995. Analyses were performed in support of the Safety Screening and the Waste Compatibility Safety programs. All analytical results were within the action limits stated in the TSAP.

  12. Escondida Mine, Chile (United States)


    Full resolution visible and near-infrared image (1.4 MB) Full resolution shortwave infrared image (1.6 MB) This Advanced Spaceborne Thermal Emission and Reflection Radiometer (ASTER) image covers 30 by 23 km (full images 30 x 37 km) in the Atacama Desert, Chile, and was acquired on April 23, 2000. The Escondida copper, gold, and silver open-pit mine is at an elevation of 3050 m, and began operations in 1990. Current capacity is 127,000 tons/day of ore; in 1999 production totaled 827,000 tons of copper, 150,000 ounces of gold, and 3.53 million ounces of silver. Primary concentrate of the ore is done on-site; the concentrate is then sent to the coast for further processing through a 170 km long, 9-inch pipe. Escondida is related geologically to three porphyry bodies intruded along the Chilean West Fissure Fault System. A high grade supergene cap overlies primary sulfide ore. The top image is a conventional 3-2-1 (near infrared, red, green) RGB composite. The bottom image displays shortwave infrared bands 4-6-8 (1.65um, 2.205um, 2.33um) in RGB, and highlights the different rock types present on the surface, as well as the changes caused by mining. Image courtesy NASA/GSFC/MITI/ERSDAC/JAROS, and U.S./Japan ASTER Science Team

  13. Country watch: Chile. (United States)

    Montoya Leiva, M


    Servicio Paz y Justicia (SERPAJ) is a nongovernmental organization (NGO) established in Chile in 1977. It supports fundamental human dignity and rights by fighting discrimination and exclusion based upon individual differences. SERPAJ promotes training, organization, and the political participation of community members as part of the democratic process, working mainly with the at risk women, street children, and youth of Santiago's working-class neighborhoods. Groups participate in workshops and training courses on human rights and development, civic education, and methods of non-violent community action. In 1987, SERPAJ-Sur Oriente began to include the topic of sexuality and AIDS/STDs in courses training working-class women as community human rights agents. The NGO is therefore one of the first mainstream Chilean human rights organizations to incorporate HIV/AIDS issues. A basic facts brochure was developed, followed by a pilot education project developed in one neighborhood which was then systematically replicated in other neighborhoods. The comments of some people who have participated in SERPAJ workshops are presented.

  14. complejidad en Chile

    Directory of Open Access Journals (Sweden)

    Miguel Alejandro Bustamante-Ubilla


    Full Text Available El presente estudio tiene por objetivo caracterizar el clima organizacional al interior de 2 hospitales dealta complejidad de Chile, determinando las dimensiones más y menos influyentes. Para su desarrollose aplicó un cuestionario que consta de 71 variables agrupadas en 14 dimensiones a una muestra de561 funcionarios. La interpretación de los resultados se realizó a través del análisis del valor prome-dio estandarizado y su confiabilidad ratificada mediante el alfa de Cronbach. A partir de lo anterior, sedeterminó que las dimensiones que influyen por encima del promedio fueron: identidad, motivaciónlaboral y responsabilidad; en tanto que las dimensiones que muestran un nivel de impacto por debajodel promedio resultaron ser: equipo y distribución de personas y material, administración del conflictoy comunicación.© 2015 Universidad ICESI. Publicado por Elsevier España, S.L.U. Este es un artículo Open Access bajo lalicencia CC BY (

  15. Meet the APS Journal Editors (United States)


    The Editors of the APS journals invite you to join them for conversation. The Editors will be available to answer questions, hear your ideas, and discuss any comments about the journals. All are welcome. Light refreshments will be served.

  16. Modernitet og forbrugskultur i Chile

    DEFF Research Database (Denmark)

    Cristoffanini, Pablo Rolando


    I de sidste årtier er Chile blevet et egentligt forbrugersamfund. Udbredelsen af forbrugskulturen og forbrugerismen er centrale fænomener i chilenernes dagligliv og har nået et omfang, som har konsekvenser for de borgere, der ikke kan deltage fuldt ud heri, noget som er typisk for et samfund med en...... ujævn økonomisk udvikling og med store sociale forskelle. Denne proces er ikke et produkt af en stille, fredelig og naturlig samfundsudvikling, således som magteliten og de toneangivende intellektuelle i Chile har fremstillet det. Som jeg vil vise, er skabelsen af et egentlig forbrugssamfund knyttet til...... til i dag. Ifølge disse er Chile blevet et moderne samfund netop i kraft af, at Chile er et ægte forbrugersamfund med alt, hvad dette indebærer, såvel materielt som symbolsk. For det tredje er billedet af Chile som en ”supermoderne” nation i den latinamerikanske kontekst en udbredt forestilling hos...

  17. It Pays to Invest in Chile

    Institute of Scientific and Technical Information of China (English)

    Li Zhen


    @@ Chile is the first country to establish coopera-tive relations with China in South America, and also the first one to support China's ac-cession to the World Trade Organization.In 2005, Chile and China signed a free trade agreement.After that, China has become Chile's largest trad-ing partner, and Chile become China's second largest partner in South America.

  18. China and Chile Signing Free Trade Agreement

    Institute of Scientific and Technical Information of China (English)

    Shen; Danyang


      Mr. Bo Xilai, Minister of Commerce of China, and Mr.Walker, Foreign Minister of Chile, signed the China-Chile FTA on behalf of their respective government on November 18, 2005. Chinese President Hu Jintao and Chile President Lagos attended the signing ceremony, according to a press release on the website of Network Center of MOFCOM.……

  19. China and Chile Signing Free Trade Agreement

    Institute of Scientific and Technical Information of China (English)

    Shen Danyang


    @@ Mr. Bo Xilai, Minister of Commerce of China, and Mr.Walker, Foreign Minister of Chile, signed the China-Chile FTA on behalf of their respective government on November 18, 2005. Chinese President Hu Jintao and Chile President Lagos attended the signing ceremony, according to a press release on the website of Network Center of MOFCOM.

  20. APS Education and Diversity Efforts (United States)

    Prestridge, Katherine; Hodapp, Theodore


    American Physical Society (APS) has a wide range of education and diversity programs and activities, including programs that improve physics education, increase diversity, provide outreach to the public, and impact public policy. We present the latest programs spearheaded by the Committee on the Status of Women in Physics (CSWP), with highlights from other diversity and education efforts. The CSWP is working to increase the fraction of women in physics, understand and implement solutions for gender-specific issues, enhance professional development opportunities for women in physics, and remedy issues that impact gender inequality in physics. The Conferences for Undergraduate Women in Physics, Professional Skills Development Workshops, and our new Professional Skills program for students and postdocs are all working towards meeting these goals. The CSWP also has site visit and conversation visit programs, where department chairs request that the APS assess the climate for women in their departments or facilitate climate discussions. APS also has two significant programs to increase participation by underrepresented minorities (URM). The newest program, the APS National Mentoring Community, is working to provide mentoring to URM undergraduates, and the APS Bridge Program is an established effort that is dramatically increasing the number of URM PhDs in physics.

  1. Women and Politics in Chile. (United States)

    Kirkwood, Julieta


    Political parties in Chile of both the left and right have focused more on drawing women into their ideologies than on considering what political issues mean to women. A look at feminist thought shows how political life for women includes not only the traditional political arena but also domestic life. (IS)

  2. The biomethane potential in Chile

    International Nuclear Information System (INIS)

    Within the last decade natural gas gained considerable importance in Chile. The contribution of natural gas within the energy system will increase in the future by predicted 3.6% annually until the year 2015. Due to limited resources within its own country, the energy system of Chile depends on natural gas imports preferential from Argentina. Therefore, the aim of several stakeholders from policy and industry is to reduce the share of imported primary energy within the overall energy system. In order to reach this goal, the use of domestic resources and particularly the utilisation of biomass as one of the most important renewable sources of energy in Chile could play an important role. Against this background, the goal of this paper is the analysis of the technical potentials of biomethane as a substitute for natural gas. For the production of biomethane the anaerobic or bio-chemical (i.e. Biogas) as well as the thermo-chemical conversion pathways (i.e. Bio-SNG) are considered. The results of this analysis show that biomass converted to biomethane is a promising energy provision option for Chile and it contributes to the reduction of greenhouse gas emissions

  3. Corporate Governance Country Assessment : Chile


    World Bank


    Chile's equity market is fairly large and successful. The market capitalization of the 249 listed firms represented 89 percent of GDP at year-end, 2001. Corporate ownership is concentrated and pyramid structures are common. Business groups/conglomerates are the predominant corporate form. Institutional investors, especially pension funds, are active equity investors. The Securities Market ...

  4. AP Geography, Environmental Science Thrive (United States)

    Robelen, Erik W.


    Geography may not be particularly known as a hot topic among today's students--even some advocates suggest it suffers from an image problem--but by at least one measure, the subject is starting to come into its own. Across more than 30 topics covered in the Advanced Placement (AP) program, participation in geography is rising faster than any…

  5. APS beamline standard components handbook

    International Nuclear Information System (INIS)

    It is clear that most Advanced Photon Source (APS) Collaborative Access Team (CAT) members would like to concentrate on designing specialized equipment related to their scientific programs rather than on routine or standard beamline components. Thus, an effort is in progress at the APS to identify standard and modular components of APS beamlines. Identifying standard components is a nontrivial task because these components should support diverse beamline objectives. To assist with this effort, the APS has obtained advice and help from a Beamline Standardization and Modularization Committee consisting of experts in beamline design, construction, and operation. The staff of the Experimental Facilities Division identified various components thought to be standard items for beamlines, regardless of the specific scientific objective of a particular beamline. A generic beamline layout formed the basis for this identification. This layout is based on a double-crystal monochromator as the first optical element, with the possibility of other elements to follow. Pre-engineering designs were then made of the identified standard components. The Beamline Standardization and Modularization Committee has reviewed these designs and provided very useful input regarding the specifications of these components. We realize that there will be other configurations that may require special or modified components. This Handbook in its current version (1.1) contains descriptions, specifications, and pre-engineering design drawings of these standard components. In the future, the APS plans to add engineering drawings of identified standard beamline components. Use of standard components should result in major cost reductions for CATs in the areas of beamline design and construction

  6. Radiation effects on active pixel sensors (APS)

    International Nuclear Information System (INIS)

    Active pixel sensor (APS) is a new generation of image sensors which presents several advantages relatively to charge coupled devices (CCDs) particularly for space applications (APS requires only 1 voltage to operate which reduces considerably current consumption). Irradiation was performed using 60Co gamma radiation at room temperature and at a dose rate of 150 Gy(Si)/h. 2 types of APS have been tested: photodiode-APS and photoMOS-APS. The results show that photoMOS-APS is more sensitive to radiation effects than photodiode-APS. Important parameters of image sensors like dark currents increase sharply with dose levels. Nevertheless photodiode-APS sensitivity is one hundred time lower than photoMOS-APS sensitivity

  7. Acuicultura Insostenible en Chile (Unsustainable aquaculture in Chile

    Directory of Open Access Journals (Sweden)

    Sommer, Marcos


    Full Text Available ResumenLa acuicultura en Chile sólo será alternativa a la pesca si se consigue llevar su producción a parámetros de sostenibilidad, no solamente económica sino, fundamentalmente, ambiental. Con un esfuerzo dirigido hacia medidas legislativas y de control, e investigación aplicada, podríamos acercarnos a una acuicultura ambientalmente sostenible.

  8. The AP-2 family of transcription factors


    Eckert, Dawid; Buhl, Sandra; Weber, Susanne; Jäger, Richard; Schorle, Hubert


    The AP-2 family of transcription factors consists of five different proteins in humans and mice: AP-2α, AP-2β, AP-2γ, AP-2δ and AP-2ε. Frogs and fish have known orthologs of some but not all of these proteins, and homologs of the family are also found in protochordates, insects and nematodes. The proteins have a characteristic helix-span-helix motif at the carboxyl terminus, which, together with a central basic region, mediates dimerization and DNA binding. The amino terminus contains the tra...

  9. Socialisme i Chile efter Pinochet

    DEFF Research Database (Denmark)

    Cristoffanini, Pablo Rolando


    Chile bliver ofte præsenteret som et paradigme for resten af det latinamerikanske kontinent: Et land med høj økonomisk vækst og politisk stabilitet. Landet har endda haft to socialistiske præsidenter siden 2000, den sidste den første kvindelige præsident. Succeshistorien har en bagside: De...... socialistiske regeringer har accepteret et begrænset demokrati og videreført en nyliberal økonomisk politik, der har bragt dem på konfrontationskurs med massebevægelserne og isoleret Chile fra de andre lande i regionen, der søger integration og gensidig støøte. Udgivelsesdato: Februar...

  10. [The epidemiological transition in Chile]. (United States)

    Albalá, C; Vio, F; Robledo, A; Icaza, G


    Aiming to describe the place that Chile has in the epidemiological transition, a descriptive study of the changes in demographic and epidemiological profiles of the country during the last 30 years is presented. The important decrease in general and child mortality rates, that has lead to an increase in life expectancy and ageing of the population, is emphasized. A 82% reduction in the proportion of deaths among less than one year old children and a 62% increase in mortality among people 65 years or older is observed. In agreement with these changes, non transmissible chronic diseases appear as the principal cause of mortality (65% of all deaths). However, regarding morbidity, an increase in digestive infectious and sexually transmitted diseases and a decrease in immuno-preventable diseases, excepting measles, is noted. It is concluded that, according to mortality, Chile is in a post transition stage, but there is persistence of some infectious diseases, typical of a pre-transition stage. PMID:8085073

  11. Miedo y represionpolitica en Chile


    Amado M. Padilla; Lillian Comas Díaz


    This paper describes a human rights fact-finding mission to Chile concerned with the use of psychological techniques employed in offlcia- Uy sactioned torture and repressíon, Meetings and interviews were conducted with representatives of many organízatíons working with víctima of governrnental repression including the Chílean Psychological Assocíation. Fear and repression wene found to be widespread among all socioeconomic segments of the population. Physical and psychologic...

  12. The APS control system network

    International Nuclear Information System (INIS)

    The APS accelerator control system is a distributed system consisting of operator interfaces, a network, and computer-controlled interfaces to hardware. This implementation of a control system has come to be called the open-quotes Standard Model.close quotes The operator interface is a UNDC-based workstation with an X-windows graphical user interface. The workstation may be located at any point on the facility network and maintain full functionality. The function of the network is to provide a generalized communication path between the host computers, operator workstations, input/output crates, and other hardware that comprise the control system. The crate or input/output controller (IOC) provides direct control and input/output interfaces for each accelerator subsystem. The network is an integral part of all modem control systems and network performance will determine many characteristics of a control system. This paper will describe the overall APS network and examine the APS control system network in detail. Metrics are provided on the performance of the system under various conditions

  13. Preparing Students for the AP Psychology Exam (United States)

    Whitlock, Kristin


    The Advanced Placement Psychology exam is one of the fastest growing exams offered by the College Board. The average percent of change in the number of students taking this exam over the past five years is 12.4%. With 238,962 students taking the exam in 2013, the AP Psychology exam is the sixth largest exam, surpassing AP Biology and AP World…

  14. An AP Calculus Classroom Amusement Park (United States)

    Ferguson, Sarah


    Throughout the school year, AP Calculus teachers strive to teach course content comprehensively and swiftly in an effort to finish all required material before the AP Calculus exam. As early May approaches and the AP Calculus test looms, students and teachers nervously complete lessons, assignments, and assessments to ensure student preparation.…

  15. Sistema de salud de Chile The health system of Chile


    Víctor Becerril-Montekio; Juan de Dios Reyes; Annick Manuel


    En este trabajo se describe el sistema de salud de Chile, incluyendo su estructura, financiamiento, beneficiarios y recursos físicos, materiales y humanos de los que dispone. Este sistema está compuesto por dos sectores, público y privado. El sector público está formado por todos los organismos que constituyen el Sistema Nacional de Servicios de Salud y cubre aproximadamente a 70% de la población, incluyendo a los pobres del campo y las ciudades, la clase media baja y los jubilados, así como ...

  16. Testing of Solar Heated Domestic Hot Water System for Solahart Scandinavia ApS

    DEFF Research Database (Denmark)

    Andersen, Elsa


    The solar heating system marketed by Solahart Scandinavia ApS was tested in the Institutes test facility for SDHWsystems. The test results are described in the report.......The solar heating system marketed by Solahart Scandinavia ApS was tested in the Institutes test facility for SDHWsystems. The test results are described in the report....

  17. Chile : Household Risk Management and Social Protection


    World Bank, (WB)


    This report is part of the World Bank's advisory and analytical assistance to the Government of Chile. The report examines whether Chile has a social protection "system" - broadly defined to include policy interventions, public institutions, and the regulation of private institutions that lower the welfare costs of adverse shocks to income from job loss and extended unemployment, health ep...

  18. Rising Expectations in Brazil and Chile (United States)

    Elacqua, Gregory; Alves, Fatima


    Two themes connect Brazil and Chile: one is economic success; the other is social unrest. Protests rocked cities across Brazil in June 2013, and in Chile, recent student protests turned violent. Yet living conditions in both nations are better now than they've ever been. Successful economic and social reforms over the last two decades have…

  19. Sistema de salud de Chile


    Víctor Becerril-Montekio; Juan de Dios Reyes; Annick Manuel


    En este trabajo se describe el sistema de salud de Chile, incluyendo su estructura, financiamiento, beneficiarios y recursos físicos, materiales y humanos de los que dispone. Este sistema está compuesto por dos sectores, público y privado. El sector público está formado por todos los organismos que constituyen el Sistema Nacional de Servicios de Salud y cubre aproximadamente a 70% de la población, incluyendo a los pobres del campo y las ciudades, la clase media baja y los jubilados, así como ...

  20. [Antimicrobial susceptibility in Chile 2012]. (United States)

    Cifuentes-D, Marcela; Silva, Francisco; García, Patricia; Bello, Helia; Briceño, Isabel; Calvo-A, Mario; Labarca, Jaime


    Bacteria antimicrobial resistance is an uncontrolled public health problem that progressively increases its magnitude and complexity. The Grupo Colaborativo de Resistencia, formed by a join of experts that represent 39 Chilean health institutions has been concerned with bacteria antimicrobial susceptibility in our country since 2008. In this document we present in vitro bacterial susceptibility accumulated during year 2012 belonging to 28 national health institutions that represent about 36% of hospital discharges in Chile. We consider of major importance to report periodically bacteria susceptibility so to keep the medical community updated to achieve target the empirical antimicrobial therapies and the control measures and prevention of the dissemination of multiresistant strains.

  1. APS high heat load monochromator

    International Nuclear Information System (INIS)

    This document contains the design specifications of the APS high heat load (HHL) monochromator and associated accessories as of February 1993. It should be noted that work is continuing on many parts of the monochromator including the mechanical design, crystal cooling designs, etc. Where appropriate, we have tried to add supporting documentation, references to published papers, and calculations from which we based our decisions. The underlying philosophy behind performance specifications of this monochromator was to fabricate a device that would be useful to as many APS users as possible, that is, the design should be as generic as possible. In other words, we believe that this design will be capable of operating on both bending magnet and ID beamlines (with the appropriate changes to the cooling and crystals) with both flat and inclined crystal geometries and with a variety of coolants. It was strongly felt that this monochromator should have good energy scanning capabilities over the classical energy range of about 4 to 20 keywith Si (111) crystals. For this reason, a design incorporating one rotation stage to drive both the first and second crystals was considered most promising. Separate rotary stages for the first and second crystals can sometimes provide more flexibility in their capacities to carry heavy loads (for heavily cooled first crystals or sagittal benders of second crystals), but their tuning capabilities were considered inferior to the single axis approach

  2. Miedo y represionpolitica en Chile

    Directory of Open Access Journals (Sweden)

    Amado M. Padilla


    Full Text Available This paper describes a human rights fact-finding mission to Chile concerned with the use of psychological techniques employed in offlcia- Uy sactioned torture and repressíon, Meetings and interviews were conducted with representatives of many organízatíons working with víctima of governrnental repression including the Chílean Psychological Assocíation. Fear and repression wene found to be widespread among all socioeconomic segments of the population. Physical and psychological abuses directed at individuals are díscussed, Psychological techníques used in the control of social groups such as intimidation, control of information, and community destabilization are also described. It is concluded that violations of human rigths are a reality in Chile. Ways to support the work of Chilean psychologists must be sought sínce the damaging eonsequences of officially sanctioned repressíon are wid.espread, and resources are minimal.

  3. Chile's energy

    Energy Technology Data Exchange (ETDEWEB)


    In recent years, a new emphasis has been placed on increasing solid fuel availability in Chile, to reach the northern mining operations where demand for power is soaring. The south of the country is well served by hydroelectric power plants (2.3 million kW). The coal industry has doubled its capacity to cope with increased copper production - the Tocopilla power plant at the Chuquicamata copper mine has been converted from oil to coal - and there has been a major investment programme in the steel industry. In 1986, 1.4 million tons of coal was mined, mostly from the Provinces of Concepcion and Arauco, the remainder from Valdivia. Since then, 70 million US dollars has been invested by COCAR SA in the Pecket deposit near Punta Arenas. Coal from Pecket should cost around 26 dollars/t compared with 60 dollars/t for underground coal. It should support an expanded coal market in Chile and may also be able to compete in the Brazilian and Argentine markets. Reserves are estimated at over 200 Mt. Petroleum reserves in Tierra del Fuego are nearly exhausted; seismic surveys in the Atacama desert are promising.


    Directory of Open Access Journals (Sweden)



    Full Text Available El problema de la desigualdad en Chile ha sido abordado desde diferentes puntos de vista como la cuestión de la distribución de la riqueza o el acceso a los derechos sociales. Es este trabajo se observa el mismo problema pero desde la perspectiva recientemente esbozada por los movimientos sociales: la del racismo ambiental o la desigual distribución de los deshechos del desarrollo y el consumo. De esta manera se revisan sucintamente los principales conflictos que han surgido en el último tiempo a lo largo del país entre empresas públicas y privadas y comunidades locales y originarias. Así mismo se examinan las formas de organización que estas últimas han asumido y el estado actual de articulación entre ellas. De la revisión de la situación se concluye que estamos ante el surgimiento de un actor de nuevo tipo, que surge de las contradicciones del Chile neoliberal y que se diferencia del movimiento ecologista por vincular sus reivindicaciones a la defensa del territorio y al derecho a la autodeterminación de los pueblos.

  5. President of Chile at CERN

    CERN Multimedia


    The President of Chile, Michelle Bachelet, in the ATLAS cavern with, from left to right, Peter Jenni, ATLAS Spokesman, Vivian Heyl, CONICYT President, and Robert Aymar, CERN Director-General. Robert Aymar, CERN Director-General, and Vivian Heyl, CONICYT President, signing a cooperation agreement between CERN and Chile’s Comisión Nacional de Investigación Científica y Tecnológica (CONICYT).The President of Chile, Michelle Bachelet, paid a visit to CERN during her three-day tour of Switzerland. The charismatic Michelle Bachelet and her large delegation were greeted by the CERN Director-General and then taken to see the ATLAS experiment and the LHC. She also took time to meet the Chilean community working at CERN, comprising several physicists in the Theory Group and the ATLAS experiment. The meeting was followed by the signing of a cooperation agreement between CERN and Chile’s Comisión Nacional de Investigación Científi...

  6. Is Mining Still the Wage of Chile?

    Directory of Open Access Journals (Sweden)

    Luis Valenzuela


    Full Text Available – Historia de la minería del hierro en Chile, by Augusto Millán. Santiago: Editorial Universitaria, 1999. – Capital transnacional y trabajo. El desarrollo minero en Chile, by Rafael Agacino, Cristián González and Jorge Rojas. Santiago: Lom Ediciones, 1998. – Dilemas y debates en torno al cobre, by Patricio Meller. Santiago: Dolmen, 2002. – Royalty. Regalía o renta minera. Lo que solo Chile no cobra, by Jorge Lavandero Illanes. Santiago: Ediciones Lafken, 2003.

  7. On AP-property of Function Spaces

    Institute of Scientific and Technical Information of China (English)

    SHEN Rong-xin


    In this paper,it is discussed the AP-property of function spaces.We prove that for any compact network α for a space X which is closed under finite unions,(1) if Cα(X) is an AP-space and X is paracompact,then X is a Hurewicz space; (2) if Cα (X) is an AP-space which has countable tightness,then Cα(X) is discretely generated.

  8. Chile: los mapuches y el Bicentenario Chile: Mapuches e do Bicentenario Chile: Mapuche and the Bicentennial

    Directory of Open Access Journals (Sweden)

    José Bengoa


    Full Text Available El Bicentenario de la República de Chile se conmemoró en el mes de septiembre del año 2010. Además de marcar un importante hito histórico, coincidió con un cambio político en el Gobierno del país, el que pasó de la Concertación de Partidos por la Democracia a la Alianza de partidos formada por la derecha chilena. Se cumplieron por tanto 20 años desde que en el año 1990 cambiara el Gobierno militar presidido por el general Pinochet. Ese largo tiempo, dos décadas, coincide con un período de políticas que el Estado ha implementado hacia los Pueblos Indígenas. El Proyecto “Conmemoraciones y Memorias Subalternas” ha realizado durante el año 2010 un conjunto de investigaciones de terreno y documentales tendientes a comprender del modo más objetivo y científico lo ocurrido en el período y por tanto la situación actual de las sociedades mapuches en sus complejas relaciones con la chilena.O Bicentenario da República do Chile comemorou-se no mês de Setembro do ano 2010. Junto com transformar-se num marco histórico, coincidiu com uma mudança política no Governo do país, que passou da Concertação de Partidos pela Democracia (centro-esquerda à Aliança de partidos formada pela direita chilena. Cumpriram-se por tanto 20 anos desde que em 1990 mudasse o Governo militar presidido pelo general Pinochet. Esse longo tempo, duas décadas, coincide com um período de políticas que o Estado implementou para com os Povos Indígenas. O Projeto “Comemorações e Memórias Subalternas” realizou durante o ano 2010 um conjunto de pesquisas de campo e documentais tendentes a compreender do modo mais objetivo e científico o ocorrido no período e, por tanto, a situação atual das sociedades mapuches em suas complexas relações com a chilena.The conmeration of the 200 years of the Independence of Chile was in September 2010. This year was also the political change from the Concertación de Partidos por la Democracia to the right

  9. AP calculus AB & BC crash course

    CERN Document Server

    Rosebush, J


    AP Calculus AB & BC Crash Course - Gets You a Higher Advanced Placement Score in Less Time Crash Course is perfect for the time-crunched student, the last-minute studier, or anyone who wants a refresher on the subject. AP Calculus AB & BC Crash Course gives you: Targeted, Focused Review - Study Only What You Need to Know Crash Course is based on an in-depth analysis of the AP Calculus AB & BC course description outline and actual AP test questions. It covers only the information tested on the exams, so you can make the most of your valuable study time. Written by experienced math teachers, our

  10. Village microgrids: The Chile project

    Energy Technology Data Exchange (ETDEWEB)

    Baring-Gould, E.I.


    This paper describes a village application in Chile. The objective was to demonstrate the technical, economic and institutional viability of renewable energy for rural electrification, as well as to allow local partners to gain experience with hybrid/renewable technology, resource assessment, system siting and operation. A micro-grid system is viewed as a small village system, up to 1200 kWh/day load with a 50 kW peak load. It can consist of components of wind, photovoltaic, batteries, and conventional generators. It is usually associated with a single generator source, and uses batteries to cover light day time loads. This paper looks at the experiences learned from this project with regard to all of the facets of planning and installing this project.

  11. 2010 Chile Earthquake Aftershock Response (United States)

    Barientos, Sergio


    The Mw=8.8 earthquake off the coast of Chile on 27 February 2010 is the 5th largest megathrust earthquake ever to be recorded and provides an unprecedented opportunity to advance our understanding of megathrust earthquakes and associated phenomena. The 2010 Chile earthquake ruptured the Concepcion-Constitucion segment of the Nazca/South America plate boundary, south of the Central Chile region and triggered a tsunami along the coast. Following the 2010 earthquake, a very energetic aftershock sequence is being observed in an area that is 600 km along strike from Valparaiso to 150 km south of Concepcion. Within the first three weeks there were over 260 aftershocks with magnitude 5.0 or greater and 18 with magnitude 6.0 or greater (NEIC, USGS). The Concepcion-Constitucion segment lies immediately north of the rupture zone associated with the great magnitude 9.5 Chile earthquake, and south of the 1906 and the 1985 Valparaiso earthquakes. The last great subduction earthquake in the region dates back to the February 1835 event described by Darwin (1871). Since 1835, part of the region was affected in the north by the Talca earthquake in December 1928, interpreted as a shallow dipping thrust event, and by the Chillan earthquake (Mw 7.9, January 1939), a slab-pull intermediate depth earthquake. For the last 30 years, geodetic studies in this area were consistent with a fully coupled elastic loading of the subduction interface at depth; this led to identify the area as a mature seismic gap with potential for an earthquake of magnitude of the order 8.5 or several earthquakes of lesser magnitude. What was less expected was the partial rupturing of the 1985 segment toward north. Today, the 2010 earthquake raises some disturbing questions: Why and how the rupture terminated where it did at the northern end? How did the 2010 earthquake load the adjacent segment to the north and did the 1985 earthquake only partially ruptured the plate interface leaving loaded asperities since

  12. Biomonitoring air pollution in Chile

    International Nuclear Information System (INIS)

    Full text: Chile, in general, and Santiago, its capital city, in particular, has serious air pollution problems mainly in winter time when the pollutants could reach dangerous levels which might be detrimental to older people and children. A project was undertaken within the framework of a Co-ordinated Research Programme (CRP) supported by the International Atomic Energy Agency (IAEA) to carry out a long term study on atmospheric air pollution in Chile using biomonitors. The present paper describes the activities carried out within this CRP. The lichens, collected in clean areas (native forests), were transplanted to selected sites in Santiago and exposed during three and six months. At a second stage, samples of Tillandsia recurvata were collected in the Metropolitan Area. All samples were carefully cleaned, using only clean plastic materials, milled at liquid nitrogen temperature, freeze dried, re-homogenized and stored at low temperature until analysis. The samples were mainly analysed by INAA, RNAA SS-AAS and ASV. As part of the routine QA/QC programme, analytical laboratories involved in the project participated in intercomparison runs organized by the IAEA for the determination of trace and minor elements in two lichens samples. From the data and its subsequent mapping over the area under study, it was possible to identify places exposed to higher amounts of some elements. Of interest are also the correlations between several elements, perhaps indicating a given source of pollutants. The results indicate the usefulness of biomonitoring air pollution using lichens and Tillandsias, which, jointly with multielemental analytical techniques, such as NAA, open the possibility to study extensive areas without the infrastructure needed for conventional APM sample collection and at reduced costs. (author)

  13. Report on the ESO Chile Science Days (United States)

    West, Michael


    Science Days in Santiago are an annual gathering of ESO's geographically dispersed team in Chile to learn more about each other's research, to celebrate scientific achievements of the past year and to encourage new collaborations.

  14. Surface Observations from Punta Arenas, Chile (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Surface Observations from Punta Arenas, in extreme southern Chile. WMO station ID 85934. Period of record 1896-1954. The original forms were scanned at the Museo...

  15. 1960 Puerto Montt, Valdivia, Chile Images (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — On May 22, 1960, a Mw 9.5 earthquake, the largest earthquake ever instrumentally recorded, occurred in southern Chile. The series of earthquakes that followed...

  16. Enterprise Surveys : Chile Country Profile 2010


    World Bank; International Finance Corporation


    The Country Profile for Chile is based on data from the Enterprise Surveys conducted by the World Bank. The benchmarks include the averages for the group of countries in Latin America & Caribbean and the Chile income group. The enterprise surveys focus on the many factors that shape the decisions of firms to invest. These factors can be accommodating or constraining and play an important r...

  17. Coaching Strategies for AP: Building a Successful AP European History Program (United States)

    Fornaciari, Jim


    The October 2013 special issue of "Social Education" dealt with almost all AP social studies subjects, but omitted AP European History. This is one of the most fascinating AP subjects for students and teachers alike. In this article, the author shares his experiences since hewas given the responsibility of building his school's…

  18. Diversidad de la familia Carabidae (Coleoptera en Chile Diversity of the family Carabidae (Coleoptera in Chile

    Directory of Open Access Journals (Sweden)



    Full Text Available Carabidae constituye dentro de los coléopteros chilenos, la cuarta familia en importancia por su cantidad de especies. El presente trabajo incluye una breve compilación acerca de la historia de la familia y de las primeras expediciones realizadas en Chile. También se realizan comparaciones de la diversidad de carábidos chilenos con respecto a otros países y el Neotrópico. Para Chile, se conocen 21 tribus, con 95 géneros y 365 especies, que representan el 38,8, 28,8 y 7,9 % de la fauna del Neotrópico, respectivamente. Chile posee un bajo número de tribus comparado con otros países, sin embargo, constituye un área importante por la presencia de seis tribus relictuales, principalmente pangeicas o gondwánicas. Chile posee 18 géneros endémicos (18,5 % de su fauna de Carabidae, 28 cuya distribución está restringida a Chile y Argentina y seis restringidos a Chile, Argentina y Uruguay. La cantidad de especies presentes en Chile es inferior a la que poseen otros países de América del Sur, pero la cantidad de especies endémicas es muy alta (204 y representa el 55,8 % de su fauna de carábidos. El alto grado de endemismo que posee Chile con respecto a otros países de América del Sur puede deberse a su condición de aislamiento, siendo las barreras más importantes la región desértica del norte y la cordillera de Los Andes. Este hecho también se vislumbra por la ausencia de importantes tribus neotropicales como Galeritini, Scaritini y Brachinini. También se incluyen en este trabajo claves para la identificación de todas las tribus y géneros presentes en Chile, como así también una breve descripción acerca de la diversidad y ambientes en los que se encuentra cada géneroThe family Carabidae is the fourth largest Coleoptera family in Chile. The present work includes a brief compilation on the taxonomic history of the family and the first expeditions to Chile. In addition, knowledge of carabid diversity in Chile is compared with

  19. AP Courses Get Audited for Quality (United States)

    Ashford, Ellie


    As the college admissions process has gotten much more competitive, the number of high school students taking Advanced Placement (AP) courses has soared. At the same time, policymakers and education leaders seek to get more minorities and students not on the college track to sign up for AP and other rigorous classes. But as high schools have…


    This project is aimed at consolidating, selecting, and disseminating the most appropriate data and methods for estimating air emissions from wildfires and prescribed burns. The product will replace a current section of AP-42, but may not take the precise form of an AP-42 secti...

  1. The status of APS, BESSRC, and NEET.

    Energy Technology Data Exchange (ETDEWEB)

    Ahmad, I.; Dunford, R. W.; Esbensen, H.; Gemmell, D. S.; Kanter, E. P.; Kraessig, B.; Rutt, U.; Southworth, S. H.


    We present a brief summary of the current status of the Advanced Photon Source (APS) at Argonne National Laboratory and of the facilities at two of the APS sectors operated by the Basic Energy Sciences Synchrotrons Radiation Center (BESSRC). This is followed by a report on recent measurements at BESSRC on the phenomenon of Nuclear Excitation by Electronic Transition (NEET).

  2. El poblamiento temprano de la costa norte de Chile

    Directory of Open Access Journals (Sweden)

    Varela, Héctor Hugo


    Full Text Available La costa Norte de Chile estuvo habitada por lo menos desde 10000 AP por pequeños grupos humanos que subsistían de los recursos del mar y la costa. Ellos estaban asociados con la cultura Chinchorro, caracterizada por el tratamiento artificial que le daban a sus muertos. El sitio Caleta Huelén 42 se encuentra ubicado en la desembocadura del río Loa en el Norte de Chile. Constituye una importante conexión hacia el sur, vinculada con la expansión de los grupos de pescadores arcaicos semejantes a Morro 1 y Morro 1-6 y que continúa hacia Punta de Teatinos y El Cerrito. La presente experiencia tiene como objetivo establecer las relaciones biológicas de Caleta Huelén 42 con otros grupos arcaicos costeros. La colección está constituida por 33 individuos y los fechados conocidos la ubican entre el 4780 y el 3780 AP. Las afinidades biológicas con grupos semejantes (Morro 1, Morro 1/6, Morro Uhle, El Cerrito y Punta de Teatinos se analizan mediante el empleo de 29 caracteres métricos del cráneo y la aplicación de diferentes técnicas de análisis multivariado. Se demostró la existencia de dos conglomerados biológicos uno constituido por las muestras del Norte Árido (Morro Uhle, Morro 1, Morro1/6 y Caleta Huelén 42 y el otro por las series del Norte Semiárido (El Cerrito y Punta de Teatinos. Los fundadores de Caleta Huelén 42 son el resultado de la migración hacia el sur de una pequeña banda de cazadores recolectores arcaicos, que conservaron parte de genoma original y características culturales que los conecta con la tradición Chinchorro. Además, es posible que hayan recibido el aporte genético de grupos arcaicos proveniente del interior del continente a través del río Loa.

  3. APS undulator radiation: First results

    International Nuclear Information System (INIS)

    The first undulator radiation has been extracted from the Advanced Photon Source (APS). The results from the characterization of this radiation are very satisfactory. With the undulator set at a gap of 15.8 mm (K=1.61), harmonics as high as the 17th were observed using a crystal spectrometer. The angular distribution of the third-harmonic radiation was measured, and the source was imaged using a zone plate to determine the particle beam emittance. The horizontal beam emittance was found to be 6.9 ± 1.0 nm-rad, and the vertical emittance coupling was found to be less than 3%. The absolute spectral flux was measured over a wide range of photon energies, and it agrees remarkably well with the theoretical calculations based on the measured undulator magnetic field profile and the measured beam emittance. These results indicate that both the emittance of the electron beam and the undulator magnetic field quality exceed the original specifications

  4. Where Do Mexico and Chile Stand on Inclusive Education? Short Title: Inclusion in Mexico and Chile (United States)

    García-Cedillo, Ismael; Romero-Contreras, Silvia; Ramos-Abadie, Liliana


    This paper discusses the background, current situation and challenges of educational integration and inclusive education in Mexico and Chile. These countries obtained similar low results on the academic achievement of their students (Mexico last and Chile second last) among OECD countries; and above average scores, among Latin-American countries.…

  5. The Genus Austroleptis from South Chile and Patagonia (Diptera, Rhagionidae)


    NAGATOMI, Akira; NAGATOMI, Hisako; ナガトミ, アキラ; ナガトミ, ヒサコ; 永冨, 昭; 永冨, 尚子


    The genus Austroleptis from South Chile and Patagonia is revised and three new species are added. So, there are eight known species, five of which are from South Chile and Patagonia and three from Australia and Tasmania.

  6. Helicobacter pylori infection in Chile. (United States)

    Figueroa, G; Acuña, R; Troncoso, M; Portell, D P; Toledo, M S; Valenzuela, J


    This article summarizes studies designed to evaluate the role of Helicobacter pylori infection in Chile, described in 21 reports from nine centers in various Chilean regions published between 1985 and 1995. According to their data, H. pylori infection is quite frequent among patients with a variety of gastric conditions, including adults (43%-92%) and children (6%-100%). Levels of specific IgG antibodies to H. pylori are also elevated among patients with duodenal ulcers (100%) and gastritis (86%) as well as asymptomatic adults (75%). Combination therapy with three (but not two) drugs has been proved effective, with clinical improvement, ulcer cure, and H. pylori eradication occurring in well-controlled studies. Available evidence suggests that antibiotic resistance is not a major problem in treatment. The H. pylori reinfection rate is low (4.2% per year), suggesting that combination therapy with three drugs constitutes a cost-effective alternative for treating colonized symptomatic patients. Concurrent preliminary studies revealed that antibodies to VacA but not CagA proteins correlate with disease severity in Chilean patients. It can be concluded that local research assists local administrators of health resources to implement adequate policies to prevent, control, and treat H. pylori-related pathologies.

  7. Regulated electricity retailing in Chile

    Energy Technology Data Exchange (ETDEWEB)

    Galetovic, Alexander, E-mail: [Facultad de Ciencias Economicas y Empresariales, Universidad de los Andes, Santiago, Chile. Av. San Carlos de Apoquindo 2200, Las Condes, Santiago (Chile); Munoz, Cristian M., E-mail: [AES Gener and Departamento de Ingenieria Electrica, Universidad Catolica de Chile (Chile)


    While some countries have unbundled distribution and retailing, skeptics argue that the physical attributes of electricity make retailers redundant. Instead, it is claimed that passive pass through of wholesale prices plus regulated charges for transmission and distribution suffice for customers to benefit from competitive generation markets. We review the Chilean experience with regulated retailing and pass through of wholesale prices. We argue that when energy wholesale prices are volatile and prices are stabilized, distortions emerge. Regulated retailers gain little by mitigating or correcting them. On the contrary, sometimes price distortions increase their profits. We estimate the cost of three distortions that neither regulated retailers nor the regulator have shown any interest in correcting. - Highlights: > We review Chile's experience with regulated electricity retailing. > Distortions emerge when energy wholesale prices are volatile and prices stabilized. > Regulated retailers gain little by mitigating or correcting distortions. > Sometimes price distortions increase retailers' profits. > We estimate the cost of three distortions, which retailers have not corrected.

  8. Regulated electricity retailing in Chile

    International Nuclear Information System (INIS)

    While some countries have unbundled distribution and retailing, skeptics argue that the physical attributes of electricity make retailers redundant. Instead, it is claimed that passive pass through of wholesale prices plus regulated charges for transmission and distribution suffice for customers to benefit from competitive generation markets. We review the Chilean experience with regulated retailing and pass through of wholesale prices. We argue that when energy wholesale prices are volatile and prices are stabilized, distortions emerge. Regulated retailers gain little by mitigating or correcting them. On the contrary, sometimes price distortions increase their profits. We estimate the cost of three distortions that neither regulated retailers nor the regulator have shown any interest in correcting. - Highlights: → We review Chile's experience with regulated electricity retailing. → Distortions emerge when energy wholesale prices are volatile and prices stabilized. → Regulated retailers gain little by mitigating or correcting distortions. → Sometimes price distortions increase retailers' profits. → We estimate the cost of three distortions, which retailers have not corrected.

  9. Tank 241-AP-107, grab samples, 7AP-99-1, 7AP-99-3 and 7AP-99-4 analytical results for the final report

    International Nuclear Information System (INIS)

    This document is the format IV, final report for the tank 241-AP-107 (AP-107) grab samples taken in May 1999 to address waste compatibility concerns. Chemical, radiochemical, and physical analyses on the tank AP-107 samples were performed as directed in Compatibility Grab Sampling and Analysis Plan for Fiscal year 1999. Any deviations from the instructions provided in the tank sampling and analysis plan (TSAP) were discussed in this narrative. Interim data were provided earlier to River Protection Project (RPP) personnel, however, the data presented here represent the official results. No notification limits were exceeded

  10. Tank 241-AP-107, grab samples, 7AP-99-1, 7AP-99-3 and 7AP-99-4 analytical results for the final report

    Energy Technology Data Exchange (ETDEWEB)

    BELL, K.E.


    This document is the format IV, final report for the tank 241-AP-107 (AP-107) grab samples taken in May 1999 to address waste compatibility concerns. Chemical, radiochemical, and physical analyses on the tank AP-107 samples were performed as directed in Compatibility Grab Sampling and Analysis Plan for Fiscal year 1999. Any deviations from the instructions provided in the tank sampling and analysis plan (TSAP) were discussed in this narrative. Interim data were provided earlier to River Protection Project (RPP) personnel, however, the data presented here represent the official results. No notification limits were exceeded.

  11. AP English language & composition crash course

    CERN Document Server

    Hogue, Dawn


    AP English Language & Composition Crash Course - Gets You a Higher Advanced Placement Score in Less Time Crash Course is perfect for the time-crunched student, the last-minute studier, or anyone who wants a refresher on the subject. AP English Language & Composition Crash Course gives you: Targeted, Focused Review - Study Only What You Need to Know Crash Course is based on an in-depth analysis of the AP English Language & Composition course description outline and actual Advanced Placement test questions. It covers only the information tested on the exam, so you can make the most of your valua

  12. [Beginning of the Microbiology education in Chile: formation centers]. (United States)

    Osorio, Carlos


    The first Chair of Microbiology in Chile was created in the School of Medicine of the Cañadilla at the University of Chile in 1892. Dr. Alejandro del Río Soto Aguilar was its first Professor. For almost three decades it was the only educational center for microbiologists in Chile. Among them were the first Professors of the new School of Medicine of the Catholic University of Chile and of the University of Concepción.

  13. 7 CFR 319.56-38 - Citrus from Chile. (United States)


    ... 7 Agriculture 5 2010-01-01 2010-01-01 false Citrus from Chile. 319.56-38 Section 319.56-38... from Chile. Clementines (Citrus reticulata Blanco var. Clementine), mandarins (Citrus reticulata Blanco), and tangerines (Citrus reticulata Blanco) may be imported into the United States from Chile,...

  14. Pentoxifylline Treatment in Acute Pancreatitis (AP) (United States)


    Acute Pancreatitis (AP); Gallstone Pancreatitis; Alcoholic Pancreatitis; Post-ERCP/Post-procedural Pancreatitis; Trauma Acute Pancreatitis; Hypertriglyceridemia Acute Pancreatitis; Idiopathic (Unknown) Acute Pancreatitis; Medication Induced Acute Pancreatitis; Cancer Acute Pancreatitis; Miscellaneous (i.e. Acute on Chronic Pancreatitis)

  15. Expedition Atacama - project AMOS in Chile (United States)

    Tóth, J.; Kaniansky, S.


    The Slovak Video Meteor Network operates since 2009 (Tóth et al., 2011). It currently consists of four semi-automated all-sky video cameras, developed at the Astronomical Observatory in Modra, Comenius University in Bratislava, Slovakia. Two new generations of AMOS (All-sky Meteor Orbit System) cameras operate fully automatically at the Canary Islands, Tenerife and La Palma, since March 2015 (Tóth et al., 2015). As a logical step, we plan to cover the southern hemisphere from Chile. We present observational experiences in meteor astronomy from the Atacama Desert and other astronomical sites in Chile. This summary of the observations lists meteor spectra records (26) between Nov.5-13, 2015 mostly Taurid meteors, single and double station meteors as well as the first light from the permanent AMOS stations in Chile.

  16. Tank 241-AP-106, Grab samples, 6AP-98-1, 6AP-98-2 and 6AP-98-3 Analytical results for the final report

    Energy Technology Data Exchange (ETDEWEB)

    FULLER, R.K.


    This document is the final report for tank 241-AP-106 grab samples. Three grab samples 6AP-98-1, 6AP-98-2 and 6AP-98-3 were taken from riser 1 of tank 241-AP-106 on May 28, 1998 and received by the 222-S Laboratory on May 28, 1998. Analyses were performed in accordance with the ''Compatability Grab Sampling and Analysis Plan'' (TSAP) (Sasaki, 1998) and the ''Data Quality Objectives for Tank Farms Waste Compatability Program (DQO). The analytical results are presented in the data summary report. No notification limits were exceeded. The request for sample analysis received for AP-106 indicated that the samples were polychlorinated biphenyl (PCB) suspects. The results of this analysis indicated that no PCBs were present at the Toxic Substance Control Act (TSCA) regulated limit of 50 ppm. The results and raw data for the PCB analysis are included in this document.

  17. Income Inequality in Chile: 1990-2006


    Alain Hourton


    The entrance of Chile to the Organization for the Economic Cooperation and Development, as the first South American country and second after Mexico in Latin America, sets a landmark in the development path that since the beginning of the 1990s decade has seemed to lead this country to a privileged position in the region. Given the reforms taken by the military regime in the 1980s, Chile is one of the most market-oriented countries in Latin America, with Free Trade Agreements and Economical Pa...

  18. Entrevista : Carlos Honorato Comandari (ProChile)


    Comandari, Carlos Honorato


    Ingeniero Comercial de la Universidad Finis Terrae y MBA de Babson College (Estados Unidos). En 2010, asumió como Subdirector Internacional de ProChile, desde donde lideró la creación del programa de apoyo a la internacionalización de la innovación chilena, CONTACTChile. Fue nombrado Director de ProChile en mayo de 2013, con la responsabilidad de conducir las más de 50 oficinas comerciales de la institución en el mundo y las 15 oficinas regionales dentro del país. En este período ha intensifi...

  19. Magnetic AP Stars in the Hertzsprung-Russell Diagram (United States)

    Hubrig, S.; North, P.; Mathys, G.


    The evolutionary state of magnetic Ap stars is rediscussed using the recently released Hipparcos data. The distribution of the magnetic Ap stars of mass below 3 Msolar in the H-R diagram differs from that of the normal stars in the same temperature range at a high level of significance. Magnetic stars are concentrated toward the center of the main-sequence band. This is shown in two forms of the H-R diagram: one where logL is plotted against logTeff and a version more directly tied to the observed quantities, showing the astrometry-based luminosity (Arenou & Luri) against the (B2-G)0 index of Geneva photometry. In particular, it is found that magnetic fields appear only in stars that have already completed at least approximately 30% of their main-sequence lifetime. No clear picture emerges as to the possible evolution of the magnetic field across the main sequence. Hints of some (loose) relations between magnetic field strength and other stellar parameters are found: stars with shorter periods tend to have stronger fields, as do higher temperature and higher mass stars. A marginal trend of the magnetic flux to be lower in more slowly rotating stars may possibly be seen as suggesting a dynamo origin for the field. No correlation between the rotation period and the fraction of the main-sequence lifetime completed is observed, indicating that the slow rotation in these stars must already have been achieved before they became observably magnetic. Based on data from the ESA Hipparcos satellite and on observations collected at the European Southern Observatory (La Silla, Chile; ESO programs Nos. 43.7-004, 44.7-012, 49.7-030, 50.7-067, 51.7-041, 52.7-063, 53.7-028, 54.E-0416, and 55.E-0751), at the Observatoire de Haute-Provence (Saint-Michel l'Observatoire, France), at Kitt Peak National Observatory, and at the Canada-France-Hawaii Telescope.

  20. Hallazgo de Ehrlichia canis en Chile, informe preliminar Ehrlichia canis in Chile; preliminary report

    Directory of Open Access Journals (Sweden)

    J. LÓPEZ


    Full Text Available Se describe el primer caso de Ehrlichiosis canina detectado en Chile, causado por la rickettsia Ehrlichia canis y transmitida por el vector Rhipicephalus sanguineus. El diagnóstico clínico fue confirmado en Alemania por Inmunofluorescencia Indirecta (IFATThe first case of canine ehrlichiosis detected in Chile is described. It is caused by the rickettsia Ehrlichia canis and carried by the vektor Rhipicephalus sanguineus. The clinical diagnosis was confirmed in Germany using the Immunofluorescent Antibody Test (IFA

  1. Nuclear public information activities in Chile

    International Nuclear Information System (INIS)

    Nuclear plans and developing programs in developing and developed countries are facing-in a higher or lower degree- opposition from public opinion. The objectives and contents of the public education program on nuclear energy in Chile are dealt with in this paper


    Directory of Open Access Journals (Sweden)

    Maria-Mihaela Győri


    Full Text Available The contemporary development of the Chilean Tourism sector is analyzed mainly on thebasis of data supplied by the National Service of Tourism in Chile. Figures on inboundtourism, domestic tourism, lodging, employment, receipts, as well as the existing structurewithin the sector, were taken into consideration for the investigated period of 1999-2006.

  3. Museos de Santiago de Chile. Directorio


    Carrillo, Andrea; Funes, Catherine; Heredia, Constanza; Herrera, Daniela; Suárez, Víctor


    Directory of the museums in Santiago of Chile categorized by subject, such as Art, Archaeology, Historic house, Science and technology, Natural science and Natural history, Specialized, Ethnography and Anthropology, History, Site museum and Other. It comprehends basic information about name, creation date, collections, services, contact info, social network accounts, website and entrance fee of the museums.

  4. A Decade of Environment Management in Chile


    Ruthenberg, Ina-Marlene


    This publication presents an evaluation of the Environmental Institutions Development Project in Chile, selected by Bank management to be part of an intensive learning process in final project evaluation, given its contributing factor to the Bank's knowledge base on environmental institutional development projects. The first part of the publication focuses on the project as catalyst for cu...

  5. Multiplicity of rapidly oscillating Ap stars

    CERN Document Server

    Schoeller, M; Hubrig, S; Kurtz, D W


    Rapidly oscillating Ap (roAp) stars have rarely been found in binary or higher order multiple systems. This might have implications for their origin. We intend to study the multiplicity of this type of chemically peculiar stars, looking for visual companions in the range of angular separation between 0.05" and 8". We carried out a survey of 28 roAp stars using diffraction-limited near-infrared imaging with NAOS-CONICA at the VLT. Additionally, we observed three non-oscillating magnetic Ap stars. We detected a total of six companion candidates with low chance projection probabilities. Four of these are new detections, the other two are confirmations. An additional 39 companion candidates are very likely chance projections. We also found one binary system among the non-oscillating magnetic Ap stars. The detected companion candidates have apparent K magnitudes between 6.8 and 19.5 and angular separations ranging from 0.23" to 8.9", corresponding to linear projected separations of 30-2400AU. While our study confi...

  6. Tank 241-AP-107, grab samples 7AP-97-1, 7AP-97-2 and 7AP-97-3 analytical results for the final report

    Energy Technology Data Exchange (ETDEWEB)

    Steen, F.H.


    This document is the final report for tank 241-AP-107 grab samples. Three grab samples were collected from riser 1 on September 11, 1997. Analyses were performed on samples 7AP-97-1, 7AP-97-2 and 7AP-97-3 in accordance with the Compatibility Grab Sampling and Analysis Plan (TSAP) (Sasaki, 1997) and the Data Quality Objectives for Tank Farms Waste Compatibility Program (DQO) (Rev. 1: Fowler, 1995; Rev. 2: Mulkey and Nuier, 1997). The analytical results are presented in the data summary report (Table 1). A notification was made to East Tank Farms Operations concerning low hydroxide in the tank and a hydroxide (caustic) demand analysis was requested. The request for sample analysis (RSA) (Attachment 2) received for AP-107 indicated that the samples were polychlorinated biphenyl (PCB) suspects. Therefore, prior to performing the requested analyses, aliquots were made to perform PCB analysis in accordance with the 222-S Laboratory administrative procedure, LAP-101-100. The results of this analysis indicated that no PCBs were present at 50 ppm and analysis proceeded as non-PCB samples. The results and raw data for the PCB analysis will be included in a revision to this document. The sample breakdown diagrams (Attachment 1) are provided as a cross-reference for relating the tank farm customer identification numbers with the 222-S Laboratory sample numbers and the portion of sample analyzed.

  7. Sistema de salud de Chile The health system of Chile

    Directory of Open Access Journals (Sweden)

    Víctor Becerril-Montekio


    Full Text Available En este trabajo se describe el sistema de salud de Chile, incluyendo su estructura, financiamiento, beneficiarios y recursos físicos, materiales y humanos de los que dispone. Este sistema está compuesto por dos sectores, público y privado. El sector público está formado por todos los organismos que constituyen el Sistema Nacional de Servicios de Salud y cubre aproximadamente a 70% de la población, incluyendo a los pobres del campo y las ciudades, la clase media baja y los jubilados, así como los profesionales y técnicos. El sector privado cubre aproximadamente a 17.5% de la población perteneciente a los grupos sociales de mayores ingresos. Un pequeño sector de la población, perteneciente a la clase alta, realiza pagos directos de bolsillo a proveedores privados de servicios de atención a la salud. Alrededor de 10% de la población está cubierta por otras agencias públicas, fundamentalmente los Servicios de Salud de las Fuerzas Armadas. Recientemente el sistema se reformó creando el Régimen General de Garantías en Salud, que establece un Sistema Universal con Garantías Explícitas que se tradujo, en 2005, en el Plan de Acceso Universal con Garantías Explícitas (AUGE, que garantiza el acceso oportuno a servicios de calidad para 56 problemas de salud, incluyendo cáncer en niños, cáncer de mama, trastornos isquémicos del corazón, VIH/SIDA y diabetes.This paper describes the Chilean health system, including its structure, financing, beneficiaries, and its physical, material and human resources. This system has two sectors, public and private. The public sector comprises all the organisms that constitute the National System of Health Services, which covers 70% of the population, including the rural and urban poor, the low middle-class, the retired, and the self-employed professionals and technicians.The private sector covers 17.5% of the population, mostly the upper middle-class and the high-income population. A small

  8. Center for Geometrisk Metrologi CGM ApS, Årsberetning 2001 til DANAK

    DEFF Research Database (Denmark)

    De Chiffre, Leonardo

    Denne årsberetning omfatter CGM ApS' akkrediterede virksomhed i kalenderåret 2001. Årsberetningen er udarbejdet til DANAK (Dansk Akkreditering, Erhvervsfremme Styrelsen), som led i opfyldelsen af laboratoriets informationspligt i henhold til gældende regler (Teknisk Forskrift Nr. TF4 af 2000.11.0...

  9. Building an AP Social Studies Program with Non-Traditional AP Students (United States)

    Ashmead, Amanda; Blanchette, Sue


    Equal access to education, that is to a high quality education, has increasingly come to mean access to an Advanced Placement program. In recent years, there has been steady attention paid to opening access to AP programs. The 9th annual College Board report (2013) stated "students who succeed on an AP Exam during high school typically…

  10. A note on weighted Ap(G)-modules


    ÖZTOP, Serap


    Let G be a locally compact abelian group and w be a weight function on G. In this paper, we show that the space Ap,w(G) is a Banach module over the Figà-Talamanca Herz algebra Ap(G) and study the multiplier space from Ap(G) to Ap,w(G).

  11. AP1000, a nuclear central of advanced design; AP1000, una central nuclear de diseno avanzado

    Energy Technology Data Exchange (ETDEWEB)

    Hernandez M, N.; Viais J, J. [ININ, 52045 Ocoyoacac, Estado de Mexico (Mexico)]. e-mail:


    The AP1000 is a design of a nuclear reactor of pressurized water (PWR) of 1000 M We with characteristic of safety in a passive way; besides presenting simplifications in the systems of the plant, the construction, the maintenance and the safety, the AP1000 is a design that uses technology endorsed by those but of 30 years of operational experience of the PWR reactors. The program AP1000 of Westinghouse is focused to the implementation of the plant to provide improvements in the economy of the same one and it is a design that is derived directly of the AP600 designs. On September 13, 2004 the US-NRC (for their initials in United States- Nuclear Regulatory Commission) approved the final design of the AP1000, now Westinghouse and the US-NRC are working on the whole in a complete program for the certification. (Author)

  12. Ectopic expression of FaesAP3, a Fagopyrum esculentum (Polygonaceae) AP3 orthologous gene rescues stamen development in an Arabidopsis ap3 mutant. (United States)

    Fang, Zheng-wu; Qi, Rui; Li, Xiao-fang; Liu, Zhi-xiong


    Arabidopsis thaliana APETALA3 (AP3) and Antirrhinum majus DEFICIENS (DEF) MADS box genes are required to specify petal and stamen identity. AP3 and DEF are members of the euAP3 lineage, which arose by gene duplication coincident with radiation of the core eudicots. In order to investigate the molecular mechanisms underlying organ development in early diverging clades of core eudicots, we isolated and identified an AP3 homolog, FaesAP3, from Fagopyrum esculentum (buckwheat, Polygonaceae), a multi-food-use pseudocereal with healing benefits. Protein sequence alignment and phylogenetic analyses revealed that FaesAP3 grouped into the euAP3 lineage. Expression analysis showed that FaesAP3 was transcribed only in developing stamens, and differed from AP3 and DEF, which expressed in developing petals and stamens. Moreover, ectopic expression of FaesAP3 rescued stamen development without complementation of petal development in an Arabidopsis ap3 mutant. Our results suggest that FaesAP3 is involved in the development of stamens in buckwheat. These results also suggest that FaesAP3 holds some potential for biotechnical engineering to create a male sterile line of F. esculentum. PMID:25149019

  13. An analysis of AP600 design features

    Energy Technology Data Exchange (ETDEWEB)

    Park, Jong Kyoon; Jang, Moon Heui; Hwang, Yung Dong [Korea Atomic Energy Research Institute, Taejon (Korea, Republic of)] [and others


    In the aspect of engineering, passive safety system concept has improved the safety degree of nuclear power plant. Therefore, the objective of this study is to check on the possibility of the capacity upgrade of nuclear power plant in the case of adopting the passive safety system concept of AP 600. The characteristics of AP 600 are the advanced functions in ECCS, heat removal of containment building and residual heat removal under the passive safety system concept. The result of this study will become the basic data of capacity upgrade of nuclear power plant and will be widely used in second year project. (Author).

  14. Formalistic approaches to A&P

    Institute of Scientific and Technical Information of China (English)



    A&P is a famous short story. Its simple words, the unique point of view and skillful writing technique are expressed successfully. Besides, the first-person narrator is also a good point. From Sammy’s eyes, readers can learn the character’s characteristics. Another point is the usage of symbol, the name of the store, A&P, it shows that people’s life is rich, but their spirit is barren. This article tries to analyze it by formalistic approaches.

  15. Kepler observations of rapidly oscillating Ap, δ Scuti and γ Doradus pulsations in Ap stars

    DEFF Research Database (Denmark)

    Balona, Luis A.; Cunha, Margarida S.; Kurtz, Donald W.;


    Observations of the A5p star KIC 8677585 obtained during the Kepler 10-d commissioning run with 1-min time resolution show that it is a rapidly oscillating Ap (roAp) star with several frequencies with periods near 10 min. In addition, a low frequency at 3.142 d−1 is also clearly present. Multiper......Observations of the A5p star KIC 8677585 obtained during the Kepler 10-d commissioning run with 1-min time resolution show that it is a rapidly oscillating Ap (roAp) star with several frequencies with periods near 10 min. In addition, a low frequency at 3.142 d−1 is also clearly present....... Multiperiodic γ Doradus (γ Dor) and δ Scuti (δ Sct) pulsations, never before seen in any Ap star, are present in Kepler observations of at least three other Ap stars. Since γ Dor pulsations are seen in Ap stars, it is likely that the low frequency in KIC 8677585 is also a γ Dor pulsation. The simultaneous...

  16. Managing hazardous pollutants in Chile: arsenic. (United States)

    Sancha, Ana María; O'Ryan, Raul


    Chile is one of the few countries that faces the environmental challenge posed by extensive arsenic pollution, which exists in the northern part of the country. Chile has worked through various options to appropriately address the environmental challenge of arsenic pollution of water and air. Because of cost and other reasons, copying standards used elsewhere in the world was not an option for Chile. Approximately 1.8 million people, representing about 12% of the total population of the country, live in arsenic-contaminated areas. In these regions, air, water, and soil are contaminated with arsenic from both natural and anthropogenic sources. For long periods, water consumed by the population contained arsenic levels that exceeded values recommended by the World Health Organization. Exposure to airborne arsenic also occurred near several large cities, as a consequence of both natural contamination and the intensive mining activity carried out in those areas. In rural areas, indigenous populations, who lack access to treated water, were also exposed to arsenic by consuming foods grown locally in arsenic-contaminated soils. Health effects in children and adults from arsenic exposure first appeared in the 1950s. Such effects included vascular, respiratory, and skin lesions from intake of high arsenic levels in drinking water. Methods to remove arsenic from water were evaluated, developed, and implemented that allowed significant reductions in exposure at a relatively low cost. Construction and operation of treatment plants to remove arsenic from water first began in the 1970s. Beginning in the 1990s, epidemiological studies showed that the rate of lung and bladder cancer in the arsenic-polluted area was considerably higher than mean cancer rates for the country. Cancer incidence was directly related to arsenic exposure. During the 1990s, international pressure and concern by Chile's Health Ministry prompted action to regulate arsenic emissions from copper smelters. A

  17. Two Successful Approaches to Teaching AP Government (United States)

    Ladd, Brian; Stepp, Heidi


    Amador Valley High School, in Pleasanton, California, uses two unique approaches to teaching Advanced Placement Government and Politics. AP Government consists of six units: Constitutional Underpinnings; Political Behavior and Political Beliefs; Mass Media, Interest Groups, and Political Parties; Institutions of Government; Civil Liberties and…

  18. 2000 Johnston Site 3A-P (United States)

    US Fish and Wildlife Service, Department of the Interior — Underwater Site 3A-P was established at Johnston Atoll by Dr. James Maragos, U.S. Fish & Wildlife Service, on July 3, 2000. With a start point (meter 0) at...

  19. 2000 Johnston Site 2A-P (United States)

    US Fish and Wildlife Service, Department of the Interior — Underwater Site 2A-P was established at Johnston Atoll by Dr. James Maragos, U.S. Fish & Wildlife Service, on June 30, 2000. With a start point (meter 0) at...

  20. The Demographic Wave: Rethinking Hispanic AP Trends (United States)

    Edwards, Kelcey; Sawtell, Ellen


    Presented at the Advanced Placement Annual Conference (APAC) in Las Vegas, NV in July 2013. This presentation reviews new research examining the AP® experience of Hispanic graduates over the past decade. Topics include an in-depth look at the AP Spanish Language and Culture gateway hypothesis and trends in family characteristics such as parent…

  1. 2006 Johnston Site 1A-P (United States)

    US Fish and Wildlife Service, Department of the Interior — Underwater Site 1A-P was established at Johnston Atoll by Dr. James Maragos, U.S. Fish & Wildlife Service, on June 29, 2000. With a start point (meter 0) at...

  2. 2000 Johnston Site 1A-P (United States)

    US Fish and Wildlife Service, Department of the Interior — Underwater Site 1A-P was established at Johnston Atoll by Dr. James Maragos, U.S. Fish & Wildlife Service, on June 29, 2000. With a start point (meter 0) at...

  3. Structuring the AP Art History Course (United States)

    Herscher, Walter R.


    While AP (Advanced Placement) Art History may be taught within the art department in many schools, social studies teachers are equally capable of teaching the course well. They have the historical background to discuss the reasons for changes in art styles. A teacher's preparation is similar to teaching a course stressing political history,…

  4. Conditioning of radium sources in Chile

    International Nuclear Information System (INIS)

    A process experimented in Chile to conditioning Ra-226 sources arising as waste from medical uses in Chile is described. The IAEA offered to participate in the Project for Conditioning Radium Sources in order to place all the radium sources in the country under an internationally accepted standard. These sources hare those that have been used in medical applications for many years. The CCHEN made its own modifications to the project's execution by using its own infrastructure and scientific and technical skill in this field. For this purpose, the CCHEN uses the human resources and facilities of the Radioactive Waste Management Unit (UGDR) and acquires materials that are commercially available in the country. IAEA assistance focused on quality assurance, so they supply all expensive items which the UGDR, cannot access, plus they certify the quality of the conditioned products. This assistance is achieved through the approval of procedures and methodologies based on those that are recommended

  5. Bibliothekswesen in Südamerika - Chile im Jahr 2014


    Schultheis, Alexander H. T.


    Librarianship in South America - Chile in 2014 (translation of the title). The historian and librarian Alexander H.T. Schultheis is living since nine years in Santiago de Chile and he is observing the Chilean librarianship. Although Chile is doing well economically, no improvement can be seen in the field of culture and education. On the contrary, the public libraries are still poorly equipped. Chance can be seen as small bright spots on the horizon, for example, the new opened cultural cente...

  6. Tank 241-AP-106, grab samples, 6AP-96-1 through 6AP-96-3 analytical results for the final report

    Energy Technology Data Exchange (ETDEWEB)

    Esch, R.A., Westinghouse Hanford


    This document is the final report for tank 241-AP-106 grab samples. This document presents the analytical results for three samples (6AP-96-1, 6AP-96-2 and 6AP-96-3) taken from riser 1 @ 150{degrees} of tank 241-AP-1 06 on September 12, 1996. Analyses were performed in accordance with the Compatibility Grab Sampling and Analysis Plan (TSAP) (Sasaki, 1996) and the Data Quality Objectives for Tank Farms Waste Compatibility Program (DQO) (Fowler, 1995).

  7. Movilidad intrageneracional del ingreso en Chile


    Claudio, Sapelli


    This paper estimates the different intra-generational mobility indicators for Chile on the basis of the Casen panel. Conclusions from the literature are evaluated in light of results that are based mainly on a discussion of the transition matrix. It is concluded that there is a mistaken interpretation of the data in part of the literature. A simulation is made that demonstrates that the Chilean transition matrix could be the consequence of random shocks to the effective distribution of income...

  8. Unmarried cohabitation among deprived families in Chile


    Ramm Santelices, Alejandra Margarita


    It is clear that unmarried cohabitation is increasing in Chile. It is less clear what unmarried cohabitation is and why is it rising. In Latin America cohabitation is common among low income groups, and has been described as a surrogate marriage for the disadvantaged. Cohabitation in the region entails conventional gender roles and having children. It has been explained by colonial dominance, poverty, kinship, and machismo. The evidence amassed here indicates that although in practice cohabit...

  9. Registro nuevo de Amphipyrinae en Chile A new record of Amphipyrinae from Chile

    Directory of Open Access Journals (Sweden)

    Tania S. Olivares


    Full Text Available Se registra por primera vez en Chile la especie Agrotisia subhyalina Hampson, entre las latitudes 18° 29' S 70° 20' O hasta 29° 54' S 71° 16' O (I-IV regiones en Chile. Se redescriben los genitales del macho y de la hembra y se presentan algunos aspectos taxonómicos de la especie.The species Agrotisia subhyalina Hampson is recorded for the first time from Chile (18° 29' S 70° 20' W to 29° 54' S 71° 16' W, I to IV Chilean regions. Redescriptions of male and female are presented, along with some taxonomic aspects of the species.

  10. The Clathrin Adaptor AP-1A Mediates Basolateral Polarity


    Gravotta, Diego; Carvajal-Gonzalez, Jose Maria; Mattera, Rafael; Deborde, Sylvie; Banfelder, Jason R.; Bonifacino, Juan S.; Rodriguez-Boulan, Enrique


    Clathrin and the epithelial-specific clathrin adaptor AP-1B mediate basolateral trafficking in epithelia. However, several epithelia lack AP-1B and mice knocked-out for AP-1B are viable, suggesting the existence of additional mechanisms that control basolateral polarity. Here, we demonstrate a distinct role of the ubiquitous clathrin adaptor AP-1A in basolateral protein sorting. Knock-down of AP-1A causes missorting of basolateral proteins in MDCK cells but only after knock-down of AP-1B, sug...

  11. Dynamics of intracellular clathrin/AP1 and clathrin/AP3 containing carriers



    Clathrin/AP1 and clathrin/AP3 coated vesicular carriers originate from endosomes and the TGN. We report here the real-time visualization of these structures in living cells reliably tracked by using rapid, three-dimensional imaging with a spinning-disk confocal microscope. We imaged relatively sparse, diffraction-limited, fluorescent objects containing chimeric fluorescent protein (clathrin light chain, σ adaptor subunits or dynamin2) with a spatial precision of up to ~ 30 nm and a temporal r...

  12. Discovery of new roAp pulsators in the UVES survey of cool magnetic Ap stars

    CERN Document Server

    Kochukhov, O; Ryabchikova, T; Boyko, S; Cunha, M; Tsymbal, V; Weiss, W


    We have carried out a survey of short-period pulsations among a sample of carefully chosen cool Ap stars using time-resolved observations with the UVES spectrometer at the ESO 8-m VLT telescope. Here we report the discovery of pulsations with amplitudes 50-100 m/s and periods 7-12 min in HD132205, HD148593 and HD151860. These objects are therefore established as new rapidly oscillating Ap (roAp) stars. In addition, we independently confirm the presence of pulsations in HD69013, HD96237 and HD143487 and detect, for the first time, radial velocity oscillations in two previously known photometric roAp stars HD119027 and HD185256. At the same time, no pulsation variability is found for HD5823, HD178892 and HD185204. All of the newly discovered roAp stars were previously classified as non-pulsating based on the low-precision ground-based photometric surveys. This shows that such observations cannot be used to reliably distinguish between pulsating and non-pulsating stars and that all cool Ap stars may harbor p-mod...

  13. Comparative analysis between radiographic views for knee osteoarthrosis (bipedal AP versus monopedal AP

    Directory of Open Access Journals (Sweden)

    Rodrigo Pires e Albuquerque


    Full Text Available OBJECTIVE: A comparative analysis by applying the criteria of the original classification Ahlbäck in the anteroposterior (AP bipedal knee in extension and anteroposterior (AP monopodal knee in symptomatic knee arthrosis. With this analysis we intend to observe the agreement, any advantage or difference between the incidence and degree of joint involvement between the orthopedic surgeons and radiologists with the referring physician. METHODS: From January 2012 to March 2012, was a prospective study of 60 symptomatic arthrosis knees (60 patients, clinically selected group of outpatient knee and radiographic proposals submitted to the search. Of the 60 patients, 39 were female and 21 male, mean age 64 years (ranging from 50 to 84 years. Of the 60 knees studied, 37 corresponded to the right side and 23 on the left side. Statistical analysis was performed by Kappa statistics, which evaluates the interobserver agreement for qualitative data. RESULTS: According to the scale of Ahlbäck, there was a significant agreement (p < 0.0001 intra-observer in the classification of knee osteoarthritis among the five evaluators. There was a significant agreement (p < 0.0001 with inter-observer referring physician in the incidence of AP monopodal and AP bipedal for the four raters. CONCLUSION: The study found no difference between the incidence in the AP monopodal versus AP bipedal in osteoarthritis of the knee.

  14. Perú-Chile: imágenes mutuas (Perú-Chile: mutual images

    Directory of Open Access Journals (Sweden)

    Álvaro González Riesle


    Full Text Available RESUMEN: A partir de los enfoques sobe Expansionismo-Revanchismo de Elizondo y las Imágenes en Espejo de Scott, se analizaron los contenidos de blogs referentes a imágenes mutuas entre Perú y Chile, comprendidos a partir de la fecha (16-01-2008 de presentación por parte del Perú de la Demanda ante el Tribunal de la Haya para la solución del Diferendo Limítrofe con Chile, hasta el 30-03-2011. Se han registrado intensas y variadas manifestaciones de hostilidad mutua, que respaldan la vigencia de la dinámica Expansionismo-Revanchismo en las imágenes mutuas entre Chile y Perú en los blogs analizados. Paralelamente, se detectaron contenidos correspondientes a actitudes integracionistas entre ambos países. Los resultados fundamentan la utilidad del enfoque de las Imágenes en Espejo como instrumento para el análisis de contenido de blogs portadores de mensajes de hostilidad e integración entre ambos países. Se propone una estrategia psicosocial binacional para desactivar la dinámica Expansionismo- revanchismo que contribuiría a producir catastróficas consecuencias para las generaciones actuales y futuras de ambos países; y, promover la integración fronteriza entre Tacna (Perú y Arica (Chile. ABSTRACT: The contents of blogs relating to mutual images between Peru and Chile were analyzed from the approaches about Expansionism – Revanchism of Elizondo, and The images on the mirror of Scott, included the date of the presentation (January 16th, 2008 by Peru of the demand before the International Court of Justice at the Hague for the solution of the border dispute with Chile until March 30th, 2011. There have been intense and varied manifestations of mutual hostility that support the validity of Expansionism-Revanchism dynamics in the mutual images between Chile and Peru in the analyzed blogs. At the same time, it was detected content corresponding to integrationist attitudes between the two countries. The results underlie the utility

  15. The AP-1A and AP-1B clathrin adaptor complexes define biochemically and functionally distinct membrane domains


    Fölsch, Heike; Pypaert, Marc; Maday, Sandra; Pelletier, Laurence; Mellman, Ira


    Most epithelial cells contain two AP-1 clathrin adaptor complexes. AP-1A is ubiquitously expressed and involved in transport between the TGN and endosomes. AP-1B is expressed only in epithelia and mediates the polarized targeting of membrane proteins to the basolateral surface. Both AP-1 complexes are heterotetramers and differ only in their 50-kD μ1A or μ1B subunits. Here, we show that AP-1A and AP-1B, together with their respective cargoes, define physically and functionally distinct membra...

  16. Magnetic Doppler Imaging of Ap stars


    Silvester, J.; Wade, G. A.; Kochukhov, O.; Landstreet, J. D.; Bagnulo, S.


    Historically, the magnetic field geometries of the chemically peculiar Ap stars were modelled in the context of a simple dipole field. However, with the acquisition of increasingly sophisticated diagnostic data, it has become clear that the large-scale field topologies exhibit important departures from this simple model. Recently, new high-resolution circular and linear polarisation spectroscopy has even hinted at the presence of strong, small-scale field structures, which were completely une...

  17. APS storage ring vacuum system performance

    International Nuclear Information System (INIS)

    The Advanced Photon Source (APS) storage ring was designed to operated with 7-GeV, 100-mA positron beam with lifetimes > 20 hours. The lifetime is limited by residual gas scattering and Touschek scattering at this time. Photon-stimulated desorption and microwave power in the rf cavities are the main gas loads. Comparison of actual system gas loads and design calculations will be given. In addition, several special features of the storage ring vacuum system will be presented

  18. Cultural Diversity in AP Art History (United States)

    Bolte, Frances R.


    Teaching AP Art History is like running on a treadmill that is moving faster than a teacher can run. Many teachers are out of breath before the end of the term and wonder how in the world they can cover every chapter. Because time is short and art from pre-history through to the present, including the non-European traditions, must be covered, this…

  19. ¿Es Chile un país católico? Polémica en torno a un libro del padre Hurtado

    Directory of Open Access Journals (Sweden)

    P. Pedro Espinosa Santander


    Full Text Available Cuando a fines de 1941 el Padre Alberto Hurtado publicó su libro "¿Es Chile un País Católico?", invitaba especialmente a los jóvenes de la Acción Católica a conocer el país real: ¿cómo era de verdad Chile y su Iglesia? Alberto Hurtado con su mirada de apóstol miró a Chile desde la mirada de Jesús y remeció conciencias e incomodó a muchos con su denuncia de los males que corroían el alma nacional: miseria, injusticias, vicios, salarios miserables, falta de educación del pueblo, viviendas indignas, y junto con esto, la lejanía de los pobres de la Iglesia y la escasez de sacerdotes. Para él había una tarea pendiente que muchos esquivaban: conquistar Chile para Cristo. El libro y la invitación fueron acogidos con gran entusiasmo, por los jóvenes especialmente; pero las cr��ticas arreciaron de parte del clero y laicado conservadores. Para ellos, la visión de Hurtado era peligrosamente amarga y desconocía la labor que la Iglesia, desde la Colonia, hacía en el país formando el "alma de Chile". La polémica de fondo era una sorda crítica a Hurtado, asesor nacional de los jóvenes de la Acción Católica. El artículo muestra la polémica en torno al libro y a su autor, los diferentes actores que intervinieron y la significación eclesial de todo el proceso: ¿Era Chile un país católico?When at the end of 1941 Father Alberto Hurtado Publisher his book, "¿Es Chile un País Católico?" ("Is Chile a Catholic Country?", he especially invited the youth of Catholic Action (Acción Católica to become acquainted with the real country: What was Chile and its Church really like? Alberto Hurtado, with his characteristic view of an apostle, looked upon Chile with the gaze of Jesus and shook consciences, making many people uncomfortable with his condemnation of the evils corroding the national soul: the misery, injustices, vices, paltry salaries, lack of education, undignified living conditions and, together with all this, the


    This project develops emission factors, etc., for residential fireplaces and woodstoves which are incorporated into AP-42. AP42 is a massive collection of material which describes processes which generate air emissions and presents emission factors and control effectiveness infor...

  1. Dicty_cDB: FC-AP07 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP07 (Link to dictyBase) - - - Contig-U15932-1 FC-AP07P (Li...nk to Original site) FC-AP07F 546 FC-AP07Z 446 FC-AP07P 992 - - Show FC-AP07 Library FC (Link to library) Clone ID site URL Representative seq. ID FC-AP...07P (Link to Original site) Representative DNA sequence >FC-AP07 (FC-AP07Q) /CSM/FC/FC-AP/FC-AP...ificant alignments: (bits) Value FC-AP07 (FC-AP07Q) /CSM/FC/FC-AP/FC-AP07Q.Seq.d/ 1148 0.0 SSM404 (SSM404Q)

  2. Dicty_cDB: FC-AP08 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP08 (Link to dictyBase) - - - Contig-U16116-1 FC-AP08P (Li...nk to Original site) FC-AP08F 125 FC-AP08Z 352 FC-AP08P 477 - - Show FC-AP08 Library FC (Link to library) Clone ID site URL Representative seq. ID FC-AP...08P (Link to Original site) Representative DNA sequence >FC-AP08 (FC-AP08Q) /CSM/FC/FC-AP/FC-AP... (VSA612Q) /CSM/VS/VSA6-A/VSA612Q.Seq.d/ 624 e-178 FC-AP08 (FC-AP08Q) /CSM/FC/FC-AP/FC-AP

  3. AP Deployment Research Based on Physical Distance and Channel Isolation


    Dangui Yan; Chengchang Zhang; Honghua Liao; Lisheng Yang; Ping Li; Guogang Yang


    Aiming at the problem of inefficiency of wireless local area networks (WLAN) access point (AP) deployment in urban environment, a new algorithm for AP deployment based on physical distance and channel isolation (DPDCI) is proposed. First, it detects the position information of deployed APs and then calculates the interference penalty factor combined with physical distance and channel isolation, and finally gets the optimal location and channel of the new AP through the genetic algorithm. Comp...

  4. Chile: Una Vision Politica, Economica y Social (Chile: A Political, Economic, and Social View). (United States)

    Cortes-Hwang, Adriana


    This address seeks to explain in brief the historical background and political, economic, and social conditions leading to the democratic election of a Marxist president in Chile. A historical sketch of Chilean government from independence in 1810 is provided with a description of the situation just before Salvador Allende's election in 1969. Some…

  5. The Mass Media and Political Socialization: Chile, 1970-2000 (United States)

    Walter, Amy R.


    This project seeks to determine the effect of the mass media on political attitudes and behaviors in Chile between the years 1970 and 2000. The relationship between the media and "political socialization" is just now gaining recognition in scholarly research, and Chile offers an excellent case study. This paper traces these two variables during…

  6. Chile, Latin America, and the Asia-Pacific Region

    Directory of Open Access Journals (Sweden)

    Manfred Wilhelmy


    Full Text Available Text of a presentation in the Colloquium Chile and the World, organized by the Princeton University Program in Latin American Studies, May 6, 2005, in honor of Professor Paul E.Sigmund. The views expressed have not been reviewed or endorsed by the Chile Pacific Foundation. Manfred Wilhelmy holds a Ph.D. in Politics (1973 from Princeton University

  7. Chile - Institutional Design for an Effective Education Quality Assurance


    World Bank


    The main objective of this report is to present the Government of Chile with policy options related to the institutional distribution of roles and responsibilities for effective quality assurance in education. Following the introduction, the report is structured as follows. Chapter II presents background information on the evolution of Chile's education system since 1980. This information,...

  8. Childcare in Chile. The role of ethnicity and socioeconomic inequalities

    NARCIS (Netherlands)

    Cárcamo Leiva, Rodrigo Alejandro


    Chile has embarked on a road that must lead to the reduction of inequality gaps for the population. A public policy called Chile Growths With You has focused on an increase in the breadth of coverage of non-maternal care through childcare centers to provide equal opportunities in early childhood and

  9. Honors in Chile: New Engagements in the Higher Education System (United States)

    Skewes, Juan Carlos; Sampaio, Carlos Alberto Cioce; Conway, Frederick J.


    Honors programs are rare in Latin America, and in Chile they were unknown before 2003. At the Universidad Austral de Chile, an interdisciplinary group of scholars linked to environmental studies put forward a pilot project for implementing a new experience in higher education. Challenged by an educational environment where (i) apathy and…

  10. Critical Perspectives on Adolescent Vocational Guidance in Chile (United States)

    McWhirter, Ellen Hawley; McWhirter, Benedict T.


    In this article, the lens of critical psychology is applied to adolescent career development and vocational guidance in Chile. The authors describe and critique the status of adolescent vocational guidance in Chile, the reproduction of extant social inequities in Chilean education, and offer recommendations for enhancing vocational guidance…

  11. Pharmakologische Charakterisierung der vasoaktiven Eigenschaften von Ap7A und Ap8A an der isolierten perfundierten Rattenniere


    Blaschke, Daniela


    Recently, diadenosine heptaphosphate and diadenosine octaphosphate have been isolated in human platelets. With thrombin-induced platelet aggregation, Ap7A and Ap8A are released from the platelets into the extracellular space. Like other dinucleoside polyphosphates, maybe they play an important role in the control of vascular tone and platelet aggregation. Here we describe the effects on regulation of vascular tone of Ap7A and Ap8A in isolated perfused rat kidney. Our experiments demonstrate t...

  12. China and Chile Are to Be Free-Trade Partners

    Institute of Scientific and Technical Information of China (English)


    @@ In line with the words "We hope that Chile's Next Partner is China", Chile is believed to choose China as the new negotiation party of Free Trade Agreements after signing respectively free trade agreements with Canada, the United States, EU and ROK. On January 24, Chile's trade delegation composed of 20 members led by Kaiross Feirch, the Head of economy general department of the Ministry of Foreign Affairs paid the first visit to China to launch first five-day round of mutual trade negotiation.Kaiross Feirch, the Head of economy general department of the Ministry of Foreign Affairs of Chile and Barbirlo Kafuleirla, Chile's Ambassador to China received special visit of reporters about this round.

  13. Dicty_cDB: FC-AP01 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP01 (Link to dictyBase) - - - Contig-U15092-1 FC-AP01Z (Li...nk to Original site) - - FC-AP01Z 591 - - - - Show FC-AP01 Library FC (Link to library) Clone ID FC-AP01 (Li.../ Representative seq. ID FC-AP...01Z (Link to Original site) Representative DNA sequence >FC-AP01 (FC-AP01Q) /CSM/FC/FC-AP/FC-AP01Q.Seq....EELNISGPLSRNKLKWADFLNLTMNTNHARG HRHGRSPSKIFWRAVRGMLPHKTPRGQAALDNMKVFEGVPAPYDKVKRVVVPSALRVVKL NTTRKYTVLSRLSQE

  14. Dicty_cDB: FC-AP10 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP10 (Link to dictyBase) - - - Contig-U15819-1 FC-AP10Z (Li...nk to Original site) - - FC-AP10Z 497 - - - - Show FC-AP10 Library FC (Link to library) Clone ID FC-AP10 (Li.../ Representative seq. ID FC-AP...10Z (Link to Original site) Representative DNA sequence >FC-AP10 (FC-AP10Q) /CSM/FC/FC-AP/FC-AP10Q.Seq....SGDWWDAELKGRRGKVPSNYLQLIKNAAPPRAGGPPVPTGNRA PTTTTTSGGSTRGGFNNGPSTAPSGRGAAPPSSRGGMAPRGGSVAPPSSRGGIAPRGGIA PRGGMAPRGGMAP

  15. 77 FR 24480 - Application for New Awards; Advanced Placement (AP) Test Fee Program-Reopening the AP Test Fee... (United States)


    .... ACTION: Notice reopening the AP Test Fee fiscal year 2012 competition. Catalog of Federal Domestic Assistance (CFDA) Number: 84.330B. SUMMARY: On February 15, 2012, we published in the Federal Register (77 FR... Application for New Awards; Advanced Placement (AP) Test Fee Program--Reopening the AP Test Fee Fiscal...

  16. Chile's pension reform after twenty years


    Acuna R., Rodrigo; Iglesias P., Augusto


    The aim of this paper is to describe the 1980 Chilean pension reform and to present its main results and economic impact. It is mainly descriptive; however we have tried to emphasize the lessons that may be learned and that may be of interest to other countries in different circumstances. In particular, we focus on potential areas for regulatory improvements. In Section II, a brief description of the AFP system and its place within Chile's social security system is presented. Also, the main c...

  17. Financiamiento de la vivienda en Chile


    Morandé, Felipe G.; Garcia, Carlos


    El financiamiento a la vivienda en Chile ha alcanzado en los últimos 20 años un grado de desarrollo muy importante. Para esto ha sido fundamental: a) la eliminación del efecto de la inflación sobre el valor de las deudas de largo plazo, primero, mediante el desarrollo de una unidad de cuenta indexada a la inflación creíble y transparente (la UF), y posteriormente, con el abatimiento de la inflación como fenómeno macroeconómico; b) la reforma provisional de comienzos de los años 80, que fue cl...

  18. Chile Successfully Halts Rise in Childhood Obesity

    International Nuclear Information System (INIS)

    The increasing prevalence of childhood obesity in Latin America has become a cause for concern. The IAEA has worked closely with the Institute of Nutrition and Food Technology (INTA) at the University of Chile since 1997 to address the problem of malnutrition in the country. In Santiago, the Laboratory of Energy Metabolism and Stable Isotopes was established in 1998 with the help of the IAEA to provide an isotope ratio mass spectrometer and training in the use of stable isotope techniques to assess body composition, infant feeding practices and total daily energy expenditure

  19. La atencion preescolar en Chile: desafios para la redemocratizacion (Preschool Care in Chile: Challenges for Redemocratization. Discussion Paper No. 13). (United States)

    Filp, Johanna; Undurrage, Consuelo

    This paper examines the current status of programs for preschool children in Chile. Section 1 of the paper provides an overview of the situation of preschool children in Chile. The country's population includes more than 1.6 million children between the ages of 0 and 5 years 11 months, and in urban areas, 18.4 percent of children between the ages…

  20. 75 FR 10846 - The Chile Fund, Inc., et al.; Notice of Application (United States)


    ... COMMISSION The Chile Fund, Inc., et al.; Notice of Application March 2, 2010. AGENCY: Securities and Exchange.... Applicants: The Chile Fund, Inc. (``Chile Fund''), Aberdeen Australia Equity Fund (``Australia Fund,'' together with the Chile Fund, the ``Current Funds''), Aberdeen Asset Management Asia Limited...

  1. AP600 containment purge radiological analysis

    Energy Technology Data Exchange (ETDEWEB)

    O`Connor, M.; Schulz, J.; Tan, C. [Bechtel Power Corporation (United States)] [and others


    The AP600 Project is a passive pressurized water reactor power plant which is part of the Design Certification and First-of-a-Kind Engineering effort under the Advanced Light Water Reactor program. Included in this process is the design of the containment air filtration system which will be the subject of this paper. We will compare the practice used by previous plants with the AP600 approach to meet the goals of industry standards in sizing the containment air filtration system. The radiological aspects of design are of primary significance and will be the focus of this paper. The AP600 Project optimized the design to combine the functions of the high volumetric flow rate, low volumetric flow rate, and containment cleanup and other filtration systems into one multi-functional system. This achieves a more simplified, standardized, and lower cost design. Studies were performed to determine the possible concentrations of radioactive material in the containment atmosphere and the effectiveness of the purge system to keep concentrations within 10CFR20 limits and within offsite dose objectives. The concentrations were determined for various reactor coolant system leakage rates and containment purge modes of operation. The resultant concentrations were used to determine the containment accessibility during various stages of normal plant operation including refueling. The results of the parametric studies indicate that a dual train purge system with a capacity of 4,000 cfm per train is more than adequate to control the airborne radioactivity levels inside containment during normal plant operation and refueling, and satisfies the goals of ANSI/ANS-56.6-1986 and limits the amount of radioactive material released to the environment per ANSI/ANS 59.2-1985 to provide a safe environment for plant personnel and offsite residents.

  2. Proactive AP Selection Method Considering the Radio Interference Environment (United States)

    Taenaka, Yuzo; Kashihara, Shigeru; Tsukamoto, Kazuya; Yamaguchi, Suguru; Oie, Yuji

    In the near future, wireless local area networks (WLANs) will overlap to provide continuous coverage over a wide area. In such ubiquitous WLANs, a mobile node (MN) moving freely between multiple access points (APs) requires not only permanent access to the Internet but also continuous communication quality during handover. In order to satisfy these requirements, an MN needs to (1) select an AP with better performance and (2) execute a handover seamlessly. To satisfy requirement (2), we proposed a seamless handover method in a previous study. Moreover, in order to achieve (1), the Received Signal Strength Indicator (RSSI) is usually employed to measure wireless link quality in a WLAN system. However, in a real environment, especially if APs are densely situated, it is difficult to always select an AP with better performance based on only the RSSI. This is because the RSSI alone cannot detect the degradation of communication quality due to radio interference. Moreover, it is important that AP selection is completed only on an MN, because we can assume that, in ubiquitous WLANs, various organizations or operators will manage APs. Hence, we cannot modify the APs for AP selection. To overcome these difficulties, in the present paper, we propose and implement a proactive AP selection method considering wireless link condition based on the number of frame retransmissions in addition to the RSSI. In the evaluation, we show that the proposed AP selection method can appropriately select an AP with good wireless link quality, i.e., high RSSI and low radio interference.

  3. Ozone mitigation tests at the APS

    Energy Technology Data Exchange (ETDEWEB)

    Kuzay, T.M.; Collins, J.T.; Pisharody, M.; Job, P.K.; Wang Zhibi


    Ozone is generated in the APS experimental stations whenever the x-ray beam has a chance to interact with air. Ozone concentrations in an experimental station have to be below a certain defined limit (current OSHA regulations specify 0.08 ppm as the maximum limit) before an experimenter can reenter the hutch. This limit is said to be currently under study for a downward adjustment. One method of depleting the ozone generated in an experimental station is mitigation through either adsorption or direct destruction. In recent tests, both methods were tried using commercially available units. Test results and some analytical predictions are presented.

  4. Wiley AP english language and composition

    CERN Document Server

    Woods, Geraldine


    Two full-length practice tests to help you score your highest Review questions with complete answers and explanations for the most popular themes on the test Study strategies and expert test-taking tips to keep you calm and focused on test day Review key exam topics and themes to maximize your score Preparing for the AP English Language and Composition test? This test-prep guide helps you perfect the skills you need to achieve your best possible score. You'll find winning test-taking tips, multiple-choice strategies, and essay guidelines, as well as great advice on getting the

  5. Path Deviation Equations in AP-Geometry

    CERN Document Server

    Wanas, M I


    Recently, it has been shown that Absolute Parallelism (AP) geometry admits paths that are naturally quantized. These paths have been used to describe the motion of spinning particles in a background gravitational field. In case of a weak static gravitational field limits, the paths are applied successfully to interpret the discrepancy in the motion of thermal neutrons in the Earth's gravitational field (COW-experiment). The aim of the present work is to explore the properties of the deviation equations corresponding to these paths. In the present work the deviation equations are derived and compared to the geodesic deviation equation of the Riemannian geometry.

  6. [Reflections about the historical development of biomedical sciences in Chile and the role of Revista Médica de Chile: an homage on 130-years old]. (United States)

    Vargas Fernández, Luis


    When Revista Médica de Chile turns to be 130 years old, the author reflects about the difficulties that scientific and technological creativity faces in Chile, considering that there was a 70 years gap between its historical origin in Chile compared to developed countries. The scientific progress erases the boundaries between Biomedicine and science and technology. This progress has resulted in an improvement in the quality of scientific publications in Revista Medica de Chile. The editorial work has also contributed to this improvement. Revista Medica de Chile has obtained international recognition and stands in a good position as a medical journal in Latin America and Chile.

  7. Contributions to the mammalogy of Chile (United States)

    Pine, Ronald H.; Miller, Sterling D.; Schamberger, Mel L.


    Collections of mammals were made during more than three years of biological investigations in Chile sponsored by the Corporación Nacional Forestal under the aegis of the Peace Corps (Smithsonian Environmental Program). Genera and species hitherto unreported for that country were taken and many useful data concerning distributional patterns of other (mostly little-known) species were gathered. These collections have also proved valuable in better understanding Chilean mammals from a taxonomic point of view and contribute knowledge of the species' natural history. Specimens are to be deposited in the (United States) National Museum of Natural History (USNM) or are to be retained by the Corporación Nacional Forestal, Avda, Bulnes 285, Depto. 401, Santiago. Numbers provided below are field numbers. A final division of specimens between the two institutions has not yet been made. A number of specimens reported here were not taken by Peace Corps personnel but have been obtained by the National Museum of Natural History from other sources. Specimens in the Field Museum of Natural History (FMNH) were used in making comparisons. Some of Fulk's (GWF) specimens are at Texas Tech University. Other are at the Servicio Agricola y Ganadero in Santiago (as are specimens of some introduced species taken by Schamberger). Reise's (DF) are at the Universidad de Chile-Concepción and in his personal collection.

  8. SN 2005ap: A Most Brilliant Explosion

    CERN Document Server

    Quimby, Robert M; Wheeler, J Craig; Höflich, Peter; Akerlof, Carl W; Rykoff, Eli S


    We present unfiltered photometric observations with ROTSE-III and optical spectroscopic follow-up with the HET and Keck of the most luminous supernova yet identified, SN 2005ap. The spectra taken about 3 days before and 6 days after maximum light show narrow emission lines (likely originating in the dwarf host) and absorption lines at a redshift of z=0.2832, which puts the peak unfiltered magnitude at -22.7 +/- 0.1 absolute. Broad P-Cygni features corresponding to H-alpha, CIII, NIII, and OIII, are further detected with a photospheric velocity of ~20,000 km/s. Unlike other highly luminous supernovae such as 2006gy and 2006tf that show slow photometric evolution, the light curve of SN 2005ap indicates a 1-3 week rise to peak followed by a relatively rapid decay. The spectra also lack the distinct emission peaks from moderately broadened (FWHM ~ 2,000 km/s) Balmer lines seen in SN 2006gy and SN 2006tf. We briefly discuss the origin of the extraordinary luminosity from a strong interaction as may be expected fro...

  9. APS insertion devices: Recent developments and results

    International Nuclear Information System (INIS)

    The Advanced Photon Source (APS) now has a total of 23 insertion devices (IDs). Over two-thirds of them are installed on the storage ring. The installed devices include 18, 27 and 55 mm-period undulators; an 85 mm-period wiggler; a 16 cm-period elliptical multipole wiggler; and many 33 mm-period undulators. Most of the IDs occupy storage-ring straight sections equipped with 8 mm vertical-aperture vacuum chambers. All of the IDs were measured magnetically at the APS and, in most cases, underwent a final magnetic tuning in order to minimize variation in the various integrals of the field through the ID over the full gap range. Special shimming techniques to correct magnetic field parameters in appropriate gap-dependent ways were developed and applied. Measurements of the closed-orbit distortion as a function of the ID gap variation have been completed, and results are in a good agreement with magnetic measurements. Spectral diagnostics of the ID radiation, including measurements of the absolute spectral flux, brilliance and polarization, show excellent agreement between calculated and measured results. Studies of the sensitivity of IDs to radiation exposure and measurements of the dose rate received by the IDs are in progress

  10. ESO and Chile: 10 Years of Productive Scientific Collaboration (United States)


    ESO and the Government of Chile launched today the book "10 Years Exploring the Universe", written by the beneficiaries of the ESO-Chile Joint Committee. This annual fund provides grants for individual Chilean scientists, research infrastructures, scientific congresses, workshops for science teachers and astronomy outreach programmes for the public. In a ceremony held in Santiago on 19 June 2006, the European Organisation for Astronomical Research in the Southern Hemisphere (ESO) and the Chilean Ministry of Foreign Affairs marked the 10th Anniversary of the Supplementary Agreement, which granted to Chilean astronomers up to 10 percent of the total observing time on ESO telescopes. This agreement also established an annual fund for the development of astronomy, managed by the so-called "ESO-Chile Joint Committee". ESO PR Photo 21/06 ESO PR Photo 21/06 Ten Years ESO-Chile Agreement Ceremony The celebration event was hosted by ESO Director General, Dr. Catherine Cesarsky, and the Director of Special Policy for the Chilean Ministry of Foreign Affairs, Ambassador Luis Winter. "ESO's commitment is, and always will be, to promote astronomy and scientific knowledge in the country hosting our observatories", said ESO Director General, Dr. Catherine Cesarsky. "We hope Chile and Europe will continue with great achievements in this fascinating joint adventure, the exploration of the universe." On behalf of the Government of Chile, Ambassador Luis Winter outlined the historical importance of the Supplementary Agreement, ratified by the Chilean Congress in 1996. "Such is the magnitude of ESO-Chile Joint Committee that, only in 2005, this annual fund represented 8 percent of all financing sources for Chilean astronomy, including those from Government and universities", Ambassador Winter said. The ESO Representative and Head of Science in Chile, Dr. Felix Mirabel, and the appointed Chilean astronomer for the ESO-Chile Joint Committee, Dr. Leonardo Bronfman, also took part in the

  11. Dicty_cDB: FC-AP24 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP24 (Link to dictyBase) - - - Contig-U16528-1 FC-AP24F (Li...nk to Original site) FC-AP24F 525 - - - - - - Show FC-AP24 Library FC (Link to library) Clone ID FC-AP24 (Li.../ Representative seq. ID FC-AP...24F (Link to Original site) Representative DNA sequence >FC-AP24 (FC-AP24Q) /CSM/FC/FC-AP/FC-AP24Q.Seq....C-BE24Q.Seq.d/ 1041 0.0 FC-AP24 (FC-AP24Q) /CSM/FC/FC-AP/FC-AP24Q.Seq.d/ 1041 0.0

  12. Dicty_cDB: FC-AP21 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP21 (Link to dictyBase) - - - Contig-U15099-1 FC-AP21Z (Li...nk to Original site) - - FC-AP21Z 511 - - - - Show FC-AP21 Library FC (Link to library) Clone ID FC-AP21 (Li.../ Representative seq. ID FC-AP...21Z (Link to Original site) Representative DNA sequence >FC-AP21 (FC-AP21Q) /CSM/FC/FC-AP/FC-AP21Q.Seq....14Q.Seq.d/ 1013 0.0 SLE553 (SLE553Q) /CSM/SL/SLE5-C/SLE553Q.Seq.d/ 1013 0.0 FC-AP21 (FC-AP21Q) /CSM/FC/FC-AP/FC-AP

  13. Dicty_cDB: FC-AP22 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP22 (Link to dictyBase) - G24045 DDB0232387 Contig-U15141-1 FC-AP...22F (Link to Original site) FC-AP22F 317 - - - - - - Show FC-AP22 Library FC (Link to library) Clone ID FC-AP...1-1 Original site URL Representative seq. ID FC-AP22F (Link to Original site) Representative DNA sequence >FC-AP22 (FC-AP22Q) /CSM/FC/FC-AP/FC-AP...KKKKKKK Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-AP22 (FC-AP22Q) /CSM/FC/FC-AP/FC-AP

  14. El Parque Portal Bicentenario en Santiago de Chile / Portal Bicentennial Park in Santiago de Chile

    Directory of Open Access Journals (Sweden)

    Beach Lobos, Myriam;


    Full Text Available Se presenta los principios que orientaron el diseño del Parque Portal Bicentenario, un parque de 50 hás. que será el eje principal de la nueva urbanización “Ciudad Parque Bicentenario”, actualmente en construcción en los terrenos del ex aeropuerto de Los Cerrillos en Santiago de Chile.The following text was submitted to the Architecture Competition together with the project drawings. It presents the principles that leaded the design. The 123 acres park will be the main axis of a new urban development in Santiago “Ciudad Parque Bicentenario” at present under construction on the area occupied by the former Cerrillos Airport, Santiago de Chile.





    This case gives an overview of the Coca-Cola System in Chile and focuses on the Coca-Cola Chile Foundation (CCFCH), a non-profit organization dedicated to education. Created in 1992 with donations from Coca-Cola de Chile S.A. (CCCH) and the bottling companies Embotelladora Andina S.A., Coca-Cola Embonor S.A. and Coca-Cola Polar S.A., the foundation now faces an expansion dilemma in its most important program, the TAVEC Laboratories. Under this program the CCFCH donated interactive scientific ...

  16. [Ecology and health in Chile: present and future development]. (United States)

    Oyarzún, M


    In response to the progressive environmental deterioration, the Ecological Society of America has made a proposal, called "Sustainable Biosphere Initiative", to do research, teaching and decision making processes on biodiversity, global change and the effects of human activities on environment. The goal of appropriate environmental protection and welfare for mankind includes health and quality of life. Presently, Chile faces a number of environmental problems such as pollution, excessive urban growth, loss of agricultural areas, disposal of solid waste and species extinction. The lack of education and information in Chile, on these problems, is worrisome. The role of universities to overcome this deficit should be crucial in the future sustainable development of Chile.

  17. Alleviating extreme poverty in Chile: The short term effects of Chile Solidario


    Galasso, Emanuela


    This paper evaluates the effect of an anti-poverty program, Chile Solidario, during its first two years of operation. We find that the program tends to increases significantly their take-up of cash assistance programs and of social programs for housing and employment, and to improve education and health outcomes for participating households. There is no evidence that the participation to employment program translates into improved employment or income outcomes in the short term. Finally, we p...

  18. LA NOVELA DE LA DICTADURA EN CHILE The novel of the dictatorship's period in Chile

    Directory of Open Access Journals (Sweden)

    Mario Lulo C


    Full Text Available Para un sector de la crítica y de la academia chilena, la gran novela de la Dictadura es una asignatura pendiente. En este artículo se problematiza este tema mediante la formulación de una hipótesis según la cual una serie de novelas aparecidas en Chile entre 1977 y 2006 cumplen con la función de narrar -desde su fragmentariedad- las causas y consecuencias del 11 de septiembre de 1973. Así, busca plantear las bases epistemológicas e históricas que posibiliten llevar a cabo una investigación de mayor alcance acerca del problema del papel de la novela durante y después de la Dictadura.For many critics and scholars the great novel of the dictatorship's period in Chile still remains a pending matter. This article, on the contrary, hypothesizes on the existence of a significant number of novéis published in Chile between 1977 and 2006, which out of their fragmentary character and peculiarity give a proper account of the causes and consequences of the coup d'état held on September llth 1973. The article seeks to set a preliminary basis for an epistemological discussion and further major research about the role of the Chilean novel, in the historical context of post modernity, during and after the dictatorship's era.

  19. Dicty_cDB: FC-AP13 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP13 (Link to dictyBase) - - - Contig-U15374-1 FC-AP13P (Li...nk to Original site) FC-AP13F 550 FC-AP13Z 184 FC-AP13P 734 - - Show FC-AP13 Library FC (Link to library) Clone ID site URL Representative seq. ID FC-AP...13P (Link to Original site) Representative DNA sequence >FC-AP13 (FC-AP13Q) /CSM/FC/FC-AP/FC-AP...KKRKLNILIIII*fnnhqvmekkikkkiknkkn f*k Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-AP


    Directory of Open Access Journals (Sweden)

    Pablo Contreras V.


    Full Text Available El autor analiza el problema de constitucionalidad de las leyes secretas en Chile, en razón de las modificaciones introducidas a la Constitución en el 2005. Primero, describe brevemente el fundamento sobre la publicidad de la ley en el Estado Democrático. Luego, se analiza el nuevo principio constitucional de publicidad establecido en el artículo 8º de la Constitución. Adicionalmente, se examina la constitucionalidad de las leyes secretas desde dos puntos de vista: confrontando la compatibilidad con el principio general de transparencia -como base de la institucionalidad- y analizando la afectación en el contenido esencial del derecho fundamental de acceso a la información pública.

  1. Epidemiology of Vibrio parahaemolyticus outbreaks, southern Chile. (United States)

    Harth, Erika; Matsuda, Luis; Hernández, Cristina; Rioseco, Maria L; Romero, Jaime; González-Escalona, Narjol; Martínez-Urtaza, Jaime; Espejo, Romilio T


    Disease outbreaks caused by Vibrio parahaemolyticus in Puerto Montt, Chile, began in 2004 and reached a peak in 2005 at 3,600 clinical cases. Until 2006, every analyzed case was caused by the serovar O3:K6 pandemic strain. In the summer of 2007, only 475 cases were reported; 73% corresponded to the pandemic strain. This decrease was associated with a change in serotype of many pandemic isolates to O3:K59 and the emergence of new clinical strains. One of these strains, associated with 11% of the cases, was genotypically different from the pandemic strain but contained genes that were identical to those found on its pathogenicity island. These findings suggest that pathogenicity-related genes were laterally transferred from the pandemic strain to one of the different V. parahaemolyticus groups comprising the diverse and shifting bacterial population in shellfish in this region. PMID:19193258

  2. Privatization And Vouchers In Colombia And Chile (United States)

    Arenas, Alberto


    The voucher model of financing schooling is becoming increasingly common throughout Latin America, with at least 12 countries using vouchers or voucher-like schemes. The present study focuses on the voucher models of Colombia and Chile, which have the most extensive programs of this type and those of the longest standing in the region. Using empirical evidence, the author compares the two models along four evaluative dimensions: educational quality, segregation, choice and socialization. After weighing the successes and weaknesses of each system, he concludes that, among other characteristics, the most effective and equitable voucher model features: (a) a flexible interpretation of educational quality; (b) financial grants which target solely the poor; (c) vouchers which cover the entire cost of tuition; (d) open enrolment at participating schools; (e) the participation of both secular and religious private schools; (f) accessible and meaningful information to parents; and (g) strong systems of accountability.

  3. Three halls for music performance in Chile (United States)

    Delannoy, Jaime; Heuffemann, Carolina; Ramirez, Daniel; Galvez, Fernando


    The primary purpose of this work was to investigate about the present acoustic conditions of used architectonic spaces in Santiago of Chile for orchestras of classic music performance. The studied halls were three: Aula Magna Universidad de Santiago, Teatro Municipal de Nunoa, and Teatro Baquedano. The used methodology was based on studies made by L. Beranek, M. Barron, among others, in concert halls worldwide. As it guides, for the measurement procedure, physical parameters RT, EDT, C50, C80, LF, BR, G, U50 were evaluated according to norm ISO 3382. On the other hand, it has been defined, to proposal way, a questionnaire of subjective valuation directed to musicians, specialized conductors, and listeners.


    CERN Multimedia


    Aerial clip (shot using a drone and a Go pro) describing ESO's astronomical observatory facilities in the Atacama desert, Northern Chile. Locations covered by the drone flight include Cerro Paranal, with the Residencia (external and internal views) and the Very Large Telescope facility on Cerro Paranal, from above and with a peek into Unit Telescope 1 and its 8,2 m diameter mirror; final image on Cerro Armazones, the site chosen for building ESO's next telescope, the E-ELT (European Extremely Large Telescope). With a 39-metre main mirror, it will be the largest optical/near-infrared telescope in the world. The Argentinian Codillera with the Llullaillaco volcano are visible in the background.

  5. Improving the effectiveness of rural development policy in Chile

    NARCIS (Netherlands)

    Carter Leal, L.M.


    In Chile, agriculture remains a key economic factor for rural development. Accordingly, the Chilean government, through the Agricultural Development Institute (INDAP), provides financial support for fostering entrepreneurship among small farmers to enable them to become more competitive in global ma

  6. Market analysis of APS/SCM applications and technologies


    Prášil, Zdeněk


    The bachelor thesis aims to describe a current worldwide market of APS/SCM technologies and applications , i.e. advanced planned scheduling /supply chain management. In the first part, the APS/SCM is described in theory. The APS/SCM is defined and its benefits and impacts on company are discussed. The next part of the work is focused on the market with APS/SCM and the distribution of forces in the market. The demand and supply of this market segment is analyzed. In the last part, solutions of...

  7. Genetic differentiation between 'Araucana' creole and 'Hampshire Down' sheeps in Chile

    Directory of Open Access Journals (Sweden)

    Silvana Bravo


    Full Text Available Genetic diversity studies in domestic animals allow evaluating genetic variation within and among breeds mainly for conservation purposes. In Chile exist isolated recovery programs, conservation and characterization of animal genetic resources, a consequence of which the vast majority of them have not been characterized, poorly used, and some of them have become extinct. The aim of this research was to determine genetic diversity and relationship between 'Araucana' creole and 'Hampshire Down' sheeps based on microsatellite markers; sheep breeds with similar phenotypic characteristics, raised in the south of Chile. A total of 64 'Araucana' sheep ('Araucana' from Freire, AF: 27, 'Araucana' from Padre Las Casas, AP: 10, 'Araucana' from Chol Chol, AC: 15, 'Araucana' from Villarrica, AV: 12 and 43 'Hampshire Down' sheep ('Hampshire' from Marchigue, HM: 18, 'Hampshire' from Valdivia, HV: 11, 'Hampshire' from San José, HS: 14 were analyzed using 17 microsatellite markers for determine the genetic diversity and relationship between breeds. A total of 284 alleles were observed with average polymorphic information content equal to 0.76, showing that the microsatellites panel used was highly informative. Estimated heterozygosity ranged from 0.73 in 'Hampshire Down' to 0.85 in 'Araucana'. The low inbreeding or endogamy coefficient (F IS, 0.022 and total inbreeding estimate (F IT, 0.070 indicated low level of inbreeding within and among breeds. The phylogenetic tree showed a separation between HS and HV, and the other sheep populations. The results indicated high genetic variability, low inbreeding, and low genetic differentiation, except for HV and HS, and were in according with geographical location and breeding practices.

  8. Project W-211, initial tank retrieval systems, description of operations for 241-AP-102 and 241-AP-104

    Energy Technology Data Exchange (ETDEWEB)

    RIECK, C.A.


    The primary purpose of the Initial Tank Retrieval Systems (ITRS) is to provide systems for retrieval of radioactive wastes stored in underground double-shell tanks (DSTS) for transfer to alternate storage, evaporation, pretreatment or treatment, while concurrently reducing risks associated with safety watch list and other DSTs. This Description of Operations (DOO) defines the control philosophy for the waste retrieval system for tanks 241-AP-102 (AP-102) and 241-AP-104 (AP-104). This DOO will provide a basis for the detailed design of the Retrieval Control System (RCS) for AP-102 and AP-104 and establishes test criteria for the RCS. The test criteria will be used during qualification testing and acceptance testing to verify operability.

  9. AP1000主系统先进性分析%The Progressiveness Analysis of the AP1000 Main System

    Institute of Scientific and Technical Information of China (English)



      本文总结了第三代先进非能动压水堆核电厂AP1000主系统的主要特点,对AP1000主系统的先进性进行了分析,核电厂主系统设计人员能够从该文中了解到 AP1000主系统与第二代核电厂主系统之间的差别。%  This paper summarizes the main features of the AP1000 main system of the third generation of advanced passive pressurized water reactor nuclear power plant , and analyzes the progressiveness of the AP1000 main system .From this paper, the main system designers of nuclear power factory can learn the difference between the second-generation nuclear power factory main system and AP1000 main system

  10. Research training in dental undergraduate curriculum in Chile.


    Ximena Moreno


    ABSTRACT Research plays a central role in professional training in dentistry. There is a clear recommendation to include a minimum training in biomedical research at undergraduate level. In Chile, there is no standardized curriculum structure including research training for undergraduate students. Objective: To describe the presence of research courses in the undergraduate dental curriculum in Chile during 2014. Methodology: A descriptive cross-sectional study. The curriculum for all Chilean...

  11. Beyond Income: A Study of Multidimensional Poverty in Chile


    Bronfman, Javier


    Using the latest nationally representative household survey for Chile, this paper empirically assesses multidimensional poverty both at the national and subnational level. Based on the Alkire-Foster method and focusing on four dimensions of well-being –education, health, income and living standard– this study estimates the level and depth of multidimensional poverty for Chile in 2011. At national level, the results show that fewer individuals are subject to multidimensional poverty compared t...

  12. Hippidion saldiasi Roth, 1899 (Mammalia, Perissodactyla en el Pleistoceno tardío de Calama, norte de Chile Late Pleistocene Hippidion saldiasi Roth, 1899 (Mammalia, Perissodactyla from Calama, northern Chile

    Directory of Open Access Journals (Sweden)



    Full Text Available Se describen restos del género Hippidion procedentes de la zona del desierto de Atacama (Calama, Segunda Región de Chile. El conjunto analizado corresponde a un esqueleto bastante completo proveniente del yacimiento Betecsa 1, así como escasas unidades del yacimiento Kamac Mayu. En ambos sitios se identifica H. saldiasi. A partir de dos dataciones radiométricas por AMS del ejemplar estudiado, los restos se sitúan estratigráficamente en el Pleistoceno Superior (21.070 ± 100 AP y 21.380 ± 100 14C AP. Se infieren datos ambientales y de dieta a partir de análisis de isótopos estables en los restos de Hippidion saldiasi del sitio Betecsa 1 cuyo valor de δ13C en hueso fue de -15,45 y el valor en esmalte de dientes fue de -16,68, sugiriendo una alimentación con pastos C3. El cráneo recuperado es el primero conocido de esta especieThis paper describes the Hippidion bones recovered from the Atacama Desert (Calama, Second Region of Chile. The analyzed assemblage corresponds to a nearly complete skeleton from Betecsa 1 site and more poorly preserved remains from Kamac Mayu site. In both H. saldiasi is identified. Two 14C radiometric determinations indicate late Pleistocene age for these remains (21,070 ± 100 BP and 21,380 ± 100 BP. Environmental and diet inferences from stable isotope analysis are also presented. The δ13C value from Betecsa 1 horses (-15.45 from bone sample and -16.68 from enamel sample suggest a dietary adaptation exclusively C3 feeders. This is the first skull and associated skeleton recovered of this species

  13. Genome-Wide Identification of the Target Genes of AP2-O, a Plasmodium AP2-Family Transcription Factor.

    Directory of Open Access Journals (Sweden)

    Izumi Kaneko


    Full Text Available Stage-specific transcription is a fundamental biological process in the life cycle of the Plasmodium parasite. Proteins containing the AP2 DNA-binding domain are responsible for stage-specific transcriptional regulation and belong to the only known family of transcription factors in Plasmodium parasites. Comprehensive identification of their target genes will advance our understanding of the molecular basis of stage-specific transcriptional regulation and stage-specific parasite development. AP2-O is an AP2 family transcription factor that is expressed in the mosquito midgut-invading stage, called the ookinete, and is essential for normal morphogenesis of this stage. In this study, we identified the genome-wide target genes of AP2-O by chromatin immunoprecipitation-sequencing and elucidate how this AP2 family transcription factor contributes to the formation of this motile stage. The analysis revealed that AP2-O binds specifically to the upstream genomic regions of more than 500 genes, suggesting that approximately 10% of the parasite genome is directly regulated by AP2-O. These genes are involved in distinct biological processes such as morphogenesis, locomotion, midgut penetration, protection against mosquito immunity and preparation for subsequent oocyst development. This direct and global regulation by AP2-O provides a model for gene regulation in Plasmodium parasites and may explain how these parasites manage to control their complex life cycle using a small number of sequence-specific AP2 transcription factors.

  14. Residual radiation studies at AP0

    Energy Technology Data Exchange (ETDEWEB)

    Alexander J Elwyn et al.


    The radiation environment at the NuMI experiment has received a lot of attention in the last few years in preparation for project construction. One important issue is the induced radioactivation of the components in the beam line and the shielding materials. This arises from irradiation by hadrons that are generated in the target. Since the level of the residual activity has to be considered when determining access procedures for maintenance during NuMI operation, an understanding of the properties of the remnant radiation is important. To this end, experimental studies were performed in the target vault at AP0 which is similar in design to the NuMI target area. Here 120 GeV protons bombard a target, generating the hadrons that produce the induced radioactivity. Two sets of samples each consisting of three small cylindrical or rectangular solids of iron and steel, one sample of aluminum, and one of concrete were irradiated. One set was hung just below the bottom of a module near the lithium lens (in-vault), and the other was placed on top of the modules downstream of this location (above-vault), just beneath the movable concrete roof of the vault at AP0. Further, four thin activation foils of Au, Au+Cd, In, and Al (along with small disks of the same iron, aluminum, and concrete samples discussed above) were mounted on four 10.2 cm diameter Al disks, one placed on the in-vault module and three at above-vault downstream locations as well. The radioactivity of all these materials on the 10.2 cm Al disks was determined at the Radioisotope Analysis Facility in an attempt to characterize the radionuclides produced during irradiation. The activities of the thin foils were employed in an effort to unfold a spectrum of the neutrons produced during the hadronic cascades in the target. The MARS Monte Carlo code (MO95, MO00) was used to predict and analyze the residual radiation produced during the beam irradiation. New subroutines have been developed for the MARS14 version

  15. The fruit fly programme in Chile

    International Nuclear Information System (INIS)

    Full text: country. In fact, no species of the genera Ceratitis, Bactrocera, Anastrepha, Dacus and Toxotrypana exist in the country. This programme uses the Fruit fly National Detection System, which includes detection of the pest by trapping and fruit sampling in different areas located between the I and XI Regions of the country. This system is approved by the Chilean trade partners on the basis of the fruit fly-free recognition. For the Chilean fresh fruit exports, this is an important advantage, because there is no need to apply quarantine treatments or any other restriction measure. Chile has also a huge fruit industry, whose export revenues last season reached USD 1,900 million. This fact has permitted to undertake continuously a big effort to maintain that phytosanitary condition. Since Chile is the only fruit-fly free Latin American country, it has to face a continuous biological pressure of fruit flies, mainly C. capitata, to invade its territory. But the country has also some important advantages to prevent flies migrating due to its natural isolation. These natural barriers are the Los Andes ranges in the east, thousands of kilometers of desert in the north, the Pacific Ocean in the west and finally an extremely cold, sub polar climate in the south. This isolation has led to the NPPO officials to believe that the passive spread, through smuggling and hidden fruit in passenger's baggage, to be the most likely source of fruit fly entries. Because of that, Chile has a very strict quarantine system with border control stations at every point of entry. The only exception to the mentioned isolation is Arica Province on the border with Peru. There, SAG applies an area-wide preventative approach through the rearing and release of sterile insects, as well as bait spraying in the border area, which is mainly desert, but has some 'green spots' that allow the fly to alight for resting and feeding. Additionally, through bi-national agreements, common activities are

  16. APS extends open access to all its journals

    CERN Multimedia

    Thomas, Kim


    "Physics research promoter and publisher the American Physical Society (APS) is to extend open access to all its journals. Th APS previously made its five print journals available through subscriptions, and its two e-journals (Physical Review Special Topics and Physics Educatoin Research) on an open access basis." (1/2 page)


    This project develops emission factors, etc., for landfills, in particular for combustion devices fed by landfill gas, for incorporation into AP-42. AP-42 is a massive collection of information concerning processes which generate air emissions and presents emission factors and co...

  18. Data-Based Decision Making: The Road to AP Equity (United States)

    Edwards, Kelcey; Duggan, Odette


    Presented at the Advanced Placement Annual Conference (APAC) in Lake Buena Vista, FL in July 2012. This presentation reviews concepts central to achieving equitable AP access and success for all willing and academically prepared students. We analyze trends in participation and performance by race/ethnicity from the AP Report to the Nation and…

  19. A Closer Examination of the Academic Benefits of AP (United States)

    McKillip, Mary E. M.; Rawls, Anita


    The authors sought to better understand the relationship between students participating in the Advanced Placement (AP) program and subsequent performance on the Scholastic Aptitude Test (SAT). Focusing on students graduating from U.S. public high schools in 2010, the authors used propensity scores to match junior year AP examinees in 3 subjects to…

  20. La Medialuna: un edificio para Chile/The Crescent, a building for Chile

    Directory of Open Access Journals (Sweden)

    Moreira Recchione, Alberto


    Full Text Available Se refiere los antecedentes históricos sobre la escuela ecuestre de la jineta y su introducción en las faenas agrícola-ganaderas chilenas. Se reseña el nacimiento del rodeo como deporte nacional chileno y los requerimientos del complejo espacio de la “fiesta del rodeo”: un problema arquitectónico y también urbanístico./ The equestrian school of "La Jineta" in Chile, and the architecture for the national holiday of "rodeo."

  1. Dicty_cDB: FC-AP05 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP05 (Link to dictyBase) - - - Contig-U16521-1 FC-AP05Z (Li...nk to Original site) - - FC-AP05Z 532 - - - - Show FC-AP05 Library FC (Link to library) Clone ID FC-AP05 (Li.../ Representative seq. ID FC-AP...05Z (Link to Original site) Representative DNA sequence >FC-AP05 (FC-AP05Q) /CSM/FC/FC-AP/FC-AP05Q.Seq....GAGA TCCGTCAAAGTTTCAAGCAAAAAAGTTGTTGCCAAGTAAATAAATAATACTTTTTTCCCT AT sequence update 1997. 3.25 Translated Amino Acid sequence ---AP

  2. Dicty_cDB: FC-AP23 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP23 (Link to dictyBase) - G03230 DDB0190153 Contig-U16094-1 FC-AP...23P (Link to Original site) FC-AP23F 515 FC-AP23Z 472 FC-AP23P 987 - - Show FC-AP23 Library FC (Link ...ontig Contig-U16094-1 Original site URL Representative seq. ID FC-AP23P (Link to Original site) Representative DNA sequence >FC-AP23 (FC-AP...23Q) /CSM/FC/FC-AP/FC-AP23Q.Seq.d/ CAAATACATAATCTCTTTTTTGAAAATGTCCGAAAATAACGAAATTGAAATGGAACTCC

  3. Dicty_cDB: FC-AP12 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP12 (Link to dictyBase) - G01739 DDB0232214 Contig-U15924-1 FC-AP...12P (Link to Original site) FC-AP12F 323 FC-AP12Z 613 FC-AP12P 936 - - Show FC-AP12 Library FC (Link ...ontig Contig-U15924-1 Original site URL Representative seq. ID FC-AP12P (Link to Original site) Representative DNA sequence >FC-AP12 (FC-AP...12Q) /CSM/FC/FC-AP/FC-AP12Q.Seq.d/ CATATTATTTTAAATTTCAGATGTTCCCAAAATAACACATTAATTTGCTTTTTTTGTTG

  4. AP1000R licensing and deployment in the United States

    International Nuclear Information System (INIS)

    In recent years, both domestic and foreign utilities have turned to the standardized Westinghouse AP1000 plant design in satisfying their near - and long-term - sustainable energy needs. As direct support to these actions, licensing the AP1000 design has played a significant role by providing one of the fundamental bases in clearing regulatory hurdles leading to the start of new plant construction. Within the U.S. alone, Westinghouse AP1000 licensing activities have reached unprecedented milestones with the approvals of both AP1000 Design Certification and Southern Company's combined construction permit and operating license (COL) application directly supporting the construction of two new nuclear plants in Georgia. Further COL application approvals are immediately pending for an additional two AP1000 plants in South Carolina. And, across the U.S. nuclear industry spectrum, there are 10 other COL applications under regulatory review representing some 16 new plants at 10 sites. In total, these actions represent the first wave of new plant licensing under the regulatory approval process since 1978. Fundamental to the Nuclear Regulatory Commission's AP1000 Design Certification is the formal recognition of the AP1000 passive safety design through regulatory acceptance rulemaking. Through recognition and deployment of the AP1000 Design Certification, the utility licensee / operator of this reactor design are now offered an opportunity to use a simplified 'one-step' combined license process, thereby managing substantial back-end construction schedule risk from regulatory and intervention delays. Application of this regulatory philosophy represents both acceptance and encouragement of standardized reactor designs like the AP1000. With the recent AP1000 Design Certification and utility COL acceptances, the fundamental licensing processes of this philosophy have successfully proven the attainment of significant milestones with the next stage licensing actions directed

  5. ALMA communication backbone in Chile goes optical (United States)

    Filippi, G.; Ibsen, J.; Jaque, Sandra; Liello, F.; Navarro, C.


    High-bandwidth communication has become a key factor for scientific installations as Observatories. This paper describes the technical, organizational, and operational goals and the level of completion of the ALMA Optical Link Project. The project focus is the creation and operation of an effective and sustainable communication infrastructure to connect the ALMA Observatory, located in the Atacama Desert, in the Northern region of Chile, with the point of presence in ANTOFAGASTA, about 400km away, of the EVALSO infrastructure, and from there to the Central Office in the Chilean capital, Santiago. This new infrastructure that will be operated in behalf of ALMA by REUNA, the Chilean National Research and Education Network, will use state of the art technologies, like dark fiber from newly built cables and DWDM transmission, allowing extending the reach of high capacity communication to the remote region where the Observatory is located. When completed, the end-to-end Gigabit-per-second (Gbps) capable link will provide ALMA with a modern, effective, robust, communication infrastructure capable to cope with present and future demands, like those coming from fast growing data transfer to rapid response mode, from remote monitoring and engineering to virtual presence.

  6. Macroeconomic fluctuations and bank behavior in Chile

    Directory of Open Access Journals (Sweden)

    Jorge E. Restrepo


    Full Text Available The purpose of this study is to analyze bank behavior in Chile over time, looking at how their balance sheets and performance move both in the short and long run, and how they react to macroeconomic shocks. The evolution of banking aggregates over an 18 year period (1989-2006, using quarterly data is examined. Techniques common in the real business cycle literature are applied to establish empirical patterns. Robustness tests using several filters are performed. The effects of macro shocks on banking variables are analyzed, both by means of an event study, and by estimating impulse responses with VARs. The results show that credit lags the cycle, demand deposits lead it, both being procyclical, while the capital adequacy ratio (CAR is countercyclical. In addition, a shock to interest rates reduces loans (total, commercial, consumption, and increases non performing loans (NPL and the capital adequacy ratio (CAR. A shock to GDP growth has a positive effect on loans, return over equity (ROE, and a negative impact on NPL and CAR.

  7. [Nutritive value of shellfish consumed in Chile]. (United States)

    Pak, N; Vera, G; Araya, H


    The purpose of the present study was to determine the protein quality and digestibility of shellfish commonly consumed in Chile, and to estimate its contribution to the protein needs of the Chilean population. The shellfish studied were chorito (Mytilus edulis chilensis), macha (Mesodesma donacium), loco (Concholepas concholepas), cholga (Aulacomya ater), erizo (Loxechinus albus) and almeja (no specific variety). The NPU method was used to determine protein quality. The percentage of protein adequacy for adult rations was calculated according to FAO/WHO 1973. The contribution of shellfish to the protein availability according to the family income of the Santiago population, was also calculated. Most of the shellfish presented NPU values of about 70; the lowest values were found for loco (54.9) and macha (63.3). The apparent and true digestibility gave an average of 83.6 and 90.4, respectively. The percentage of protein adequacy of habitual rations ranged between 27% (erizo) and 58% (loco). The availability of shellfish protein in relation to total protein increased from 0.4 to 2.5% when income increased. It is concluded therefore, that shellfish protein is, in general, of good quality. Nevertheless, it might be considered of poor influence insofar as fulfilling the protein needs of the population studied, whatever its socioeconomic level. PMID:3834878

  8. Social Networks and Political Parties in Chile

    Directory of Open Access Journals (Sweden)

    Adler Lomnitz, Larissa


    Full Text Available This paper describes the origin and evolution of two Chilean political parties (the Radical Party and the Christian Democrat Party through the analysis of the social networks that originated and composed them. The aim of this study is to propose a model of national political cultures on the basis of the structure of social networks related to power and of the symbol system, which legitimizes it. The structure of social networks, horizontal and vertical, are based on reciprocal or redistributive forms of exchange, on what is being exchanged and on the articulation between networks. In every society there are symmetrical and asymmetrical exchanges, which produce horizontal and vertical networks. These networks interact among themselves to form the social fabric. The dominance of some over others and how they combine, delineate the character of the political culture (authoritarian vs. egalitarian. Chile is a multiparty country within which there are cohorts of horizontal groups of friends, who informally exercise a central control over their members and create invisible boundaries setting them apart from others, in which leadership is under constrains. The result is both a strong presidential system based on an almost fanatic legitimacy, combined with factionalism and a strong parliamentary system.

  9. [Nutritive value of shellfish consumed in Chile]. (United States)

    Pak, N; Vera, G; Araya, H


    The purpose of the present study was to determine the protein quality and digestibility of shellfish commonly consumed in Chile, and to estimate its contribution to the protein needs of the Chilean population. The shellfish studied were chorito (Mytilus edulis chilensis), macha (Mesodesma donacium), loco (Concholepas concholepas), cholga (Aulacomya ater), erizo (Loxechinus albus) and almeja (no specific variety). The NPU method was used to determine protein quality. The percentage of protein adequacy for adult rations was calculated according to FAO/WHO 1973. The contribution of shellfish to the protein availability according to the family income of the Santiago population, was also calculated. Most of the shellfish presented NPU values of about 70; the lowest values were found for loco (54.9) and macha (63.3). The apparent and true digestibility gave an average of 83.6 and 90.4, respectively. The percentage of protein adequacy of habitual rations ranged between 27% (erizo) and 58% (loco). The availability of shellfish protein in relation to total protein increased from 0.4 to 2.5% when income increased. It is concluded therefore, that shellfish protein is, in general, of good quality. Nevertheless, it might be considered of poor influence insofar as fulfilling the protein needs of the population studied, whatever its socioeconomic level.

  10. [The evolution theory in the medical sciences in Chile]. (United States)

    Cruz-Coke, R


    The evolutionist ideas of Lamarck, Darwin and Haeckel entered the country through the arrival of their books. "On the origin of Species" arrived in Chile in 1869. The most outstanding immigrant european physicians that discussed these ideas were Rodulfo A Phillippi (1808-1904) and Juan José Brunner (1825-1899). Both discussed Darwin's ideas in their books and conferences as academics of the Faculty of Medicine of the University of Chile. The first Chilean physicians that read and discussed the validity of evolution theory were Adolfo Valderrama (1834-1902) and Pedro Candia Salgado. Both wrote articles about this matter in Revista Médica de Chile in 1872 and 1874. The professor of general biology, Juan Noé Crevani, italian physician and zoologist that arrived in Chile in 1912, was the first to teach directly the concepts of the evolution theory until his death in 1947. Professor Noé founded the great biological school of the twentieth century in Chile and his disciples introduced the concepts of Mendelian theory and neodarwinism in the decade of fifties. The theory of evolution was taught as a chapter of general biology in the Faculty of Medicine between 1913 and 1947, but its practical applications to medicine were introduced with the birth of medical genetics in the decade of fifties and the foundation of Chilean Genetics society in 1964, under the direction of professors Danko Brncic and Gustavo Hoecker, both awarded with the National Sciences Prize.

  11. [Mental health in Chile and Finland: Challenges and lessons]. (United States)

    Retamal C, Pedro; Markkula, Niina; Peña, Sebastián


    This article analyses and compares the epidemiology of mental disorders and relevant public policies in Chile and Finland. In Chile, a specific mental health law is still lacking. While both countries highlight the role of primary care, Finland places more emphasis on participation and recovery of service users. Comprehensive mental health policies from Finland, such as a successful suicide prevention program, are presented. Both countries have similar prevalence of mental disorders, high alcohol consumption and high suicide rates. In Chile, the percentage of total disease burden due to psychiatric disorders is 13% and in Finland 14%. However, the resources to address these issues are very different. Finland spends 4.5% of its health budget on mental health, while in Chile the percentage is 2.2%. This results in differences in human resources and service provision. Finland has five times more psychiatric outpatient visits, four times more psychiatrists, triple antidepressant use and twice more clinical guidelines for different psychiatric conditions. In conclusion, both countries have similar challenges but differing realities. This may help to identify gaps and potential solutions for public health challenges in Chile. Finland’s experience demonstrates the importance of political will and long-term vision in the construction of mental health policies. PMID:27661557

  12. First record of Phoebis argante chincha Lamas (Lepidoptera, Pieridae) in Chile


    Héctor A. Vargas; Gerardo Lamas


    First record of Phoebis argante chincha Lamas (Lepidoptera, Pieridae) in Chile. The presence of Phoebis argante chincha Lamas, 1976 (Lepidoptera, Pieridae) is reported for the first time in Chile, from the Azapa valley, Arica.Primeiro registro de Phoebis argante chincha Lamas (Lepidoptera, Pieridae) no Chile. A presença de Phoebis argante chincha Lamas, 1976 (Lepidoptera; Pieridae) é mencionada pela primeira vez para o Chile, no vale de Azapa, Arica.

  13. AP600 design certification thermal hydraulics testing and analysis

    International Nuclear Information System (INIS)

    Westinghouse Electric Corporation, in conjunction with the Department of Energy and the Electric Power Research Institute, have been developing an advanced light water reactor design; the AP600. The AP600 is a 1940 Mwt, 600Mwe unit which is similar to a Westinghouse two-loop Pressurized Water Reactor. The accumulated knowledge on reactor design to reduce the capital costs, construction time, and the operational and maintenance cost of the unit once it begins to generate electrical power. The AP600 design goal is to maintain an overall cost advantage over fossil generated electrical power

  14. AP600 design certification thermal hydraulics testing and analysis

    Energy Technology Data Exchange (ETDEWEB)

    Hochreiter, L.E.; Piplica, E.J.


    Westinghouse Electric Corporation, in conjunction with the Department of Energy and the Electric Power Research Institute, have been developing an advanced light water reactor design; the AP600. The AP600 is a 1940 Mwt, 600Mwe unit which is similar to a Westinghouse two-loop Pressurized Water Reactor. The accumulated knowledge on reactor design to reduce the capital costs, construction time, and the operational and maintenance cost of the unit once it begins to generate electrical power. The AP600 design goal is to maintain an overall cost advantage over fossil generated electrical power.

  15. A new gap separation mechanism for APS insertion devices.

    Energy Technology Data Exchange (ETDEWEB)

    Trakhtenberg, E. M.; Tcheskidov, V.; Den Hartog, P. K.; Deriy, B.; Erdmann, M.; Makarov, O.; Moog, E. R.


    A new gap separation mechanism for use with the standard Advanced Photon Source (APS) 3.3-cm-period undulator magnetic structures has been designed and built and the first system has been installed in the APS storage ring. The system allows a minimum magnetic gap of 10 mm for use with the APS 8-mm insertion device vacuum chambers. The mechanism is a bolted steel frame structure with a simple 4-motor mechanical drive train. The control system uses servomotors with incremental rotary encoders and virtual absolute linear encoders.

  16. 77 FR 22663 - Importation of Pomegranates From Chile Under a Systems Approach (United States)


    ... Chile Under a Systems Approach AGENCY: Animal and Plant Health Inspection Service, USDA. ACTION: Final... continental United States of pomegranates from Chile, subject to a systems approach. Under this systems... plant protection organization of Chile and certified as having a low prevalence of Brevipalpus...

  17. 19 CFR 10.490 - Goods re-entered after repair or alteration in Chile. (United States)


    ... Chile. 10.490 Section 10.490 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND... States-Chile Free Trade Agreement Goods Returned After Repair Or Alteration § 10.490 Goods re-entered after repair or alteration in Chile. (a) General. This section sets forth the rules which apply...

  18. 77 FR 12903 - Suggestions for Environmental Cooperation Pursuant to the United States-Chile Environmental... (United States)


    ... Suggestions for Environmental Cooperation Pursuant to the United States-Chile Environmental Cooperation Agreement ACTION: Notice of preparation of the 2012-2014 U.S.-Chile Environmental Cooperation Work Program... suggestions regarding items for inclusion in a new work program for implementing the U.S.-Chile...

  19. 7 CFR 319.56-23 - Apricots, nectarines, peaches, plumcot, and plums from Chile. (United States)


    ... Chile. 319.56-23 Section 319.56-23 Agriculture Regulations of the Department of Agriculture (Continued... and Vegetables § 319.56-23 Apricots, nectarines, peaches, plumcot, and plums from Chile. (a... from Chile in accordance with this section and all other applicable provisions of this subpart. 3 3...

  20. CHILE: An Evidence-Based Preschool Intervention for Obesity Prevention in Head Start (United States)

    Davis, Sally M.; Sanders, Sarah G.; FitzGerald, Courtney A.; Keane, Patricia C.; Canaca, Glenda F.; Volker-Rector, Renee


    Background: Obesity is a major concern among American Indians and Hispanics. The Child Health Initiative for Lifelong Eating and Exercise (CHILE) is an evidence-based intervention to prevent obesity in children enrolled in 16 Head Start (HS) Centers in rural communities. The design and implementation of CHILE are described. Methods: CHILE uses a…

  1. 77 FR 64106 - Renewable Energy and Energy Efficiency Trade Policy Mission to Chile (United States)


    ... International Trade Administration Renewable Energy and Energy Efficiency Trade Policy Mission to Chile AGENCY... (RE&EE) Trade Policy Mission to Santiago, Chile from April 15-16, 2013. The mission is designed to be... conducive to growth in Chile's RE&EE market; and (2) introducing U.S. RE&EE exporters to key...

  2. Energy and Mass Balance At Gran Campo Nevado, Patagonia, Chile (United States)

    Schneider, C.; Kilian, R.; Casassa, G.

    The Gran Campo Nevado (GCN) Ice Cap on Peninsula Muñoz Gamero, Chile, is lo- cated in the southernmost part of the Patagonian Andes at 53S. It comprises an ice cap and numerous outlet glaciers which mostly end in proglacial lakes at sea level. The total ice covered area sums up to approximately 250 km2. GCN forms the only major ice body between the Southern Patagonian Icefield and the Street of Magallan. Its almost unique location in the zone of the all-year westerlies makes it a region of key interest in terms of glacier and climate change studies of the westwind zone of the Southern Hemisphere. Mean annual temperature of approximately +5C at sea level and high precipitation of about 8.000 mm per year lead to an extreme turn-over of ice mass from the accumulation area of the GCN Ice Cap to the ablation areas of the outlet glaciers. Since October 1999 an automated weather station (AWS) is run continuously in the area at Bahia Bahamondes for monitoring climate parameters. From February to April 2000 an additional AWS was operated on Glaciar Lengua a small outlet glacier of GCN to the north-west. Ablation has been measured at stakes during the same pe- riod. The aim of this study, was to obtain point energy and mass balance on Glaciar Lengua. The work was conducted as part of the international and interdisciplinary working group SGran Campo NevadoT and supported by the German Research Foun- & cedil;dation (DFG). Energy balance was calculated using the bulk approach formulas and calibrated to the measured ablation. It turns out, that sensible heat transfer is the major contribution to the energy balance. Since high cloud cover rates prevail, air tempera- ture is the key factor for the energy balance of the glacier. Despite high rain fall rates, energy input from rain fall is of only minor importance to the overall energy balance. From the energy balance computed, it was possible to derive summer-time degree-day factors for Glaciar Lengua. With data from the nearby

  3. The Unexpected Awakening of Chaitén Volcano, Chile (United States)

    Carn, Simon A.; Pallister, John S.; Lara, Luis; Ewert, John W.; Watt, Sebastian; Prata, Alfred J.; Thomas, Ronald J.; Villarosa, Gustavo


    On 2 May 2008, a large eruption began unexpectedly at the inconspicuous Chaitén volcano in Chile's southern volcanic zone. Ash columns abruptly jetted from the volcano into the stratosphere, followed by lava dome effusion and continuous low-altitude ash plumes [Lara, 2009]. Apocalyptic photographs of eruption plumes suffused with lightning were circulated globally. Effects of the eruption were extensive. Floods and lahars inundated the town of Chaitén, and its 4625 residents were evacuated. Widespread ashfall and drifting ash clouds closed regional airports and cancelled hundreds of domestic flights in Argentina and Chile and numerous international flights [Guffanti et al., 2008]. Ash heavily affected the aquaculture industry in the nearby Gulf of Corcovado, curtailed ecotourism, and closed regional nature preserves. To better prepare for future eruptions, the Chilean government has boosted support for monitoring and hazard mitigation at Chaitén and at 42 other highly hazardous, active volcanoes in Chile.

  4. Desigualdad Geográfica en Chile

    Directory of Open Access Journals (Sweden)

    Claudio A. Agostini


    Full Text Available Despite success in reducing poverty over the last twenty years, inequality in Chile has remained virtually unchanged, making Chile one of the least equal countries in the world. High levels of inequality have been shown to hamper further reductions in poverty as well as economic growth and local inequality has been shown to affect such outcomes as violence and health. The study of inequality at the local level is thus crucial for understanding the economic well-being of a country. Local measures of inequality have been difficult to obtain, but recent theoretical advances have enabled the combination of survey and census data to obtain estimators of inequality that are robust at disaggregated geographic levels. In this paper, we employ this methodology to produce consistent estimators of inequality for every county in Chile. We find a great deal of variation in inequality, with countylevel Gini coefficients ranging from 0.41 to 0.63.

  5. Biogeografía marina de Chile continental Marine biogeography of continental Chile

    Directory of Open Access Journals (Sweden)



    Full Text Available Por casi un siglo, varios autores han analizado los patrones de distribución de la fauna y flora marina del Pacífico de Sudamérica y de la costa de Chile en particular, con el propósito de establecer el número de las unidades biogeográficas presentes. Si bien los patrones generales actuales son relativamente bien conocidos, la mayoría de los estudios se ha enfocado en las discontinuidades distribucionales y en propuestas de clasificación más que en los factores y procesos dinámicos que han formado las unidades espaciales identificadas. Aun en el caso de las clasificaciones, las conclusiones publicadas se basan principalmente en el análisis de uno o pocos grupos seleccionados, y presentan diferencias importantes en los criterios de selección de los grupos, el número de especies involucrado y la metodología usada. Por otra parte, las discrepancias entre estudios específicos tienden a obscurecer un fenómeno relevante y de mayor escala como es la dinámica de las biotas, uno de los aspectos biogeográficos menos conocidos en Chile. En tal contexto, este trabajo presenta una revisión de literatura sobre la biogeografía marina de Chile y sus aspectos asociados, con los siguientes objetivos: (a resumir las características oceanográficas, climáticas y geomorfológicas de la costa continental de Chile; (b discutir 27 clasificaciones biogeográficas publicadas para la costa chilena, analizando los criterios y procedimientos usados por los autores, sus conclusiones principales, y la concordancia entre los estudios; (c evaluar los procesos dispersivos y vicariantes asociados a los desplazamientos y modificaciones de las biotas de la región, en función de los antecedentes disponibles sobre las condiciones existentes y los principales eventos ocurridos durante los períodos Terciario y Cuaternario; y (d proponer un escenario de cambio biogeográfico basado en determinantes históricas y su influencia en la formación, carácter y din

  6. Analysis and projections of physics in Chile

    International Nuclear Information System (INIS)

    In the present work, an assessment of the Physics research capacity in Chile is presented. For this, the period between 2000 and June 2005 has been studied. In this period almost 200 physicists have contributed to scientific production in terms of ISI publications. Amongst these 200, ∼160 correspond to theoretical physicists and only ∼40 to experimental physicists; ∼178 are men and only ∼22 are women. A more detailed analysis shows that ∼160 physicists have at least one appearance in ISI publications per year considering the last 3 years. Ten years ago, a similar criteria (at least one appearance per year in ISI articles, considering mobile three-year periods), the number of active physicists in the Chilean community was estimated at 70. Therefore, the Chilean active physicists' community has doubled in 10 years. There exist 20 centres in which scientific research is developed: 18 university centres, a government institute and a private institute. As regards scientific productivity, both as related to disciplines or research areas, and well as in relation to research centres, it is found that, generally, scientific production, in a particular area in Physics or in a research centre, is directly related to the number of corresponding researchers; that is to say, the percentage of the national productivity in an area or research centre corresponds to its share in the total number of physicists in the country. A geographical analysis shows that 50% of the productivity corresponds to Santiago and 50% to the rest of the country. The impact of the different funds for research is assessed, also: FONDECYT, Presidential Chairs and large projects and centres of excellence. According to Physics researchers opinion, Fondo Nacional de Ciencia y TecnologIa (FONDECYT, National Fund fro Science and Technology) has become the best instrument to support researchi activities in Chile. However, the amount of projects awarded has practically not been increased, which is

  7. Dicty_cDB: FC-AP17 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 4.1 SJMBIB09 SJM Schistosoma japonicum cDNA, mRNA sequence. 80 8e-20 2 BE859184 |BE859184.1 SsS0499 Suaeda salsa ZAP...FC (Link to library) FC-AP17 (Link to dictyBase) - - - Contig-U16254-1 FC-AP17Z (Li...nk to Original site) - - FC-AP17Z 546 - - - - Show FC-AP17 Library FC (Link to library) Clone ID FC-AP17 (Li.../ Representative seq. ID FC-AP...17Z (Link to Original site) Representative DNA sequence >FC-AP17 (FC-AP17Q) /CSM/FC/FC-AP/FC-AP17Q.Seq.

  8. Dicty_cDB: FC-AP11 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available A clone IMAGE:4920557 5', mRNA sequence. 56 1e-04 2 BF345929 |BF345929.1 602017931F1 NCI_CGAP_Brn67 Homo sap...FC (Link to library) FC-AP11 (Link to dictyBase) - - - Contig-U16101-1 FC-AP11F (Li...nk to Original site) FC-AP11F 394 - - - - - - Show FC-AP11 Library FC (Link to library) Clone ID FC-AP11 (Li.../ Representative seq. ID FC-AP...11F (Link to Original site) Representative DNA sequence >FC-AP11 (FC-AP11Q) /CSM/FC/FC-AP/FC-AP11Q.Seq.

  9. Dicty_cDB: FC-AP18 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP18 (Link to dictyBase) - - - Contig-U16455-1 FC-AP18Z (Li...nk to Original site) - - FC-AP18Z 367 - - - - Show FC-AP18 Library FC (Link to library) Clone ID FC-AP18 (Li.../ Representative seq. ID FC-AP...18Z (Link to Original site) Representative DNA sequence >FC-AP18 (FC-AP18Q) /CSM/FC/FC-AP/FC-AP18Q.Seq....XELTPSRPMCVESFNEYPP LGRFAVRDMGQTVAVGVIKSTVKKAPGKAGDKKGAXAPSKKK*innis**iafynnfkkk kkkkk Translated Amino Acid

  10. Dicty_cDB: FC-AP16 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP16 (Link to dictyBase) - - - Contig-U16269-1 FC-AP16Z (Li...nk to Original site) - - FC-AP16Z 552 - - - - Show FC-AP16 Library FC (Link to library) Clone ID FC-AP16 (Li.../ Representative seq. ID FC-AP...16Z (Link to Original site) Representative DNA sequence >FC-AP16 (FC-AP16Q) /CSM/FC/FC-AP/FC-AP16Q.Seq....7. 3.28 Translated Amino Acid sequence ---RNRRYKVRKGPLVVVSGKTTVSQALRNIPGVEVANVSRLNLLKLAPGGHLGRFIIWT KSAFEQLD

  11. Tank characterization report for double shell tank 241-AP-104

    Energy Technology Data Exchange (ETDEWEB)

    Winkelman, W.D., Westinghouse Hanford


    This document summarizes the information on the historical uses, present status, and the sampling and analysis results of waste stored in Tank 241-AP-104. This report supports the requirements of Tri-Party Agreement Milestone M-44-09.

  12. Lumbar pedicle screw placement: Using only AP plane imaging

    Directory of Open Access Journals (Sweden)

    Anil Sethi


    Conclusion: Placement of pedicle screws under fluoroscopic guidance using AP plane imaging alone with tactile guidance is safe, fast, and reliable. However, a good understanding of the radiographic landmarks is a prerequisite.

  13. Competitividad de las exportaciones de chile seco mexicano


    Carlos Alberto Flores Sánchez; Alejandro Mungaray Lagarda


    En el presente trabajo se estudia el comportamiento de la competitividad que ha mostrado México, en cuanto a sus exportaciones de chile seco, durante el periodo de 1993 a 2009, mediante la obtención del índice de ventaja relativa de exportaciones y aplicando el método de análisis de participación constante de mercado, los resultados que se obtuvieron muestran que las exportaciones de chile seco de México han crecido fuertemente, con una tendencia de crecimiento muy variable, por otro lado los...

  14. The economic and financial gains from water markets in Chile


    Hearne, Robert R.; Easter, K. William


    Chile is one of the few countries that has encouraged the use of markets in water resource management. In order to assess the impact of water markets and transactions costs in Chile, four river valleys, the Maipo, Elqui, Limari, and the Azapa were selected as case studies. Transactions from the Elqui and Limari valleys, during the years 1986 to 1993, were analyzed to determine the gains-from-trade from market transfers. In the economic and financial analysis of water markets, crop budgets wer...

  15. Nuevos inmigrantes en Chile: Los determinantes de su actividad emprendedora


    Mancilla, Claudio; de Lima, Philomena


    En Chile es poca la literatura que estudia a los inmigrantes desde una perspectiva económica, y menos la que aborda su actitud emprendedora (a pesar de que son proporcionalmente más emprendedores que los habitantes locales). El objetivo de este trabajo es estudiar los factores que influyen en el emprendimiento de los in - migrantes sudamericanos en Chile. Se utilizó un modelo logit ajustado para even - tos extraños para determinar el impacto sobre la probabilidad de emprendimiento individual....

  16. [Measles: the disease, epidemiology, history and vaccination programs in Chile]. (United States)

    Delpiano, Luis; Astroza, Leonor; Toro, Jorge


    Measles, one of most important inmuno-preventable diseases, remains as a worldwide concern issue with an important morbidity and mortality. Particularly in the America region declared free of measles in 2010 by WHO, they still appear imported cases that origin outbreaks of variable magnitude in susceptible subjects usually none vaccinated which is the current situation in Santiago, the capital city of Chile. In this review we present characteristics of the etiological agent, the disease, epidemiological aspects with national historical focus, impact of immunization programs and outbreaks in Chile, in order to contribute to knowledge and management of this always present public health problem. PMID:26436786

  17. Roles of AP-2 in clathrin-mediated endocytosis.

    Directory of Open Access Journals (Sweden)

    Emmanuel Boucrot

    Full Text Available BACKGROUND: The notion that AP-2 clathrin adaptor is an essential component of an endocytic clathrin coat appears to conflict with recent observations that substantial AP-2 depletion, using RNA interference with synthesis of AP-2 subunits, fails to block uptake of certain ligands known to internalize through a clathrin-based pathway. METHODOLOGY/PRINCIPAL FINDINGS: We report here the use of in vivo imaging data obtained by spinning-disk confocal microscopy to study the formation of clathrin-coated structures at the plasma membranes of BSC1 and HeLa cells depleted by RNAi of the clathrin adaptor, AP-2. Very few clathrin coats continue to assemble after AP-2 knockdown. Moreover, there is a total absence of clathrin-containing structures completely lacking AP-2 while all the remaining coats still contain a small amount of AP-2. These observations suggest that AP-2 is essential for endocytic coated-pit and coated-vesicle formation. We also find that AP-2 knockdown strongly inhibits light-density lipoprotein (LDL receptor-mediated endocytosis, as long as cells are maintained in complete serum and at 37 degrees C. If cells are first incubated with LDL at 4 degrees C, followed by warming, there is little or no decrease in LDL uptake with respect to control cells. LDL uptake at 37 degrees C is also not affected in AP-2 depleted cells first deprived of LDL by incubation with either serum-starved or LDL-starved cells for 24 hr. The LDL-deprived cells display a significant increase in endocytic structures enriched on deeply invaginated tubes that contain LDL and we suggest that under this condition of stress, LDL might enter through this alternative pathway. CONCLUSIONS/SIGNIFICANCE: These results suggest that AP-2 is essential for endocytic clathrin coated-pit and coated-vesicle formation. They also indicate that under normal conditions, functional endocytic clathrin coated pits are required for LDL internalization. We also show that under certain

  18. AP-102/104 Retrieval control system qualification test procedure

    Energy Technology Data Exchange (ETDEWEB)

    RIECK, C.A.


    This Qualification Test Procedure documents the results of the qualification testing that was performed on the Project W-211, ''Initial Tank Retrieval Systems,'' retrieval control system (RCS) for tanks 241-AP-102 and 241-AP-104. The results confirm that the RCS has been programmed correctly and that the two related hardware enclosures have been assembled in accordance with the design documents.

  19. AP1000 design adaptation to European Markets and EUR compliance

    International Nuclear Information System (INIS)

    The AP1000 plant is an 1100-MWe pressurized water reactor (PWR) with passive safety features and extensive plant simplifications that enhance construction, operation, maintenance and safety. One of the key approaches in the AP1000 design is to use passive features to mitigate design basis accidents. In addition to redundancy, these features incorporate diversity based on PRA insights. The AP1000 design has incorporated a standardization approach, which together with the level of safety achieved by the passive safety features, results in a plant design that can be applied to different geographical regions with varying regulatory standards and utility expectations without major changes. Westinghouse has cooperated for almost 2 decades with European utilities to ensure adaptation of the AP1000 design to European market. The AP1000 50 Hz standard design (also referred to as European Passive Standard) is the resulting adaptation of the AP1000 design to European market needs and requirements, addressing both customer input from the EPP program and regulatory needs identified in the UK GDA process. This standard 50 Hz design retains the overall AP1000 design (safe, simple, standard), the use of proven components and its cost, safety and operability advantages, while it incorporates some changes to adapt to the European environment. In this paper, the key changes incorporated into the AP1000 50 Hz design are discussed, including: -) Adaptation of the electrical systems and Turbine adaptation from 60 Hz to 50 Hz, including approach to IEC vs IEEE compliance; -) Modifications to defense in depth (US class D, European Class 2) and other systems to simplify European licensing and address customer requirements; -) Option for adoption of KSB RUV type Main Reactor Coolant Pumps; -) Limited design adaptations in the areas of instrumentation-control and ventilation and filtration to adapt to European requirements and simplify the licensing process

  20. Analysis and characterization of double shell tank 241-AP-108

    International Nuclear Information System (INIS)

    This document is the first part of a three-part report describing the analysis and characterization of double shell tank 241-AP-108 which is located at the Hanford Reservation.This document is the analytical laboratory data package entitled 'Analysis and Characterization of Double Shell Tank 241-AP-108' which contains a case sampling history, the sampling protocols, the analytical procedures, sampling and analysis quality assurance and quality control measures, and chemical analysis results for samples obtained from the tank

  1. The Dushak–Erekdag Survey of roAp Stars

    Indian Academy of Sciences (India)

    Tatyana Dorokhova; Nikolay Dorokhov


    The search of roAp stars at Mt. Dushak–Erekdag Observatory was started in 1992 using the 0.8m Odessa telescope equipped with a two-star high-speed photometer. We have observed more than a dozen stars so far and discovered HD 99563 as roAp star while BD+8087 is suspected to have rapid oscillations. Negative results of our observations for the search of rapid oscillations in four stars in NGC 752 are also discussed.

  2. Scenarios for wind power in Brazil, Argentina and Chile; Cenarios para a energia eolio eletrica no Brasil, Argentina e Chile

    Energy Technology Data Exchange (ETDEWEB)

    Dedecca, Joao Gorestein; Nogueira, Larissa Goncalves; Jannuzzi, Gilberto de Martino [Universidade Estadual de Campinas (UNICAMP), SP (Brazil). Fac. de Engenharia Mecanica. Dept. de Energia], emails:,,; Gomes, Rodolfo Dourado [International Energy Initiative-Latin America (IEI-LA), Campinas, SP (Brazil)], email:


    The Chilean, Argentinean and Brazilian power matrixes presented in the last two decades a growth of the non-renewable energy sources share, especially fossil sources, mainly in installed capacity and in a lesser degree in energy production. Greenpeace and the European Renewable Energy Council have elaborated a reference energy scenario together with a scenario analyzing the institution of ample measures for the promotion of renewable energy sources. Feed-in tariffs and auction or bidding mechanisms implemented in Brazil and Argentina and the renewable portfolio standard implemented in Chile allied with the wind industry state in these countries indicate that Chile and Argentina will fulfill the 2020 wind power installed capacity predicted in the reference scenarios, while Brazil will reach the energy revolution scenario prediction. Important energy policy changes are required if the Chile and Argentina energy revolution scenarios wind power installed capacity are to become a reality in 2020. (author)

  3. Monitoring the northern Chile megathrust with the Integrated Plate boundary Observatory Chile (IPOC) (United States)

    Schurr, Bernd; Asch, Günter; Cailleau, Beatrice; Diaz, Guillermo Chong; Barrientos, Sergio; Vilotte, Jean-Pierre; Oncken, Onno


    The oceanic Nazca plate subducts beneath the continental South American plate by recurrent rupture of large segments of its interface. The resulting earthquakes are among the largest and most frequent on Earth. Along the Chilean and southern Peruvian margin, all sizeable segments have ruptured at least once in the past 150 years for which there exist historic and/or instrumental records. The one segment that is most mature for re-rupture stretches for more than 500 km along the northernmost Chilean coast between roughly -23° and -18° latitude. It last broke in 1877 in a magnitude ~8.5 earthquake, triggering a major Tsunami. From the historical record, it has been known to have a recurrence cycle of approximately 110 years. The adjoining segments to the south and north broke rather recently in 1995 and 2001 in M>8 earthquakes and an M 7.7 earthquake intruded into the southern part of the seismic gap in 2007 between Antofagasto and Tocopilla. This makes northern Chile a unique natural laboratory to observe a subduction megathrust at various stages of its seismic cycle. For that purpose, installation of long-term observatories started in 2006 in a close cooperation of the Universidad de Chile (Santiago, Chile), the Universidad Catolica del Norte (Antofagasta, Chile), the Institut de Physique du Globe de Paris (France), and the GFZ German research Centre for Geosciences (Germany). Currently we are operating 17 modern seismological stations equipped with STS-2 broadband seismometers and accelerometers (EPI sensor). At least two more stations will be installed in the near future. Continuous GPS, tilt, creep, climate and magnetotellurics measurements are complementing the seismological part. A majority of the sites provide data near real-time. We will present results of seismic monitoring including analysis of the 2007 M7.7 Tocopilla earthquake sequence that was recorded during the installation stage of the observatory. We relocated the mainshock and about a one

  4. Production and consumption of energy in Chile 1987. Produccion y consumo de energia en Chile 1987

    Energy Technology Data Exchange (ETDEWEB)


    Presents information, at a national level, on production and consumption of various types of energy, including statistical data on commercial deals (hydrocarbons, coal) and the activities of the companies (hydromechanical energy, vegetable wastes for power generation and biogas). Electrical energy is described in detail. The first chapter presents an energy overview of the country and its energy sources, evaluating each one in order to obtain the total energy produced in Chile. The second chapter deals with electric power in the country, classifying power installed, generated and consumed by category of producer, consumer and generating type. The third chapter discusses the planned capacity of the Zonas Electricas, and the fourth chapter reviews the characteristics of the installations, production statistics, consumption and operation of the grid.

  5. CHILE'S RUSH TO FREE TRADE AGREEMENTS El frenesí de Chile por los Tratados de Libre Comercio

    Directory of Open Access Journals (Sweden)



    Full Text Available This article analyses the reasons for Chile's aggressive Free Trade Agreement (FTA policy. Assessing both how the Chilean government has converged with the export sector and how the government has been able to co-opt, soften and divide those on the losing side of any FTA policy, are key to understanding Chile's vast number of FTAs. However, FTAs are also a constitutive part of a country's foreign policy, which converts these accords into a vehicle for the achievement of state goals dealing with economic issues and power configurations and expectations. It is the interplay between domestic groups' interests and the state's foreign policy goals that explain Chile's rush to FTAs.Este artículo analiza las razones que llevan a Chile a implementar una política agresiva de Tratados de Libre Comercio (TLC. Para comprender el porqué del frenesí y del número de acuerdos se evalúa cómo el gobierno de Chile logra converger con el sector exportador, y cómo coopta, divide y disminuye a los grupos perdedores de esta política. Sin embargo, los TLC son además parte de la política exterior de un país; lo que hace de estos acuerdos un vehículo para alcanzar objetivos estratégicos para el Estado. Es la interrelación entre los intereses de grupos domésticos y los objetivos de política exterior del Estado los que explican el porqué del frenesí de Chile por alcanzar un alto número de TLC.

  6. Detailed Axial Morphology of the Chile Rise as it Approaches the Chile Triple Junction (United States)

    Blackman, D. K.; Henig, A. S.; Barroso, E.; Grevemeyer, I.; Thurber, A. R.; German, C. R.; Inspire Cruise Participants, T.


    New bathymetric mapping along the two southernmost Chile Rise spreading segments shows axial volcanic structure that had not been evident in prior data. On the first segment extending north from the triple junction, where the basement is not obscured by sediment, a narrow line of volcanic structures appears to track the center of the rift valley. However, the next segment north, which is offset almost 50 km along a transform fault, has axial volcanic features that vary in position within the rift valley. In the northern ~half of this segment, lineated small volcanic structures hug the eastern scarp of the rift whereas in the south they are apparent only along the western part of the valley floor. A classic ridge-transform intersection (RTI) nodal deep occurs at this southern end of the segment. The position of the basin is asymmetric relative to the axis, toward the ‘inside corner’ on the eastern side of the rift valley. It is intriguing that the nodal deep, which is often modeled as the result of viscous mantle upwelling and plate stresses at an RTI, is centered on the opposite side of the rift valley from where the most recent volcanic activity occurred. Presumably this reflects interplay between local magma plumbing and tectonic stresses. In addition to the local ridge-transform forces, regional factors associated with subduction along the edge of the Cocos plate may affect mantle flow, melting, and detailed plate kinematics. We will present maps that combine the new Simrad EM122 swath sonar data, obtained during cruise MV1003 aboard R/V Melville, with pre-existing German and Chilean bathymetric grids. We will also discuss some of the tectonic and magmatic implications of the observed detailed morphologic patterns. As one of the few areas on the globe where active subduction and spreading occur in close proximity, the southernmost Chile rise presents a natural laboratory for studying the manifestations of interaction between these processes.

  7. Energy from the Andes. The hydropower plant La Confluencia in Chile; Energie aus den Anden. Die Wasserkraftanlage La Confluencia in Chile

    Energy Technology Data Exchange (ETDEWEB)

    Mueller, Mathias [Hochschule Regensburg (Germany). Bauingenieurwesen


    The author of the contribution under consideration reports on the hydropower plant La Confluencia situated nearly 150 km south of Santiago de Chile (Chile). La Confluencia is a project development of a Norwegian-Australian joint venture of SN Power utilities (Oslo, Norway) and Pacific Hydro (Melbourne, Australia). Constructora Hochtief Tecsa (Santiago, Chile) took over the order to construct the plant completely including planning, construction, equipment and operation. The system concept was developed in collaboration with Poeyry Energy (Zurich, Switzerland). The plant design was devised in cooperation with Intertechne (Curitiba, Brazil), EDIC Ingenieros (Santiago, Chile) and Geocontrol (Madrid, Spain).

  8. An AP4B1 frameshift mutation in siblings with intellectual disability and spastic tetraplegia further delineates the AP-4 deficiency syndrome. (United States)

    Abdollahpour, Hengameh; Alawi, Malik; Kortüm, Fanny; Beckstette, Michael; Seemanova, Eva; Komárek, Vladimír; Rosenberger, Georg; Kutsche, Kerstin


    The recently proposed adaptor protein 4 (AP-4) deficiency syndrome comprises a group of congenital neurological disorders characterized by severe intellectual disability (ID), delayed or absent speech, hereditary spastic paraplegia, and growth retardation. AP-4 is a heterotetrameric protein complex with important functions in vesicle trafficking. Mutations in genes affecting different subunits of AP-4, including AP4B1, AP4E1, AP4S1, and AP4M1, have been reported in patients with the AP-4 deficiency phenotype. We describe two siblings from a non-consanguineous couple who presented with severe ID, absent speech, microcephaly, growth retardation, and progressive spastic tetraplegia. Whole-exome sequencing in the two patients identified the novel homozygous 2-bp deletion c.1160_1161delCA (p.(Thr387Argfs*30)) in AP4B1. Sanger sequencing confirmed the mutation in the siblings and revealed it in the heterozygous state in both parents. The AP4B1-associated phenotype has previously been assigned to spastic paraplegia-47. Identification of a novel AP4B1 alteration in two patients with clinical manifestations highly similar to other individuals with mutations affecting one of the four AP-4 subunits further supports the observation that loss of AP-4 assembly or functionality underlies the common clinical features in these patients and underscores the existence of the clinically recognizable AP-4 deficiency syndrome.

  9. DNA cleavage at the AP site via β-elimination mediated by the AP site-binding ligands. (United States)

    Abe, Yukiko S; Sasaki, Shigeki


    DNA is continuously damaged by endogenous and exogenous factors such as oxidation and alkylation. In the base excision repair pathway, the damaged nucleobases are removed by DNA N-glycosylase to form the abasic sites (AP sites). The alkylating antitumor agent exhibits cytotoxicity through the formation of the AP site. Therefore blockage or modulation of the AP site repair pathway may enhance the antitumor efficacy of DNA alkylating agents. In this study, we have examined the effects of the nucleobase-polyamine conjugated ligands (G-, A-, C- and T-ligands) on the cleavage of the AP site. The G- and A-ligands cleaved DNA at the AP site by promoting β-elimination in a non-selective manner by the G-ligand, and in a selective manner for the opposing dT by the A-ligand. These results suggest that the nucleobase-polyamine conjugate ligands may have the potential for enhancement of the cytotoxicities of the AP site.

  10. Subduction zone guided waves in Northern Chile (United States)

    Garth, Thomas; Rietbrock, Andreas


    Guided wave dispersion is observed in subduction zones as high frequency energy is retained and delayed by low velocity structure in the subducting slab, while lower frequency energy is able to travel at the faster velocities associated with the surrounding mantle material. As subduction zone guided waves spend longer interacting with the low velocity structure of the slab than any other seismic phase, they have a unique capability to resolve these low velocity structures. In Northern Chile, guided wave arrivals are clearly observed on two stations in the Chilean fore-arc on permanent stations of the IPOC network. High frequency (> 5 Hz) P-wave arrivals are delayed by approximately 2 seconds compared to the low frequency (wave arrivals. Full waveform finite difference modelling is used to test the low velocity slab structure that cause this P-wave dispersion. The synthetic waveforms produced by these models are compared to the recorded waveforms. Spectrograms are used to compare the relative arrival times of different frequencies, while the velocity spectra is used to constrain the relative amplitude of the arrivals. Constraining the waveform in these two ways means that the full waveform is also matched, and the low pass filtered observed and synthetic waveforms can be compared. A combined misfit between synthetic and observed waveforms is then calculated following Garth & Rietbrock (2014). Based on this misfit criterion we constrain the velocity model by using a grid search approach. Modelling the guided wave arrivals suggest that the observed dispersion cannot be solely accounted for by a single low velocity layer as suggested by previous guided wave studies. Including dipping low velocity normal fault structures in the synthetic model not only accounts for the observed strong P-wave coda, but also produces a clear first motion dispersion. We therefore propose that the lithospheric mantle of the subducting Nazca plate is highly hydrated at intermediate depths by

  11. Great Chile Earthquake of May 22, 1960 - Anniversary Edition (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — On May 22, 1960 (19:11 UTC), a Mw 9.5 earthquake occurred in southern Chile (39.5 S, 74.5 W). This was the largest earthquake ever instrumentally recorded. (It was...

  12. How Young Teachers Experience Their Professional Work in Chile (United States)

    Avalos, Beatrice; Aylwin, Pilar


    This paper presents results from a qualitative study of 15 neophyte teachers in Chile who were part of a survey of 242 teachers in two geographical regions of the country. They were studied on the basis of questionnaires, interviews, observations and focus groups, all of which served to examine their teaching contexts and working conditions, how…

  13. Radiation doses in neuroangiography for a clinical hospital in Chile

    International Nuclear Information System (INIS)

    The objective of this study is to estimate the levels of radiation to the patient in neuroangiography procedures diagnostic and therapy in a Chile's Hospital, using a biplane angiographic system Siemens model ArtisZee. This research was conducted under the auspices of the International Atomic Energy Agency and the support of their radiation protection programs for patients

  14. Transit Search from Antarctica and Chile - Comparison and Combination

    CERN Document Server

    Fruth, T; Csizmadia, Sz; Dreyer, C; Eigmüller, P; Erikson, A; Kabath, P; Pasternacki, T; Rauer, H; Titz-Weider, R; Abe, L; Agabi, A; Gonçalves, I; Guillot, T; Mékarnia, D; Rivet, J -P; Crouzet, N; Chini, R; Lemke, R; Murphy, M


    Observing sites at the East-Antarctic plateau are considered to provide exceptional conditions for astronomy. The aim of this work is to assess its potential for detecting transiting extrasolar planets through a comparison and combination of photometric data from Antarctica with time series from a midlatitude site. During 2010, the two small aperture telescopes ASTEP 400 (Dome C) and BEST II (Chile) together performed an observing campaign of two target fields and the transiting planet WASP-18b. For the latter, a bright star, Dome C appears to yield an advantageous signal-to-noise ratio. For field surveys, both Dome C and Chile appear to be of comparable photometric quality. However, within two weeks, observations at Dome C yield a transit detection efficiency that typically requires a whole observing season in Chile. For the first time, data from Antarctica and Chile have been combined to extent the observational duty cycle. This approach is both feasible in practice and favorable for transit search, as it i...

  15. Oil and Gas Emergency Policy: Chile 2012 update

    Energy Technology Data Exchange (ETDEWEB)



    Chile has experienced several serious energy supply incidents over the last decade, including major droughts, a sustained gas supply cut from Argentina (since 2004), and a major earthquake in early 2010 which affected electricity networks and refineries, and caused several black-outs. Due to Chile's unique and sinuous geography - it runs 4 300 kilometres from North to South and only 175 kms from East to West- the country's energy markets are regionally disjointed, particularly as the regional gas and electricity grids are not connected. In the arid North, energy demand is dominated by the mining industry, and operates based on a separate thermal-based Sistema Interconectado Norte Grande (SING) electricity grid. The more densely-populated central region (including Santiago) operates on the more hydro-dependent Sistema Interconectado Central (SIC) electricity grid. The southernmost, hydro-rich regions of the country are not connected to the rest of Chile in terms of electricity and gas. The following report is based on an IEA Emergency Response Assessment carried out in 2010 and 2011 which looked specifically at Chile's capacity to respond to short-term emergencies in oil, gas and electricity.

  16. Education with ICT in South Korea and Chile (United States)

    Sanchez, Jaime; Salinas, Alvaro; Harris, Jordan


    This article presents a linear-analytical case study on the development of ICT within the educational systems of Chile and South Korea. Through a comprehensive meta-data analysis and bibliographic review, we collected information on both educational systems and their ICT adoption policies. Key differences necessary to understand how both countries…

  17. Reshaping Power Markets-Lessons from Chile and Argentina


    Lalor, R. Peter; García, Hernán


    Power sector reforms in Chile and Argentina are now roughly fourteen and four years old. In both countries, restructuring and deregulation have increased efficiency, led to active entry by new generators, improved the quality of supply, and reduced prices in real terms. The authors' review of experience in both systems confirms that policymakers must apply effective measures to introduce a...

  18. Neoliberal Education and Student Movements in Chile: Inequalities and Malaise (United States)

    Cabalin, Cristian


    This article examines the major consequences of the neoliberal education system implemented in Chile during the dictatorship of Augusto Pinochet and how two important student movements contested this structure. In 2006 and 2011, thousands of students filled the streets to demand better public education, more social justice and equal opportunities.…

  19. Accreditation in Higher Education in Chile: Results and Consequences (United States)

    Espinoza, Oscar; Gonzalez, Luis Eduardo


    Purpose: The purpose of this paper is to analyze and discuss the results that the accreditation system implemented in Chile has brought to higher education institutions and undergraduate and graduate programs, taking into account both its positive and negative implications. Design/methodology/approach: The examination of the Chilean accreditation…

  20. The New Student Loan System in Chile's Higher Education (United States)

    Larrain, Christian; Zurita, Salvador


    Chile's higher education system stands out as being one of the most privatized and open to the market in the world. Recently, the Chilean Congress passed Law #20.027 of 2005, which provides the legal framework for the creation of a student loan system guaranteed both by the State and by higher education institutions (HEIs), financed by the private…

  1. Gender Effects of Social Security Reform in Chile


    Cox Edwards, Alejandra


    In 1981 Chile replaced a mature government-run social security system that operated on a pay-as-you-go basis with a privately managed system based on individual retirement accounts. The new system is more fiscally sustainable because pension benefits are defined by contributions. The minimum pension guaranteed to beneficiaries with at least 20 years is funded from general taxes, preserving...

  2. How Local Market Pressures Shape Leadership Practices: Evidence from Chile (United States)

    Carrasco, Alejandro; Fromm, Germán


    Chile is well known worldwide for its extensive use of market-driven mechanisms in education. Using a case study strategy in three schools, this paper shows that "universal" voucher system and mixed provision (co-existence of subsidised private and state-funded schools) policies are reshaping school management practices. The paper draws…

  3. Creating Dialogues: Exploring the "Good Early Childhood Educator" in Chile (United States)

    Viviani, Maria


    The aim of this study was to explore the different ways in which a number of Chilean stakeholders conceptualise the "good early childhood educator" in Chile. In a context where new foreign narratives are increasingly dominating the field and the recent standardisation of the educators' professional role is being implemented, this…

  4. 75 FR 11583 - The Chile Fund, Inc.; Notice of Application (United States)


    ... From the Federal Register Online via the Government Publishing Office SECURITIES AND EXCHANGE COMMISSION The Chile Fund, Inc.; Notice of Application March 8, 2010. AGENCY: Securities and Exchange... Company Act of 1940 (the ``Act'') for an exemption from section 17(a) of the Act. Applicant: The...

  5. The Impact of Chile's School Feeding Program on Education Outcomes (United States)

    McEwan, Patrick J.


    Chile operates one of the oldest and largest school feeding programs in Latin America, targeting higher-calorie meals to relatively poorer schools. This paper evaluates the impact of higher-calorie meals on the education outcomes of public, rural schools and their students. It applies a regression-discontinuity design to administrative data,…

  6. [Health research and health technology assessment in Chile]. (United States)

    Espinoza, Manuel Antonio; Cabieses, Báltica; Paraje, Guillermo


    Health research is considered an essential element for the improvement of population health and it has been recommended that a share of the national health budget should be allocated to develop this field. Chile has undertaken efforts in the last decades in order to improve the governmental structure created to promote the development of health research, which has increased human resources and funding opportunities. On the other hand, the sustained economic growth of Chile in the last decades suggests that the health expenditure will maintain its increasing trend in the following years. This additional funding could be used to improve coverage of current activities performed in the health system, but also to address the incorporation of new strategies. More recently, health technology assessment (HTA) has been proposed as a process to support decisions about allocation of resources based on scientific evidence. This paper examines the relationship between the development of health research and the HTA process. First, it presents a brief diagnosis of the situation of health research in Chile. Second, it reviews the conceptual basis and the methods that account for the relationship between a HTA process and the development of health research. In particular, it emphasizes the relevance of identifying information gaps where funding additional research can be considered a good use of public resources. Finally, it discusses the challenges and possible courses of action that Chile could take in order to guarantee the continuous improvement of an articulated structure for health research and HTA.

  7. AP@home: The Artificial Pancreas Is Now at Home. (United States)

    Heinemann, Lutz; Benesch, Carsten; DeVries, J Hans


    In the past years the development of an artificial pancreas (AP) has made great progress and many activities are ongoing in this area of research. The major step forward made in the last years was moving the evaluation of AP systems from highly controlled experimental conditions to daily life conditions at the home of patients with diabetes; this was also the aim of the European Union-funded AP@home project. Over a time period of 5 years a series of clinical studies were performed that culminated in 2 "final studies" during which an AP system was used by patients in their home environment for 2 or 3 months without supervision by a physician, living their normal lives. Two different versions of the AP system developed within this project were evaluated. A significant improvement in glycated hemoglobin was observed during closed-loop conditions despite the fact that during the control period the patients used the best currently available therapeutic option. In addition, a "single-port AP system" was developed within the project that combines continuous glucose monitoring and insulin infusion at a single tissue site. By using such a combined device the patients not only have to carry one less device around, the number of access points through the skin is also reduced from 2 to 1. In summary, close cooperation of 12 European partners, both academic centers and industry, enabled the development and evaluation of AP systems under daily life conditions. The next step is to develop these into products in cooperation with commercial partners. PMID:26888971

  8. An alternatively spliced mRNA from the AP-2 gene encodes a negative regulator of transcriptional activation by AP-2.


    Buettner, R; Kannan, P; Imhof, A.; Bauer, R.; Yim, S O; Glockshuber, R; Van Dyke, M W; Tainsky, M A


    AP-2 is a retinoic acid-inducible and developmentally regulated activator of transcription. We have cloned an alternative AP-2 transcript (AP-2B) from the human teratocarcinoma cell line PA-1, which encodes a protein differing in the C terminus from the previously isolated AP-2 protein (AP-2A). This protein contains the activation domain of AP-2 and part of the DNA binding domain but lacks the dimerization domain which is necessary for DNA binding. Analysis of overlapping genomic clones spann...

  9. Hydrothermal Exploration at the Chile Triple Junction - ABE's last adventure? (United States)

    German, C. R.; Shank, T. M.; Lilley, M. D.; Lupton, J. E.; Blackman, D. K.; Brown, K. M.; Baumberger, T.; Früh-Green, G.; Greene, R.; Saito, M. A.; Sylva, S.; Nakamura, K.; Stanway, J.; Yoerger, D. R.; Levin, L. A.; Thurber, A. R.; Sellanes, J.; Mella, M.; Muñoz, J.; Diaz-Naveas, J. L.; Inspire Science Team


    In February and March 2010 we conducted preliminary exploration for hydrothermal plume signals along the East Chile Rise where it intersects the continental margin at the Chile Triple Junction (CTJ). This work was conducted as one component of our larger NOAA-OE funded INSPIRE project (Investigation of South Pacific Reducing Environments) aboard RV Melville cruise MV 1003 (PI: Andrew Thurber, Scripps) with all shiptime funded through an award of the State of California to Andrew Thurber and his co-PI's. Additional support came from the Census of Marine Life (ChEss and CoMarge projects). At sea, we conducted a series of CTD-rosette and ABE autonomous underwater vehicle operations to prospect for and determine the nature of any seafloor venting at, or adjacent to, the point where the the East Chile Rise subducts beneath the continental margin. Evidence from in situ sensing (optical backscatter, Eh) and water column analyses of dissolved CH4, δ3He and TDFe/TDMn concentrations document the presence of two discrete sites of venting, one right at the triple junction and the other a further 10km along axis, north of the Triple Junction, but still within the southernmost segment of the East Chile Rise. From an intercomparison of the abundance of different chemical signals we can intercompare likely characteristics of these differet source sites and also differentiate between them and the high methane concentrations released from cold seep sites further north along the Chile Margin, both with the CTJ region and also at the Concepcion Methane Seep Area (CMSA). This multi-disciplinary and international collaboration - involving scientists from Chile, the USA, Europe and Japan - can serve as an excellent and exciting launchpoint for wide-ranging future investigations of the Chile Triple Junction area - the only place on Earth where an oceanic spreading center is being actively subducted beneath a continent and also the only place on Earth where all known forms of deep

  10. AP1000 - the new standard for nuclear power

    International Nuclear Information System (INIS)

    Full text of publication follows: The AP1000 is the only Generation III+ reactor to receive Final Design Approval (FDA) from the Nuclear Regulatory Commission, and is expected to receive its Design Certification by the end of the year. Building on the proven features of current generation nuclear plants, the AP1000 combines experience with innovation into a design that surpasses current standards of safety and reliability. Use of passive safety features results in a simpler and more compact design that enhances safety, simplifies O and M requirements, and reduces capital and operating costs. At 1117 Mwe, the AP1000 is well suited for almost any grid system and will be fully competitive with combined-cycle gas and comparable fossil fuel plants. The AP1000 is ready to help launch a renaissance in new nuclear plant construction throughout the world. Maturity of Design: In excess of 1300 man-years and $400 million in development funding have been expended on the AP1000. It has undergone extensive, part scale testing at the system, sub-system and component level, in addition to a series of part scale integrated tests. The AP1000 is the most analyzed of the next generation reactors. Simplicity of Design/Economics: The AP1000 uses simplified and innovative passive safety systems to an unprecedented extent. Simplified passive safety systems provide reliable operation, reduced capital costs, and enhanced plant safety with large plant operating margins. The AP1000 features improved reliability through simplicity rather than addition of redundant safety trains. This simpler design is easier and less costly to operate and maintain than larger, more complex plants, while less equipment and smaller buildings translate into lower capital costs and shorter construction durations. After construction, economic benefit will be found in reduced operating and maintenance costs, largely due to reduced operating and maintenance staffing requirements. Construction aspects

  11. New records of biting midges from Argentina and Chile (Diptera: Ceratopogonidae Nuevos registros de Ceratopogonidae (Diptera para Argentina y Chile

    Directory of Open Access Journals (Sweden)

    Gustavo R. Spinelli


    Full Text Available New records are provided for 22 species of biting midges (Diptera: Ceratopogonidae from Argentina and Chile, 12 belonging to Forcipomyia Meigen, two to Atrichopogon Kieffer and Culicoides Latreille, and one to Leptoconops Skuse, Dasyhelea Kieffer, Paradasyhelea Macfie, Alluaudomyia Kieffer, Macrurohelea Ingram & Macfie and Palpomyia Meigen. Forcipomyia (F. harpegonata Wirth & Soria, F. (F. pictoni Macfie, F. (F. sexvittata Wirth, F. (Lepidohelea annulatipes Macfie, F. (L. kuanoskeles Macfie, F. (Phytohelea jocosa Saunders and F. (Thyridomyia nana (Macfie are firstly recorded from Argentina, and Leptoconops ricardoi Ronderos & Spinelli, Atrichopogon endemicus Spinelli & Marino, Culicoides chacoensis Spinelli & Wirth, Paradasyhelea brevipalpis (Ingram & Macfie and Alluaudomyia schnacki Spinelli are firstly recorded from Chile. Forcipomyia calchaqui Spinelli & Marino is removed from the subgenus Thyridomyia Saunders and assigned to the subgenus Synthyridomyia Saunders.Se brindan nuevas citas de 22 especies de Ceratopogonidae para Argentina y Chile, de las cuales 12 pertenecen a Forcipomyia Meigen, dos a Atrichopogon Kieffer y Culicoides Latreille, y una a Leptoconops Skuse, Dasyhelea Kieffer, Paradasyhelea Macfie, Alluaudomyia Kieffer, Macrurohelea Ingram & Macfie y Palpomyia Meigen. Forcipomyia (F. harpegonata Wirth & Soria, F. (F. pictoni Macfie, F. (F. sexvittata Wirth, F. (Lepidohelea annulatipes Macfie, F. (L. kuanoskeles Macfie, F. (Phytohelea jocosa Saunders y F. (Thyridomyia nana (Macfie son registradas por primera vez para Argentina, mientras que Leptoconops ricardoi Ronderos & Spinelli, Atrichopogon endemicus Spinelli & Marino, Culicoides chacoensis Spinelli & Wirth, Paradasyhelea brevipalpis (Ingram & Macfie y Alluaudomyia schnacki Spinelli lo son para Chile. Se excluye Forcipomyia calchaqui Spinelli & Marino del subgénero Thyridomyia Saunders y se la asigna a Synthyridomyia Saunders.

  12. Learning through delivery, Westinghouse AP1000 plant construction

    International Nuclear Information System (INIS)

    The AP1000 plant, which is a 1100 MWe class pressurized water reactor with passive safety features, is designed around a conventional 2 loop, 2 steam generator primary system configuration with 2 hot legs, 4 reactor coolant pumps directly mounted in the steam generator lower head and 4 cold legs. A particular feature of AP1000 is its modular construction to minimize the time and cost of construction. Modular construction allows activities to be run in parallel, it allows more activities to be performed in a controlled factory instead of in the field, and it provides a better level of quality. The AP1000 plant design includes 106 structural modules and 52 mechanical modules. Structural modules include all penetrations for piping, cable trays, HVAC duct runs, and all reinforcement for pipe, equipment hangers, and supports. Structural modules are shipped in sub-modules to support transportation by rail or truck or barge. Mechanical modules contain equipment such as pumps, tanks, heat exchangers, air-handling units, and filters along with interconnecting pipes, valves, instruments, wiring and support services. Modular construction requires strong coordination between engineering, supply chain and construction. A total of 8 AP1000 units are currently under construction in China and in the United States. The lessons learned and best practices of each new AP1000 construction are systematically incorporated into the standard design. (A.C.)

  13. Past, Present, and Future of AP Chemistry: A Brief History of Course and Exam Alignment Efforts (United States)

    Magrogan, Serena


    As part of the Advanced Placement (AP) Program's commitment to continually enhance alignment with current best practices in college-level learning, the AP Program is currently evaluating and redesigning courses and exams, one of which launched during the 2013-2014 academic school year: AP chemistry. The history of the AP chemistry course and…

  14. AP Report to the Nation: A Closer Look at the Nation and Florida (United States)

    Sawtell, Ellen A.; Gillie, Jacqueline M.; Smith, Patricia Z.


    In February 2012, the College Board published The 8th Annual AP Report to the Nation. This session provides a deeper dive into key information for the United States with an emphasis on Florida, and participants hear how one school in Florida utilizes AP Potential™ to help build their AP Program. Participants also learn about AP participation and…

  15. Meloidogyne incognita Inoculum Source Affects Host Suitability and Growth of Yellow Nutsedge and Chile Pepper. (United States)

    Thomas, S H; Schroeder, J; Kenney, M J; Murray, L W


    Meloidogyne incognita (Mi) reproduction and host plant responses in chile pepper (Capsicum annuum) and yellow nutsedge (Cyperus esculentus = YNS) to three sources of inoculum obtained by rearing a single Mi population on chile, YNS, and tomato were evaluated in two factorial greenhouse experiments. The interactive effects of Mi inoculum source and crop-weed competition were determined. In the absence of YNS competition, chile growth was reduced less by Mi inoculum from chile than by inoculum from YNS or tomato. When YNS was present, chile root weight was not affected and shoot weight increased with Mi initial inoculation, regardless of inoculum source. Chile plants inoculated with Mi from tomato exhibited double the nematode reproduction observed with inoculum from chile or YNS. With chile present, Mi reproduction on YNS was nearly three times greater with inoculum from tomato, but reproduction was similar among inoculum sources when chile was absent. Reductions in YNS root mass due to competition from chile failed to reduce the total number of Mi eggs produced on YNS plants. Differences in total Mi reproduction among inoculum sources were not attributable to differences in root growth or plant competition. This study illustrates the influence of Mi-YNS interactions and previous hosts on severity of Mi infection. PMID:19274174

  16. Jazz en Chile: su historia y función social Jazz in Chile: its history and social function

    Directory of Open Access Journals (Sweden)

    Álvaro Menanteau


    Full Text Available Este artículo presenta una visión general de la historia del jazz en Chile que destaca la función social de esta música y el cambio que tuvo a través del tiempo. Estos cambios se relacionaron con diferentes valoraciones de la práctica jazzística local. En un principio el jazz fue música popular masiva. Posteriormente fue valorado estéticamente por un segmento de élite, quienes eran profesionales en áreas no musicales y en muchos casos eran instrumentistas aficionados. En una tercera etapa, músicos profesionales asumieron la práctica del jazz como una plataforma para fusionar el lenguaje jazzístico con recursos tomados de la música tradicional chilena. Este tránsito del jazz en Chile está cruzado por factores socioeconómicos y estéticos, que se analizan en el trabajo.The article presents an overview of the history of jazz in Chile on the basis of the social function of jazz and the changes it has underwent over the years in terms of the valúes it has represented for Chilean society. Initially jazz was considered as mass popular music. Afterwards it was valued in aesthetic terms by a group belonging to the élite of Chilean society. Many of them belonged to non-music professions and in some cases were amateur musicians. Most recently professional musicians took up jazz as the basis for combining the jazz style with elements belonging to traditional music of Chile. This process in Chile is also influenced by social, economic and aesthetic aspects which are explored in this article.

  17. Vibration analysis of primary air pump JE01 AP003

    International Nuclear Information System (INIS)

    JE01 AP003 primary coolant pump is one of the main components in the safe operation of the reactor so that needs to be done early detection of damage types and levels of its constituent components. The main components of the pump that is often damaged bearing. The purpose of this paper is to know the symptoms of bearing damage and the level of damage based on vibration analysis. One indication of the bearing has been damaged, that is the vibration or temperature rise in the bearing. One way to detect early symptoms of damage to the pump is to use the vibration response peak Based on the analysis of the measurement results cited the obtained results that the primary coolant pump JE01 AP003 has been damage to a free end looseness bearing with moderate levels of damage. Need JE01 AP003 bearing replacement even though the damage is not severe. (author)

  18. Experience with the EPICS PV Gateway at the APS

    CERN Document Server

    Evans, Kenneth


    The EPICS PV Gateway has become a stable, high-performance application that provides access to process variables while minimizing the impact on critical IOCs and implementing additional access security. The additional access security typically prevents write access but is highly configurable. The Advanced Photon Source (APS) currently uses 40 Gateways running on 11 machines to provide access to the machine network from the offices and for the individual experimental teams. These include reverse Gateways that allow administration of all 40 APS Gateways from a single MEDM screen, even though the Gateways are running on separate networks. This administration includes starting, stopping, making and viewing reports, and viewing and editing access security files. There is one Gateway that provides process variable renaming. This paper provides an overview of the Gateways at the APS and describes the procedures that have been set up to use and administer them.

  19. PKA-activated ApAF–ApC/EBP heterodimer is a key downstream effector of ApCREB and is necessary and sufficient for the consolidation of long-term facilitation


    LEE, Jin-A; Lee, Sue-Hyun; Lee, Changhoon; Chang, Deok-Jin; Lee, Yong; Kim, Hyoung; Cheang, Ye-Hwang; Ko, Hyoung-Gon; Lee, Yong-Seok; Jun, Heejung; Bartsch, Dusan; Kandel, Eric R.; Kaang, Bong-Kiun


    Long-term memory requires transcriptional regulation by a combination of positive and negative transcription factors. Aplysia activating factor (ApAF) is known to be a positive transcription factor that forms heterodimers with ApC/EBP and ApCREB2. How these heterodimers are regulated and how they participate in the consolidation of long-term facilitation (LTF) has not, however, been characterized. We found that the functional activation of ApAF required phosphorylation of ApAF by PKA on Ser-2...

  20. Transcriptional Regulation of the AP-2α Promoter by BTEB-1 and AP-2rep, a Novel wt-1/egr-Related Zinc Finger Repressor


    Imhof, Axel; Schuierer, Marion; Werner, Oliver; Moser, Markus; Roth, Christina; Bauer, Reinhard; BUETTNER, REINHARD


    AP-2 transcription factors have been suggested to exert key regulatory functions in vertebrate embryonic development, in tumorigenicity of various cancer cell types, and in controlling cell cycle and apoptotic effector genes. In this study, we investigated transcriptional regulation of the AP-2α gene promoter mediated by an autoregulatory element (referred to as A32) with a core consensus AP-2 binding site at position −336 relative to the mRNA initiation site. AP-2 and multiple different nucl...

  1. Miniature Autonomous Star Tracker Based on CMOS APS


    Ying, Dong; Zheng, You; Fei, Xing; Qin, Chou


    An APS (Active Pixel Sensor) based autonomous star tracker (AAST) has been proposed for small satellite and microsatellite attitude determination. A prototype of AAST has been developed. It has low mass of 1kg, low power of 3W, high rate up to 5Hz, and acquisition success rate of higher than 99.9%. The improvements in dimensions and performances are realized with the replacement of the CCD (Charge Coupled Device) by the APS. The optical design of the prototype is based on PSF (Point Spread Fu...

  2. SN 2002ap, the hypernova of class Ic


    Pandey, S. B.; Sahu, D. K.; Anupama, G. C.; Bhattacharya, D; Sagar, Ram


    The supernova SN 2002ap was discovered in the outer regions of the nearby spiral M74 on January 29.4 UT. Early photometric and spectroscopic observations indicate the supernova belongs to the class of Ic hypernova. Late time (After JD 2452500) light curve decay slopes are similar to that of the hypernovae SN 1997ef and SN 1998bw. We present here the $BVRI$ photometric light curves and colour evolutions of SN 2002ap to investigate the late time nature of the light curve.

  3. ESO Delegation to Visit Chile: the Chile-Eso Treaty and Paranal (United States)


    The ESO Council, in its extraordinary session on 28 April 1994, among other matters discussed the relations with the Republic of Chile and the situation around Paranal mountain [1], the designated site for the ESO Very Large Telescope (VLT). Council decided to send a high ranking delegation to Santiago de Chile to discuss with Chilean authorities the pending problems, including the finalisation of the new Treaty between the Republic of Chile and ESO and the legal aspects of the Paranal location. The ESO delegation will consist of Dr. Peter Creola (President of ESO Council), Dr. Catherine Cesarsky (Vice-President of ESO Council), Dr. Henrik Grage (Former Vice-President of ESO Council) and Professor Riccardo Giacconi (ESO Director General), the latter accompanied by his advisers. The delegation will arrive in Chile during the second half of May 1994. The ESO delegation will meet with the Chilean Minister of Foreign Affairs, Mr. Carlos Figueroa, and the Secretary of State in the Ministry of Foreign Affairs, Mr. Jose Miguel Insulza. Other meetings at high level are being planned. The delegation will report about these discussions to the ESO Council during its ordinary session on 7 - 8 June 1994. FOUR PARANAL PHOTOS AVAILABLE A series of four photos which show the current status of the work at Paranal has been prepared. Photographic colour prints for use by the media can be requested from the ESO Information and Photographic Service (please remember to indicate the identification numbers). [1] See ESO Press Release 07/94 of 21 April 1994. PHOTO CAPTIONS ESO PR PHOTO 08/94-1: CERRO PARANAL This aerial photo of the Paranal mountain, the designated site for the ESO Very Large Telescope (VLT), was obtained on 22 March 1994. Paranal is situated in the driest part of the Chilean Atacama desert, approx. 130 km south of the city of Antofagasta, and about 12 km from the Pacific Ocean. In this view towards the West, the ocean is seen in the background. The altitude is 2650 metres

  4. Berberine inhibits cyclin D1 expression via suppressed binding of AP-1 transcription factors to CCND1 AP-1 motif

    Institute of Scientific and Technical Information of China (English)

    Ye LUO; Yu HAO; Tai-ping SHI; Wei-wei DENG; Na LI


    Aim: To verify the suppressive effect of berberine on the proliferation of the human pulmonary giant cell carcinoma cell line PG and to demonstrate the mecha-nisms behind the antitumoral effects of berberine. Methods: The proliferative effects of PG cells were detected by 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide colorimetry. The cell cycle was examined by flow cytometry. The expression level of cyclin D1 was detected by RT-PCR. The activities of the activating protein-1 (AP-1) and NF-κB signaling pathways related to cyclin D1 were examined by luciferase assay. The cytoplasmic level of c-Jun was detected by Western blot analysis. An electrophoretic mobility shift assay was used to examiae the binding of transcription factors to the cyclin D1 gene (CCNDl) AP-1 motif. Results: The results showed that the proliferation of PG cells treated with different concentrations (10, 20, and 40 μg/mL) of berberine for 24 and 48 h was suppressed significantly compared to the control group. After treatment with berberine, the proportion of PG cells at the G0/G1 phase increased, while cells at the S and G2/M phases decreased. Berberine could inhibit the expression of cyclin D1 in PG cells. Berberine inhibited the activity of the AP-1 signaling pathway, but had no significant effect on the NF-κB signaling pathway. Berberine suppressed the expression of c-Jun and decreased the binding of tran-scription factors to the CCND1 AP-1 motif. Conclusion: Berberine suppresses the activity of the AP-1 signaling pathway and decreases the binding of transcrip-tion factors to the CCND1 AP-1 motif. This is one of the important mechanisms behind the antitumoral effects of berberine as a regulator of cyclin D1.

  5. El estado de la seguridad ciudadana en Chile


    de Rementería, Ibán


    Este artículo desarrolla, desde una perspectiva crítica, un detallado “estado del arte” de la temática de “seguridad ciudadana” en Chile, delineando cómo esta problemática obedece más bien a una percepción de inseguridad instalada en la ciudadanía desde los medios de comunicación, y legitimada por los expertos interesados en asegurar la sostenibilidad de sus servicios en el emergente “mercado de la seguridad.” Se sostiene en el ensayo que en Chile la situación de seguridad ciudadana es la mej...

  6. [Mental health financing in Chile: a pending debt]. (United States)

    Errázuriz, Paula; Valdés, Camila; Vöhringer, Paul A; Calvo, Esteban


    In spite of the high prevalence of mental health disorders in Chile, there is a significant financing deficit in this area when compared to the world's average. The financing for mental health has not increased in accordance with the objectives proposed in the 2000 Chilean National Mental Health and Psychiatry Plan, and only three of the six mental health priorities proposed by this plan have secure financial coverage. The National Health Strategy for the Fulfilment of Health Objectives for the decade 2011-2020 acknowledges that mental disorders worsen the quality of life, increase the risk of physical illness, and have a substantial economic cost for the country. Thus, this article focuses on the importance of investing in mental health, the cost of not doing so, and the need for local mental health research. The article discusses how the United States is trying to eliminate the financial discrimination suffered by patients with mental health disorders, and concludes with public policy recommendations for Chile.

  7. International Uranium Resources Evaluation Project (IUREP) national favourability studies: Chile

    International Nuclear Information System (INIS)

    Chile has an area of 740,760 square kilometers. The capital is Santiago. The country is 4,183 km. long and ranges from 22.5 to about 354 km. in width. Its chief topographic features para]lei each other - the Coastal Range, Andes Mountains and Central Valley. The Coastal Range rises to 2,130 meters in the north, but averages from 610 to 700 meters high generally. The range plunges into the Pacific Ocean far south of Valparaiso and reappears in the southern archipelagic islands. The Andes extend along nearly the entire length of Chile and contain 100 volcanoes. Andean peaks range mostly from 3,000 to 6,700 meters in elevation. In southern Chile the Andes are lower, and contain about a dozen major lakes. The mountains disappear in Chilean Patagonia, but reappear at Cape Horn. The Central Valley lies between the Coastal Range and the Andes, being best defined in the midland region as a 64 to 72 km sloping plain. It is the Chilean heartland with three-quarters of the country's population. Salt basins are found over much of northern Chile in the very arid desert, while the region south of the Gulf of Reloncavi consists of unpopulated islands, fjords, channels and heavily forested mountains. The Strait of Magellan, the Tierra del Fuego archipelago and a flat grassland area make up the extreme southern end of the country. Much of Chile is subject to flash floods, earthquakes, volcanic eruptions, landslides and avalanches. In September 1976 the Comision Chilena de Energia Nuclear (CCEN) was given exclusive rights to negotiate contracts with private companies for the exploration, development and mining of uranium and other radioactive minerals. The new law provides the CCEN with considerable flexibility in the terms of the contracts. Pre-964 owners of uranium deposits may reach agreements with foreign companies to mine the uranium, but since 1964 all uranium has belonged to the state. Uranium produced in the country can only be exported after Chile's needs have been met. The

  8. Reforma educativa y política en Chile

    Directory of Open Access Journals (Sweden)

    Alan Angell


    Full Text Available This article examines two important educational reforms introduced since the return to democracy in Chile. The first one was targeted at the poorest 10% of schools in Chile. The second was a fundamental reform of the primary educational sector. Both have been successful in meeting their objectives, and mark a fundamental shift from the educational reforms of the Pinochet government. The reasons for the success of the reforms are broken down into political, institutional and operational factors. In essence, a small team of trained educational reformers, with widespread support and strong backing from the Minister of Education and the President were able to overcome the resistance of the bureaucrats of the Ministry of Education and that of the school teachers union.

  9. [Chile: political education and a critical reading of television]. (United States)

    Mattelart, M


    A study of television was conducted in Chile in 1971. There is a discontinuous aspect in the requests of the public, especially in times of crisis and rupture with the traditional order. In order to measure the various levels of appreciation and critique raised by the television in various areas of the working class in Chile, the poblaciones (peripheric residential zones) were chosen as the place for the study. 100 interviews were conducted. 60% of the people questioned were sympathizers or militants of the various left wing parties; the other 40% were sympathizers or militants of the opposition (Christian democracy, National party and right wing of the radical party). Television does not make any distinction between the publics, but the public makes distinctions between the effects of television. Melodramas and detective programs have the largest adhesion in the popular public of Latin America. PMID:12261387

  10. Nuevos inmigrantes en Chile: Los determinantes de su actividad emprendedora

    Directory of Open Access Journals (Sweden)

    Claudio MANCILLA


    Full Text Available En Chile es poca la literatura que estudia a los inmigrantes desde una perspectiva económica, y menos la que aborda su actitud emprendedora (a pesar de que son proporcionalmente más emprendedores que los habitantes locales. El objetivo de este trabajo es estudiar los factores que influyen en el emprendimiento de los in - migrantes sudamericanos en Chile. Se utilizó un modelo logit ajustado para even - tos extraños para determinar el impacto sobre la probabilidad de emprendimiento individual. Algunos resultados indican que el tiempo de residencia, forma legal de ingreso al país, nivel educacional y experiencia previa de emprendimiento, influyen en la probabilidad de crear una actividad empresarial.

  11. [Adult mortality from chronic diseases in Chile, 1968-1990]. (United States)

    Taucher, E; Albala, C; Icaza, G


    "The paper starts with a brief analysis of the sources and the quality of the data and the mortality indices [for trends in adult mortality from chronic diseases in Chile]....A comparison is made of mortality among the 13 regions of the country and an attempt is made to relate the observed differences to some environmental and life-style factors. Rural-urban and educational differences of mortality by cause of death are also analyzed. The paper ends by comparing mortality by chronic disease in Chile with that of other countries of the Latin American region, noting some difficulties [in] such a comparison and proposing hypotheses for future studies." (SUMMARY IN ENG) PMID:12290226

  12. [Public health infrastructure investment difficulties in Chile: concessions and public tenders]. (United States)

    Goyenechea, Matías


    This paper seeks to highlight the problems of gaps in health infrastructure in Chile, and to analyze the mechanisms by which it is provided. In Chile this is done in two ways: the first is through competitive bidding or sector-wide modality. The second way is through hospital concessions. Both mechanisms have had difficulties in recent years, which are reported. Finally, we propose ways to improve the provision of health infrastructure in Chile. PMID:27187810

  13. Disintegration in Peru - consolidation in Chile: the case for militant Capitalism in Latin America


    Quinn, Edward J.


    Approved for public release; distribution is unlimited. Over the past two decades, Peru and Chile have each experienced both military regimes and civilian governments. Peru's experience has been dominated by the political left; Chile's by the right. In contrast to Peru's populist politics and interventionist economics, Chile, in 1973, experienced a militant capitalist revolution. Almost twenty years later, Peru is a nation torn by political violence of both the left and right; on the brink...

  14. Penetration dynamics of AP8 in thin ceramic tiles

    NARCIS (Netherlands)

    Abadjieva, E.; Khoe, Y.S.


    The interaction of thin ceramic tiles with AP8 (WC core, 7,62 mm) at 1000 m/s velocity has been studied experimentally and numerically. “Thin” ceramic tiles refers here to ratio of the tile thickness (t) to the projectile diameter, (d), t/d@ 1, as they are both in the same order. The method applied

  15. Time Trials--An AP Physics Challenge Lab (United States)

    Jones, David


    I have come to the conclusion that for high school physics classroom and laboratory experiences, simpler is better! In this paper I describe a very simple and effective lab experience that my AP students have thoroughly enjoyed year after year. I call this lab exercise "Time Trials." The experiment is simple in design and it is a lot of fun for…

  16. The AP Lever for Boosting Access, Success, and Equity (United States)

    Roegman, Rachel; Hatch, Thomas


    Four New Jersey school districts worked together to increase student achievement by applying a number of strategies focused on getting traditionally underrepresented students to take more AP courses. The districts are members of the New Jersey Network of Superintendents (NJNS), comprising 15 superintendents who work together to develop systemwide…

  17. The New AP Chemistry Exam: Its Rationale, Content, and Scoring (United States)

    Price, Paul D.; Kugel, Roger W.


    The 2013-2014 academic year marks the rollout of the redesigned advanced placement (AP) chemistry course and exam. There have been many questions as to why the course was redesigned and how the new examination will differ from its legacy version. In this article we give a brief overview of the legacy course and examine why a redesign occurred in…

  18. Integrating Particulate Representations into AP Chemistry and Introductory Chemistry Courses (United States)

    Prilliman, Stephen G.


    The College Board's recently revised curriculum for advanced placement (AP) chemistry places a strong emphasis on conceptual understanding, including representations of particle phenomena. This change in emphasis is informed by years of research showing that students could perform algorithmic calculations but not explain those calculations…

  19. Growth, Poverty and Employment in Brazil, Chile and Mexico


    Eduardo Zepeda; Diana Alarcón; Fabio Veras Soares; Rafael Guerreiro Osório


    Insufficient labour income and limited access to employment are critical problems that policy makers must address when designing development strategies in Latin American countries. The persistence of the high incidence of poverty and inequality can be explained largely by the poor performance of labour markets. This Working Paper uses household survey data for Chile, Brazil and Mexico, from the early 1990s to the early 2000s, to examine the link between the growth of labour income, employment...

  20. Physical dating violence among college students in Chile


    Lehrer, Jocelyn A.; Lehrer, Vivian L.; Lehrer, Evelyn Lilian; Zhao, Zhenxiang


    Dating violence is a serious public health concern both per se and because victimization in the young adult years can be a precursor to more severe incidents of domestic violence later, in the context of cohabitation or marriage. To date, no quantitative studies have examined dating violence among college students in Chile. To address this gap, a survey on this topic was administered to students at a major public university. The present analyses focused on the female sample (n=441). Generaliz...





    This article analizes the installation in Chile of a neoliberal model during the military regime headed by General Augusto Pinochet, between 1973 and 1979. Within that context, it offers a reinterpretation of the allegedly foundational character of that government, its also supposedly early adherence to the neoliberal matrix, and its break with the Keynesian capitalism which had prevailed since the 1930’s. The analysis is focused on the evolution of military with regard to the links between t...

  2. Improving the effectiveness of rural development policy in Chile


    Carter Leal, L.M.


    In Chile, agriculture remains a key economic factor for rural development. Accordingly, the Chilean government, through the Agricultural Development Institute (INDAP), provides financial support for fostering entrepreneurship among small farmers to enable them to become more competitive in global markets. Despite this support, a declining number of farmers and an aging population are observed in rural areas. Most rural development programs focus on increasing competitiveness, whereas the stay...

  3. Nota técnica: Seguridad vial: Chile


    Banco Interamericano de Desarrollo (BID)


    Esta nota sectorial ha servido de apoyo para el dialogo con el Gobierno Chileno en la preparación de la estrategia país del BID con Chile 2011-2014. En este se describe el estado de la situación de la seguridad vial en el país, se realiza un diagnostico del sector, se exponen los desafíos de desarrollo y se realizan recomendaciones de política.

  4. Residential Segregation Effects on Poor’s Opportunities in Chile


    Osvaldo Larrañaga Jiménez; Claudia Sanhueza Riveros


    This paper aims to identify whether or not the spatial concentration of poverty –also called economic residential segregation- affects the opportunities of the poor in Chile. Residential segregation is understood as the concentration particular population groups in determined geographical areas within cities. To identify the effects of segregation we use a panel of cross sections of the Casen household surveys, although the measures of segregation are computed from the Census data. The result...

  5. Social Protection Systems in Latin America and the Caribbean: Chile


    Claudia Robles Farías


    Chile has a long history of implementing social policies. It was one of the first countries in Latin America to expand free health care coverage and education, incorporating cash and in-kind transfers to promote access to social services and offer diverse protection mechanisms for its most vulnerable population groups. That said, its current social protection model is the result of a series of efforts, institutions and policies that have been consolidated over time.(?)

  6. Managing Natural Resources Revenue: The case of Chile


    J. Rodrigo Fuentes


    Countries abundant in natural resources face the dilemma of how to manage this source of revenues. The recent boom in commodity prices put this issue at the top of the agenda in natural resource rich economies. Chile, for instance, is the largest copper producer in the world, supplying 43% of world copper exports. In 2007, the state-owned corporation, CODELCO, produced one third of total Chilean copper output and the revenues from its copper exports accounted for 16% of total fiscal revenues....

  7. Talcahuano, Chile, in the wake of the 2010 disaster


    Engel, Karen E.


    Because of Chile’s geographical position, earthquakes and tsunamis are recurrent phenomena and reducing vulnerability to these events is imperative. To do this, one needs to understand the geophysical features of the hazards involved and the vulnerability that exposed communities live with. This article presents some unexpected findings of a research regarding the latter and devised to investigate the vulnerability realities that the devastating 2010 earthquake/tsunami event in Chile exposed....


    Directory of Open Access Journals (Sweden)

    Olga Ulianova


    Full Text Available Reconociendo al comunismo como un actor nacional e internacional clave en la evolución política de Chile durante el siglo XX, que tempranamente vincula el país con la política mundial, el artículo pretende reconstruir, contrastando la documentación de los archivos kominternianos con las fuentes memorialísticas y periodísticas locales, una de las primeras y más enigmáticas formas de la vinculación del movimiento comunista mundial con su partido chileno: la presencia intermitente en el país, entre las décadas de 1920 y 1930, de "delegados" o "emisarios" del Komintern. El análisis de las formas de la interacción de los emisarios kominternianos no solo con la militancia criolla, sino con importantes sectores de la sociedad nacional, contribuye a la reflexión acerca de la dimensión internacional en la construcción de la cultura política chilena del siglo XX.The article analyzes the interaction between Soviet Komintern emissaries and local communist followers as well as important sectors of Chilean society. It recognizes that communism was a key national and international factor in Chile's political evolution during the twentieth century, when the country was closely linked with world politics. This contributes to the discussion regarding the international dimensión of the construction of Chile's political culture during the twentieth century. The article reconstructs one of the first and enigmatic forms of linking the world communist movement and Chile's Communist Party. Documents from Komintern archives, memories and local press sources, were used to explore this topic.





    This paper is intended to contribute to the understanding of the motivations behind the diversification decisions of the Chilean “economic groups”. With this objective we surveyed the largest such groups in Chile. Our results show that the most important reasons for diversification for the top management of the Chilean business groups are managerial synergies (board of directors), financial synergies, information synergies and some specific operational synergies such as economies of scope in ...

  10. Price elasticity of demand for toll roads in Chile


    Rodrigo Saens; Germán Lobos


    The efficiency of a road pricing scheme to optimize the use of transport infrastructure depends on the available information regarding the price elasticity of demand for bridges, tunnels and highways. The aim of this paper is to estimate the price elasticity of demand for toll roads in Chile using the seemingly unrelated regressions (SUR) method and a panel of 48 monthly data drawn from 21 toll plazas (48 x 21). Our results show that, even when controlling for gasoline prices and economic act...

  11. Business Incubator Financing and Financial Services in Chile


    Aruna Chandra; Magda Narczewska


    Business incubation in Chile is still in its nascent stages, with approximately 20-25 incubators supported primarily by a coalition of government and universities. Chilean business incubators tend to capitalize on regional resource strengths and have a strategic focus on high growth, high innovation, high impact businesses as a result of a government mandate to focus on developing business with high potential for economic development and job creation. The government’s efforts to organize risk...

  12. Variables perceptuales y emprendimiento naciente en Chile: oportunidad versus necesidad


    Lennon Sabatini, Joaquin; Franetovic Parker, Francisco


    In this work we seek to assess how perception variables affect on the timely decision to undertake in Chile, measured by the nascent entrepreneurship, ie, those entrepreneurs who are starting a new business, including any form of self-employment or commersialisation of all types of goods or services. This, controlling for other relevant variables of demographic and economic nature . It seems particularly interesting to quantify how affect self-confidence, perception of opportunity, fear of fa...

  13. Employment Generation, Firm Size, and Innovation in Chile


    Roberto Alvarez; José Miguel Benavente; Rolando Campusano; Conrado Cuevas


    This paper compiles and analyzes several sources of information to shed light on the relationship between innovation and employment growth in the manufacturing industry in Chile in the last 15 years. Our overall conclusions are that process innovation is generally not found to be a relevant determinant of employment growth, and that product innovation is usually positively associated with an expansion in employment. These results seem to be similar regardless of firm size and hold for both lo...

  14. Cultural experiences of immigrant nurses at two hospitals in Chile


    Gabriel Rodríguez; Luz Angélica-Muñoz; Luiza Akiko Komura Hoga


    OBJECTIVE: to explore the cultural experiences of nurses who immigrated to Chile. The study´s theoretical framework was the Purnell Model for Cultural Competence.METHOD: Leininger's Observation-Participation-Reflection method was developed at two hospitals in the city of Santiago, and ethnographic interviews were held with 15 immigrant nurses.RESULTS: among Purnell's 12 domains, the following were identified: Overview/heritage, Communication, Workforce issues, Family roles and organization, B...

  15. Reviews of National Policies for Education : Tertiary Education in Chile


    Mogollón, Maria Paulina; Crawford, Michael


    Tertiary education in Chile has been transformed radically over the past 20 years. As recently as 1990, tertiary education was an elite system centered on a handful of traditional universities which served a small number of well-prepared students. Today the system is diverse and dynamic, with over 6,000 programs of study offered by more than 200 institutions. More than 800,000 students are...

  16. Revisiting the Source Process of the 2007 Tocopilla, Chile Earthquake (United States)

    Simons, M.; Minson, S. E.; Jolivet, R.; Jiang, J.; Beck, J. L.


    We revisit the 2007 Mw 7.7 Tocopilla, Chile earthquake to create a finite fault kinematic source model based on the current best practices in data analysis and inversion methods. The data used to constrain the source model include both static GPS offsets and 1 Hz kinematic GPS time series, as well as interferograms which have been reanalyzed to remove tropospheric effects which can be quite significant in this region. Our inversion methodology is a Bayesian approach that uses only physics-based constraints on the rupture evolution, and which utilizes models of both the observational noise and the errors in our forward model to obtain the ensemble of all plausible rupture models which satisfy both the data and our a priori assumptions. This approach allows us to better understand which parts of the rupture process are well-constrained and which are not, and thus to better understand how the 2007 Tocopilla, Chile earthquake rupture fits into the sequence of large earthquakes which have been mosaicking the northern Chile subduction zone.

  17. [Early detection of cervical cancer in Chile: time for change]. (United States)

    Léniz Martelli, Javiera; Van De Wyngard, Vanessa; Lagos, Marcela; Barriga, María Isabel; Puschel Illanes, Klaus; Ferreccio Readi, Catterina


    Mortality rates for cervical cancer (CC) in Chile are higher than those of developed countries and it has an unequal socioeconomic distribution. The recognition of human papilloma virus (HPV) as the causal agent of cervical cancer in the early 80's changed the prevention paradigms. Current goals are to prevent HPV infection by vaccination before the onset of sexual activity and to detect HPV infection in women older than 30 years. This article reviews CC prevention and early detection methods, discusses relevant evidence to support a change in Chile and presents an innovation proposal. A strategy of primary screening based on HPV detection followed by triage of HPV-positive women by colposcopy in primary care or by cytological or molecular reflex testing is proposed. Due to the existence in Chile of a well-organized nationwide CC prevention program, the replacement of a low-sensitivity screening test such as the Papanicolau test with a highly sensitive one such as HPV detection, could quickly improve the effectiveness of the program. The program also has a network of personnel qualified to conduct naked-eye inspections of the cervix, who could easily be trained to perform triage colposcopy. The incorporation of new prevention strategies could reduce the deaths of Chilean women and correct inequities.

  18. Development of management system for fruit export from Chile

    International Nuclear Information System (INIS)

    The activities of agencies in the control of fruit quality and of phytosanitary aspects have considerably increased in the last four years, resulting in an improvement in the quality of fresh fruits exported from Chile to the USA and Europe. Most of the produce, requiring shipping times of 2 to 3 weeks, is being shipped in refrigerated vessels. The Fundacion Chile has helped this export industry not only by training field inspectors, capable of checking quality of fruit before it has been packed, but also by certifying this quality when required by the exporter or his overseas customer. Strict quarantine requirements in importing countries have imposed a number of restrictions and produce is fumigated either in Chile or in the port of import. It is suggested that before irradiation is applied to Chilean fruits for export one should: (a) evaluate its effect on quality, with special reference on maturity at harvest, (b) demonstrate quarantine efficacy to a standard accepted by importing countries, (c) solve logistical aspects, (d) evaluate application technique in dependence of different packagings, (e) make cost assessments and (f) work towards bilateral agreement regarding acceptance of treatment and of facilities. (author)

  19. AP1000 Features Prevent Potential Containment Recirculation Screen Plugging

    International Nuclear Information System (INIS)

    This paper presents the results of plant design development and evaluations that demonstrate that the AP1000 plant is not subject to potential containment recirculation screen plugging following a loss-of-coolant-accident (LOCA). Following a LOCA in a pressurized water reactor, it is necessary to recirculate water from the containment back into the reactor to maintain long term core cooling. The AP1000 utilizes passive safety systems to provide containment recirculation for long term core cooling following a LOCA. The AP1000 also has non-safety pumps which provide a backup means of providing recirculation. Screens are provided around the recirculation pipes to prevent debris from blocking recirculation flow and core cooling passages. Debris may be generated by the LOCA blowdown from insulation and coatings used inside containment. Even with effective cleanliness programs, there may be some resident debris such as dust and dirt. The potential for plugging the recirculation screens is a current PWR licensing issue. The AP1000 design provides inherent advantages with respect to the potential plugging of containment recirculation screens. These characteristics include prevention of fibrous debris generation, improved debris settling and improved recirculation screen design. Debris settling analysis demonstrates that failure of coatings does not result in debris being transported to the screens before it settles to the floor. Additional analysis also shows that the plant can tolerate conservative amounts of resident debris being transported to the screens. The AP1000 significantly reduces the probability of plugging the containment recirculation screens and significantly reduces inspection and maintenance of coatings used inside containment. (authors)

  20. Functional analysis of the two Brassica AP3 genes involved in apetalous and stamen carpelloid phenotypes.

    Directory of Open Access Journals (Sweden)

    Yanfeng Zhang

    Full Text Available The Arabidopsis homeotic genes APETALA3 (AP3 and PISTILLATA (PI are B genes which encode MADS-box transcription factors and specify petal and stamen identities. In the current study, the stamen carpelloid (SC mutants, HGMS and AMS, of B. rapa and B. napus were investigated and two types of AP3 genes, B.AP3.a and B.AP3.b, were functional characterized. B.AP3.a and B.AP3.b share high similarity in amino acid sequences except for 8 residues difference located at the C-terminus. Loss of this 8 residues in B.AP3.b led to the change of PI-derived motifs. Meanwhile, B.AP3.a specified petal and stamen development, whereas B.AP3.b only specified stamen development. In B. rapa, the mutations of both genes generated the SC mutant HGMS. In B. napus that contained two B.AP3.a and two B.AP3.b, loss of the two B.AP3.a functions was the key reason for the apetalous mutation, however, the loss-of-function in all four AP3 was related to the SC mutant AMS. We inferred that the 8 residues or the PI-derived motif in AP3 gene probably relates to petal formation.

  1. Seroepidemiology of human toxoplasmosis in Chile Seroepidemiología de la toxoplasmosis en Chile

    Directory of Open Access Journals (Sweden)

    Maria del C. Contreras


    Full Text Available A series of already published and unpublished seroepidemiological surveys for toxoplasmosis, carried out in Chile in 1982-1994, is reviewed, expanded and analyzed. The surveys included 76,317 apparently healthy individuals of different ages (0.57% of the country's total population, from 309 urban and rural-periurban localities. Urban groups were integrated by blood donors, delivering mothers and middle grade schoolchildren, while rural-periurban individuals corresponded to unselected family groups. Blood samples were collected in filter paper. The presence of antibodies to Toxoplasma gondii was determined by the indirect hemagglutination test (IHAT, titers > 16 were considered positive. The test resulted positive in 28,124 (36.9% of the surveyed people. Two hundred and six (0.3% individuals presented IHAT titers > 1000, probably corresponding to acute or reactivated infections. A progressive increase of positive IHAT from northern to southern regions of the country was noted, phenomenom probably related to geographical conditions and to a higher production and consumption of different types of meat in the latter regions. It is postulated that ingestion of T. gondii cysts by humans is epidemiologically as important as ingestion of oocysts. The results presented stress the epidemiological importance of toxoplasmosis in humans, and warn about eventual implications in immunocompromised patients and in transplacental transmission, organ transplants and transfusions.En este trabajo se revisa, se amplía y se analiza en conjunto una serie de encuestas seroepidemiológicas sobre toxoplasmosis efectuadas en Chile entre 1982 y 1994, utilizando la reacción de hemaglutinación indirecta (RHAI. El estudio incluyó 76.317 personas aparentemente sanas de diferentes edades (0,57% de la problación total del país, procedentes de 309 localidades urbanas y rural-periurbanas. Los grupos urbanos estuvieron constituídos por donantes de sangre, parturientas y

  2. Environmental management in Chile: The power plants case; Gestion ambiental en Chile: Caso de las centrales termoelectricas

    Energy Technology Data Exchange (ETDEWEB)

    Jadrijevic, Maritza [Comision Nacional del Medio Ambiente, (Chile)


    In this paper are presented the general aspects of the historic evolution o the legal norms on environmental matters in Chile; general aspects of the electric generation system and the instruments of environmental management currently applied in the fossil fueled power plants, such as: the assessment system of the environmental impact; compliance of the air quality and emissions Standards and plans for decontamination [Espanol] En este trabajo se dan a conocer aspectos generales de la evolucion historica de las normas juridicas en materia ambiental en Chile; aspectos generales del sistema de generacion electrica y los instrumentos de gestion ambiental que actualmente se aplican a las plantas de generacion termoelectricas, tales como: el sistema de evaluacion de impacto ambiental; cumplimiento de normas de la calidad de aire y de emision y, planes de descontaminacion

  3. [Mortality in Chile 1955-1975: trends and causes]. (United States)

    Taucher, E


    Sources for data on mortality in Chile are available from the Instituto National de Estadistica, and from the Servicio National de Salud. For the purpose of this study every possible effort was made to get valid data, relying on the national death register, and on medical certificates of death. Between 1953 and 1963 the mortality rate was 12-13/1000; it abruptly descended in 1973, and rose again, to reach the level of 7.2/1000 in 1975. Male mortality is higher than female mortality. In the years 1974-1975 the mortality rate descended considerably for infants and for children 1-4. If one compares mortality rates in Chile and Sweden for 1975, it is obvious that modern medical technology and different sanitary conditions are responsible for the low mortality rate in Sweden. As to the causes of mortality, 9 diseases are responsible for more than 90% of deaths. During the past 15 years death from cancer was about 110/1000, while violent deaths and deaths by accidents augmented. The death rate for respiratory diseases decreased significantly in 1974-1975. In comparing causes of death in Chile and in the U.S. one notices that respiratory diseases, infectious diseases, and circulatory diseases account for a great number of deaths in Chile, while in the U.S. accidents account for 73.4% of deaths in the 15-24 year old group. Tuberculosis, which has almost disappeared in the U.S., accounts for 5% of deaths in Chile in the 15-44 year old group. Such differences are due to cultural, social and economic diversity in the structure of the 2 countries. Pneumonia still accounts for 50% of infant mortality, and malnutrition for about 39% of mortality of children under 5. Still, most causes of death, like diarrhea in children, could be avoided with proper diagnosis and treatment. Nutrition, sanitary conditions, medical attention, and socioeconomic conditions are finally responsible if Chilean mortality rates still are much higher than those of developed countries.

  4. Field survey of the 16 September 2015 Chile tsunami (United States)

    Lagos, Marcelo; Fritz, Hermann M.


    On the evening of 16 September, 2015 a magnitude Mw 8.3 earthquake occurred off the coast of central Chile's Coquimbo region. The ensuing tsunami caused significant inundation and damage in the Coquimbo or 4th region and mostly minor effects in neighbouring 3rd and 5th regions. Fortunately, ancestral knowledge from the past 1922 and 1943 tsunamis in the region along with the catastrophic 2010 Maule and recent 2014 tsunamis, as well as tsunami education and evacuation exercises prompted most coastal residents to spontaneously evacuate to high ground after the earthquake. There were a few tsunami victims; while a handful of fatalities were associated to earthquake induced building collapses and the physical stress of tsunami evacuation. The international scientist joined the local effort from September 20 to 26, 2015. The international tsunami survey team (ITST) interviewed numerous eyewitnesses and documented flow depths, runup heights, inundation distances, sediment deposition, damage patterns, performance of the navigation infrastructure and impact on the natural environment. The ITST covered a 500 km stretch of coastline from Caleta Chañaral de Aceituno (28.8° S) south of Huasco down to Llolleo near San Antonio (33.6° S). We surveyed more than 40 locations and recorded more than 100 tsunami and runup heights with differential GPS and integrated laser range finders. The tsunami impact peaked at Caleta Totoral near Punta Aldea with both tsunami and runup heights exceeding 10 m as surveyed on September 22 and broadcasted nationwide that evening. Runup exceeded 10 m at a second uninhabited location some 15 km south of Caleta Totoral. A significant variation in tsunami impact was observed along the coastlines of central Chile at local and regional scales. The tsunami occurred in the evening hours limiting the availability of eyewitness video footages. Observations from the 2015 Chile tsunami are compared against the 1922, 1943, 2010 and 2014 Chile tsunamis. The

  5. Functional Analysis of the Two Brassica AP3 Genes Involved in Apetalous and Stamen Carpelloid Phenotypes


    Zhang, Yanfeng; Wang, Xuefang; Zhang, Wenxue; Yu, Fei; Tian, Jianhua; Li, Dianrong; Guo, Aiguang


    The Arabidopsis homeotic genes APETALA3 (AP3) and PISTILLATA (PI) are B genes which encode MADS-box transcription factors and specify petal and stamen identities. In the current study, the stamen carpelloid (SC) mutants, HGMS and AMS, of B. rapa and B. napus were investigated and two types of AP3 genes, B.AP3.a and B.AP3.b, were functional characterized. B.AP3.a and B.AP3.b share high similarity in amino acid sequences except for 8 residues difference located at the C-terminus. Loss of this 8...

  6. Installation Technology of AP1000 Steam Generator%AP1000蒸汽发生器安装技术

    Institute of Scientific and Technical Information of China (English)

    郑东宏; 王志强; 张明; 门昌华; 胡德全


    AP1000 nuclear power plant is a 3rd generation advanced passive 1000 MWe pressurized water reactor plant with two loops of reactor coolant systems .Compared with the conventional 2nd generation pressurized water reactor technology ,the steam generator ( SG) of AP1000 has many improved changes concerning SG property features and arrangement requirements for facilities within the nuclear island . Based on these improved changes and relevant installation practices ,the installation technology of AP 1000 SG has been introduced and analyzed including installation preparation ,transportation ,lifting,and instal-lation construction ,etc., with a view to provide a technical reference to the installation of main equip-ments in steam supply system of nuclear power plant .%AP1000是二环路的1000 MWe级压水堆三代核电厂,采用非能动安全设施,与传统的二代压水堆核电技术相比,蒸汽发生器本体特征和核岛内的就位要求均有较大的改进。根据AP1000蒸汽发生器自身的特点,并在实践的基础上,对蒸汽发生器的现场安装技术,包括安装准备、现场运输、吊装、核岛安装等进行了介绍和分析,为核电站核蒸汽供应系统主设备的现场运输、吊装和安装提供技术参考。

  7. Nuevos registros de Phthiraptera (Artropoda: Insecta en Lama pacos Linnaeus 1758, en Chile New records of Phthiraptera (Artropoda: Insecta in Lama pacos Linnaeus 1758, in Chile

    Directory of Open Access Journals (Sweden)

    D González-Acuña


    Full Text Available Se cita a Microthoracius mazzai (Werneck 1932 y Bovicola breviceps (Rudow 1866 por primera vez en Chile, y se confirma la presencia de M. praelongiceps (Neumann 1909 parasitando alpacas en la comuna de General Lagos (I Región, Chile. Se discute la importancia de los presentes registros.For the first time in Chile, the presence of Microthoracius mazzai (Werneck 1932 and Bovicola breviceps (Rudow 1866, are reported, and the presence of M. praelongiceps (Neuman 1909 parasiting alpacas in the General Lagos area (I Region is also confirmed. The importance of this situation is discussed in the present report.

  8. Status of APS 1-Mwe Parabolic Trough Project

    Energy Technology Data Exchange (ETDEWEB)

    Canada, S.; Brosseau, D.; Kolb, G.; Moore, L.; Cable, R.; Price, H.


    Arizona Public Service (APS) is currently installing new power facilities to generate a portion of its electricity from solar resources that will satisfy its obligation under the Arizona Environmental Portfolio Standard (EPS). During FY04, APS began construction on a 1-MWe parabolic trough concentrating solar power plant. This plant represents the first parabolic trough plant to begin construction since 1991. Site preparation and construction activities continued throughout much of FY05, and startup activities are planned for Fall 2005 (with completion early in FY06). The plant will be the first commercial deployment of the Solargenix parabolic trough collector technology developed under contract to the National Renewable Energy Laboratory. The plant will use an organic Rankine cycle (ORC) power plant, provided by Ormat. The ORC power plant is much simpler than the conventional steam Rankine cycle plant and allows unattended operation of the facility.

  9. Comparative advantages of AP1000 passive safety system

    International Nuclear Information System (INIS)

    With the increasing need of nuclear power, almost all countries who want to build new nuclear power plant take the generation Ⅲ technology as their first choice. The main reason is that the safety of generation Ⅲ technology has been improved greatly than generation Ⅱ and Ⅱ + technology. The passive safety technology is introduced by AP1000 and it is one of the best in generation Ⅲ technologies. The representative passive containment cooling system of AP1000 and containment spray system of generation Ⅱ nuclear power plant were compared in the paper and analyzed using probabilistic safety assessment method. The reasons of passive safety system possessing comparative advantages were obtained by the concrete calculation. (authors)

  10. Diffusion and Settling in Ap/Bp Stars

    Energy Technology Data Exchange (ETDEWEB)

    Turcotte, S


    Ap/Bp stars are magnetic chemically peculiar early A and late B type stars of the main sequence. They exhibit peculiar surface abundance anomalies that are thought to be the result of gravitational settling and radiative levitation. The physics of diffusion in these stars are reviewed briefly and some model predictions are discussed. While models reproduce some observations reasonably well, more work is needed before the behavior of diffusing elements in a complex magnetic field is fully understood.

  11. Diffusion and Settling in Ap/Bp Stars

    CERN Document Server

    Turcotte, S


    Ap/Bp stars are magnetic chemically peculiar early A and late B type stars of the main sequence. They exhibit peculiar surface abundance anomalies that are thought to be the result of gravitational settling and radiative levitation. The physics of diffusion in these stars are reviewed briefly and some model predictions are discussed. While models reproduce some observations reasonably well, more work is needed before the behavior of diffusing elements in a complex magnetic field is fully understood.

  12. Electron-cloud measurements and simulations for the APS


    Furman, M.A.; Pivi, M.; Harkay, K.C.; Rosenberg, R. A.


    We compare experimental results with simulations of the electron cloud effect induced by a positron beam at the APS synchrotron light source at ANL, where the electron cloud effect has been observed and measured with dedicated probes. We find good agreement between simulations and measurements for reasonable values of certain secondary electron yield (SEY) parameters, most of which were extracted from recent bench measurements at SLAC.

  13. On the progenitor of the Type Ic supernova 2002ap

    NARCIS (Netherlands)

    Smartt, SJ; Ramirez-Ruiz, E; Gilmore, GF; Meikle, WPS; Ferguson, AMN; Knapen, JH


    This Letter presents wide-field optical and near-IR (UBVRIHalphaK') images of the galaxy M74 that were taken between 0.6 and 8.3 yr before the discovery of the Type Ic supernova 2002ap. We have located the position of the supernova on these images with an accuracy of 0."3. We find no sign of a proge

  14. Thermal analysis of the beam missteering in APS storage ring

    International Nuclear Information System (INIS)

    Several bending magnet beam missteering cases have been investigated for the 7-GeV storage ring of the Advanced Photon Source (APS). One of the critical missteering events is presented in this paper. Finite element analyses are performed to solve for both temperature and stress fields. Thermally induced deflections are determined by using beam bending theory. A safe current limit is established for the storage ring chambers

  15. Electron-cloud measurements and simulations for the APS

    International Nuclear Information System (INIS)

    We compare experimental results with simulations of the electron cloud effect induced by a positron beam at the APS synchrotron light source at ANL, where the electron cloud effect has been observed and measured with dedicated probes. We find good agreement between simulations and measurements for reasonable values of certain secondary electron yield (SEY) parameters, most of which were extracted from recent bench measurements at SLAC

  16. 77 FR 70874 - Notification of the Next Meetings of the U.S.-Chile FTA Environmental Affairs Council and ECA... (United States)


    ... Notification of the Next Meetings of the U.S.-Chile FTA Environmental Affairs Council and ECA Joint Commission... State. ACTION: Notice of the next meeting of the U.S.-Chile Free Trade Agreement Environmental Affairs... States Trade Representative (``USTR'') are providing notice that the United States and Chile intend...

  17. 75 FR 5034 - Determination of Pest-Free Areas in the Republic of Chile; Request for Comments (United States)


    ... Animal and Plant Health Inspection Service Determination of Pest-Free Areas in the Republic of Chile... are advising the public that we have received a request from the government of the Republic of Chile... the Republic of Chile. After reviewing the documentation submitted in support of this request,...

  18. Data of evolutionary structure change: 1AP2D-1QLRD [Confc[Archive

    Lifescience Database Archive (English)


  19. Conservación de la biodiversidad en Chile: Nuevos desafíos y oportunidades en ecosistemas terrestres y marinos costeros Biodiversity conservation in Chile: New challenges and opportunities in terrestrial and marine coastal ecosystems

    Directory of Open Access Journals (Sweden)



    Full Text Available La pérdida de la biodiversidad producida por el crecimiento demográfico, la demanda por recursos y la actividad productiva es contradictoria con el reconocimiento de su importancia. En ecosistemas terrestres, el Sistema Nacional de Áreas Protegidas del Estado (SNASPE contiene cerca del 19 % del territorio de Chile continental; aunque no representa todos los ecosistemas con especies amenazadas, puede ser complementado implementando nuevas áreas protegidas públicas (AP y privadas (APP. El desarrollo de áreas marinas protegidas (AMP es incipiente, y algunas iniciativas comparten la responsabilidad de conservación con los usuarios locales. En Chile, un conjunto de reglamentos, normas legales y tratados internacionales promueven distintas oportunidades de conservación en ecosistemas terrestres y marinos costeros, de las cuales emergen nuevos desafíos. Entre estos destacan, estandarizar la clasificación de especies según categorías de conservación en un protocolo internacional y optimizar las metodologías para seleccionar áreas prioritarias, ambos criterios indispensables para decidir qué y dónde conservar. Otro desafío es integrar el valor intrínseco de la biodiversidad con los servicios ecosistémicos que presta para instaurar una cultura participativa. Esto mejoraría la efectividad de las distintas estrategias de protección y uso sustentable de la biodiversidad al incorporar la educación y la participación ciudadana desde una perspectiva biocultural. La educación fomenta la conservación de la naturaleza al hacernos conscientes de nuestro entorno; mientras que la participación involucra a los ciudadanos como un actor más en la toma de decisiones, procurando la aplicación efectiva de las estrategias de conservación de la biodiversidad.Biodiversity loss caused by population growth, the demand of resources and productive activities is inconsistent with the recognition of its importance. In terrestrial ecosystems, the

  20. Work plan, AP-102 mixer pump removal and pump replacement

    International Nuclear Information System (INIS)

    The objective of this work plan is to plan the steps and estimate the costs required to remove the failed AP-102 mixer pump, and to plan and estimate the cost of the necessary design and specification work required to order a new, but modified, mixer pump including the pump and pump pit energy absorbing design. The main hardware required for the removal of the mixer is as follows: a flexible receiver and blast shield; a metal container for the pulled mixer pump; and a trailer and strongback to haul and manipulate the container. Additionally: a gamma scanning device will be needed to detect the radioactivity emanating from the mixer as it is pulled from the tank; a water spray system will be required to remove tank waste from the surface of the mixer as it is pulled from the AP-102 tank; and a lifting yoke to lift the mixer from the pump pit (the SY-101 Mixer Lifting Yoke will be used). A ''green house'' will have to be erected over the AP-102 pump pit and an experienced Hoisting and Rigging crew must be assembled and trained in mixer pump removal methods before the actual removal is undertaken

  1. Maternal AP determinants in the Drosophila oocyte and embryo. (United States)

    Ma, Jun; He, Feng; Xie, Gengqiang; Deng, Wu-Min


    An animal embryo cannot initiate its journey of forming a new life on its own. It must rely on maternally provided resources and inputs to kick-start its developmental process. In Drosophila, the initial polarities of the embryo along both the anterior-posterior (AP) and dorsal-ventral (DV) axes are also specified by maternal determinants. Over the past several decades, genetic and molecular studies have identified and characterized such determinants, as well as the zygotic genetic regulatory networks that control patterning in the early embryo. Extensive studies of oogenesis have also led to a detailed knowledge of the cellular and molecular interactions that control the formation of a mature egg. Despite these efforts, oogenesis and embryogenesis have been studied largely as separate problems, except for qualitative aspects with regard to maternal regulation of the asymmetric localization of maternal determinants. Can oogenesis and embryogenesis be viewed from a unified perspective at a quantitative level, and can that improve our understanding of how robust embryonic patterning is achieved? Here, we discuss the basic knowledge of the regulatory mechanisms controlling oogenesis and embryonic patterning along the AP axis. We explore properties of the maternal Bicoid gradient in relation to embryo size in search for a unified framework for robust AP patterning. WIREs Dev Biol 2016, 5:562-581. doi: 10.1002/wdev.235 For further resources related to this article, please visit the WIREs website. PMID:27253156

  2. Standardized safety management of AP1000 nuclear power plant

    International Nuclear Information System (INIS)

    In 2002, China published and implemented the Law of the People's Republic of China on Work Safety and promulgated a series of guidelines and policies, which strengthened the safety management supervision. Standardization of safety, as another important step on safety supervision, comes after safety assesment and safety production licensing system, is also a permanent solution. Standardization of safety is a strategic, long term and fundamental work, which is also the basic access to achieving scientific safety management and increasing the inherent safety of an enterprise. Haiyang AP1000 nuclear power plant, adopting the modularized, 'open-top' and parallel construction means, overturned the traditional construction theory of installation work comes after the civil work and greatly shorten the construction period. At the same time, the notable increase of oversize module transportation and lifting and parallel construction raises higher demands for safety management. This article combines the characteristics and difficulties of safety management for Haiyang AP1000 nuclear power plant, puts forward ideas and methods for standardized safety management, and could also serve as reference to the safety management for other AP1000 projects. (authors)

  3. Credit constraints in rural financial markets in Chile: determinants and consequences

    NARCIS (Netherlands)

    Reyes, A.


    Using data from two surveys carried out in 2006 and 2008 on 177 farmers in Chile, this study measures access to credit and empirically determine the effects of credit constraints on investment and production for market-oriented farmers in central Chile. More specifically, four issues are dealt with:

  4. A new species of Eupithecia Curtis (Lepidoptera, Geometridae from the Azapa Valley, northern Chile

    Directory of Open Access Journals (Sweden)

    Héctor A. Vargas


    Full Text Available A new species of Eupithecia Curtis (Lepidoptera, Geometridae from the Azapa Valley, northern Chile. Male and female adults of a new species of Eupithecia Curtis from the Arica Province, Chile are described and illustrated. The species is compared with E. yubitzae Vargas & Parra, 2004, from the same locality, and E. galapagosata Landry & Rindge 1995, from the Galapagos Islands, Ecuador.

  5. 75 FR 28059 - Actual Effects of the Free Trade Agreements With Chile, Australia, and Singapore (United States)


    ... COMMISSION Actual Effects of the Free Trade Agreements With Chile, Australia, and Singapore AGENCY: United... Singapore. DATES: July 15, 2010: Deadline for filing written submissions. December 13, 2010: Transmittal of...) concluded with Chile, Singapore, and Australia. In its report the Commission will-- (1) With respect to...

  6. 75 FR 22369 - Certain Preserved Mushrooms From Chile, India, Indonesia, and the People's Republic of China... (United States)


    ...: Certain Preserved Mushrooms from Chile, 63 FR 66529 (December 2, 1998); Notice of Amendment of Final... India, 64 FR 8311 (February 19, 1999); Notice of Antidumping Duty Order: Certain Preserved Mushrooms... foreseeable time. See Preserved Mushrooms from Chile, China, India, and Indonesia; Determinations, 75 FR...

  7. Apprenticeship in Latin America: The INACAP Program in Chile. A Case Study. Occasional Paper #6. (United States)

    Corvalan-Vasquez, Oscar E.

    The development of apprenticeship programs in several Latin American countries was investigated with a focus on the results of an industrial apprenticeship program in Santiago, Chile. The program studied was the Instituto Nacional de Capacitacion Profesional (INACAP), the national vocational training institute of Chile. The purpose of the study…

  8. 75 FR 19658 - Preserved Mushrooms From Chile, China, India, and Indonesia; Determinations (United States)


    ..., 2009 (74 FR 50818) and determined on January 4, 2010 that it would conduct expedited reviews (75 FR... COMMISSION Preserved Mushrooms From Chile, China, India, and Indonesia; Determinations On the basis of the... revocation of the antidumping duty orders on preserved mushrooms from Chile, China, India, and...

  9. Ontological disorders: nightmares, psychotropic drugs and evil spirits in southern Chile

    NARCIS (Netherlands)

    C. Bonelli


    This article explores several equivocations in the relationship between state healthcare workers and the Pehuenche population in southern Chile. In particular, it focuses on radical differences in understanding the body, personhood, sleeping and dreaming. In Alto Bío Bío, Chile, while healthcare wor

  10. Barriers to Equitable Access: Higher Education Policy and Practice in Chile Since 1990 (United States)

    Matear, Ann


    This paper examines higher education policy in Chile after the return to democracy in 1990 from an equity perspective. Chile faces the challenge of implementing equity-oriented policies within the legal confines of an education system constructed under the neoliberal model and introduced by the military government (1973-1990). This has resulted in…

  11. Equity in Education in Chile: The Tensions between Policy and Practice (United States)

    Matear, Ann


    The article examines education policy in Chile after the return to democracy in 1990 from an equity perspective. Since then, policies have aimed for continuity, coherence and complementarity with the aim of furthering national development, promoting social mobility, and equitable access to quality education at all levels. However, Chile faces the…

  12. Socio-economic Segregation with (without) Competitive Education Policies: A Comparative Analysis of Argentina and Chile. (United States)

    Narodowski, Mariano; Nores, Milagros


    The view that competition initiatives in education, such as Chile's introduction of vouchers, promote socioeconomic segregation in schools is questioned. Chile and Argentina have faced very different decentralization reforms, carried out within different regulatory frameworks, but have arrived at similar situations in terms of schools'…

  13. Strepsicrates smithiana Walsingham (Lepidoptera, Tortricidae: first record from Chile and a newly documented host plant

    Directory of Open Access Journals (Sweden)

    Héctor A. Vargas


    Full Text Available Strepsicrates smithiana Walsingham (Lepidoptera, Tortricidae: first record from Chile and a newly documented host plant. Strepsicrates smithiana Walsingham, 1892 (Lepidoptera, Tortricidae is recorded for the first time from Chile. Male and female adults were reared from leaf-tying larvae collected on Myrica pavonis (Myricaceae, which is a new host plant record for S. smithiana.

  14. 75 FR 32901 - Notice of Determination of Pest-Free Areas in the Republic of Chile (United States)


    ... February 1, 2010 (75 FR 5034-5035, Docket No. APHIS-2009-0082), in which we announced the availability, for... Chile AGENCY: Animal and Plant Health Inspection Service, USDA. ACTION: Notice. SUMMARY: We are advising the public that we are recognizing an additional area of the Republic of Chile as a pest-free area...

  15. Nuevos registros de Phthiraptera en cánidos y caprinos en Chile New records of Phthiraptera in domestic mammals in Chile

    Directory of Open Access Journals (Sweden)

    D González-Acuña


    Full Text Available Se cita para las especies domésticas Canis familiaris los Phthiraptera Linognathus setosus (von Olfers 1816 y Heterodoxus spiniger (Enderlein 1909, y para Capra hircus a Linognathus africanus Kellogg & Paine (Kellog and Paine 1911 provenientes de la provincia de Ñuble, VIII Región. Se discute la descripción de Heterodoxus longitarsus (Piaget 1880 hecha anteriormente en Chile y también la presencia de L. africanus en Chile.The presence of the Phthiraptera species Linognathus setosus (von Olfers 1816 and‘Heterodoxus spiniger (Enderlein 1909 on the domestic dog Canis familiaris, and Linognathus africanus (Kellog and Paine 1911 on Capra hircus are described in the province of Ñuble, 8th Region of Chile. The description of Heterodoxus longitarsus (Paiget 1880, and the presence of L. africanus in Chile is discussed.

  16. Alstroemeria presliana Herb. (Alstroemeriaceae) in Chile from a Cytogenetic Perspective Alstroemeria presliana Herb. (Alstroemeriaceae) en Chile Bajo una Perspectiva Citogenética


    Carlos M Baeza; Otto Schrader; Eduardo Ruiz; M Negritto


    Alstroemeria (Alstroemeriaceae) is an endemic genus of South America with two major distribution centers in the continent: Chile and Brazil. In Chile the genus is distributed from the North, near Iquique (20º13’ S, 70º09’ W) to the Chilean and Argentine Patagonia (53º10’ S, 70º54’ W). The central zone of Chile presents the highest number of species. A. presliana Herb. grows from Curicó (34º59’ S, 71º14’ W) to Cautín (38º45’ S, 72º34’ W) in Chile and Neuquén (36º50’ S, 71º05’ W), Argentina. A ...

  17. PolyADP-ribose polymerase is a coactivator for AP-2-mediated transcriptional activation.


    Kannan, P; Yu, Y; Wankhade, S; Tainsky, M A


    Overexpression of transcription factor AP-2 has been implicated in the tumorigenicity of the human teratocarcinoma cell lines PA-1 that contain an activated ras oncogene. Here we show evidence that overexpression of AP-2 sequesters transcriptional coactivators which results in self-inhibition. We identified AP-2-interacting proteins and determined whether these proteins were coactivators for AP-2-mediated transcription. One such interacting protein is polyADP-ribose polymerase (PARP). PARP su...

  18. Regiones-commodities: Crisis y contagio en Chile

    Directory of Open Access Journals (Sweden)

    Antonio Daher


    Full Text Available La hipótesis de un nuevo dualismo entre una capital subglobal y sus "regiones-commodities" subyace en el estudio del impacto diferencial de las tres últimas crisis internacionales en las regiones de Chile, cuantificado a través de cuatro indicadores: el producto, el empleo, la inversión externa y las exportaciones, cuya variación permite verificar la disímil vulnerabilidad de cada región y su desigual exposición al riesgo de contagio de crisis. Fundamentado en un marco conceptual que sostiene que las crisis siguen siendo más regionales que globales, y que existe una verdadera geografía del contagio, el estudio muestra evidencia empírica que permite constatar: 1 la reproducción de un desbalance norte-sur al interior de Chile; 2 la doble paradoja de Santiago, cuya economía es la más diversificada y la más vulnerable, la más recesiva y la de mayor crecimiento; 3 la emergencia de Antofagasta como segunda economía regional de Chile, desplazando a Valparaíso y Concepción; 4 el paralelismo de Santiago y Antofagasta como regiones con el mayor producto, la mayor inversión extranjera y mayores exportaciones; y 5 la "mercosurización" de Santiago, capital subglobal, y la globalización de sus "regiones-commodities".The hypothesis of a new dualism between a sub-global capital city and its "commodities regions" underlies the study of the differential impact of the three last international crises on the regions of Chile. This impact is quantified through four indicators: product, employment, foreign investment and exports, and their variability allow the verification of the dissimilar vulnerability of each region and its dissimilar exposure to the risk of crisis contamination. The study is based on a conceptual frame that states that crisis continue to be more regional-like than global, and that there is a real geography of contamination. On the other hand, this study shows empirical evidence which makes it possible to verify: 1 the

  19. FRANX. Application for analysis and quantification of the APS fire; FRANK. Aplicacion para el analisis y cuantificacion de los APS de incendios

    Energy Technology Data Exchange (ETDEWEB)

    Snchez, A.; Osorio, F.; Ontoso, N.


    The FRANX application has been developed by EPRI within the Risk and Reliability User Group in order to facilitate the process of quantification and updating APS Fire (also covers floods and earthquakes). By applying fire scenarios are quantified in the central integrating the tasks performed during the APS fire. This paper describes the main features of the program to allow quantification of an APS Fire. (Author)

  20. On the generation of coastal lows in central Chile

    International Nuclear Information System (INIS)

    Previous studies of the coastal-low occurrences in central Chile have been aimed at the formulation of a conceptual model to explain observed features in connection with applied studies. The most prominent weather pattern associated with CL occurrences, (type A), coincides with the onset of a warm, middle-troposphere ridge over central Chile, and a surface high over northern Argentina. The synoptic forcing of the low is related to weak frontal disturbances that travel equatorwards. They result in a thickening of the marine layer that becomes blocked by the coastal escarpment, at the time of the onset of the ridge aloft. The blocking of the stable air above the subsidence inversion by the Andes is also hypothesized. The analysis of the subsidence inversion, the geometry of the coastal and Andes mountain ranges, and a scale analysis of the non-dimensional governing equations for the generation of the coastal lows, following the approach of Reason and Steyn (1990); leads to the conclusion that both blocking actions are strong and persistent in central Chile. An interactive mechanism between the upper and lower blocking effects is postulated to explain the cyclonic vorticity and the initial steering of the coastal lows. The scale analysis of the governing equations for the propagation stage of the low suggests that, departing for the South African case, non-linearity is important here, and that solitary Kelvin waves could be expected. Theoretical phase propagation speeds and Rossby radii are found to range between 8 and 15 m s-1 and 100-250 km, respectively. The importance of strong southerly winds ahead of the low and weak winds at its trailing edge is also stressed, as another major departure from the coastal-low behaviour elsewhere. (author). 17 refs, 4 figs, 4 tabs

  1. Development and validation of the Affect in Play Scale-brief rating version (APS-BR). (United States)

    Cordiano, Tori J Sacha; Russ, Sandra W; Short, Elizabeth J


    The Affect in Play Scale (APS; Russ, 1987, 2004) is one of few reliable, standardized measures of pretend play, yet the fact that it requires videotaping and extensive training to score compromises its clinical utility. In this study, we developed and validated a brief rating version (APS-BR) that does not require videotaping. Construct validity was established by comparing scores from the original APS and the APS-BR using an existing data set of videotaped play (n = 46). We examined associations between scores on the APS-BR and theoretically relevant measures of divergent thinking and emotional memories. Scores on the APS-BR related strongly to those on the APS, and the pattern of correlations for each scale and relevant criterion measures was similar in strength and direction, supporting the APS-BR as an alternate form of the APS. In addition, we completed a pilot study to examine the efficacy of using the APS-BR in its intended in vivo format (n = 28). Results from both studies suggest that the APS-BR is a promising brief measure of children's pretend play that can be substituted for the APS in clinical and research settings. PMID:18444095

  2. Peumus boldus (Monimiaceae, Magnoliopsida) una especie silvestre promisoria de Chile


    San Martín Acebedo, José; Doll, Ursula


    Se organiza y sintetiza la información relacionada con la botánica, ecología y el contenido químico de extraíbles de hojas, corteza y madera de Peumus boldus (Monimiaceae, Magnoliopsida), árbol siempreverde, autóctono, endémico y termófilo de los bosques y matorrales esclerófilos naturales del área mediterránea de Chile. La popularidad y conocimiento de la especie tiene arraigo en la medicina popular empírica, dado el efecto farmacológico atribuible fundamentalmente, al alcaloide boldina, pre...

  3. Geopolitics representation: Chile and Argentina in southern ice fields

    Directory of Open Access Journals (Sweden)

    Karen Isabel Manzano Itura


    Full Text Available Geopolitics, from concept named in 1917 by Rudolf Kjellén has been in continuous evolution until today. Since the incorporation of the representations, the first concept has been of vital importance in different territorial conflicts’ analysis. By means of a geopolitical analysis, the present article intends to understand the geopolitical representations in the area of southern ice fields, the last boundaries issue that still remains in abeyance between Chile and Argentina and how is that both countries have discussed the problem on a basis of representations, in which maps have been the image of each one facing the other, favoring in this way competition between states.

  4. Medication Overdoses at a Public Emergency Department in Santiago, Chile

    Directory of Open Access Journals (Sweden)

    Pablo Aguilera, MD


    Full Text Available Introduction: While a nationwide poison control registry exists in Chile, reporting to the center is sporadic and happens at the discretion of the treating physician or by patients’ self-report. Moreover, individual hospitals do not monitor accidental or intentional poisoning in a systematic manner. The goal of this study was to identify all cases of intentional medication overdose (MO that occurred over two years at a large public hospital in Santiago, Chile, and examine its epidemiologic profile. Methods: This study is a retrospective, explicit chart review conducted at Hospital Sótero del Rio from July 2008 until June 2010. We included all cases of identified intentional MO. Alcohol and recreational drugs were included only when they were ingested with other medications. Results: We identified 1,557 cases of intentional MO and analyzed a total of 1,197 cases, corresponding to 0.51% of all emergency department (ED presentations between July 2008 and June 2010. The median patient age was 25 years. The majority was female (67.6%. Two peaks were identified, corresponding to the spring of each year sampled. The rate of hospital admission was 22.2%. Benzodiazepines, selective serotonin reuptake inhibitors, and tricyclic antidepressants (TCA were the causative agents most commonly found, comprising 1,044 (87.2% of all analyzed cases. Acetaminophen was involved in 81 (6.8% cases. More than one active substance was involved in 35% of cases. In 7.3% there was ethanol co-ingestion and in 1.0% co-ingestion of some other recreational drug (primarily cocaine. Of 1,557 cases, six (0.39% patients died. TCA were involved in two of these deaths. Conclusion: Similar to other developed and developing nations, intentional MO accounts for a significant number of ED presentations in Chile. Chile is unique in the region, however, in that its spectrum of intentional overdoses includes an excess burden of tricyclic antidepressant and benzodiazepine overdoses, a


    Directory of Open Access Journals (Sweden)



    Full Text Available This article analizes the installation in Chile of a neoliberal model during the military regime headed by General Augusto Pinochet, between 1973 and 1979. Within that context, it offers a reinterpretation of the allegedly foundational character of that government, its also supposedly early adherence to the neoliberal matrix, and its break with the Keynesian capitalism which had prevailed since the 1930’s. The analysis is focused on the evolution of military with regard to the links between the State and development, and on the debate between neoliberalism and statism that was carried out within the armed forces

  6. Las fábricas de la charla en Chile


    Salazar, Areli Escobar


    Este artículo expone los resultados preliminares de la investigación doctoral en Antropología, orientada a conocer la materialidad y la subjetividad del trabajo de los call centers en Chile. Un salario definido por metas inalcanzables, el maltrato, el cansancio de nuevo tipo, la doble extracción del valor productivo y reproductivo de las mujeres trabajadoras y su entorno familiar, la explotación de las capacidades subjetivas, entre otros aspectos, dan cuenta de las nuevas formas que asume la ...

  7. Lejos de NYC: El hip-hop en Chile


    Rainer Quitzow


    En este artículo se abordan las manifestaciones concretas de una forma cultural urbana exportada desde Occidente a los países en desarrollo. A través de una reconstrucción de la historia de la cultura hip hop en Chile, se han intendado esbozar algunas conclusiones sobre su influencia en la formación de una identidad cultural urbana, tratando además de relacionar el desarrollo histórico del movimiento y de las prácticas actuales de la juventud en Santiago con tendencias más amplias en la socie...

  8. Economic Residential Segregation and Educational Achievements: Evidence from Chile


    Román, Miguel Vargas


    Using a database from Chile, we have tested empirically the effects of economic residential segregation on educational achievements. Our hypothesis is based on literature’s findings about segregation’s negative impact on individuals’ well being. We found that segregation has negative impacts. This result would have interesting policy implications and goes in the opposite directions of those investigations’ findings, which indicate that segregation has just negligible effects. Keywords...

  9. Health system reform in chile and colombia: results and balance


    Granados Toraño, Ramón; Gómez Montoya, María C.


    In order to understand the health system reforms, factors inherent to the health sector as well as external factors that gave origin to them must be considered. The policy of the World Bank acted as a determining factor and was taken into practice in the middle of processes that increased the inequalities in Latin America. The models of Chile and Colombia are examined from this background and some of the lessons that can be drawn from these experiences for other countries are pointed out.


    Directory of Open Access Journals (Sweden)



    Full Text Available El artículo presenta el desarrollo de la Física en Chile desde los comienzos de la República hasta 1960, poniendo énfasis en el desarrollo interno de la disciplina, la evolución de su concepción y la transmisión de su saber. El trabajo enfrenta el mito de la inexistente tradición científica en Chile, mostrando que en el caso de la Física ha habido un largo y sostenido desarrollo. En este desarrollo de la Física se distinguen cuatro etapas: (1 como capítulo de la Filosofía Escolástica; (2 como ciencia útil o indistinguible de la ingeniería; (3 como ciencia cultural y centro de una concepción científica del mundo; y (4 como disciplina con problemas propios, donde la investigación deviene parte central de su desarrollo. Para el historiador de la ciencia la novedad es que su desarrollo sigue una lógica donde los parámetros locales tienen una influencia muy significativa en comparación con aquellos determinados por el desarrollo mundial de la disciplinaThis paper presents the development of Physics in Chile from the beginnings of the Republic until the year 1960, emphasizing the internal development of the discipline, the evolution of its conception and the transmission of its body of knowledge. This work faces the myth of the non-existent scientific tradition in Chile by showing in the case of Physics a long and sustained development. In this development we distinguish four stages of Physics: (1 As a chapter of Scholastic Philosophy; (2 As a discipline closely related to engineering and real-life problems; (3 As cultural science and base of a scientific view of the world; (4 As a discipline with its own problems, where research becomes a central part of its development. For the science historian the novelty is that this development follows a logic where the local parameters have strong influence as compared to those determined by the universal development of the discipline

  11. The Intertemporal Approach to the Current Account: Evidence for Chile

    Directory of Open Access Journals (Sweden)

    Sergio A. Salas Landeau


    Full Text Available This paper studies the existence of "excess" current-account imbalances in Chile in the 1960-1999 period. This phenomenon is modelled using present value tests that allow for variable interest rates and exchange rate fluctuations. Despite its simplicity, most of the observed imbalances in the current account are accounted for by the model. Results suggest that using models where agents behave as forward-looking rational agents, is a valid framework. Moreover, the analysis highlights the rel-evance of variable interest rates and exchange rates. Results also imply that capital controls, that were widely used in the period under study, were not effective.

  12. Status of Implementation of the Code of Conduct in Chile

    International Nuclear Information System (INIS)

    This paper is intended to present the status of implementation in Chile of the Code of Conduct on the Safety and Security of Radioactive Sources (hereinafter referred to as the Code) and its supplementary Guidance on the Import and Export of Radioactive Sources (hereinafter referred to as the Guidance). It is presented as a contribution to the International Conference on the Safety and Security of Radioactive Sources: Maintaining the Continuous Global Con-trol of Sources throughout their Life Cycle, to be held in Abu Dhabi, United Arab Emirates, from 27 to 31 October 2013. (author)

  13. Fruit production in Chile: bright past, uncertain future

    Directory of Open Access Journals (Sweden)

    Jorge B. Retamales


    Full Text Available In 2007 (the last agricultural census, Chile had 308, 445 ha of fruit orchards: an increase of almost 32% from the previous census (1997. The most important species were table grapes (20%, avocados (13% and apples (12%. Some 22% of the fruit crops growing area corresponded to juvenile orchards; within the species with higher proportion of juvenile orchards were prunes (42% and blueberries (56%. Most orchards are located between latitude 27º18` S (Copiapó and 40º36´S (Puerto Varas. The industry is driven by the export component which accounts for more than 50% of the fruits produced. In the crop season 2009-2010, approximately 254 million boxes (around 2.5 million tons were exported, representing over US$ 3.5 million. Processed and fresh fruits represented 8.2 and 26.7% of the total forest and agricultural Chilean exports in 2008, respectively. The main markets for this fruits were USA/Canada (42% and Europe (32%. The fruit grower receives, on average, 12-16% of the total price of the fruit in its final destination. Each year the fruit industry employs 450.000 people directly, of which 1/3 are permanent. Even though the fruit industry employs the highest proportion of the agricultural labor and the growing area has increased in the last 20 years, the proportion of agricultural employment has decreased from 19.5% in 1989 to 10.8% in 2008. It might also be noted that Chile invests only 0.7% of the GDP in research. In the last 40 years, the fruit industry has been a motor for the Chilean economic development, but the lower rates of currency exchange, the rising costs of energy (oil, electricity, and the increasing scarcity of hand labor have drastically reduced the profitability and are putting at risk the viability of a large proportion of the fruit orchards in Chile. It is estimated that this season around 65% of the orchards will have a negative economic balance in their operations. Higher investment in research, improvements in fruit quality

  14. NRC confirmatory AP600 safety system phase I testing in the ROSA/AP600 test facility

    Energy Technology Data Exchange (ETDEWEB)

    Rhee, G.S.; Kukita, Yutaka; Schultz, R.R.


    The NRC confirmatory phase I testing for the AP600 safety systems has been completed in the modified ROSA (Rig of Safety Assessment) test facility located at the Japan Atomic Energy Research Institute (JAERI) campus in Tokai, Japan. The test matrix included a variety of accident scenarios covering both design and beyond-design basis accidents. The test results indicate the AP600 safety systems as reflected in ROSA appear to perform as designed and there is no danger of core heatup for the accident scenarios investigated. In addition, no detrimental system interactions nor adverse effects of non-safety systems on the safety system functions were identified. However, three phenomena of interest have been identified for further examination to determine whether they are relevant to the AP600 plant. Those three phenomena are: (1) a potential for water hammer caused by rapid condensation which may occur following the actuation of the automatic depressurization system (ADS), (2) a large thermal gradient in the cold leg pipe where cooled water returns from the passive residual heat removal system and forms a thermally stratified layer, and (3) system-wide oscillations initiating following the ADS stage 4 actuation and persisting until the liquid in the pressurizer drains and steam generation in the core becomes insignificant.

  15. Role of the tryptophan residue in the vicinity of the catalytic center of exonuclease III family AP endonucleases: AP site recognition mechanism


    Kaneda, Kohichi; Sekiguchi, Junichi; Shida, Toshio


    The mechanisms by which AP endonucleases recognize AP sites have not yet been determined. Based on our previous study with Escherichia coli exonuclease III (ExoIII), the ExoIII family AP endonucleases probably recognize the DNA-pocket formed at an AP site. The indole ring of a conserved tryptophan residue in the vicinity of the catalytic site presumably intercalates into this pocket. To test this hypothesis, we constructed a series of mutants of ExoIII and human APE1. Trp-212 of ExoIII and Tr...

  16. The AP-1 transcription factor homolog Pf-AP-1 activates transcription of multiple biomineral proteins and potentially participates in Pinctada fucata biomineralization


    Xiangnan Zheng; Minzhang Cheng; Liang Xiang; Jian Liang; Liping Xie; Rongqing Zhang


    Activator protein-1 (AP-1) is an important bZIP transcription factor that regulates a series of physiological processes by specifically activating transcription of several genes, and one of its well-chartered functions in mammals is participating in bone mineralization. We isolated and cloned the complete cDNA of a Jun/AP-1 homolog from Pinctada fucata and called it Pf-AP-1. Pf-AP-1 had a highly conserved bZIP region and phosphorylation sites compared with those from mammals. A tissue distrib...

  17. Parasites of the Green-backed Firecrown (Sephanoides sephaniodes in Chile Parásitos del picaflor chico (Sephanoides sephaniodes en Chile

    Directory of Open Access Journals (Sweden)

    Daniel González-Acuña


    Full Text Available Gastrointestinal and external parasites from 12 Green-backed Firecrown (Sephanoides sephaniodes were collected between January 2004 and December 2008 from the Biobío Region south-central Chile and Santiago (central Chile. Helminths collected included 1 trematode species (Mosesia sp. and 1 cestode species (Hymenolepis trinidadensis. The mite Proctophyllodes huitzilopchtlii was the only ectoparasite species found. All these parasites represent new records for Chile and the first parasites reported for this host species.Se recolectaron parásitos internos (gastrointestinales y externos de 12 picaflores (Sephanoides sephaniodes entre enero del 2004 y diciembre del 2008, de la región del Biobío en el centro-sur de Chile y en Santiago, en la región central de Chile. Los helmintos recolectados incluyeron 1 especie de trematodo (Mosesia sp. y 1 de cestodo (Hymenolepis trinidadensis. Únicamente se encontró 1 especie de ectoparásito, el ácaro Proctophyllodes huitzilopchtlii. Todos los parásitos mencionados representan nuevos registros para Chile y se registran por primera vez para este hospedero.

  18. Free-living benthic marine invertebrates in Chile Invertebrados bentónicos marinos de vida libre en Chile

    Directory of Open Access Journals (Sweden)



    Full Text Available A comprehensive literature review was conducted to determine the species richness of all the possible taxa of free-living benthic marine invertebrates in Chile. In addition, the extent of endemism to the Pacific Islands and deep-sea, the number of non-indigenous species, and the contribution that the Chilean benthic marine invertebrate fauna makes to the world benthic marine invertebrate fauna was examined. A total of 4,553 species were found. The most speciose taxa were the Crustacea, Mollusca and Polychaeta. Species richness data was not available for a number of taxa, despite evidence that these taxa are present in the Chilean benthos. The Chilean marine invertebrate benthic fauna constitutes 2.47 % of the world marine invertebrate benthic fauna. There are 599 species endemic to the Pacific Islands and 205 in the deep-sea. There are 25 invasive or non-indigenous species so far identified in Chile. Though the Chilean fauna is speciose there is still a considerable amount of diversity yet to be described, particularly amongst the small bodied invertebrates and from the less well explored habitats, such as the deep-seaSe realizó una revisión exhaustiva de la literatura para determinar la riqueza de especies de todos los taxa de invertebrados bentónicos de vida libre en Chile. Además, se analizó el endemismo de invertebrados marinos bentónicos para las islas chilenas del Pacífico y el mar profundo y el número de especies no indígenas; del mismo modo que la contribución de estos invertebrados a la riqueza mundial de invertebrados bentónicos marinos. Para Chile se acumuló un total de 4.553 especies de invertebrados bentónicos. Los taxa con más especies fueron Crustacea, Mollusca y Polychaeta. En algunos taxa de invertebrados no se encontró información sobre la diversidad de especies presentes en Chile, a pesar de existir evidencia de que éstos están presentes en el bentos marino chileno. Los invertebrados bentónicos marinos

  19. Atracción del picudo del chile a compuestos volátiles de sus hospederos.


    Múñiz Merino, Manolo


    El picudo del chile (Anthonomus eugenii Cano), principal plaga del chile (Capsicum spp.) en América, responde a los aromas de sus plantas hospederas, por lo que estos podrían ser de utilidad como fuentes de atrayentes. En la presente investigación se analizaron los compuestos volátiles de las yemas florales y frutos de cinco hospederos de A. eugenii: chile jalapeño (Capsicum annuum L.), pimiento morrón (C. annuum), chile manzano (C. pubescens Ruiz y Pav), chile chiltepe (C. frutescens L) y hi...

  20. Moluscos dulceacuícolas exóticos en Chile Exotic freshwater mollusks in Chile

    Directory of Open Access Journals (Sweden)

    Sergio Letelier V.


    Full Text Available Las especies de moluscos exóticas dulceacuícolas registradas en esta contribución, corresponden a ejemplares recolectados en humedales en acuarios comerciales o interceptados en barreras aduaneras, así como de referencias bibliográficas. Un total de 7 especies pertenecientes a 6 géneros fueron identificadas: Pomacea bridgesii; Helobia sp.; Thiara (Melanoides tuberculata; Melanoides maculata; Physa sp.; Physella venustula y Biomphalaria sp. Melanoides maculata fue recolectada en el río Lluta y clasificada como especie criptogénica. Los moluscos exóticos recolectados podrían tener éxito en su establecimiento si se considera la vulnerabilidad de los hábitats nativos debido al cambio en las condiciones climáticas globales o a las elevaciones térmicas producidas en el sector costero por los fenómenos de El Niño. En este sentido, las especies subtropicales observadas se podrían considerar como no endémicas y vectores potenciales de zoonosis parasitarias. Las principales vías de introducción de moluscos dulceacuícolas exóticos se derivaron del intercambio comercial, por lo cual, y frente a su incremento interregional, se hace necesario recopilar datos ecológicos y taxonómicos adecuados que permitan evaluar el riesgo de su establecimiento, así como servir de base para la aplicación de futuros tratamientos en bioseguridad.The exotic freshwater mollusk species we report here were collected in wetlands, commercial aquariums, or were given to us by government officials who intercepted some exotic species at customs offices. Other records came from the specialized literature. These species are Pomacea bridgesii; Helobia sp.; Thiara (Melanoides tuberculata; Melanoides maculata; Physa sp., Physella venustula and Biomphalaria sp. It is not clear how Melanoides maculata, found in the Río Lluta, reached Chile. The exotic species collected could expand their ranges in Chilean territory given global environmental and climate change or the

  1. Chile2015: Lévy Flight and Long-Range Correlation Analysis of Earthquake Magnitudes in Chile (United States)

    Beccar-Varela, Maria P.; Gonzalez-Huizar, Hector; Mariani, Maria C.; Serpa, Laura F.; Tweneboah, Osei K.


    The stochastic Truncated Lévy Flight model and detrended fluctuation analysis (DFA) are used to investigate the temporal distribution of earthquake magnitudes in Chile. We show that Lévy Flight is appropriated for modeling the time series of the magnitudes of the earthquakes. Furthermore, DFA shows that these events present memory effects, suggesting that the magnitude of impeding earthquakes depends on the magnitude of previous earthquakes. Based on this dependency, we use a non-linear regression to estimate the magnitude of the 2015, M8.3 Illapel earthquake based on the magnitudes of the previous events.

  2. Chile y la globalización: una dependencia potencialmente peligrosa Chile and globalization: a potentially dangerous dependence

    Directory of Open Access Journals (Sweden)

    Fernando Duque


    Full Text Available Este ensayo tiene varios propósitos. Primero, discutir el concepto de globalización en sus diferentes acepciones, particularmente, la económica, la política y la cultural. En segundo lugar, intenta tratar de describir y demostrar el enorme grado de dependencia que Chile tiene del actual proceso globalizador. En tercer término, se trata de señalar que la actual globalización, es un proceso similar al que ha ocurrido en otras épocas de la historia. Especialmente se comenta en detalle el análisis del profesor Ferguson quien compara la actual globalización con la que ocurrió a fines del siglo XIX y comienzos del XX. Se concluye que el actual proceso de globalización es tan volátil, inestable y peligroso como fue la globalización decimonónica. Se concluye también indicando que es altamente probable que el actual proceso globalizador, termine en forma similar a como terminó la globalización 1870-1914. Finalmente se argumenta que debido a que Chile está geográficamente ubicado en la parte más austral del hemisferio sur, es probable que el país salga relativamente intacto de la conflagración que se avecina.This article begins by discussing the different meanings of globalization, especially the economic, political and social ones. It then describes how Chile is greatly dependent on the current globalization process, as well as points out that this process is similar to others that have taken place in other times in history. It discusses in detail professor Ferguson's analysis comparing the current globalization with the one that occurred at the end of the 19th century and the beginning of the 20th. The article concludes that the current process is as volatile, unstable and dangerous as that of the 19th century, and that it is highly probable that it will end as that of 1870-1914. It also argues that since Chile is on the southernmost part of the southern hemisphere, it will be relatively preserved from the oncoming conflagration.

  3. Síndrome pulmonar por hantavirus Andes en Chile CARDIOPULMONARY SYNDROME DUE TO ANDES VIRUS IN CHILE

    Directory of Open Access Journals (Sweden)



    Full Text Available Desde 1993 han ocurrido 204 casos de Síndrome Cardiopulmonar por Hantavirus (SCPH en Chile. Los brotes epidémicos comenzaron en el sur y avanzan hacia el norte del país. Los más afectados son varones jóvenes, obreros agrícolas o forestales. En Chile, el SCPH es causado por el virus Andes, cuyo reservorio es el Oligorizomys longicaudatus (ratón de cola larga, que se distribuye desde la III Región al sur. El cuadro clínico es similar al descrito en EE.UU., caracterizado por una fase prodrómica que simula un estado gripal o cuadro gastrointestinal febril y que agrava por la aparición de edema pulmonar agudo e inestabilidad hemodinámica (fase cardiopulmonar. Sin embargo, cursa con mayores alteraciones hemorragí-paras y compromiso renal. La mortalidad inicial fue sobre 50% y actualmente es de alrededor del 33,3%. La presente revisión incluye: historia de la enfermedad, reservorio, modos de transmisión, patogenia, cuadro clínico, diagnóstico, tratamiento y medidas de prevenciónSince 1993, 204 cases of Hantavirus cardiopulmonary syndrome (HCPS occurred in Chile. Epidemic began in the south and moved thereafter to the northern regions. The disease affected predominantly young males, who worked in agricultural labours or as timber workers. The HCPS in Chile is caused by the Andes virus. The reservoir is the wild rat Oligoryzomis longicaudatus distributed from the III to the XII Region. The clinical features are similar to those described for Sin Nombre Virus. The disease has a prodromal stage characterised by fever, muscular pain, with or without gastrointestinal manifestations, followed by the rapid onset of respiratory insufficiency and haemodynamic unstability. Andes virus courses more often with haemorrhagic disorders and overt renal failure, than Sin Nombre Virus. The initial mortality was over 50% and declined to 33,3% in the last year. History of hantavirus-diseases, reservoir, and mode of contagion, pathogenesis, clinical

  4. AP4 directly downregulates p16 and p21 to suppress senescence and mediate transformation


    Jackstadt, R; Jung, P.; Hermeking, H


    Here we analyzed the function of the c-MYC-inducible basic helix–loop–helix leucine-zipper transcription factor AP4 in AP4-deficient mouse embryo fibroblasts (MEFs). Loss of AP4 resulted in premature senescence and resistance towards immortalization. Senescence was accompanied by induction of the cyclin-dependent kinase inhibitor-encoding genes p16, a known tumor suppressor, and p21, a previously described target for repression by AP4. Notably, AP4 directly repressed p16 expression via conser...

  5. Packaging design criteria, transfer and disposal of 102-AP mixer pump

    International Nuclear Information System (INIS)

    A mixer pump installed in storage tank 241-AP-102 (102-AP) has failed. This pump is referred to as the 102-AP mixer pump (APMP). The APMP will be removed from 102-AP 1 and a new pump will be installed. The main purpose of the Packaging Design Criteria (PDC) is to establish criteria necessary to design and fabricate a shipping container for the transfer and storage of the APMP from 102-AP. The PDC will be used as a guide to develop a Safety Evaluation for Packaging (SEP)

  6. NF-κB/AP-1-Targeted Inhibition of Macrophage-Mediated Inflammatory Responses by Depigmenting Compound AP736 Derived from Natural 1,3-Diphenylpropane Skeleton

    Directory of Open Access Journals (Sweden)

    Van Thai Ha


    Full Text Available AP736 was identified as an antimelanogenic drug that can be used for the prevention of melasma, freckles, and dark spots in skin by acting as a suppressor of melanin synthesis and tyrosinase expression. Since macrophage-mediated inflammatory responses are critical for skin health, here we investigated the potential anti-inflammatory activity of AP736. The effects of AP736 on various inflammatory events such as nitric oxide (NO/prostaglandin (PG E2 production, inflammatory gene expression, phagocytic uptake, and morphological changes were examined in RAW264.7 cells. AP736 was found to strongly inhibit the production of both NO and PGE2 in lipopolysaccharide- (LPS- treated RAW264.7 cells. In addition, AP736 strongly inhibited both LPS-induced morphological changes and FITC-dextran-induced phagocytic uptake. Furthermore, AP736 also downregulated the expression of multiple inflammatory genes, such as inducible NO synthase (iNOS, cyclooxygenase- (COX- 2, and interleukin- (IL- 1β in LPS-treated RAW264.7 cells. Transcription factor analysis, including upstream signalling events, revealed that both NF-κB and AP-1 were targeted by AP736 via inhibition of the IKK/IκBα and IRAK1/TAK1 pathways. Therefore, our results strongly suggest that AP736 is a potential anti-inflammatory drug due to its suppression of NF-κB-IKK/IκBα and AP-1-IRAK1/TAK1 signalling, which may make AP736 useful for the treatment of macrophage-mediated skin inflammation.


    Directory of Open Access Journals (Sweden)

    Magda Sepúlveda Eriz


    Full Text Available La viajera espectral de Poema de Chile reflexiona sobre la adopción del nombre Mistral. Los fundamentos de esta elección van desde retornar a una intimidad anterior, la escena primigenia del campo, hasta el rechazo a la sociedad urbana. Este acto moderno de autonominarse constituye una atribución consciente frente al menoscabo y a los insultos recibidos en una posición representativa anterior. En vista de lo cual, la fantasma reclama los lugares, las palabras, los bienes y exige la recomposición de los cuerpos despedazados por el discurso blanco y etnocéntrico.The travelling spectrum of Poema de Chile reflects on the adoption of the name Mistral. The causes of this choice gofrom coming back to a previous intimacy -the original scene of the country- to the rejection of the urban society. The name she gives herself is a conscious act and therefore, a modern one, which is used as a response to the damage she received when she was in a previous situation. As a result, the ghost calls for the places, the language and the goods that were stolen, and she demands to recover the bodies that were torn by the white and ethnocentric discourse.

  8. Tendencias generales en la toponimia del Norte Grande de Chile

    Directory of Open Access Journals (Sweden)

    Guillermo Latorre


    Full Text Available En este trabajo el autor se propone examinar las facetas más salientes de la preponderancia del sustrato indígena en la toponimia mayor del Norte Grande, asunto poco o nada tratado en descripciones del español de Chile. Pasa revista a voces como "Arica", "Chañaral", "Iquique", "Taltal", "Tocopilla", "Chuquicamata", "Andes", "Antofagasta", "Calama", "Pica", "Loa" y otras. Finalmente, da algunas explicaciones de esa marcada presencia de topónimos autóctonos a pesar de cinco siglos de dominio español. (In this paper, the author examines the most salient features of the prevalence of indigenous backgrounds in the toponymy of Northernmost Chile, an aspect barely tackled, or simply neglected, in the descriptions of Chilean Spanish. The author reviews terms such as "Arica", "Chañaral", "Iquique", "Taltal", "Tocopilla", "Chuquicamata", "Andes", "Antofagasta", "Calama", "Pica", "Loa", and others. Also, some explanations are offered that may justify the notorious presence of native placenames, in spite of five centuries of Spanish domination.

  9. Desarrollo metropolitano integrado: El caso de Santiago de Chile

    Directory of Open Access Journals (Sweden)

    Paulina Schiappacasse


    Full Text Available El Área Metropolitana de Santiago (AMS ocupa un rol significativo en términos demográficos y de desarrollo económico en Chile. Sin embargo existen debilidades importantes en el establecimiento de mecanismos adecuados que permitan definir su orientación estratégica en un marco global competitivo; esta situación se intensifica en la medida que las áreas metropolitanas en Chile, no poseen una institucionalidad definida y un marco legal que las sustente. El AMS esta siendo afectada por cambios estructurales típicos en la evolución de las grandes metrópolis, con las consecuentes externalidades negativas que incrementan las dificultades para enfrentar y orientar su crecimiento y para establecer instancias de colaboración entre los diferentes actores involucrados. En este artículo se analiza la situación del AMS, en el marco de la discusión internacional, en relación a las metas estratégicas necesarias para el logro de un desarrollo metropolitano sustentable. La intención es contribuir al debate nacional actual en torno a la revisión y cambio de las políticas de planificación, en particular, aquellas orientadas a enfrentar los procesos dinámicos que están experimentando las ciudades.

  10. Isotopic composition and origin of the precipitation in Northern Chile

    Energy Technology Data Exchange (ETDEWEB)

    Aravena, R. [Department of Earth Sciences, University of Waterloo, Waterloo (Canada); Suzuki, O. [Exploracion y Desarrollo de Recursos Hidricos, Santiago (Chile); Pena, H. [Direccion General de Aguas, Ministerio de Obras Publicas, Santiago (Chile); Pollastri, A. [Comision Chilena de Energia Nuclear, Santiago (Chile); Fuenzalida, H. [Departamento de Geofisica, Universidad of Chile, Santiago (Chile); Grilli, A. [Empresa Metropolitana de Obras Sanitarias, Santiago (Chile)


    A 3 a data set of isotopes in precipitation from northern Chile show a very distinct pattern, with {delta}{sup 18}O values ranging between -18 and -15per thousand at high altitude stations, compared to {delta}{sup 18}O values between -10 and -6per thousand at the lower altitude areas. The {sup 18}O-depleted values observed in the high altitude area, the Altiplano, are related to processes that affect the air masses that originated over the Atlantic, cross the Amazon Basin (continental effect), ascend the Andes (altitude effect) and precipitated (convective effect) in the Altiplano. It is postulated that a second source of moisture, associated with air masses from the Pacific, may contribute to the {sup 18}O-enriched values observed in the lower altitude areas. Similar isotopic patterns are documented in springs and groundwater indicating that the data presented in this paper are an accurate representation of the long term behavior isotopic composition of rain in northern Chile. (Copyright (c) 1999 Elsevier Science B.V., Amsterdam. All rights reserved.)

  11. Chile. Actores Populares en la Protesta Nacional, 1983-1984

    Directory of Open Access Journals (Sweden)



    Full Text Available RESUMEN: Los acontecimientos y los actores implicados en las movilizaciones producidas en Santiago de Chile en 1983-84, son el objeto de andlisis de este artículo. Tras una breve exposición del contexto económico y político, se describen los rasgos fundamentales y la evolución de las protestas. Del análisis de los hechos se deducen tres objetivos implícitos en las movilizaciones: recuperación de la identidad política y social, integración polltica de los excluidos y democracia. Los resultados son dispares; mientras en el plano político se produce una derrota, en lo referente a la expresividad de las acciones y al problema de la integración, las movilizaciones fueron exitosas.ABSTRACT: ThLs article focuses on the events and actors involved in the mobilizations tha took place in Santiago de Chile between 1983-1984. After a short exposition of the political and economic context, it describes the main characteristics and the protest's evolution. Three implicit objetives can be identified from the demostrations: the recovering of social and political identity, the political integration of the excluded people and democracy. The results are inequal; while on the political level a defeat ocurs, with regard to the expressiveness of the actions and the integration's problem, the mobilizations were successful.

  12. An overview of the dinosaur fossil record from Chile (United States)

    Rubilar-Rogers, David; Otero, Rodrigo A.; Yury-Yáñez, Roberto E.; Vargas, Alexander O.; Gutstein, Carolina S.


    In Chile, the record of dinosaurs in Jurassic and Cretaceous sediments is often restricted to footprints, with few skeletal remains. Tetanuran theropods are known in the Upper Jurassic, and bones of titanosaur sauropods in the Late Cretaceous, including partial skeletons (e.g. Atacamatitan chilensis Kellner et al.). Also from the late Cretaceous, an ornithopod vertebra, a pair of theropod teeth and one tarsometatarsus of a gaviiform bird (Neogaeornis wetzeli Lambrecht) have been reported. The Cenozoic fossil record comprises abundant and well-preserved marine birds from Eocene and Miocene units, with a specially abundant record of Sphenisciformes and less frequently, Procellariiformes. There is an excellent Miocene-Pliocene record of other birds such as Odontopterygiformes, including the most complete skeleton ever found of a pelagornithid, Pelagornis chilensis Mayr and Rubilar-Rogers. Fossil birds are also known from Pliocene and Pleistocene strata. A remarkable collection of birds was discovered in lacustrine sediments of late Pleistocene age associated to human activity. The perspectives in the study of dinosaurs in Chile are promising because plenty of material stored in institutional collections is not described yet. The record of Chilean dinosaurs is relevant for understanding the dynamics and evolution of this group of terrestrial animals in the western edge of Gondwana, while Cenozoic birds from the Region may contribute to the understanding of current biogeography for instance, the effect of the emergence and establishment of the Humboldt Current.

  13. Peru-Chile upwelling dynamics under climate change (United States)

    Oerder, Véra; Colas, Francois; Echevin, Vincent; Codron, Francis; Tam, Jorge; Belmadani, Ali


    The consequences of global warming on the Peru-Chile Current System (PCCS) ocean circulation are examined with a high-resolution, eddy-resolving regional oceanic model. We performed a dynamical downscaling of climate scenarios from the IPSL-CM4 Coupled General Circulation Model (CGCM), corresponding to various levels of CO2 concentrations in the atmosphere. High-resolution atmospheric forcing for the regional ocean model are obtained from the IPSL atmospheric model run on a stretched grid with increased horizontal resolution in the PCCS region. When comparing future scenarios to preindustrial (PI) conditions, the circulation along the Peru and Chile coasts is strongly modified by changes in surface winds and increased stratification caused by the regional warming. While the coastal poleward undercurrent is intensified, the surface equatorial coastal jet shoals and the nearshore mesoscale activity are reinforced. Reduction in alongshore wind stress and nearshore wind stress curl drive a year-round reduction in upwelling intensity off Peru. Modifications in geostrophic circulation mitigate this upwelling decrease in late austral summer. The depth of the upwelling source waters becomes shallower in warmer conditions, which may have a major impact on the system's biological productivity.

  14. Oxygenation variability off Northern Chile during the last two centuries

    Directory of Open Access Journals (Sweden)

    J. A. Díaz-Ochoa


    Full Text Available The Peru Chile Current ecosystem is characterized by high biological productivity and important fisheries. Although this system is likely to be severely affected by climate change, its response to current global warming is still uncertain. In this paper we analyze 10–166 year old sediments in two cores collected in Mejillones Bay, an anoxic sedimentary setting favorable for preservation of proxies. Based on a 166 year chronology we used indicators of bottom water oxygenation proxies (Mo, V, S, and the (lycopane+n-C35/n-C31 ratio and surface water productivity (biogenic opal, counts of diatom valves, biogenic Ba, organic carbon and chlorins to reconstruct environmental variations in Mejillones Bay. We find that at decadal scales, and during the last two centuries, a shift in the coastal marine ecosystem off Northern Chile took place which was characterized by intense ENSO-like activity and large fluctuations in biological export productivity, in bottom water oxygenation, and increased eolic activity (inferred from Ti/Al and Zr/Al. On top of this short-term variability, a gradual increase of sulfidic conditions has occurred being even more intensified since the early 1960s.


    Directory of Open Access Journals (Sweden)

    Mateo Martinic B.


    Full Text Available En este artículo se entrega una visión completa acerca de los ferrocarriles construidos y explotados en la región austral de Chile y se ofrece asimismo una explicación sobre su modesta expresión hist��rica, cosa notable en un territorio como la Patagonia chilena en cuya colonización y desarrollo ulterior fue importante la utilización de la tecnología industrial moderna. Se dan a conocer también algunas interesantes iniciativas ferrocarrileras que no llegaron a materializarseIn spite of the important development in Chilean Patagonia between circa 1870 an 1973, particulary in the old Magellan Territory, an almost surprising fact was that in between many incorporated industrial technology the railroad, a paradigm of modernity, had a scarce representation. In this paper, a complete review about railroads settled and exploted in southernmost Chile is done and a explanation of its modest expression and some interesting projects that necer became materialized which explains the emptiness in the historical information on the subject

  16. Astronomy Outreach Activities in Chile: IYA 2009 and Beyond (United States)

    Vogt, N.; Evans, M.; Aranda, J.; Gotta, V.; Monsalves, A.; Puebla, E.


    In Chile, one of the developing countries in Latin-America, there are large social differences that persist between the richest and the poorest citizens. On the other hand, Chile has the advantage of a special and unique resource, the incomparably clear and dry skies in the desert of Atacama in the north of the country. This advantage is being exploited by the installation of large and powerful international observatories. However, the Chilean people's perception of this resource and the corresponding advantages for their country are still underdeveloped and rather poor. Therefore, we have been conducting successful outreach activities at all levels during the past few years, with special highlights during the International Year of Astronomy 2009, including participation of our undergraduate physics and astronomy students, the local media like newspapers, radio, and TV stations, talks and workshops in schools, popular talks for the general public, exhibitions, contests, and other multi-media efforts. We briefly describe these activities and outline the difference between our situation and that existing in developed countries like the USA.

  17. [Mental health financing in Chile: a pending debt]. (United States)

    Errázuriz, Paula; Valdés, Camila; Vöhringer, Paul A; Calvo, Esteban


    In spite of the high prevalence of mental health disorders in Chile, there is a significant financing deficit in this area when compared to the world's average. The financing for mental health has not increased in accordance with the objectives proposed in the 2000 Chilean National Mental Health and Psychiatry Plan, and only three of the six mental health priorities proposed by this plan have secure financial coverage. The National Health Strategy for the Fulfilment of Health Objectives for the decade 2011-2020 acknowledges that mental disorders worsen the quality of life, increase the risk of physical illness, and have a substantial economic cost for the country. Thus, this article focuses on the importance of investing in mental health, the cost of not doing so, and the need for local mental health research. The article discusses how the United States is trying to eliminate the financial discrimination suffered by patients with mental health disorders, and concludes with public policy recommendations for Chile. PMID:26530201

  18. Differences in infant temperament between Chile and the US. (United States)

    Farkas, Chamarrita; Vallotton, Claire


    Temperament refers to individual differences in reactivity and self-regulation and is influenced by genetic and experiential variation and maturation. Temperament reflects biologically based individual differences that emerge in early life and remain relatively stable thereafter. Given the growing interest in cultural variation in infant temperament, this study examined the temperament of 12-month-old children in Chile and the US. The aims were to validate a version of the Infant Behavior Questionnaire - Revised - Very Short Form in Spanish for Chile and to compare Chilean and US infants' temperament. For the first aim, 150 Chilean infants aged 10-15 months were assessed, and 73 US infants aged 10-15 months were examined for the second aim. The children's parents completed a demographic questionnaire and the IBQ-R-VSF, which measures three dimensions of temperament: Surgency, Negative Affectivity, and Effortful Control. The reliability of each dimension for the Chilean sample was between 0.70 and 0.75, and significant differences between Chilean and US infants emerged. Parents of Chilean infants reported higher levels of Effortful Control, whereas US parents reported that their infants exhibited higher levels of Negative Affectivity. A relationship between parents' higher educational level and infants' higher levels of Surgency was found for both countries. No gender or age differences were observed for any of the three temperament dimensions. These results and their implications for cultural studies are discussed. PMID:27450101

  19. Abortion in Chile: the practice under a restrictive regime. (United States)

    Casas, Lidia; Vivaldi, Lieta


    This article examines, from a human rights perspective, the experience of women, and the practices of health care providers regarding abortion in Chile. Most abortions, as high as 100,000 a year, are obtained surreptitiously and clandestinely, and income and connections play a key role. The illegality of abortion correlates strongly with vulnerability, feelings of guilt and loneliness, fear of prosecution, physical and psychological harm, and social ostracism. Moreover, the absolute legal ban on abortion has a chilling effect on health care providers and endangers women's lives and health. Although misoprostol use has significantly helped to prevent greater harm and enhance women's agency, a ban on sales created a black market. Against this backdrop, feminists have taken action in aid of women. For instance, a feminist collective opened a telephone hotline, Linea Aborto Libre (Free Abortion Line), which has been crucial in informing women of the correct and safe use of misoprostol. Chile is at a crossroads. For the first time in 24 years, abortion law reform seems plausible, at least when the woman's life or health is at risk and in cases of rape and fetal anomalies incompatible with life. The political scenario is unfolding as we write. Congressional approval does not mean automatic enactment of a new law; a constitutional challenge is highly likely and will have to be overcome. PMID:25555764

  20. Assessing computer waste generation in Chile using material flow analysis. (United States)

    Steubing, Bernhard; Böni, Heinz; Schluep, Mathias; Silva, Uca; Ludwig, Christian


    The quantities of e-waste are expected to increase sharply in Chile. The purpose of this paper is to provide a quantitative data basis on generated e-waste quantities. A material flow analysis was carried out assessing the generation of e-waste from computer equipment (desktop and laptop PCs as well as CRT and LCD-monitors). Import and sales data were collected from the Chilean Customs database as well as from publications by the International Data Corporation. A survey was conducted to determine consumers' choices with respect to storage, re-use and disposal of computer equipment. The generation of e-waste was assessed in a baseline as well as upper and lower scenarios until 2020. The results for the baseline scenario show that about 10,000 and 20,000 tons of computer waste may be generated in the years 2010 and 2020, respectively. The cumulative e-waste generation will be four to five times higher in the upcoming decade (2010-2019) than during the current decade (2000-2009). By 2020, the shares of LCD-monitors and laptops will increase more rapidly replacing other e-waste including the CRT-monitors. The model also shows the principal flows of computer equipment from production and sale to recycling and disposal. The re-use of computer equipment plays an important role in Chile. An appropriate recycling scheme will have to be introduced to provide adequate solutions for the growing rate of e-waste generation.

  1. Abortion in Chile: the practice under a restrictive regime. (United States)

    Casas, Lidia; Vivaldi, Lieta


    This article examines, from a human rights perspective, the experience of women, and the practices of health care providers regarding abortion in Chile. Most abortions, as high as 100,000 a year, are obtained surreptitiously and clandestinely, and income and connections play a key role. The illegality of abortion correlates strongly with vulnerability, feelings of guilt and loneliness, fear of prosecution, physical and psychological harm, and social ostracism. Moreover, the absolute legal ban on abortion has a chilling effect on health care providers and endangers women's lives and health. Although misoprostol use has significantly helped to prevent greater harm and enhance women's agency, a ban on sales created a black market. Against this backdrop, feminists have taken action in aid of women. For instance, a feminist collective opened a telephone hotline, Linea Aborto Libre (Free Abortion Line), which has been crucial in informing women of the correct and safe use of misoprostol. Chile is at a crossroads. For the first time in 24 years, abortion law reform seems plausible, at least when the woman's life or health is at risk and in cases of rape and fetal anomalies incompatible with life. The political scenario is unfolding as we write. Congressional approval does not mean automatic enactment of a new law; a constitutional challenge is highly likely and will have to be overcome.

  2. Generic effluent monitoring system certification for AP-40 exhauster stack

    Energy Technology Data Exchange (ETDEWEB)

    Glissmeyer, J.A.; Davis, W.E.; Bussell, J.H.; Maughan, A.D.


    Tests were conducted to verify that the Generic Effluent Monitoring System (GEMS), as applied to the AP-40 exhauster stack, meets all applicable regulatory performance criteria for air sampling systems at nuclear facilities. These performance criteria address both the suitability of the air sampling probe location and the transport of the sample to the collection devices. The criteria covering air sampling probe location ensure that the contaminants in the stack are well mixed with the airflow at the probe location such that the extracted sample represents the whole. The sample transport criteria ensure that the sampled contaminants are quantitatively delivered to the collection device. The specific performance criteria are described in detail in the report. The tests demonstrated that the GEMS/AP-40 system meets all applicable performance criteria. The contaminant mixing tests were conducted by Pacific Northwest National Laboratory (PNNL) at the wind tunnel facility, 331-H Building, using a mockup of the actual stack. The particle sample transport tests were conducted by PNNL at the Numatec Hanford Company`s 305 Building. The AP-40 stack is typical of several 10-in. diameter stacks that discharge the filtered ventilation air from tank farms at the U.S. Department of Energy`s Hanford Site in Richland, Washington. The GEMS design features a probe with a single shrouded sampling nozzle, a sample delivery line, and sample collection system. The collection system includes a filter holder to collect the sample of record and an in-line detector head and filter for monitoring beta radiation-emitting particles. Unrelated to the performance criteria, it was found that the record sample filter holder exhibited symptoms of sample bypass around the particle collection filter. This filter holder should either be modified or replaced with a different type. 10 refs., 8 figs., 6 tabs.

  3. Westinghouse Passive Plants - AP600 and S PWR

    International Nuclear Information System (INIS)

    The original thought behind the AP600 passive design was that if the U. S. nuclear industry was to be revitalized, it would require a new, advanced technology with clearly proven benefits in safety. Response from the international arena indicates that, regardless of local domestic consideration, a revitalization of the U. S. industry is seen as very important, even essential, worldwide. And the potential for scale up of these passive safety features has been clearly established, allowing the benefits of the passive technology to be realized in countries that, for whatever reason, are interested in larger plant sizes only. Government projections indicate that U. S. energy demands in the 1990s will grow steadily, creating the need for approximately 117,000 to 322,000 MW of new generating capacity by the year 2010. Although this growth in electricity demand continues to be strong, orders for new nuclear power plants have not kept pace, in part due to licensing delays, prohibitive construction costs, and public uncertainty about safety. However, with the increased concerns about the environmental and economic security risks involved with an excessive dependence on fossil fuels, there is a growing realization that nuclear power must play a major role in our energy future. Looking to the future, Westinghouse is developing the AP600, a simplified two-loop PWR featuring passive safety systems. Drawing on the results of the AP600 development and testing programs, Westinghouse is also developing the larger S PWR, a passive, three-loop power plant with an output in the 900 to 1000 MW range

  4. Molecular Basis for Enhancement of the Meiotic DMCI Recombinase by RAD51AP1

    Energy Technology Data Exchange (ETDEWEB)

    Dray, Eloise; Dunlop, Myun Hwa; Kauppi, Liisa; San Filippo, Joseph San; Wiese, Claudia; Tsai, Miaw-Sheue; Begovic, Sead; Schild, David; Jasin, Maria; Keeney, Scott; Sung, Patrick


    Homologous recombination is needed for meiotic chromosome segregation, genome maintenance, and tumor suppression. RAD51AP1 (RAD51 Associated Protein 1) has been shown to interact with and enhance the recombinase activity of RAD51. Accordingly, genetic ablation of RAD51AP1 leads to enhanced sensitivity to and also chromosome aberrations upon DNA damage, demonstrating a role for RAD51AP1 in mitotic homologous recombination. Here we show physical association of RAD51AP1 with the meiosis-specific recombinase DMC1 and a stimulatory effect of RAD51AP1 on the DMC1-mediated D-loop reaction. Mechanistic studies have revealed that RAD51AP1 enhances the ability of the DMC1 presynaptic filament to capture the duplex DNA partner and to assemble the synaptic complex, in which the recombining DNA strands are homologously aligned. We also provide evidence that functional co-operation is dependent on complex formation between DMC1 and RAD51AP1, and that distinct epitopes in RAD51AP1 mediate interactions with RAD51 and DMC1. Finally, we show that RAD51AP1 is expressed in mouse testes, and that RAD51AP1 foci co-localize with a subset of DMC1 foci in spermatocytes. These results suggest that RAD51AP1 also serves an important role in meiotic homologous recombination.

  5. Multiplicity among chemically peculiar stars II. Cool magnetic Ap stars


    Carrier, F.; North, P.; Udry, S.; Babel, J.


    We present new orbits for sixteen Ap spectroscopic binaries, four of which might in fact be Am stars, and give their orbital elements. Four of them are SB2 systems: HD 5550, HD 22128, HD 56495 and HD 98088. The twelve other stars are : HD 9996, HD 12288, HD 40711, HD 54908, HD 65339, HD 73709, HD 105680, HD 138426, HD 184471, HD 188854, HD 200405 and HD 216533. Rough estimates of the individual masses of the components of HD 65339 (53 Cam) are given, combining our radial velocities with the r...

  6. Santiago Apóstol en la intimidad del santiaguero


    Portuondo Zúñiga, Olga


    La relación entre el apóstol Santiago (el Mayor) y Santiago de Cuba remonta hasta el ya casi milenio de su fundación; y en el día de hoy, la ciudad está orgullosa de su nombre y de su patronazgo. La tradición engarza las cuentas de una historia común, sin que implique una plena identificación espiritual inicial, ni la inexistencia de escollos a salvar para que la comunidad asumiera como honra y nobleza su cualidad santiaguera.

  7. Initial diagnostics commissioning results for the APS injector subsystems (United States)

    Lumpkin, A.; Chung, Y.; Kahana, E.; Patterson, D.; Sellyey, W.; Smith, T.; Wang, X.


    In recent months the first beams have been introduced into the various injector subsystems of the Advanced Photon Source (APS). An overview will be given of the diagnostics results on beam profiling, beam position monitors (BPMs), loss rate monitors (LRMs), current monitors (CMs), and photon monitors on the low energy transport lines, positron accumulator ring (PAR), and injector synchrotron (IS). Initial measurements have been done with electron beams at energies from 250 to 450 MeV and 50 to 400 pC per macrobunch. Operations in single turn and stored beam conditions were diagnosed in the PAR and IS.

  8. Operation of the APS photoinjector drive laser system.

    Energy Technology Data Exchange (ETDEWEB)

    Li, Y.; Accelerator Systems Division (APS)


    The APS photoinjector drive laser system has been in operation since 1999 and is achieving a performance level exceeding the requirement of stable operation of the LEUTL FEL system. One remarkable number is the UV energy stability of better than 2% rms, sometimes less than 1% rms. This report summarizes the operation experience of the laser system and the improvements made along the way. We also outline the route of upgrade of the system and some frontier laser research and development opportunities in ultrabright electron beam generation.

  9. Euphorbesulins A-P, Structurally Diverse Diterpenoids from Euphorbia esula. (United States)

    Zhou, Bin; Wu, Yan; Dalal, Seema; Cassera, Maria B; Yue, Jian-Min


    Aqueous ethanol extracts of powdered twigs of Euphorbia esula afforded 16 new diterpenoids, named euphorbesulins A-P. These euphorbesulins included presegetane (1-3), jatrophane (4-14), paraliane (15), and isopimarane (16) diterpenoids as well as six known analogues. Compounds 1-3 represent a rare type of presegetane diterpenoid. Their structures were determined by analysis of the spectroscopic data, and the absolute configuration of 1 was established by X-ray crystallography. Diterpenoid 7 showed low nanomolar antimalarial activity, while the remaining compounds showed only moderate or no antimalarial activity. PMID:27447736

  10. Expansion and Functional Divergence of AP2 Group Genes in Spermatophytes Determined by Molecular Evolution and Arabidopsis Mutant Analysis (United States)

    Wang, Pengkai; Cheng, Tielong; Lu, Mengzhu; Liu, Guangxin; Li, Meiping; Shi, Jisen; Lu, Ye; Laux, Thomas; Chen, Jinhui


    The APETALA2 (AP2) genes represent the AP2 group within a large group of DNA-binding proteins called AP2/EREBP. The AP2 gene is functional and necessary for flower development, stem cell maintenance, and seed development, whereas the other members of AP2 group redundantly affect flowering time. Here we study the phylogeny of AP2 group genes in spermatophytes. Spermatophyte AP2 group genes can be classified into AP2 and TOE types, six clades, and we found that the AP2 group homologs in gymnosperms belong to the AP2 type, whereas TOE types are absent, which indicates the AP2 type gene are more ancient and TOE type was split out of AP2 type and losing the major function. In Brassicaceae, the expansion of AP2 and TOE type lead to the gene number of AP2 group were up to six. Purifying selection appears to have been the primary driving force of spermatophyte AP2 group evolution, although positive selection occurred in the AP2 clade. The transition from exon to intron of AtAP2 in Arabidopsis mutant leads to the loss of gene function and the same situation was found in AtTOE2. Combining this evolutionary analysis and published research, the results suggest that typical AP2 group genes may first appear in gymnosperms and diverged in angiosperms, following expansion of group members and functional differentiation. In angiosperms, AP2 genes (AP2 clade) inherited key functions from ancestors and other genes of AP2 group lost most function but just remained flowering time controlling in gene formation. In this study, the phylogenies of AP2 group genes in spermatophytes was analyzed, which supported the evidence for the research of gene functional evolution of AP2 group.

  11. A new record of Equus (Mammalia: Equidae from the Late Pleistocene of central-south Chile Un nuevo registro de Equus (Mammalia: Equidae para el Pleistoceno Superior de Osorno, Chile

    Directory of Open Access Journals (Sweden)



    Full Text Available Fourteen dental and bone parts of a horse excavated from the Pilauco paleontological site, Osorno (40°39' S-73°07' W are analysed and interpreted. This site was formed in association with a peat bog located on the banks of the old Damas River and has conserved abundant late Pleistocene mammalian fauna and flora materials. A date of 11457 ± 140 14C yrs B.P. was obtained from a molar and agrees with our stratigraphic age model. We have identified the fossils as pertaining to the species Equus (Amerhippus andium, which confirms its presence in central-south Chile. Furthermore, the recorded geographic location indicate that the metapodial adaptations of the specimens previously described agree with the reconstructed late Pleistocene landscape of Pilauco, dominated by soft volcanic soils and isolated forest patches over large extensions of grasslands.Se analizan e interpretan 14 fósiles correspondientes a dientes y huesos de caballo registrados en el sitio Pilauco, Osorno (40°39' S-73°07' W. El sitio se formó asociado a un pantano en un borde del antiguo río Damas; en él se ha conservado abundante material de mastofauna y flora pleistocénica. Una fecha radiocarbónica de 11457 ± 140 A.P obtenida de un molar, es concordante con el modelo de edad del sitio. La identificación taxonómica permite asociar a los fósiles a la especie Equus (Amerhippus andium, lo que confirma la presencia de la especie en el centro-sur de Chile. Por otra parte, la posición geográfica de los hallazgos y la reconstrucción del paisaje indicarían que se trata de ejemplares cuyas adaptaciones en los metapodios son concordantes para el paisaje pleistocénico de Pilauco dominado por suelos volcánicos blandos, con presencia de bosquetes dispersos en grandes extensiones de praderas de gramíneas.

  12. Agreement between the Government of the Republic of Chile and ESO for Establishing a New Center for Observation in Chile - ALMA (United States)


    On October 21, 2002, the Minister of Foreign Affairs of the Republic of Chile, Mrs. María Soledad Alvear and the ESO Director General, Dr. Catherine Cesarsky , signed an Agreement that authorizes ESO to establish a new center for astronomical observation in Chile . This new center for astronomical observation will be for the Atacama Large Millimeter Array (ALMA) , the largest ground based astronomical project for the next decades. On this occasion, Minister Alvear stated that "we want to have ALMA working as soon as possible, which will constitute a pride not only to Chilean scientists but for the whole country and in particular, for the community of the Antofagasta Region" . ESO Director General Cesarsky said that "signing this agreement between the Government of Chile and ESO is a historical step in the astronomical collaboration between Chile and ESO and it will allow Chile to host, once again, a project of worldwide interest and impact" . ALMA is a joint project on equal basis between ESO and AUI (Associated Universities, Inc.). These organizations represent the scientific interests of Europe on one side and the United States with Canada on the other side. Chilean astronomers are closely involved with the project and 10% of the observing time will be reserved for Chilean science. ALMA will be built in the Andes, on the Plateau of Chajnantor (see the Chajnantor Photo Gallery ), 5000 metres above sea level and 60 km East of the town of San Pedro de Atacama. The array will be comprised of 64 antennas with unprecedent sensitivity and angular resolution that will allow studying the origin of galaxies, stars and planets, opening new horizons for astronomy, and being able to observe galaxies across the universe where stars are being formed. The agreement now signed between ESO and the Government of the Republic of Chile recognizes the interest that the ALMA Project has for Chile, as it will deepen and strengthen the cooperation in scientific and technological matters

  13. Constitutive Expression of Sense & Antisense PtAP3, an AP3 Homologue Gene of Populus tomentosa, Affects Growth and Flowering Time in Transgenic Tobacco

    Institute of Scientific and Technical Information of China (English)


    To analyze the function of PtAP3, an APETALA3 (AP3) homologue gene isolated from Populus tomentosa Carr., the full length sequence (1 797 bp) and a fragment (870 bp) of PtAP3 were fused to a CaMV 35S promoter of pBI121 to generate the sense and antisense constructs of PtAP3. These constructs were transformed into tobacco by Agrobacterium infection of leaf disks and selection on kanamycin medium. Some sense and antisense transgenic tobacco plants were obtained by PCR and Southern blot analysis. Great phenotypic differences in transgenic tobacco plants were observed. Almost all of sense PtAP3 to transgenic tobaccos showed a higher growth rate than those of antisense transformants and a few developed pregnancy earlier than wild type seedlings and antisense transformants under the same conditions.

  14. Hydrogeologische Untersuchungen der Geothermalfelder von Puyehue und Cordón Caulle, Chile


    Dorsch, Klaus


    -Resumen extendido- Investigaciones realizadas en conjunto con la Universidad de Chile, en las áreas geotermales activas entre Lago Ranco y Lago Rupanco en el Sur de Chile (40.5ºS) han sido enfocadas a establecer balances hídricos e hidroquímicos. Esta tesis muestra los resultados de dos estudios de terreno realizados en las temporadas enero-marzo 2001 y enero-febrero 2002, y una investigación bibliográfica y recopilación de datos llevada a cabo en Chile. Los cálculos del caudal total se bas...

  15. Countering the resource curse: a comparative analysis of political economy for Chile and Australia


    Ford, Daniel R.


    This thesis attempts to explain how advanced economies with large mining sectors, like those of Australia and Chile, have managed to avoid the resource curse. Minerals (iron ore and coal) account for over two-thirds of Australia’s exports, and minerals (copper) amount to over two-thirds of Chilean exports as well. Hence, Australia and Chile have been labeled as commodity-based economies in the past. There is some validity to this claim, as Chile has gained significant fiscal revenues from cop...

  16. The Expansion of Cash Transfers in Chile and its Challenges: Ethical Family Income


    Simone Cecchini; Claudia Robles; Luis Hernán Vargas


    In the last decade Chile has attracted renewed interest for its innovative social protection policies and programmes, such as the Chile Solidario system to overcome extreme poverty (launched in 2002), the special plan for Universal Access with Explicit Guarantees (Plan de Acceso Universal con Garantías Explícitas, AUGE) to ensure access to healthcare (2004), the Basic Solidarity Pension (Pensión Básica Solidaria, PBS)?the cornerstone of the 2008 pension reform?and the system of Chile Grows Wi...

  17. The new AP Physics exams: Integrating qualitative and quantitative reasoning (United States)

    Elby, Andrew


    When physics instructors and education researchers emphasize the importance of integrating qualitative and quantitative reasoning in problem solving, they usually mean using those types of reasoning serially and separately: first students should analyze the physical situation qualitatively/conceptually to figure out the relevant equations, then they should process those equations quantitatively to generate a solution, and finally they should use qualitative reasoning to check that answer for plausibility (Heller, Keith, & Anderson, 1992). The new AP Physics 1 and 2 exams will, of course, reward this approach to problem solving. But one kind of free response question will demand and reward a further integration of qualitative and quantitative reasoning, namely mathematical modeling and sense-making--inventing new equations to capture a physical situation and focusing on proportionalities, inverse proportionalities, and other functional relations to infer what the equation ``says'' about the physical world. In this talk, I discuss examples of these qualitative-quantitative translation questions, highlighting how they differ from both standard quantitative and standard qualitative questions. I then discuss the kinds of modeling activities that can help AP and college students develop these skills and habits of mind.

  18. Containment integrity analysis for the (W) advanced AP900

    International Nuclear Information System (INIS)

    The consequences of accidents that occurred at Three Mile Island and Chernobyl and the lack of interest from utilities in committing to high powered, high maintenance light water reactor designs of the past have motivated the nuclear industry to develop smaller, lower powered, simplified designs. Simplified designs must employ more passive systems that require very low maintenance and rely on the basic laws of nature. These designs must not be limited only to the reactor, but must also include the containment building. The purpose of this paper is to discuss the design concepts and to verify the feasibility of the Westinghouse Passive Containment Cooling System (PCCS) design for a 900 MWe advanced passive reactor design (AP900) by presenting its response to a design basis large break Loss of Coolant Accident (LOCA). The mass and energy releases emanating from the design basis break were developed and a representative containment model was constructed. The COMPACT computer code, which is a multi-node program that solves the complete set of mass, energy and momentum equations, was used to determine the AP900 containment response. The PCCS design concept, the computer model, the analysis inputs, and the results of the study are discussed within this paper. (author). 2 refs., 9 figs

  19. Abnormal lithium abundance in several Ap-Bp stars

    CERN Document Server

    Shavrina, A; Drake, N A; Kudryavtsev, D O; Gopka, V F; Yushchenko, V A; Yushchenko, A V


    Using observations of rapidly rotating roAp star HD 12098, obtained with 6m telescope of SAO RAS in 2005-2008 in nine rotational phases (0.001-0.817), and code V. Tsymbal ROTATE we identified 3 lithium spots on the surface of star, one of them coincided with the position of one magnetic pole and two others are located near the other pole, symmetrically with respect to it. Perhaps magnetic field of the star has a more complex structure than the dipole (Shavrina 2008). Lithium abundance in the spots is greater than cosmic one. It can be explained by diffusion of lithium in the presence of a magnetic field or by production of lithium in the reactions of "spallation" on the surface of star near the magnetic poles (see, for example, Goriely 2007). Enhanced lithium abundances was also determined for other two slowly rotating Ap stars HR 465 and HD 965. The analysis is performed using a synthetic spectrum method taking into account magnetic splitting of lines by the SYNTHM code of Khan (2004).

  20. Preparation of and porosity measurements on oxidic APS spray coatings; Praeparation und Porositaetsmessung an oxidischen APS-Spritzschichten

    Energy Technology Data Exchange (ETDEWEB)

    Motl, Wolfgang [H.C. Starck GmbH, Laufenburg (Germany); Schnarr, Holger [Struers GmbH, Willich (Germany)


    Zirconium oxide coatings for application in the field of turbine construction have to exhibit certain properties in order to meet high temperature requirements. One of the most important properties is the porosity, for it provides a thermal insulation of the coated material. For this reason, the porosity is routinely determined as quality parameter for spray coatings which helps determining their suitability for a particular application. The following work summarizes the results of the round robin test ''Preparation of and Porosity Measurements on Oxidic APS Spray Coatings'' by the DGM working group ''Preparation''.

  1. Progresses on plant AP2/ERF transcription factors%植物AP2/ERF 类转录因子研究进展

    Institute of Scientific and Technical Information of China (English)

    张计育; 王庆菊; 郭忠仁


    植物AP2/ERF 是一个庞大的转录因子基因家族,含有由60~70 个氨基酸组成的AP2/ERF 结构域而得名,存在于所有的植物中.AP2/ERF 转录因子参与多种生物学过程,包括植物生长、花发育、果实发育、种子发育、损伤、病菌防御、高盐、干旱等环境胁迫响应等.AP2/ERF 类转录因子参与水杨酸、茉莉酸、乙烯、脱落酸等多种信号转导途径,而且是逆境信号交叉途径中的连接因子.文章对国内外近年来有关植物AP2/ERF 类转录因子的分类、生物学功能、基因调控等方面的研究进行了综述.%Plant AP2/ERF transcription factor with AP2/ERF domain containing 60-70 amino acids is a huge gene family present in all plant. AP2/ERF transcriptional factors are involved in various biological functions such as plant development, flower development, fruit and seed maturation, wounding, pathogen defense, high salty, drought, and so on. AP2/ERF transcription factor are involved in salicylic acid, jasmonic acid, ethylene, abscisic acid signal transduction pathways and among them. The transcription factors are cross-talk factor in stress signal pathway. This paper summarizes the most advanced researches on types, biological functions, and gene regulations of plant AP2/ERF transcription factors.

  2. RAD51AP2, a novel vertebrate- and meiotic-specific protein, sharesa conserved RAD51-interacting C-terminal domain with RAD51AP1/PIR51

    Energy Technology Data Exchange (ETDEWEB)

    Kovalenko, Oleg V.; Wiese, Claudia; Schild, David


    Many interacting proteins regulate and/or assist the activities of RAD51, a recombinase which plays a critical role in both DNA repair and meiotic recombination. Yeast two-hybrid screening of a human testis cDNA library revealed a new protein, RAD51AP2 (RAD51 Associated Protein 2), that interacts strongly with RAD51. A full-length cDNA clone predicts a novel vertebrate specific protein of 1159 residues, and the RAD51AP2 transcript was observed only in meiotic tissue (i.e. adult testis and fetal ovary), suggesting a meiotic-specific function for RAD51AP2. In HEK293 cells the interaction of RAD51 with an ectopically-expressed recombinant large fragment of RAD51AP2 requires the C-terminal 57 residues of RAD51AP2. This RAD51-binding region shows 81% homology to the C-terminus of RAD51AP1/PIR51, an otherwise totally unrelated RAD51-binding partner that is ubiquitously expressed. Analyses using truncations and point mutations in both RAD51AP1 and RAD51AP2 demonstrate that these proteins use the same structural motif for RAD51 binding. RAD54 shares some homology with this RAD51-binding motif, but this homologous region plays only an accessory role to the adjacent main RAD51-interacting region, which has been narrowed here to 40 amino acids. A novel protein, RAD51AP2, has been discovered that interacts with RAD51 through a C-terminal motif also present in RAD51AP1.

  3. Duplication of AP1 within the Spinacia oleracea L. AP1/FUL clade is followed by rapid amino acid and regulatory evolution. (United States)

    Sather, D Noah; Golenberg, Edward M


    The AP1/FUL clade of MADS box genes have undergone multiple duplication events among angiosperm species. While initially identified as having floral meristem identity and floral organ identity function in Arabidopsis, the role of AP1 homologs does not appear to be universally conserved even among eudicots. In comparison, the role of FRUITFULL has not been extensively explored in non-model species. We report on the isolation of three AP1/FUL genes from cultivated spinach, Spinacia oleracea L. Two genes, designated SpAPETALA1-1 (SpAP1-1) and SpAPETALA1-2 (SpAP1-2), cluster as paralogous genes within the Caryophyllales AP1 clade. They are highly differentiated in the 3', carboxyl-end encoding region of the gene following the third amphipathic alpha-helix region, while still retaining some elements of a signature AP1 carboxyl motifs. In situ hybridization studies also demonstrate that the two paralogs have evolved different temporal and spatial expression patterns, and that neither gene is expressed in the developing sepal whorl, suggesting that the AP1 floral organ identity function is not conserved in spinach. The spinach FRUITFULL homolog, SpFRUITFULL (SpFUL), has retained the conserved motif and groups with Caryophyllales FRUITFULL homologs. SpFUL is expressed in leaf as well as in floral tissue, and shows strong expression late in flower development, particularly in the tapetal layer in males, and in the endothecium layer and stigma, in the females. The combined evidence of high rates of non-synonymous substitutions and differential expression patterns supports a scenario in which the AP1 homologs in the spinach AP1/FUL gene family have experienced rapid evolution following duplication.

  4. Epidemiología de la difilobotriasis en la cuenca del río Valdivia, Chile Epidemiologia de difílobotriase na bacia do rio Valdivia, Chile Epidemiology of diphyllobothriasis in the Valdivia River basin, Chile

    Directory of Open Access Journals (Sweden)

    Patricio Torres


    Full Text Available Entre los meses de marzo y octubre de 1987 fueron examinados 1295 personas de seis distritos ribereños de la cuenca del río Valdivia, determinándose un 1,2% de prevalencia de infección por Diphyllobothrium en los distritos de Riñihue y Las Huellas. Además, se comprobó un 5,3% y un 9,8% de prevalencia en perros de los distritos de Riñihue y Malihue, respectivamente, pero no se observó infección en gatos y cerdos. Los parásitos recuperados después del tratamiento fueron identificados como Diphyllobothrium latum. La infección humana por D. latum en los distritos afectados se favorece por el consumo de peces ahumados o sometidos a cocción insuficiente. La investigación de 1450 peces (4 especies introducidas y 11 autóctonas capturados entre 1986-1987 en la cuenca del río Valdivia, demostró la existencia de plerocercoides de D. latum y/o Diphyllobothrium dendriticum en Salmo gairdneri y Salmo trutta, entre los peces introducidos, y en algunas especies autóctonas. La prevalencia e intensidad media en las infecciones de los peces así como el grado de agregación de las infrapoblaciones varía en los distintos sectores. Algunas especies de peces actuarían como huésped intermediario y otras como huéspedes paraténicos de Diphyllobothrium spp. en la cuenca del río Valdivia. Como medidas de control para la difilobotriasis en los distritos afectados se propone un mejoramiento de las condiciones de saneamiento básico, educación sanitaria y tratamiento de las personas infectadas.Foram examinadas 1.295 pessoas de seis localidades situadas às margens da bacia do rio Valdivia (Chile, encontrando-se uma prevalência de infecção por Diphyllobothrium igual a 1,2% em Riñihue e Las Huellas. Em cães a prevalência foi de 5,3% e e 9,8% em Riñihue e Malihue, respectivamente, não tendo sido observada infecção em gatos nem porcos. Os parasitas obtidos após tratamento foram identificados como Diphyllobothrium latum. A infecção humana

  5. Adding the human dimension to drought: an example from Chile (United States)

    Rangecroft, Sally; Van Loon, Anne; Maureira, Héctor; Rojas, Pablo; Alejandro Gutiérrez Valdés, Sergio; Verbist, Koen


    Drought and water scarcity are important hazards and can lead to severe socio-economic impacts in many regions of the world. Given the interlinked interactions and feedbacks of hydrological droughts and their impacts and management, we need tools to evaluate these complexities and effects on the availability of water resources. Here we use a real-world case study of the Huasco basin (Northern Chile) in which we quantify the influence of human activities on hydrological drought signals. In this arid region, Andean snowmelt provides water essential for users, with agriculture acting as the main water consumer (85% of total). An increasing water demand from different water sectors (agriculture, mining, and domestic water usage) has increased pressure on available water and its management. Consequently, the Santa Juana dam was built by 1995 to increase irrigation security for downstream users, and recent management and restrictions have been established with the objective to limit impacts of hydrological droughts across the basin. The feedbacks between water availability and water management are explored for this water stressed region in Chile. Hydro-meteorological (e.g. precipitation, temperature, streamflow, reservoir levels) variables have been analysed to assess trends and drought patterns. Data over the past three decades has indicated a decrease in surface water supply, with the basin entering a situation of water scarcity during the recent multiyear drought (2007 - to-date), partly caused by meteorological drought and partly by abstraction. During this period, water supply failed to meet the demands of water users, resulting in the implementation of water restrictions. As well as the necessary continuous hydro-meteorological data, here we used information on human water users and scenario modeling, allowing for the analysis and quantification of feedbacks. This work highlights the importance of local knowledge, especially in understanding water laws, rights

  6. Induction of neural crest in Xenopus by transcription factor AP2alpha. (United States)

    Luo, Ting; Lee, Young-Hoon; Saint-Jeannet, Jean-Pierre; Sargent, Thomas D


    We report experiments with Xenopus laevis, using both intact embryos and ectodermal explants, showing that the transcription factor AP2alpha is positively regulated by bone morphogenetic protein (BMP) and Wnt signaling, and that this activation is an essential step in the induction of neural crest (NC). Ectopic expression of AP2alpha is sufficient to activate high-level expression of NC-specific genes such as Slug and Sox9, which can occur as isolated domains within the neural plate as well as by expansion of endogenous NC territories. AP2alpha also has the property of inducing NC in isolated ectoderm in which Wnt signaling is provided but BMP signaling is minimized by overexpression of chordin. Like other NC regulatory factors, activation of AP2alpha requires some attenuation of endogenous BMP signaling; however, this process occurs at a lower threshold for AP2alpha. Furthermore, AP2alpha expression domains are larger than for other NC factors. Loss-of-function experiments with antisense AP2alpha morpholino oligonucleotides result in severe reduction in the NC territory. These results support a central role for AP2alpha in NC induction. We propose a model in which AP2alpha expression, along with inactivation of NC inhibitory factors such as Dlx3, establish a feedback loop comprising AP2alpha, Sox9, and Slug, leading to and maintaining NC specification. PMID:12511599

  7. Los patelogastrópodos intermareales de Chile y Perú Intertidal limpets of Chile and Peru

    Directory of Open Access Journals (Sweden)



    Full Text Available En este estudio se entrega un sistema de clasificación que refleja las relaciones de parentesco, inferidas a partir del análisis de la región 16S de ADN mitocondrial, de los patelogastrópodos que habitan en la zona intermareal a lo largo de la costa rocosa de Chile y Perú. Además, se incluye el análisis comparativo de estos patelogastrópodos en relación con la estructura, la morfología y los patrones de color de la concha, los dientes de la rádula y la anatomía corporal. Adicionalmente, se entrega información respecto de la distribución y ecología para todos los miembros de este grupo. Los resultados muestran que la fauna Lottiidae de Chile y Perú consiste en al menos nueve especies de patelogastrópodos intermareales. Esto es, ocho especies de patelogastrópodos agrupadas dentro del clado monofilético Scurria (S. variabilis, S. zebrina, S. viridula, S. plana, S. scurra, S. araucana, S. ceciliana y una especie no determinada y un "taxón problemático" asignado preliminarmente dentro del género Lottia (Lottia orbignyi. El grupo está presente entre los 5º S y 54º S, registrándose en los niveles intermareales superior, medio e inferior, desde zonas expuestas a protegidas del oleaje. A nivel intraespecífico, los resultados nos permiten proponer la sinonimia de S. parasitica con S. variabilis, y de S. ceciliana con S. boehmita. Según esto, S. variabilis presentaría al menos tres ecofenotipos: (1 en sustratos rocosos a lo largo de todo su rango geográfico, (2 sobre las conchas de Fissurella crassa y F. limbata principalmente en Chile centro-sur y (3 sobre las placas del chitón Enoplochiton niger en el norte de Chile y sur del Perú. Por su parte, S. ceciliana es una especie de patelogastrópodo que presenta un patrón morfológico y de coloración de la concha altamente variable. En general, la alta variabilidad del patrón de color y morfología de la concha sitúa a estos patelogastrópodos entre los más complejos y

  8. The debate in Chile on organ donation revisited. (United States)

    Kottow Lang, Miguel Hugo


    The worldwide scarcity of cadaveric organs for transplants is on the rise, due in part to extended medical indications and longevity of chronic patients with organic insufficiencies. Chile has an extremely low donor rate of 6.7 per million. Although consent is presumed by law, and recently amended to include a “reciprocity principle”, nearly four million persons have expressed in writing their unwillingness to donate and, of those remaining, 53% of families have rejected donating the organs of their deceased. New proposals are urgently needed, even if some of them have previously been rejected: nonmaterial incentives, partial donations and unveiling anonymity to enhance personal ties between donors and recipients. Transparency, information and assistance are to be reinforced in order to regain trust in transplant procedures. PMID:27570970

  9. Studies on osteoporosis in Chile using isotope-related techniques

    International Nuclear Information System (INIS)

    Several studies on bone densitometry measurements in healthy individuals have been performed in Chile. However due to the fact that different techniques and no uniform protocols have been used to select patients, the results obtained are not suitable as reference values for a normal chilean population. Therefore, foreign reference values are used. This study will select healthy normal individuals, typical urban chilean residents, and measure bone density using the DEXA technique. The selection will be made according to a well defined protocol. Serum osteocalcin, a marker of bone remodeling, will be measured in all subjects as a means-a assessing bone metabolism. Bone trace element composition will be measured in selected subjects. Samples will be obtained by biopsy or through normal surgical procedures and will be analyzed by neutron activation analysis. (author)

  10. [Scarlet fever epidemic during year 1929 in Chile]. (United States)

    Laval R, Enrique


    Scarlet fever is endemic in Chile, with relatively low morbidity and periodic exacerbations every 4 or 5 years, which can become epidemics. From 1921 to 1927, the number of patients hospitalized in the country fluctuated from 15 to 65 per year, until an epidemic involving nearly 3.000 patients started at the end of 1928 and continued during all 1929. 978 patients died, 537 (52.5%) were from Santiago. Public Health authorities confronted this emergency with prevention, prophylaxis, isolation and treatment measures and 558 beds were disposed for patient hospitalization. Vaccination trials were undertaken and specific treatment with antitoxins was used in patients with toxic clinical cases, having satisfactory results. Convalescent patients were controlled in order to stop the spread of the infection. After approximately 3 years, this disease returned to its regular endemicity.

  11. DEMETER Satellite Observations of Particle Burst Prior to Chile Earthquake

    CERN Document Server

    Zhang, Zhenxia; Shen, Xuhui; Ma, Yuqian; Chen, Huaran; You, Xinzhao; Yuan, Yahong


    The lithosphere activity during seismogenic or occurrence of one earthquake may emit electromagnetic wave which propagate to ionosphere and radiation belt, then induce disturbance of electric and magnetic field and the precipitation of high energy charged particles. This paper, based on the data detected by DEMETER satellite, present the high energy charged particle burst(PB) with 4 to 6 times enhancement over the average value observed about ten days days before Chile earthquake. The obvious particle burst was also observed in the northern hemisphere mirror points conjugate of epicenter and no PB events in different years over the same epicenter region was found. The energy spectra of the PBs are different from the one averaged within the first three months in 2010. At the same time, the disturbance of the VLF electric spectrum in ionosphere over the epicenter detected by the DEMETER satellite are also observed in the same two orbits. Those observations from energetic PB and VLF electric spectrum disturbance...

  12. Distribución espacial de la pobreza en Chile


    Agostini, Claudio A.; Philip H Brown; Góngora, Diana Paola


    Chile ha sido particularmente exitoso en la reducción de la pobreza durante los últimos 20 años, disminuyendo el porcentaje de la población bajo la línea de pobreza de un 38,6% en 1990 a un 13,7% en 2006. Con tasas de pobreza más bajas, el esfuerzo de focalización necesario para el diseño de políticas públicas que permitan reducir aún más o erradicar la pobreza, es mucho mayor y se requiere información más desagregada a nivel geográfico. Los mapas de pobreza pueden cumplir este rol, ya que en...

  13. Soil erosion and its control in Chile - An overview

    International Nuclear Information System (INIS)

    Accelerate erosion in Chile is a consequence from land use that degrade soil such as compaction, loss of organic matter and soil structure. The erosion is favored by the very hilly landscape of the country that increases erosivity index and the high erodibility given by an elevated annual rate of rainfall with irregular distribution. Several experiences have demonstrated that adequate crop management and crop rotations can minimize erosion. The most effective control is achieved conserving and improving soil structure with management systems that include regular use of soil-improving crops, return of crop residues and tillage practices, thus avoiding unnecessary breakdown soil or compacted soil structure. Conservation tillage increased organic matter levels improving stabile soil structure, aeration and infiltration. (author)

  14. Identidad y fronteras urbanas en Santiago de Chile

    Directory of Open Access Journals (Sweden)

    Francisca Márquez


    Full Text Available Este articulo analiza a través de un ejercicio etnográfico los procesos de construcción identitaria de los habitantes de barrios pobres y medios de la ciudad de Santiago de Chile. Se plantea que las identidades que alli se construyen son expresión de los procesos de segregación urbana de la ciudad de Santiago y ellas dan cuenta del debilitamiento de un modelo urbano asentado en la heterogeneidad social, la noción de espacio público y valores como la ciudadanía política y la integración social. Paradojalmente, esta misma segregación urbana abre también paso a un imaginario y una práctica de vida comunitaria y tribal que refuerza y protege al nosotros de la peligrosidad de los otros.

  15. Participación electoral en Chile, 1988-2001

    Directory of Open Access Journals (Sweden)

    Patricio Navia


    Full Text Available Este trabajo muestra que la participación electoral en Chile hoy no es menor a la observada hasta antes de 1973. La alta tasa de participación en 1988 representa una comprensible anomalía. Después de 15 años sin votar, los chilenos participaron entusiastamente en el plebiscito. Pero a partir de entonces, la tasa de participación tendió a la baja hasta llegar a fines de los 90 a niveles similares a los observados antes del quiebre democrático de 1973. Usando un marco teórico que aborda la participación como una función basada en costos y beneficios, discute la participación electoral en Chile en un contexto internacional, subrayando las diferencias y similitudes de los patrones existentes antes de 1973 y después de 1988, enfatizando tanto lógicas de inscripción como de participación electoral. Al hacerlo, aborda la tensión que existe entre un electorado estable y un número creciente de personas no inscritas para votar. Por último, identifica algunas propuestas que permitirían eliminar las trabas institucionales que han llevado a la formación de dos clases de adultos, aquellos que estando inscritos están obligados a votar y los que al no estar inscritos no pueden sufragar. Puntualmente, argumenta que al automatizar la inscripción se puede incorporar a todos sin tener siquiera que entrar a discutir la obligatoriedad del votoContrary to a widespread belief, post-1990 electoral participation in Chile is not lower than before 1973. The high turnout rates observed in 1988 constitute an understandable anomaly. After 15 years without elections, Chileans enthusiastically participated in the plebiscite. Yet, after that event, turnout rates fell during the 1990s to levels similar to those observed before 1973. Using a theoretical framework that defines turnout as a function based on cost and benefits, I discuss electoral participation in Chile in an international context, highlighting the differences and similarities between the

  16. A failed platform: The Citizen Consensus Conference travels to Chile. (United States)

    Ureta, Sebastián


    This article starts by reviewing the setbacks that the recent Science and Technology Studies literature has identified in the functioning of technologies of democracy, the different arrangements that look to enact deliberation on technoscientific issues. Putting a focus on the Citizen Consensus Conference, it then proposes that several of these setbacks are related to the kind of "work" that these technologies are expected to do, identifying two kinds of it: performing a laboratory-based experiment and constituting a platform for the dissemination of facts. It then applies this framework to study a Citizen Consensus Conference carried out in Chile in 2003. After a detailed genealogy of the planning, implementation and afterlife of this exercise, the article concludes that several of the limitations experienced are derived from a "successful outcome" conceived as solely running a neat lab-based experiment, arguing for the need to incorporate its functioning as a platform with all the associated transformations and messiness.

  17. Chile: la persistencia de las memorias antagónicas

    Directory of Open Access Journals (Sweden)

    Gilda Waldman Mitnick


    Full Text Available A pesar de los años transcurridos en democracia, en Chile siguen persistiendo las sombras del pasado dictatorial. El país todavía no ha logrado realizar el duelo por un pasado tan doloroso, y las memorias antagónicas y contrapuestas siguen vigentes. Ello se manifiesta, por ejemplo, en los conflictos generados en torno a la conmemoración del 11 de septiembre, en los polémicos debates por los memoriales erigidos en honor de personajes políticos de izquierda y de derecha, así como en las contradictorias miradas respecto a uno de los personajes más emblemáticos de la represión dictatorial, Miguel Krassnoff, tal como aparece en dos libros de reciente publicación.

  18. [Vaccines against hepatitis A and B in Chile]. (United States)

    Valenzuela, M Teresa


    The mode of transmission and epidemiological approach for hepatitis A and B are different. However, both are preventable with vaccines whose efficacy and long lasting protection has been demonstrated. This review describes the secular tendency of both infections in Chile, their risk factors that have contributed to their persistence in the country and the interventions that have been carried out to reduce the disease burden. Although the vaccine for hepatitis B was incorporated to the immunization program in 2005, the vaccine for hepatitis A persists in the list of interventions that must be assumed with priority by the Ministry of Health. If Chilean health authorities pretend to reach the enteric disease indicators of developed countries, they must accelerate the epidemiological transition towards the elimination of hepatitis A.


    Directory of Open Access Journals (Sweden)

    Jorge Díaz Tejeda


    Full Text Available Este artículo propone Premisas Conceptuales, Premisas Metodológicas y el desarrollo de Aspectos Estratégicos para la implementación de soluciones a la Movilidad Urbana. Se inspira en las ideas, experiencias e investigaciones de diversas personas quienes abordan desde lógicas puntuales aspectos temáticos específicos en el marco de la Planificación Urbana en general y de las aplicaciones en Transporte en particular. Chile atraviesa por una oportunidad histórica, quizás paradójicamente, a partir de un evento de catástrofe ocurrido en Febrero del 2010; esta oportunidad es la de re-plantear el proceso de Planificación Urbana bajo los alcances del Desarrollo Sustentable.


    Pakozdi, Tamara; Leiva, Laura; Bunout, Daniel; Barrera, Gladys; de la Maza, María Pía; Henriquez, Sandra; Hirsch, Sandra


    Objetivo: evaluar el Gasto Energético Total (GET) en ancianos sanos que viven institucionalizados o independientes en Chile. Método: se evaluaron veintisiete jovenes (27-30 años), 27 adultos mayores institucionalizados (> 65 años ) y 27 ancianos independientes (> 65 años). Se midió la composición corporal utilizando absorciometría bifotónica de rayos X. Se calculó el gasto energético por actividad física (GEAF) y el gasto energético total (GET) utilizando acelerómetros Actiheart; se aplicó Mini Nutritional Assessment (MNA) y se midió el Timed Up and Go (TUG). Resultados: el GEAF fue 171, 320 y 497 kcal/día en ancianos institucionalizados, independientes y jóvenes, respectivamente (p.

  1. Characteristics of shigellosis outbreaks in the AP of Vojvodina

    Directory of Open Access Journals (Sweden)

    Đurić Predrag


    Full Text Available Introduction. Shigellosis causes around 165 million infections and around 1 million deaths in the world every year. Two thirds of both infections and deaths are among children younger than 10. Shigellosis mainly spreads by direct or indirect contact, but water- and food-borne outbreaks are not rare. Material and methods. A descriptive epidemiological method was used to analyse characteristics of shigellosis outbreaks in the AP of Vojvodina in the period 1979-2005. Results. During this period 9.083 shigellosis infections were registered, 51,9% of them in 202 shigellosis outbreaks. The leading way of transmission was contact, but water- and food-borne outbreaks were also detected. The average number of infections in contact outbreaks of shigellosis was small - 6.3 infections. The highest average is in water-borne outbreaks - 55.1. Most of the outbreaks were those occurring in families (47.5% and most of them were registered in august. Discussion. Shigellosis has been mandatory reported in the AP of Vojvodina since 1945 and results of outbreak investigation of this disease were analyzed since 1979. In the first half of this period water was the most common way of agent transmission in shigellosis outbreaks, but in recent 15 years the contact became the leading one. In the last 5 years there was no water-borne shigellosis outbreaks. Almost one third of all outbreaks were imported from Montenegro and Croatia by tourists coming back from those countries. Most of the outbreaks are small outbreaks occurring in families, primarily transmitted by contact. Outbreaks in facilities for care of disabled children and elders are also important. Sh. sonnei and Sh. flexneri are the two serotypes identified, the former in 57.4% and the latter in 40.1% outbreaks. Conclusion. Shigellosis is a disease occurring in the AP of Vojvodina primarily in small outbreaks inside families, transmitted by contact, most often in August and more often caused by Sh. sonnei. Health

  2. The flame structure of AP/HTPB sandwiches (United States)

    Chorpening, Benjamin Todd


    Ultraviolet emission imaging experiments have been used to study the combustion of sandwiches of ammonium perchlorate (AP) and hydroxyl-terminated polybutadiene (HTPB) in nitrogen at pressures up to 32 atm, with binder layers from 50 to 450 mum in thickness. An ICCD camera system has been used to image the flame emission near 310 nm, and a backlighting technique has been developed that allows determination of the corresponding surface shape during combustion. The results indicate the AP/HTPB interface regression rate of IPDI cured samples undergoing low power (100W) laser-assisted deflagration is nearly independent of the binder thickness for binders thicker than 100 mum. The pressure exponent of the regression rate is 0.31 up to 15 atm, increasing with pressure from 15 to 32 atm. Two primary regimes of flame behavior have been identified: a split flame base regime which occurs with high Peclet and Damkohler numbers, and a merged flame base regime which occurs with low Peclet and Damkohler numbers. A secondary regime, exhibiting a "lifted" flame, occurs with low Damkohler numbers and high Peclet numbers. The ultraviolet flame emissions observed in the experiments show a correspondence with the fuel-rich region of the flame, as determined with a Schvab-Zeldovich model. This is reasonable since the primary sources of ultraviolet emission in the 305--315 nm region, electronically excited OH and the CO + O reaction, are dependent on fuel related species. The growth of the fuel-rich region with increasing Peclet number, predicted by the model, is qualitatively matched by the experimental results. The predicted shrinkage of the fuel-rich region when the binder layer is diluted with fine AP is also qualitatively matched by the experiments. Comparison of the experimental results with a single-reaction model with finite rate kinetics shows a weak qualitative agreement on the influence of Damkohler number. A large increase in Damkohler number (factor of 20) leads to a strong

  3. Lung cancer and arsenic concentrations in drinking water in Chile. (United States)

    Ferreccio, C; González, C; Milosavjlevic, V; Marshall, G; Sancha, A M; Smith, A H


    Cities in northern Chile had arsenic concentrations of 860 microg/liter in drinking water in the period 1958-1970. Concentrations have since been reduced to 40 microg/liter. We investigated the relation between lung cancer and arsenic in drinking water in northern Chile in a case-control study involving patients diagnosed with lung cancer between 1994 and 1996 and frequency-matched hospital controls. The study identified 152 lung cancer cases and 419 controls. Participants were interviewed regarding drinking water sources, cigarette smoking, and other variables. Logistic regression analysis revealed a clear trend in lung cancer odds ratios and 95% confidence intervals (CIs) with increasing concentration of arsenic in drinking water, as follows: 1, 1.6 (95% CI = 0.5-5.3), 3.9 (95% CI = 1.2-12.3), 5.2 (95% CI = 2.3-11.7), and 8.9 (95% CI = 4.0-19.6), for arsenic concentrations ranging from less than 10 microg/liter to a 65-year average concentration of 200-400 microg/liter. There was evidence of synergy between cigarette smoking and ingestion of arsenic in drinking water; the odds ratio for lung cancer was 32.0 (95% CI = 7.2-198.0) among smokers exposed to more than 200 microg/liter of arsenic in drinking water (lifetime average) compared with nonsmokers exposed to less than 50 microg/liter. This study provides strong evidence that ingestion of inorganic arsenic is associated with human lung cancer.

  4. Anisakid parasites in commercial hake ceviche in southern Chile. (United States)

    Torres-Frenzel, Pablo; Torres, Patricio


    The objective of this research was to determine the occurrence of anisakid nematode larvae in hake ceviche sold in restaurants in Valdivia (39°48'S, 73°14'W) and Niebla (39°49'S, 73°22'W), Chile. Between August and November 2012, 78 portions of ceviche were collected (6 from each of the 13 restaurants that sell this product). Each portion was weighed and divided into approximately 30-g samples, which were placed in petri dishes with 0.15 M NaCl. All samples were manually shredded and then examined with a stereomicroscope. Muscles of 41 southern hake (Merluccius australis), a fish sold fresh in Valdivia, also were examined by candling to determine the presence of anisakid larvae. The presence of Pseudoterranova larvae in ceviche sold in Chile was identified for the first time. The pH of ceviche ranges from 4.1 to 4.8, which favors the presence of viable anisakid larvae that tolerate the acid pH similar to that found in the stomach of their mammalian host. No significant differences (P > 0.05) in the prevalence, mean abundance, and mean density of anisakid larvae in ceviche were found between localities. Larvae were detected in ceviche from 3 of 6 restaurants in Valdivia and 4 of 7 restaurants in Niebla. Of the 78 examined portions of ceviche, 21.8% had larvae. The prevalence of viable larvae was 16.7 and 7.1% in the examined portions from Valdivia and Niebla, respectively. In the 41 hake muscle samples from Valdivia, the prevalence (4.9%), mean abundance (0.1), and mean density (0.03) was the same for Pseudoterranova and Anisakis larvae. No inspection processes or pretreatments are currently in place for raw fish to achieve safe conditions for ceviche in restaurants from Valdivia and Niebla.

  5. La isla de calor estival en Temuco, Chile

    Directory of Open Access Journals (Sweden)

    Alicia Capelli de Steffens


    Full Text Available Temuco es una ciudad localizada en el centro sur de Chile (38º 45’ S y 72º 40’ W. Morfológicamente, el sitio de la ciudad corresponde a las terrazas fluviales del río Cautín que se desarrollan en forma encajonada entre los cerros Ñielol (350 m y Conunhueno (360 m. Esta ciudad se ha desarrollado rápidamente en las últimas décadas, por lo tanto es necesario conocer el efecto antrópico en la misma. Para evaluar parte de ese efecto se analiza la isla de calor urbana estival en la ciudad de Temuco, Chile. Se efectuaron mediciones de temperatura del aire y humedad a través de la ciudad para determinar la forma y la intensidad de la isla de calor urbano. Se utilizaron estaciones móviles e información de una estación meteorológica fija. La ciudad presenta un comportamiento térmico diferente a lo largo del día. Durante el día genera una isla de calor que responde en líneas generales al modelo ideal de calentamiento urbano. La intensidad de la isla calórica (∆Tu-r fue 6.3ºC y 1.2ºC durante el día y la noche, respectivamente. La influencia de los cerros que limitan la ciudad es importante. El estudio confirma la idea que el clima urbano de una ciudad es un mosaico de microclimas que interactuan continuamente.

  6. Chile: todas íbamos a ser reinas

    Directory of Open Access Journals (Sweden)

    Rodrigo Mardones Z


    Full Text Available El artículo describe los acontecimientos políticos del año 2006 marcados por la elección y asunción de Michelle Bachelet a la presidencia de Chile en marzo, y la muerte del ex dictador Augusto Pinochet en diciembre. Aunque el nuevo Gobierno prometía una altísima sintonía con la gente, y aunque el desempeño económico ha sido bueno, las instituciones políticas exhiben una creciente desafección ciudadana iniciada tempranamente con la movilización estudiantil secundaria, y una seguidilla de escándalos de corrupción. Una parte de estos problemas puede adjudicarse al propio Gobierno, incluida la débil conformación del gabinete de ministros; sin embargo, es el momento de la Concertación -coalición que lleva 17 años en el poder- lo que explica el mayor desgasteThe paper describes the political events of 2006, featuring the election and assumption of Michelle Bachelet as Chile's President in March, and the death of the former dictator Augusto Pinochet in December. Even though the new Government augured in tune with the citizenship, and despite good economic performance, the political institutions exhibit a growing distrust from citizens, which started early with demonstrations of high school students, and a rollover of corruption scandals. In part, these problems can be seen as the Government's own fault, including a weak cabinet of ministers. However, the main reason for most of the wear away is the current moment of the Concertación, the ruling coalition with 17 years in power

  7. XII congreso internacional de la vivienda/Chile

    Directory of Open Access Journals (Sweden)

    Escorihuela, M. José


    Full Text Available In this work, the development of the Xllth International Congress on Housing, held in Viña del Mar (Chile on March 1985, is summarized. Its central topic was: "New Construction and Financing Methods". The presented papers intended to bring technical, social and financial solutions to housing problems, specially in developing countries. Spanish participation include two works, one about the particular problem of the inner condensation in walls and another where it is showed a graphic method which allows to simplify of solar radiation in the diverse elements of a building, with the purpose to obtain a better use of this kind of energy, so as to reach a higher comfort in human habitat.En este artículo se resume el desarrollo del XII Congreso Internacional de la Vivienda, celebrado en Viña del Mar (Chile, en marzo de 1985, y que ha tenido como tema central: "Nuevos Métodos de Construcción y Financiamiento". Los trabajos presentados han tratado de dar soluciones técnicas, sociales y financieras al problema de la vivienda, especialmente en los países en desarrollo. La participación española ha consistido en dos trabajos, uno sobre la problemática concreta de las condensaciones en interiores de muros, y otro que expone un método gráfico que permite simplificar los procesos para adquirir mayor conocimiento de la radiación solar recibida sobre los distintos elementos de un edificio, con el fin de conseguir un mejor aprovechamiento de este tipo de energía y así obtener un mayor confort en el habitat humano.

  8. [Revista Médica de Chile in the year 2012]. (United States)

    Reyes B, Humberto; Bustos-González, Atilio; Andresen H, Max; Palma H, Joaquín


    During the year 2012, 539 manuscripts were submitted to this journal, following an increasing trend in the recent decade. Rejection rate was 33%. This higher number of submissions demanded a larger number and wider scope of external reviews, retarding the editorial process. The mean time lapse from reception to acceptance (or rejection) was 6.3 months (range 2-14) and from acceptance to publication 5.3 months (range 3-7). Research articles were 43.9% of published manuscripts and the remaining articles were Reviews, Special Articles, Case Reports, articles on Medical Ethics, Medical Education, Evidence Based Medicine, Public Health, History of Medicine, Letters to the Editor and others. Thirty seven published manuscripts (14.6%) came from foreign countries and 9 of them were published with full text in English. The 2012 Impact Factor was 0.360, showing little variation from previous years, locating the journal in the upper part of quartil 4 in the ISI-JCR category "Medicine, General and Internal", while the SCImago Journal & Country Rank locates the Revista in quartil 2 of its category "Medicine (miscellaneous)". In contrast with the low citation rate, the number of visits to the open access electronic version in averages over 3 million visits per year, illustrating that the interest among readers outnumbers the country's expectable readership. Only 22% of articles declared to have received financial help from entities external to the institution where the work was performed, coming mainly from Chilean Governmental competitive funds. The aim of Revista Médica de Chile is to provide readers and authors a valuable source of information about current relevant topics in general and internal medicine, progress in related specialties and updates in basic sciences, rendering them available to Health professionals in Chile and worldwide, following international standards of ethical and scientific quality in medical publications.

  9. [Revista Médica de Chile in the year 2012]. (United States)

    Reyes B, Humberto; Bustos-González, Atilio; Andresen H, Max; Palma H, Joaquín


    During the year 2012, 539 manuscripts were submitted to this journal, following an increasing trend in the recent decade. Rejection rate was 33%. This higher number of submissions demanded a larger number and wider scope of external reviews, retarding the editorial process. The mean time lapse from reception to acceptance (or rejection) was 6.3 months (range 2-14) and from acceptance to publication 5.3 months (range 3-7). Research articles were 43.9% of published manuscripts and the remaining articles were Reviews, Special Articles, Case Reports, articles on Medical Ethics, Medical Education, Evidence Based Medicine, Public Health, History of Medicine, Letters to the Editor and others. Thirty seven published manuscripts (14.6%) came from foreign countries and 9 of them were published with full text in English. The 2012 Impact Factor was 0.360, showing little variation from previous years, locating the journal in the upper part of quartil 4 in the ISI-JCR category "Medicine, General and Internal", while the SCImago Journal & Country Rank locates the Revista in quartil 2 of its category "Medicine (miscellaneous)". In contrast with the low citation rate, the number of visits to the open access electronic version in averages over 3 million visits per year, illustrating that the interest among readers outnumbers the country's expectable readership. Only 22% of articles declared to have received financial help from entities external to the institution where the work was performed, coming mainly from Chilean Governmental competitive funds. The aim of Revista Médica de Chile is to provide readers and authors a valuable source of information about current relevant topics in general and internal medicine, progress in related specialties and updates in basic sciences, rendering them available to Health professionals in Chile and worldwide, following international standards of ethical and scientific quality in medical publications. PMID:24448862

  10. When memory becomes heritage: Experiences from Santiago, Chile

    Directory of Open Access Journals (Sweden)

    Chiara Bianchini, Maria


    Full Text Available This article explores the relationships between memory politics and urban heritage in the construction of a twenty-first century democratic society. It focuses on the case of Chile and concentrates on three examples of public buildings in the capital city, Santiago. Given what can be considered a difficult heritage –linked to the recent experience of dictatorship and state sponsored violence– these buildings have been in recent years objects of heritage politics, directed to address a public memory related to those events. Based on these case studies, the article critically discusses the materialization of the dominant human rights discourse in the current memory politics affecting Santiago’s urban heritage.Este artículo aborda las relaciones entre políticas de memoria y patrimonio urbano en el proceso de construcción de una sociedad democrática del siglo XXI. El análisis se centra en el caso de Chile y presenta tres ejemplos de edificios públicos de la capital, Santiago. Los tres sitios representan lo que puede considerarse un patrimonio difícil –vinculado a una reciente experiencia de dictadura y violencia de Estado– y, por esta razón, han sido objeto, en años recientes, de políticas patrimoniales dirigidas a gestionar la memoria pública de esos eventos. A través de estos casos, el artículo analiza críticamente la materialización del discurso dominante de los derechos humanos en las actuales políticas de memoria que afectan al patrimonio urbano de Santiago.

  11. Regulating self-selection into private health insurance in Chile and the United States. (United States)

    Vargas Bustamante, Arturo; Méndez, Claudio A


    In the 1980s, Chile adopted a mixed (public and private) model for health insurance coverage similar to the one recently outlined by the Affordable Care Act in the United States (US). In such a system, a mix of public and private health plans offer nearly universal coverage using a combined approach of managed competition and subsidies for low-income individuals. This paper uses a "most different" case study design to compare policies implemented in Chile and the US to address self-selection into private insurance. We argue that the implementation of a mixed health insurance system in Chile without the appropriate regulations was complex, and it generated a series of inequities and perverse incentives. The comparison of Chile and the US healthcare reforms examines the different approaches that both countries have used to manage economic competition, address health insurance self-selection and promote solidarity. Copyright © 2015 John Wiley & Sons, Ltd. PMID:27523039

  12. Panorama de las bibliotecas de museo de la Región Metropolitana de Chile


    Funes Neira, Catherine; Carrillo Reyes, Andrea; Herrera Soriano, Daniela; Heredia Farías, Constanza


    Exploratory study on the situation of the 16 museum libraries of the Metropolitan Region of Chile which comprehends aspects as management, staff, users, technology infrastructure, collections, products and services, networking,promotion, website and future projects.

  13. CCPIT Successfully Signed Preferential Certificate of under the China-Chile Free Trade Agreement

    Institute of Scientific and Technical Information of China (English)


    @@ On March 1, 2010,China and Chile signed China-Peru Free Trade Agreement. in Beijing.After the two countries completing the domestic legal procedures, this agreement has been fully implemented since March 1, 2010.

  14. The Press Conference for the 7th China Auto International (Chile & Peru) Exhibition Tour Held

    Institute of Scientific and Technical Information of China (English)


    @@ On September 9,2009,the press conference and the flag presentation cercmony of the 7th China Auto International (Chile & Peru) Exhibition Tour (CAIET) was held at the auditorium of China Council for the Promotion of International Trade (CCPIT).

  15. Dasybasis elquiensis, a new species of horse fly from Northern Chile (Diptera: Tabanidae: Diachlorini

    Directory of Open Access Journals (Sweden)

    González Christian R


    Full Text Available The female of Dasybasis elquiensis, new species, is described and illustrated from specimens collected in Paso La Ternera, Elqui Province, north Chile. Its relationships to other Dasybasis species are discussed.

  16. Dengue-1 Virus Isolation during First Dengue Fever Outbreak on Easter Island, Chile


    Perret, Cecilia; Abarca, Katia; Ovalle, Jimena; Ferrer, Pablo; Godoy, Paula; Olea, Andrea; Aguilera, Ximena; Ferrés, Marcela


    Dengue virus was detected for the first time in Chile, in an outbreak of dengue fever on Easter Island. The virus was isolated in tissue culture and characterized by reverse transcription–polymerase chain reaction as being dengue type 1.

  17. Assessment of unconventional tight-gas resources of the Magallanes Basin Province, Chile, 2015 (United States)

    Schenk, Christopher J.; Charpentier, Ronald R.; Pitman, Janet K.; Tennyson, Marilyn E.; Brownfield, Michael E.; Gaswirth, Stephanie B.; Le, Phuong A.; Leathers-Miller, Heidi M.; Marra, Kristen R.


    Using a geology-based assessment methodology, the U.S. Geological Survey assessed a technically recoverable mean resource of 8.3 trillion cubic feet of unconventional tight gas in the Zona Glauconitica of the Magallanes Basin Province, Chile.

  18. Reporte del primer hallazgo de puma (Puma concolor puma infectado con Trichinella sp. en Chile

    Directory of Open Access Journals (Sweden)

    A Hidalgo


    Full Text Available En la actualidad, Trichinella spiralis es la única especie que ha sido identificada en Chile como agente de la trichinellosis, tanto en hospedadores domésticos como silvestres. Estudios preliminares no han identificado aún la infección por Trichinella en animales nativos de Chile. La presente comunicación, informa del primer hallazgo de Trichinella sp. aislado en musculatura diafragmática e intercostales de un ejemplar de Puma (Puma concolor puma encontrado muerto mediante seguimiento por telemetría en el sector cordillerano de la Región de La Araucanía, Chile. El diagnóstico se realizó mediante triquinoscopía y digestión artificial. Este hallazgo confirma la existencia de Trichinella sp. en carnívoros nativos de Chile.

  19. Vervoortihelcon, a new genus of the subfamily Helconinae Foerster (Hymenoptera: Braconidae) from Chile

    NARCIS (Netherlands)

    Achterberg, van C.


    A new genus of the tribe Helconini Foerster (Braconidae: Helconinae), Vervoortihelcon (type species: Vervoortihelcon scaramozzinoi spec, nov.) from Chile is described and illustrated. The new subtribe Vervoortihelconina is named to include the new genus.

  20. Differential recognition of a dileucine-based sorting signal by AP-1 and AP-3 reveals a requirement for both BLOC-1 and AP-3 in delivery of OCA2 to melanosomes


    Sitaram, Anand; Dennis, Megan K.; Chaudhuri, Rittik; De Jesus-Rojas, Wilfredo; Tenza, Danièle; Setty, Subba Rao Gangi; Wood, Christopher S.; Sviderskaya, Elena V.; Bennett, Dorothy C.; Raposo, Graça; Bonifacino, Juan S.; Marks, Michael S.


    Cell types that generate unique lysosome-related organelles (LROs), such as melanosomes in melanocytes, populate nascent LROs with cargoes that are diverted from endosomes. Cargo sorting toward melanosomes correlates with binding via cytoplasmically exposed sorting signals to either heterotetrameric adaptor AP-1 or AP-3. Some cargoes bind both adaptors, but the relative contribution of each adaptor to cargo recognition and their functional interactions with other effectors during transport to...

  1. The interaction between the adaptor protein APS and Enigma is involved in actin organisation

    DEFF Research Database (Denmark)

    Barres, Romain; Gonzalez, Teresa; Le Marchand-Brustel, Yannick;


    and APS were partially co-localised with F-actin in small ruffling structures. Insulin increased the complex formation between APS and Enigma and their co-localisation in large F-actin containing ruffles. While in NIH-3T3 and HeLa cells the co-expression of both Enigma and APS did not modify the actin...... cytoskeleton organisation, expression of Enigma alone led to the formation of F-actin clusters. Similar alteration in actin cytoskeleton organisation was observed in cells expressing both Enigma and APS with a mutation in the NPTY motif. These results identify Enigma as a novel APS-binding protein and suggest...... that the APS/Enigma complex plays a critical role in actin cytoskeleton organisation....

  2. Counting statistics and loss corrections for the APS

    International Nuclear Information System (INIS)

    It has been suggested that for timing experiments, it might be advantageous to arrange the bunches in the storage ring in an asymmetrical mode. In this paper, we determine the counting losses from pulsed x-ray sources from basic probabilistic arguments and from Poisson statistics. In particular the impact on single photon counting losses of a variety of possible filling modes for the Advanced Photon Source (APS) is examined. For bunches of equal current, a loss of 10% occurs whenever the count rate exceeds 21% of the bunch repetition rate. This changes slightly when bunches containing unequal numbers of particles are considered. The results are applied to several common detector/electronics systems

  3. An ancillary pumping system for the APS vacuum system

    Energy Technology Data Exchange (ETDEWEB)

    Walters, D.; Noonan, J.; Gagliano, J. [and others


    An ancillary pumping system has been designed and installed in the Advanced Photon Source (APS) storage ring. This vacuum system has the ability to pump sectors of the storage ring down from room pressure to ultra-high vacuum (UHV). The ancillary system is a {open_quotes}dry{close_quotes} system that uses a combination of turbomolecular pumps and oil-free roughing pumps. The benefits of this system are the reduction of equipment needed for in-tunnel maintenance, essential for the operation of a UHV storage ring; rapid response to vacuum emergencies and a guard to accidental exposures to hydrocarbon contamination. The operational logic and the pump interlock and controls are described.

  4. Autonomous star tracker based on active pixel sensors (APS) (United States)

    Schmidt, U.


    Star trackers are opto-electronic sensors used onboard of satellites for the autonomous inertial attitude determination. During the last years, star trackers became more and more important in the field of the attitude and orbit control system (AOCS) sensors. High performance star trackers are based up today on charge coupled device (CCD) optical camera heads. The Jena-Optronik GmbH is active in the field of opto-electronic sensors like star trackers since the early 80-ties. Today, with the product family ASTRO5, ASTRO10 and ASTRO15, all marked segments like earth observation, scientific applications and geo-telecom are supplied to European and Overseas customers. A new generation of star trackers can be designed based on the APS detector technical features. The measurement performance of the current CCD based star trackers can be maintained, the star tracker functionality, reliability and robustness can be increased while the unit costs are saved.

  5. Towards a theory of rapidly oscillating Ap stars

    CERN Document Server

    Gough, Douglas


    Peculiar A stars are so named because they exhibit abundance peculiarities in their atmospheres. It is believed that these arise as a result of differentiation of chemical species in large magnetic spots in which convective mixing is inhibited: there might be just two antipodal spots, whose axis is inclined to the axis of rotation. Many of the Ap stars that are rotating slowly also pulsate, with periods substantially shorter than the period of the fundamental radial mode. The pulsations appear to be nonradial, but axisymmetric, with their common axis usually aligned with the axis of the spots. In this lecture I shall first discuss the magnetic suppression of convection in the spots, and then I shall try to explain the pulsation phenomenon, reviewing some of the suggestions that have been made to explain the alignment and the excitation mechanism, and finally raising some issues that need to be addressed.

  6. Fabrication and Testing of Deflecting Cavities for APS

    Energy Technology Data Exchange (ETDEWEB)

    Mammosser, John; Wang, Haipeng; Rimmer, Robert; Jim, Henry; Katherine, Wilson; Dhakal, Pashupati; Ali, Nassiri; Jim, Kerby; Jeremiah, Holzbauer; Genfa, Wu; Joel, Fuerst; Yawei, Yang; Zenghai, Li


    Jefferson Lab (Newport News, Virginia) in collaboration with Argonne National Laboratory (Argonne, IL) has fabricated and tested four first article, 2.8 GHz, deflecting SRF cavities, for Argonne's Short-Pulse X-ray (SPX) project. These cavities are unique in many ways including the fabrication techniques in which the cavity cell and waveguides were fabricated. These cavity subcomponents were milled from bulk large grain niobium ingot material directly from 3D CAD files. No forming of sub components was used with the exception of the beam-pipes. The challenging cavity and helium vessel design and fabrication results from the stringent RF performance requirements required by the project and operation in the APS ring. Production challenges and fabrication techniques as well as testing results will be discussed in this paper.

  7. Progress on the development of APS beam position monitoring system

    International Nuclear Information System (INIS)

    This paper describes the development status of the beam position monitoring system for the Advanced Photon Source (APS), a third-generation light source now under construction at Argonne National Laboratory. The accelerator complex will consist of an electron linac, a positron linac, a positron accumulator ring (PAR), an injector synchrotron and a storage ring. For beam position measurement, striplines will be used on the linacs, while button-type pickups will be used on the injector synchrotron and the storage ring. A test stand with a prototype injector synchrotron beam position monitor (BPM) unit has been built, and we present the results of position calibration measurements using a wire. Comparison of the results with theoretical calculations will be presented. The current effort on similar storage ring BPM system measurements will also be discussed. 4 refs., 5 figs., 2 tabs

  8. Credit constraints in rural financial markets in Chile: determinants and consequences


    Reyes, A.


    Using data from two surveys carried out in 2006 and 2008 on 177 farmers in Chile, this study measures access to credit and empirically determine the effects of credit constraints on investment and production for market-oriented farmers in central Chile. More specifically, four issues are dealt with: (1) to identify the main factors that influence access to credit for market-oriented farmers, (2) to determine whether informal financial institutions act as complements to or substitutes for farm...

  9. Avance para una Arqueología del Capitalismo en Chile (1880-1930)


    Fuentes M., Miguel


    This paper presents a brief story about the initial development of the capitalism in Chile emphasizing on the structural conditions that would have given as a result new social and political actors (industrial bourgeoisie and proletariat). This process should have been the basis if a deep reconfiguration of the economy, social relationship, politics and culture in Chile during the beginning or the XX century. Following in that direction we express the necessity of the elaboration of an interp...

  10. Movilidad ocupacional en Chile 2001-2009. ¿Desigualdad de ingresos con igualdad de oportunidades?


    Espinoza, Vicente; Núñez, Javier


    The paper compares the regimes of intergenerational occupational mobility in Chile between 2001 and 2009. Data for the study considers published mobility tables for 2001 as well as original data for 2009 from the National Survey of Social Stratification (ENES). The analysis of mobility patterns replicates the constant fluidity model proposed by Erikson and Goldthorpe (1992), considering also special parameters for Chile as proposed by Torche (2005). His depiction of Chilean society as “unequa...

  11. Draft Genome Sequences of 33 Salmonella enterica Clinical and Wildlife Isolates from Chile


    Toro, Magaly; Retamal, Patricio; Allard, Marc; Brown, Eric W.; Evans, Peter; Gonzalez-Escalona, Narjol


    Salmonella enterica causes health problem worldwide. The relationships among strains that are from the same serotype but different hosts, countries, and continents remain elusive. Few genome sequences are available from S. enterica isolates from South America. Therefore, we sequenced the genomes of 33 strains from diverse sources isolated in Chile and determined that they were of different serotypes. These genomes will improve phylogenetic analysis of Salmonella strains from Chile and the res...

  12. Comunitarización competitiva: auge de la iglesia metodista pentecostal de Chile


    Francisco Donoso


    This article explores the mechanisms of statistical growth of the Pentecostal Methodist Church of Chile, through an institutional analysis approach. This is the largest and the oldest evangelical church in this country.Through emphasis on the combination of inter-ecclesiastical and contextual factors, the article explains the success of this church, which has enabled it to play a leading role in the articulation the main body of Protestantism in Chile and in the establishment of relationships...

  13. Protection of Existing and Potential Astronomical Sites in Chile - an Update. (United States)

    Smith, M. G.; Sanhueza, P.; Norman, D.; Schwarz, H.; Orellana, D.


    The IAU's Working Group on Controlling Light Pollution (iauwg) has declared Mauna Kea and a wide strip of Northern Chile between Antofagasta and Chajnanator as top priorities for its efforts to protect existing and potential sites in the Northern and Southern hemispheres respectively. This report provides an update on the iauwg's co-ordinated efforts to protect areas around the major international optical observatories in Chile, as well as the "Chilean Special Zone" (CSZ) mentioned above. This zone is of current and potential interest for the installation of extremely large optical telescopes and includes the ALMA radio-astronomy site. The CSZ is potentially vulnerable to adverse effects of mining in the region. Progess has been made in demonstrating to local mining interests within the CSZ the economic advantages of quality lighting. Educational and outreach activities to a variety of target audiences are building on legislation covering dark skies - itself part of work by the Chilean government to protect the natural heritage of Chile. Substantial good will was generated by an international, bilingual conference held last March in Chile. Just in the region around AURA's Observatory in Chile (Gemini South, CTIO and SOAR), a portable planetarium has been used to reach out to over 600 teachers and 65,000 pupils in the RedLaSer schools network within the last three years. This has attracted the direct interest of Chile's Ministry of Education. Videoconferencing over Internet2 is being used for educational purposes between Chile and various sites in the US. The NSF- initiated Mamalluca municipal observatory now receives more visitors than all the international observatories in Chile combined and is the focus of an expanding local industry of astronomical eco-tourism. Most of this work was supported by funding from, or via, the US NSF through CTIO and Gemini, and from ESO, OCIW, CONAMA and the IDA.

  14. Testing for Changes in Crustal Velocity at the Tocopilla Earthquake, Northern Chile


    Tom Eulenfeld [Richter; Günter Asch; Rainer Kind


    We use two different techniques to investigate the region between Antofagasta and Arica in northern Chile for crustal velocity changes. Data are taken from the 19 broadband stations of the IPOC project (Integrated Plate Boundary Observatory Chile) operating partly since 2006 by GFZ and Institut de Physique du Globe de Paris (IPGP). In the neighborhood of the seismic stations an M7.0 earthquake occurred near Tocopilla on 14 November 2007. Other studies have shown that in the course of such ear...

  15. "Women's Obligation to Motherhood" : A discourse analysis of the anti-abortion debate in Chile


    Köhlmark, Sara


    The objective with this study is to locate discourses within the anti-abortion debate in Chile and analyze these. The discourses will be contextualized with a historical perspective and the pro- abortion arguments. Based upon what was encountered during research, two themes selected were The Right to Motherhood and The Right to Life. The two themes were analyzed from a power, gender, class, body and normative lifeline perspective. The conclusion was that the anti- abortion debate in Chile is ...

  16. Is Chile Complying with its Light Pollution Regulations? A Status Report (United States)

    Smith, M. G.; Sanhueza, P.; Schwarz, H. E.; Walker, A. R.


    Monte Patria is the first Municipality in Chile to comply fully with Supreme Decree 686, the Chilean, environmentally-based legislation governing exterior lighting in Northern Chile - the "norma luminica". "Before" and "after" photographs of Monte Patria were published in last June's issue of "Physics Today", in the context of the global effort to control light pollution. Some photographs of other Chilean towns have been obtained for this poster and for display at the International Dark Sky Association's stand at this meeting. Highlights include detailed midnight and dawn panoramas taken by us during October, 2005 - the month in which the six-year "grace period" for all external lighting in northern Chile's astronomically-sensitive 2nd, 3rd and 4th Regions was supposed to come into full compliance. It is clear that significant progress is being made. The chief obstacle has been financial. Large-scale changeout of street lighting requires an outlay of many millions of dollars from cash-strapped municipalities. Chile's central government has moved in to provide financing at the 80-100/% level in many cases. Once Chile's congressional elections are over, we will be able to judge the political will to complete the changeover. Various large mining operations are currently engaged in major lighting changeovers; such changes are especially important in the various mines that are directly visible from existing major observatories in Northern Chile. The importance to astronomy is that full compliance with DS686 will, on average, extend the potential useful life of all the major optical observatories in Northern Chile by several decades. Funding for the Office for the Protection of the Quality of the Skies of Chile (OPCC) is provided by the Chilean National Environment Committee (CONAMA), NOAO, Gemini, ESO and the Las Campanas Observatory of the Carnegie Institute of Washington.

  17. Santiago de Chile, ¿ejemplo de una reestructuración capitalista global?

    Directory of Open Access Journals (Sweden)

    Luis Fuentes


    Full Text Available Términos como "ciudad global", "ciudad difusa", "ciudad dual", entre otros, merecen ser rediscutidos y contrastados con el proceso de transformaciones experimentado por Santiago de Chile producto de la reestructuración capitalista. En este sentido, este trabajo pretende discutir acerca de la conveniencia de otorgar a la capital de Chile éstos y otros adjetivos frecuentemente utilizados en la literatura urbanística internacional.

  18. Material flow accounting in Chile, Ecuador, Mexico and Peru (1980-2000)


    Russi, Daniela; González Martínez, Ana Citlalic; Silva-Macher, José Carlos; Giljum, Stefan; MARTÍNEZ ALIER, Joan; Vallejo, María Cristina


    In this paper we compare the resource flows of Chile, Ecuador, Mexico and Peru between 1980 and 2000. In this time span, the domestic extraction of materials increased in the four countries, mainly due to the mining sector in Chile and Peru, biomass and oil in Ecuador and construction minerals in Mexico. Imports and exports increased too, due to the increasing integration in the international markets, prompted by the liberalization policies undertaken by the four countries between the late 19...

  19. On the Quality of Private and Public Education: the Case of Chile


    Juan-Pedro Garces


    In this essay, we intend to measure the contribution of different factors within the educational system that affect the quality of education. The purpose is to compare, in a completely dispassionate way, the academic achievements of public and private schools (mainly at the secondary level) in one country: Chile. We take Chile because it has the most extensive (voucher-type) program for subsidizing private education and because it has a fairly wide and accessible amount of data. Amongst other...

  20. Indicator based sustainability analysis of future energy situation of Santiago de Chile


    Stelzer, Volker; Quintero, Adriana; Vargas, Luis; Paredes, Gonzalo; Simon, Sonja; Nienhaus, Kristina; Kopfmüller, Jürgen


    Up to now, the Chilean Energy system has fulfilled the energy needs of Santiago de Chile considerably well. However, development trends of the current system impose significant future risks on the energy system. A detailed sustainability analysis of the energy sector of the Metropolitan Region of Santiago de Chile was conducted, using selected energy indicators and a distance-to-target approach. Risks for the sustainable development of the energy sector are detected, such...

  1. Study on the thermal decomposition behavior of RDX/AP/HTPB propellant%RDX/AP/HTPB推进剂热分解特性研究

    Institute of Scientific and Technical Information of China (English)

    陈沛; 赵凤起; 阴翠梅



  2. Quality Assurance Audit Practice in AP1000 Nuclear Project%AP1000核电工程的监查管理实践

    Institute of Scientific and Technical Information of China (English)




  3. HPV16 E6 and E6AP differentially cooperate to stimulate or augment Wnt signaling

    Energy Technology Data Exchange (ETDEWEB)

    Sominsky, Sophia, E-mail: [Department of Clinical Microbiology and Immunology, Sackler School of Medicine, Tel Aviv University, Tel Aviv 69978 (Israel); Kuslansky, Yael, E-mail: [Department of Clinical Microbiology and Immunology, Sackler School of Medicine, Tel Aviv University, Tel Aviv 69978 (Israel); Shapiro, Beny, E-mail: [Department of Clinical Microbiology and Immunology, Sackler School of Medicine, Tel Aviv University, Tel Aviv 69978 (Israel); Jackman, Anna, E-mail: [Department of Clinical Microbiology and Immunology, Sackler School of Medicine, Tel Aviv University, Tel Aviv 69978 (Israel); Haupt, Ygal, E-mail: [Research Division, The Peter MacCallum Cancer Centre, East Melbourne (Australia); Rosin-Arbesfeld, Rina, E-mail: [Department of Clinical Microbiology and Immunology, Sackler School of Medicine, Tel Aviv University, Tel Aviv 69978 (Israel); Sherman, Levana, E-mail: [Department of Clinical Microbiology and Immunology, Sackler School of Medicine, Tel Aviv University, Tel Aviv 69978 (Israel)


    The present study investigated the roles of E6 and E6AP in the Wnt pathway. We showed that E6 levels are markedly reduced in cells in which Wnt signaling is activated. Coexpression of wild-type or mutant E6AP (C820A) in Wnt-activated cells stabilized E6 and enhanced Wnt/β-catenin/TCF transcription. Expression of E6AP alone in nonstimulated cells elevated β-catenin level, promoted its nuclear accumulation, and activated β-catenin/TCF transcription. A knockdown of E6AP lowered β-catenin levels. Coexpression with E6 intensified the activities of E6AP. Further experiments proved that E6AP/E6 stabilize β-catenin by protecting it from proteasomal degradation. This function was dependent on the catalytic activity of E6AP, the kinase activity of GSK3β and the susceptibility of β-catenin to GSK3β phosphorylation. Thus, this study identified E6AP as a novel regulator of the Wnt signaling pathway, capable of cooperating with E6 in stimulating or augmenting Wnt/β-catenin signaling, thereby possibly contributing to HPV carcinogenesis. - Highlights: • The roles of E6 and E6AP in the Wnt pathway were investigated. • E6AP stabilizes E6 and enhances E6 activity in augmentation of Wnt signaling. • E6AP cooperates with E6 to stabilize β-catenin and stimulate Wnt/β-catenin signaling. • E6AP and E6 act through different mechanisms to augment or stimulate Wnt signaling.

  4. On the evolution of the magnetic field of Ap star $\\alpha^2$ CVn

    CERN Document Server

    Bychkov, V D; Madej, J; Topilskaya, G P


    New high-precision measurements of the longitudinal magnetic field of Ap stars suggest the existence of secular intrinsic variations of the global magnetic field in some stars. We argue that such changes are apparent in the Ap star $\\alpha^2$ CVn in the time scale of $\\sim$ 10 years, which results from the analysis of literature data. Therefore, such an observation implies, that the rate of magnetic field evolution of Ap stars is much higher than was previously thought.

  5. Market Brief : The electric power equipment and services market in Chile

    International Nuclear Information System (INIS)

    This report presents some quick facts about the electric power equipment and services market in Chile and presents opportunities for trade. Chile, a net importer of energy, is seeking foreign participation in its electric power industry, with no restrictions on equipment imports. Chile currently imports most of its oil and gas from Argentina, but more than half of its electricity production is from hydro sources. Operators in the fully privatised electric power sector are separated into 31 power generation companies, 5 transmission companies and 36 power distributors. Chile has 5 gas pipelines, 1 oil pipeline and a power line. The key players and customers in the oil and gas sector were described along with an export check list. Power demand is expected to grow by about 5 per cent annually over the medium term. This will create a demand for more than 500 megawatts of new capacity each year. The greatest opportunity lies in the development of turbines, transformers, generators and switching gear. Competition is stiff as several top international manufacturers of electric power equipment are represented in Chile. Local manufacturers are mostly interested in power distribution equipment. Currently the major end-users are industrial users, particularly the mining industry. Imports from Canada are duty free and will be phased out under the Canada-Chile Free Trade Agreement. A list of key contacts and support services is included with this report. refs., tabs., figs

  6. CHILES Con Pol: An ultra-deep JVLA survey probing galaxy evolution and cosmic magnetism (United States)

    Hales, Christopher A.; Momjian, Emmanuel; van Gorkom, Jacqueline; Rupen, Michael P.; Greiner, Maksim; Ensslin, Torsten A.; Bonzini, Margherita; Padovani, Paolo; Harrison, Ian; Brown, Michael L.; Gim, Hansung; Yun, Min S.; Maddox, Natasha; Stewart, Adam; Fender, Rob P.; Tremou, Evangelia; Chomiuk, Laura; Peters, Charee; Wilcots, Eric M.; Lazio, Joseph


    We are undertaking a 1000 hour campaign with the Karl G. Jansky VLA to survey 0.2 square degrees of the COSMOS field in full polarization continuum at 1.4 GHz. Our observations are part of a joint program with the spectral line COSMOS HI Large Extragalactic Survey (CHILES). When complete, we expect our CHILES Continuum Polarization (CHILES Con Pol) survey to reach an SKA-era sensitivity of 500 nJy per 4 arcsecond resolving beam, the deepest view of the radio sky yet. CHILES Con Pol will open new and fertile parameter space, with sensitivity to star formation rates of 10 Msun per year out to an unprecedented redshift of z=2, and ultra-luminous infrared galaxies and sub-millimeter galaxies out to redshifts of z=8 and beyond. This rich resource will extend the utility of radio band studies beyond the usual radio quasar and radio galaxy populations, opening sensitivity to the starforming and radio-quiet AGN populations that form the bulk of extragalactic sources detected in the optical, X-ray, and infrared bands. In this talk I will outline the key science of CHILES Con Pol, including galaxy evolution and novel measurements of intergalactic magnetic fields. I will present initial results from the first 180 hours of the survey and describe our forthcoming Data Release 1. I invite the astronomical community to consider unique science that can be pursued with CHILES Con Pol radio data.

  7. Un Plan Regulador para Cartagena, una ciudad de la costa central de Chile: una visión de futuro en 1976. / A master plan for Cartagena, a city on the central coast of Chile: a vision in 1976

    Directory of Open Access Journals (Sweden)

    Pavez Reyes,María Isabel


    Full Text Available Se presenta la reseña de un proyecto de planificación urbana, conforme a la escuela desarrollada por la FAU de la Universidad de Chile, durante la etapa madura del Estado Planificador Urbano-Regional chileno. / It provides an overview of an urban planning project, developed under the FAU School of the University of Chile, during the mature stage of the Urban-Regional Planning State of Chile.

  8. Research and project practice in AP1000 nuclear plant MCR assemblies seismic test

    International Nuclear Information System (INIS)

    Background: The seismic test is one of Plant Equipment Seismic Qualification Methodologies. Purpose: To satisfy the special requirements of AP1000 seismic qualification, this test is not same to traditional seismic test. Methods: AP1000 nuclear plant equipment qualification has new methods and requirements. The special requirements as response spectrum, accelerometer installation and functional test are described for AP1000 MCR seismic test. Results: The test results are demonstrated that MCR assemblies are satisfied as AP1000 seismic qualification requirements. Conclusions: These requirements are beneficial to the qualification for structural integrity and functional safety. They are also used to find design margin. (authors)

  9. Heterologous expression in Tritrichomonas foetus of functional Trichomonas vaginalis AP65 adhesin

    Directory of Open Access Journals (Sweden)

    Alderete JF


    Full Text Available Abstract Background Trichomonosis, caused by Trichomonas vaginalis, is the number one, nonviral sexually transmitted infection that has adverse consequences for the health of women and children. The interaction of T. vaginalis with vaginal epithelial cells (VECs, a step preparatory to infection, is mediated in part by the prominent surface protein AP65. The bovine trichomonad, Tritrichomonas foetus, adheres poorly to human VECs. Thus, we established a transfection system for heterologous expression of the T. vaginalis AP65 in T. foetus, as an alternative approach to confirm adhesin function for this virulence factor. Results In this study, we show stable transfection and expression of the T. vaginalis ap65 gene in T. foetus from an episomal pBS-ap65-neo plasmid. Expression of the gene and protein was confirmed by RT-PCR and immunoblots, respectively. AP65 in transformed T. foetus bound to host cells. Specific mAbs revealed episomally-expressed AP65 targeted to the parasite surface and hydrogenosome organelles. Importantly, surface-expression of AP65 in T. foetus paralleled increased levels of adherence of transfected bovine trichomonads to human VECs. Conclusion The T. vaginalis AP65 adhesin was stably expressed in T. foetus, and the data obtained using this heterologous system strongly supports the role of AP65 as a prominent adhesin for T. vaginalis. In addition, the heterologous expression in T. foetus of a T. vaginalis gene offers an important, new approach for confirming and characterizing virulence factors.

  10. APS Goes to ComicCon and Other Tales: Reaching out for Physics (United States)

    Kirby, Kate


    Broadly interpreting the core mission of APS ``to advance and diffuse the knowledge of physics", APS carries out programmatic activities in Education, Outreach, International Affairs, Public Affairs, and Advocacy, which benefit the physics community as well as society at large. These programs are highly valued by APS members who know about them, but the challenge has been to find ways to effectively communicate to our members about all the good things we are doing. APS programs have also achieved significant recognition in the external community for their outstanding quality and success. I will describe several examples of how we ``reach out" to promote physics and physics education in a variety of venues.

  11. AP Selection Algorithm for Real-Time Communications through Mixed WLAN Environments (United States)

    Morioka, Yasufumi; Higashino, Takeshi; Tsukamoto, Katsutoshi; Komaki, Shozo

    Recent rapid development of high-speed wireless access technologies has created mixed WLAN (Wireless LAN) environments where QoS capable APs coexist with legacy APs. To provide QoS guarantee in this mixed WLAN environment, this paper proposes a new AP selection algorithm. The proposed algorithm assigns an STA (Station) to an AP in the overall WLAN service area. Simulation results show improvement in the VoIP performance in terms of an eMOS (estimated Mean Opinion Score) value and the FTP throughput compared to conventional algorithms.

  12. Isolation, classification and transcription profiles of the AP2/ERF transcription factor superfamily in citrus. (United States)

    Xie, Xiu-lan; Shen, Shu-ling; Yin, Xue-ren; Xu, Qian; Sun, Chong-de; Grierson, Donald; Ferguson, Ian; Chen, Kun-song


    The AP2/ERF gene family encodes plant-specific transcription factors. In model plants, AP2/ERF genes have been shown to be expressed in response to developmental and environmental stimuli, and many function downstream of the ethylene, biotic, and abiotic stress signaling pathways. In citrus, ethylene is effective in regulation citrus fruit quality, such as degreening and aroma. However, information about the citrus AP2/ERF family is limited, and would enhance our understanding of fruit responses to environmental stress, fruit development and quality. CitAP2/ERF genes were isolated using the citrus genome database, and their expression patterns analyzed by real-time PCR using various orange organs and samples from a fruit developmental series. 126 sequences with homologies to AP2/ERF proteins were identified from the citrus genome, and, on the basis of their structure and sequence, assigned to the ERF family (102), AP2 family (18), RAV family (4) and Soloist (2). MEME motif analysis predicted the defining AP2/ERF domain and EAR repressor domains. Analysis of transcript accumulation in Citrus sinensis cv. 'Newhall' indicated that CitAP2/ERF genes show organ-specific and temporal expression, and provided a framework for understanding the transcriptional regulatory roles of AP2/ERF gene family members in citrus. Hierarchical cluster analysis and t tests identified regulators that potentially function during orange fruit growth and development. PMID:24566692

  13. Isolation, classification and transcription profiles of the AP2/ERF transcription factor superfamily in citrus. (United States)

    Xie, Xiu-lan; Shen, Shu-ling; Yin, Xue-ren; Xu, Qian; Sun, Chong-de; Grierson, Donald; Ferguson, Ian; Chen, Kun-song


    The AP2/ERF gene family encodes plant-specific transcription factors. In model plants, AP2/ERF genes have been shown to be expressed in response to developmental and environmental stimuli, and many function downstream of the ethylene, biotic, and abiotic stress signaling pathways. In citrus, ethylene is effective in regulation citrus fruit quality, such as degreening and aroma. However, information about the citrus AP2/ERF family is limited, and would enhance our understanding of fruit responses to environmental stress, fruit development and quality. CitAP2/ERF genes were isolated using the citrus genome database, and their expression patterns analyzed by real-time PCR using various orange organs and samples from a fruit developmental series. 126 sequences with homologies to AP2/ERF proteins were identified from the citrus genome, and, on the basis of their structure and sequence, assigned to the ERF family (102), AP2 family (18), RAV family (4) and Soloist (2). MEME motif analysis predicted the defining AP2/ERF domain and EAR repressor domains. Analysis of transcript accumulation in Citrus sinensis cv. 'Newhall' indicated that CitAP2/ERF genes show organ-specific and temporal expression, and provided a framework for understanding the transcriptional regulatory roles of AP2/ERF gene family members in citrus. Hierarchical cluster analysis and t tests identified regulators that potentially function during orange fruit growth and development.

  14. K-AP: Generating specified K clusters by efficient Affinity Propagation

    KAUST Repository

    Zhang, Xiangliang


    The Affinity Propagation (AP) clustering algorithm proposed by Frey and Dueck (2007) provides an understandable, nearly optimal summary of a data set. However, it suffers two major shortcomings: i) the number of clusters is vague with the user-defined parameter called self-confidence, and ii) the quadratic computational complexity. When aiming at a given number of clusters due to prior knowledge, AP has to be launched many times until an appropriate setting of self-confidence is found. The re-launched AP increases the computational cost by one order of magnitude. In this paper, we propose an algorithm, called K-AP, to exploit the immediate results of K clusters by introducing a constraint in the process of message passing. Through theoretical analysis and experimental validation, K-AP was shown to be able to directly generate K clusters as user defined, with a negligible increase of computational cost compared to AP. In the meanwhile, K-AP preserves the clustering quality as AP in terms of the distortion. K-AP is more effective than k-medoids w.r.t. the distortion minimization and higher clustering purity. © 2010 IEEE.

  15. Fuerza laboral de la mujer en Chile: cifras y características Woman labour force in Chile: data and characteristics

    Directory of Open Access Journals (Sweden)

    Jasna Stiepovich Bertoni


    Full Text Available El presente artículo muestra algunas características sociodemográficas de la fuerza laboral femenina en Chile y las dificultades que las mujeres deben enfrentar para acceder y mantenerse en su fuerza laboral, dada su condición de género.The present article shows us some sociodemographic characteristics of the women labour force in Chile, and the difficulties they have to accede and to maintain their labour source due to gender conditions.

  16. Qué se investiga en relación a enfermedad pulmonar obstructiva crónica en Chile CHRONIC OBSTRUCTIVE PULMONARY DISEASE RESEARCH IN CHILE




    Con el propósito de conocer qué se investiga sobre enfermedad pulmonar obstructiva (EPOC) en Chile, se realizó una búsqueda bibliográfica acerca de las publicaciones en revistas biomédicas de investigaciones sobre EPOC realizadas en Chile. Se revisó los índices MEDLINE y LILACS entre 1982 y 2001. Además, se revisó los resúmenes que comunican investigaciones sobre EPOC presentados a los 5 últimos Congresos Anuales Chilenos sobre Enfermedades Respiratorias. Los temas más frecuentes de las publi...

  17. Nuevos hospedadores para las garrapatas Amblyomma tigrinum y Rhipicephalus sanguineus (Acari: Ixodidae) en Chile New hosts for the ticks Amblyomma tigrinum and Rhipicephalus sanguineus (Acari: Ixodidae) in Chile


    González-Acuña, D.; Valenzuela, G; Moreno, L.; K Ardiles; A Guglielmone


    Se registran, por primera vez en Chile, ninfas de garrapata café del perro (Rhipicephalus sanguineus) parasitando dos ejemplares de cabras (Capra hircus) y adultos (un macho y una hembra gravida) de la garrapata de listas blancas (Amblyomma tigrinum) parasitando a un bovino (Bos taurus). La importancia de los presentes reportes, hechos en la provincia de Ñuble, son discutidos.For the first time in Chile, cases of nymphs of the brown dog tick (Rhipicephalus sanguineus) being found on two goats...

  18. Macrocyclis peruvianus (Gastropoda, Acavidae, an endemic land snail from Chile Macrocyclis peruvianus (Gastropoda, Acavidae, um caracol terrestre endêmico do Chile

    Directory of Open Access Journals (Sweden)

    Leticia F. da Silva


    Full Text Available Macrocyclis peruvianus (Lamarck, 1822 is a large terrestrial snail which is endemic in Chile. A detailed description of its shell structure, jaw, radula, palial cavity and reproductive system is presented here for the first time.Macrocyclis peruvianus (Lamarck, 1822 é um grande caracol terrestre endêmico do Chile. Uma descrição detalhada da esculturação de sua concha, rádula, mandíbula, cavidade palial e sistema reprodutor são apresentados aqui pela primeira vez.

  19. LBB在AP1000技术中的应用%The Application of LBB in AP1000 Technology

    Institute of Scientific and Technical Information of China (English)

    蒋冬梅; 杜颖; 袁小兰


    压水堆核电厂的设计基准事故定义为主管道双端断裂,这一假设过于保守.管道的失效方式往往是先出现破口而后再泄漏,即所谓的先漏后破( Leak Before Break,简称LBB) ,而不是双端断裂. LBB准则是防止核电厂压力管道发生灾难性破裂事故的重要评定准则.本文介绍了LBB评定技术在国外的发展情况和意义,阐述了LBB在AP1000核电厂中的应用情况及LBB评价的理论基础.%Design basis accident of pressurized water reactor nuclear power plant was de-fined as main pipeline double-end fracture, this assumption is too conservative. Pipeline failure modes often appear as first Break then Leak,that is so-called the Leak Before Break ( Leak Before Break,LBB) ,rather than double end fracture. LBB is an important evalua-tion criteria of preventing pressure piping catastrophic rupture accident of nuclear power plant . This paper briefly introduces the development situation and the significance of the o-verseas LBB assessment technology and expounds the application of LBB in AP1000 nucle-ar power plant and the theoretical basis of LBB assessment.

  20. Zahraniční politika Chile v rámci regionu Latinské Ameriky


    Petrovičová, Martina


    The thesis deals with the foreign policy of Chile in the Latin America region. The main attention is paid to bilateral relations with neighbouring countries and Chile's involvement in regional integration groupings. The work is divided into four chapters. In the first chapter is defined the term foreign policy. In the second chapter, these findings are applied to the Chilean reality. Chile is therefore described in terms of size, political system, economic development, and geographic location...