WorldWideScience

Sample records for chile 5000-3000 ap

  1. Chile.

    Science.gov (United States)

    1988-09-01

    Chile is a long (2650 miles), narrow (250 miles at widest point) country sandwiched between the Andes mountains and the Pacific. The northern desert is rich in copper and nitrates; the temperate middle region is agricultural and supports the major cities, including Santiago, the capital, and the port of Valparaiso; and the southern region is a cold and damp area of forests, grasslands, lakes, and fjords. The country is divided into 12 administrative regions. Chile's population of 12.5 million are mainly of Spanish or Indian descent or mestizos. Literacy is 92.3%, and the national language is Spanish. Infant mortality is 18.1/1000, and life expectancy is 68.2 years. 82% of the people are urban, and most are Roman Catholics. Chile was settled by the Spanish in 1541 and attached to the Viceroyalty of Peru. Independence was won in 1818 under the leadership of Bernardo O'Higgins. In the 1880s Chile extended its sovereignty over the Strait of Magellan in the south and areas of southern Peru and Bolivia in the north. An officially parliamentary government, elected by universal suffrage, drifted into oligarchy and finally into a military dictatorship under Carlos Ibanez in 1924. Constitutional government was restored in 1932. The Christian Democratic government of Eduardo Frei (1964-70) inaugurated major reforms, including land redistribution, education, and far-reaching social and economic policies. A Marxist government under Salvador Allende lasted from 1970 to 1973 when the present military government of General Pinochet Ugarte took power, overthrew Allende, abolished the Congress, and banned political parties. It has moved the country in the direction of a free market economy but at the cost of systematic violations of human rights. A new constitution was promulgated in 1981, and congressional elections have been scheduled for October, 1989. A "National Accord for Transition to Full Democracy" was mediated by the Catholic Church in 1985. The social reforms of the

  2. Preserving Chile

    OpenAIRE

    Brennand, Charlotte P.

    2010-01-01

    The best way to preserve chile depends on how you plan to use it and your available storage space. Frozen or canned chile is best for chile rellenos and salsas. Stews can use frozen, canned or dried chile. Dried chile has minimal storage requirements and is light-weight for taking on camping trips. Pickled chiles can be used on a relish plate or as an ingredient in other dishes.

  3. AP Music Theory Applied

    Science.gov (United States)

    Spieker, Matthew H.

    2016-01-01

    Some American high schools include Advanced Placement (AP) Music Theory within their course offerings. Students who pass the AP exam can receive college credit either as a music or humanities credit. An AP class, however, offers music students more than future college credit; it ultimately improves musicianship skills and promotes deeper…

  4. Chile: Its Conventional Threats

    Science.gov (United States)

    2005-03-18

    Bolivia’s gas to Mexico and North America. Chile’s President Lagos likewise invited Bolivia to construct a plant in Chile to facilitate gas production at...tdf.htm>. Internet. Accessed 30 October 2004. 20 21 BIBLIOGRAPHY Barros, Van Buren Mario. Historia Diplomatica de Chile . Santiago: Editorial Andres

  5. Advanced Photon Source (APS)

    Data.gov (United States)

    Federal Laboratory Consortium — The Advanced Photon Source (APS) at the U.S. Department of Energy's Argonne National Laboratoryprovides this nation's (in fact, this hemisphere's) brightest storage...

  6. APS and Open Access

    Science.gov (United States)

    2011-03-01

    The movement toward Open Access continues to gain momentum. A brief review of APS efforts in this area will be presented by APS Editor in Chief, Gene Sprouse. Editors from Physical Review A, B, E, Focus, Letters, and X, Reviews of Modern Physics, and Physics will address your questions about publishing in this evolving environment.

  7. Stronger Ties With Chile

    Institute of Scientific and Technical Information of China (English)

    2011-01-01

    Chile was the first South American country to establish diplomatic relations with China. It was also the first Latin American country to support China’s entry into the WTO,recognize China’s full market

  8. APS Science 2006.

    Energy Technology Data Exchange (ETDEWEB)

    Gibson, J. M.; Fenner, R. B.; Long, G.; Borland, M.; Decker, G.

    2007-05-24

    In my five years as the Director of the Advanced Photon Source (APS), I have been fortunate to see major growth in the scientific impact from the APS. This year I am particularly enthusiastic about prospects for our longer-term future. Every scientific instrument must remain at the cutting edge to flourish. Our plans for the next generation of APS--an APS upgrade--got seriously in gear this year with strong encouragement from our users and sponsors. The most promising avenue that has emerged is the energy-recovery linac (ERL) (see article on page xx), for which we are beginning serious R&D. The ERL{at}APS would offer revolutionary performance, especially for x-ray imaging and ultrafast science, while not seriously disrupting the existing user base. I am very proud of our accelerator physics and engineering staff, who not only keep the current APS at the forefront, but were able to greatly impress our international Machine Advisory Committee with the quality of their work on the possible upgrade option (see page xx). As we prepare for long-term major upgrades, our plans to develop and optimize all the sectors at APS in the near future are advancing. Several new beamlines saw first light this year, including a dedicated powder diffraction beamline (11-BM), two instruments for inelastic x-ray scattering at sector 30, and the Center for Nanoscale Materials (CNM) Nanoprobe beamline at sector 26. Our partnership in the first x-ray free-electron laser (LCLS) to be built at Stanford contributes to revolutionary growth in ultrafast science (see page xx), and we are developing a pulse chirping scheme to get ps pulses at sector 7 of the APS within a year or so. In this report, you will find selected highlights of scientific research at the APS from calendar year 2006. The highlighted work covers diverse disciplines, from fundamental to applied science. In the article on page xx you can see the direct impact of APS research on technology. Several new products have emerged from

  9. AP statistics crash course

    CERN Document Server

    D'Alessio, Michael

    2012-01-01

    AP Statistics Crash Course - Gets You a Higher Advanced Placement Score in Less Time Crash Course is perfect for the time-crunched student, the last-minute studier, or anyone who wants a refresher on the subject. AP Statistics Crash Course gives you: Targeted, Focused Review - Study Only What You Need to Know Crash Course is based on an in-depth analysis of the AP Statistics course description outline and actual Advanced Placement test questions. It covers only the information tested on the exam, so you can make the most of your valuable study time. Our easy-to-read format covers: exploring da

  10. APS Science 2009.

    Energy Technology Data Exchange (ETDEWEB)

    Gibson, J. M; Mills, D. M.; Gerig, R.

    2010-05-01

    It is my pleasure to introduce the 2009 annual report of the Advanced Photon Source. This was a very good year for us. We operated with high reliability and availability, despite growing problems with obsolete systems, and our users produced a record output of publications. The number of user experiments increased by 14% from 2008 to more than 3600. We congratulate the recipients of the 2009 Nobel Prize in Chemistry-Venkatraman Ramakrishnan (Cambridge Institute for Medical Research), Thomas Steitz (Yale University), and Ada Yonath (Weizmann Institute) - who did a substantial amount of this work at APS beamlines. Thanks to the efforts of our users and staff, and the ongoing counsel of the APS Scientific Advisory Committee, we made major progress in advancing our planning for the upgrade of the APS (APS-U), producing a proposal that was positively reviewed. We hope to get formal approval in 2010 to begin the upgrade. With advocacy from our users and the support of our sponsor, the Office of Basic Energy Sciences in the Department of Energy (DOE) Office of Science, our operating budgets have grown to the level needed to more adequately staff our beamlines. We were also extremely fortunate to have received $7.9 M in American Recovery and Reinvestment Act ('stimulus') funding to acquire new detectors and improve several of our beamlines. The success of the new Linac Coherent Light Source at Stanford, the world's first x-ray free-electron laser, made us particularly proud since the undulators were designed and built by the APS. Among other highlights, we note that more than one-quarter of the 46 Energy Frontier Research Centers, funded competitively across the U.S. in 2009 by the DOE, included the Advanced Photon Source in their proposed work, which shows that synchrotron radiation, and the APS in particular, are central to energy research. While APS research covers everything from fundamental to applied science (reflected by the highlights in this report

  11. Chile's Madam President

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    After becoming the first female to win a presidential election in the socially conservative country, Chilean President-elect Michelle Bachelet created history again when unveiling a cabinet that was absolutely gender-balanced on January 30. Following similar breakthroughs of women politicians in Liberia and Germany, what happened in Chile is considered another case of women gaining power worldwide.

  12. APS Science 2007.

    Energy Technology Data Exchange (ETDEWEB)

    2008-05-30

    This report provides research highlights from the Advanced Photon Source (APS). Although these highlights represent less than 10% of the published work from the APS in 2007, they give a flavor of the diversity and impact of user research at the facility. In the strategic planning the aim is to foster the growth of existing user communities and foresee new areas of research. This coming year finds the APS engaged in putting together, along with the users, a blueprint for the next five years, and making the case for a set of prioritized investments in beamlines, the accelerator, and infrastructure, each of which will be transformational in terms of scientific impact. As this is written plans are being formulated for an important user workshop on October 20-21, 2008, to prioritize strategic plans. The fruit from past investments can be seen in this report. Examples include the creation of a dedicated beamline for x-ray photon correlation spectroscopy at Sector 8, the evolution of dedicated high-energy x-ray scattering beamlines at sectors 1 and 11, a dedicated imaging beamline at Sector 32, and new beamlines for inelastic scattering and powder diffraction. A single-pulse facility has been built in collaboration with Sector 14 (BioCARS) and Phil Anfinrud at the National Institutes of Health, which will offer exceptionally high flux for single-pulse diffraction. The nanoprobe at Sector 26, built and operated jointly by the Argonne Center for Nanoscale Materials and the X-ray Operations and Research (XOR) section of the APS X-ray Science Division, has come on line to define the state of the art in nanoscience.

  13. Chile exploits LNG

    Energy Technology Data Exchange (ETDEWEB)

    1980-03-01

    Simultaneously with its exploitation of offshore hydrocarbon reservoirs Chile is developing the production and selling of LNG. Chile produces a large quantity of associated gas from its reservoirs at Megallanes and processes it at the Manantiales, Cullen and Posesion plants recovering propane, butane and natural gas liguids. The stripped gas is reinjected for pressure maintenance operations. With the completion of the LNG program full use of the gas will be achieved. It will totally meet the needs of combustible liquids for the central and northern parts of the country, a volume of 2200 million cu m/yr. For its treatment natural gas is sent through gas pipelines to the LNG plant at Cabo Negro. By means of a cooling process, the gas is cooled to -160 C where it becomes a liquid and its volume is reduced by a factor of 600. It is then stored in tanks at atmospheric pressure.

  14. The APS ceramic chambers

    Energy Technology Data Exchange (ETDEWEB)

    Milton, S.; Warner, D.

    1994-07-01

    Ceramics chambers are used in the Advanced Photon Source (APS) machines at the locations of the pulsed kicker and bumper magnets. The ceramic will be coated internally with a resistive paste. The resistance is chosen to allow the low frequency pulsed magnet field to penetrate but not the high frequency components of the circulating beam. Another design goal was to keep the power density experienced by the resistive coating to a minimum. These ceramics, their associated hardware, the coating process, and our recent experiences with them are described.

  15. Chile: segundo tiempo Chile: Half-time

    Directory of Open Access Journals (Sweden)

    ROBERT L FUNK

    2009-01-01

    Full Text Available El artículo examina el año político chileno, ofreciendo un análisis crítico del concepto de 'segundo tiempo' autoimpuesto por la presidenta Michelle Bachelet a comienzos del 2008. Resumiendo algunas de las políticas implementadas, el trabajo cuestiona si se logró marcar una linea y dejar atrás los dos primeros y difíciles años del cuarto gobierno de la Concertación. Analizando las medidas tomadas y las encuestas de opinión pública, se encuentra que el reenfoque de las prioridades del gobierno y una complicada coyuntura externa ayudó a levantar los niveles de apoyo de la presidenta y su gobierno.The article examines the political year in Chile, offering a critical analysis of the concept of 'Second Period' which President Michelle Bachelet defined at the beginning of 2008. Summarising some of the policies implemented, the piece asks whether the government was able to draw a line, leaving behind the first, difficult two years of the Concertación s fourth government. Analyzing the measures taken and public opinion polls, the paper finds that a re-focussing of the government's priorities together with a complicated external environment helped to raise support for the president as well as her government.

  16. Primary Medical Care in Chile

    DEFF Research Database (Denmark)

    Scarpaci, Joseph L.

    Primary medical care in Chile: accessibility under military rule [Front Cover] [Front Matter] [Title Page] Contents Tables Figures Preface Chapter 1: Introduction Chapter 2: The Restructuring of Medical Care Financing in Chile Chapter 3: Inflation and Medical Care Accessibility Chapter 4: Help......-Seeking Behavior of the Urban Poor Chapter 5: Spatial Organization and Medical Care Accessibility Chapter 6: Conclusion...

  17. Chile rural electrification cooperation

    Energy Technology Data Exchange (ETDEWEB)

    Flowers, L. [National Renewable Energy Lab., Golden, CO (United States)

    1997-12-01

    The author describes a joint program to use renewables for rural electrification projects in Chile. The initial focus was in a limited part of the country, involving wind mapping, pilot project planning, training, and development of methodologies for comparative evaluations of resources. To this point three wind hybrid systems have been installed in one region, as a part of the regional private utility, and three additional projects are being designed. Additional resource assessment and training is ongoing. The author points out the difficulties in working with utilities, the importance of signed documentation, and the need to look at these programs as long term because of the time involved in introducing such new technologies.

  18. Biomasa en Chile

    OpenAIRE

    Nilsson Cifuentes, Gabriel; Rodríguez Monroy, Carlos

    2012-01-01

    El artículo presenta el desarrollo de la biomasa en Chile, dentro del complejo marco energético existente en el país, el cual, aún no logra potenciar e incentivar el desarrollo de energías renovables y depende fuertemente de los combustibles fósiles, acrecentando el riesgo latente de sufrir una crisis energética, en el mediano plazo, producto de la paulatina incorporación de nuevas centrales generadoras de energías, que satisfagan la creciente demanda energética pronosticada. Este ar...

  19. CGM ApS Årsberetning til DANAK

    DEFF Research Database (Denmark)

    De Chiffre, Leonardo

    Denne årsberetning omfatter CGM ApS' akkrediterede virksomhed i kalenderåret 2003. Årsberetningen er udarbejdet til DANAK (Dansk Akkreditering, ErhvervsfremmeStyrelsen), som led i opfyldelsen af laboratoriets informationspligt i henhold til gældende regler.......Denne årsberetning omfatter CGM ApS' akkrediterede virksomhed i kalenderåret 2003. Årsberetningen er udarbejdet til DANAK (Dansk Akkreditering, ErhvervsfremmeStyrelsen), som led i opfyldelsen af laboratoriets informationspligt i henhold til gældende regler....

  20. Chile: Transantiago recargado Chile: Transantiago Reloaded

    Directory of Open Access Journals (Sweden)

    RODRIGO MARDONES Z

    2008-01-01

    Full Text Available El 2007 fue el segundo año del gobierno de Michelle Bachelet. Se trató de un año sin elecciones; con un buen desempeño económico, a pesar de una inflación creciente en los últimos meses; y marcado por la discusión sobre escándalos de corrupción. Sin embargo, lo que más afectó al Gobierno fue la desastrosa puesta en marcha de la reforma al sistema de transporte público de la capital: Transantiago. Este puso un velo sobre los importantes avances en materias previsionales y educacionales, cuestionando no sólo la capacidad ejecutiva del Gobierno, sino que profundizando un flanco de indisciplina al interior de la coalición oficialista (Concertación; síntoma de su desgaste después de 17 años ocupando la Presidencia de Chile.The year 2007 was the second in Michelle Bachelet’s presidencial term. It was a year free of elections, exhibiting a fairly good economic performance, despite the high rate of inflation shown during the last months. Public discussion on corruption escandals was frequent; however, the most important issue was the disestrous beginning of the reform on the public transportation system of the country’s capital: Transantiago. This has placed a veil over the important achievements on the pension system and education, questioning not only the government’s capacity, but also opening and edge of indiscipline within the ruling coalition (Concertación, which is a symtom of its erosion after 17 years in the presidential office.

  1. 27 CFR 9.154 - Chiles Valley.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Chiles Valley. 9.154... Chiles Valley. (a) Name. The name of the viticultural area described in this section is “Chiles Valley.” (b) Approved maps. The appropriate maps for determining the boundary of the Chiles...

  2. AP physics B crash course

    CERN Document Server

    Howell, Rebecca

    2012-01-01

    AP Physics B Crash Course - Get a Higher Advanced Placement Score in Less Time Crash Course is perfect for the time-crunched student, the last-minute studier, or anyone who wants a refresher on the subject. Our AP Physics B Crash Course gives you: Targeted, Focused Review - Study Only What You Need to Know The Crash Course is based on an in-depth analysis of the AP Physics B course description outline and actual AP test questions. It covers only the information tested on the exam, so you can make the most of your valuable study time. Our easy-to-read format covers: mechanics, kinetic theory, t

  3. Center for Geometrisk Metrologi, CGM ApS

    DEFF Research Database (Denmark)

    De Chiffre, Leonardo

    Denne årsberetning omfatter CGM ApS' akkrediterede virksomhed i kalenderåret 2002. Årsberetningen er udarbejdet til DANAK (Dansk Akkreditering, Erhvervsfremme Styrelsen), som led i opfyldelsen af laboratoriets informationspligt i henhold til gældende regler (Teknisk Forskrift Nr. TF4 af 2000...

  4. Learning about Antiphospholipid Syndrome (APS)

    Science.gov (United States)

    ... other autoimmune disorders, including myasthenia gravis, Graves' disease, autoimmune hemolytic anemia, and Evan's syndrome. Top of page How is APS diagnosed? A diagnosis of APS is made based on both clinical and ... Autoimmune Related Diseases Association, Inc. [aarda.org] An organization ...

  5. Fires in Chile

    Science.gov (United States)

    2002-01-01

    On February 5, 2002, the dense smoke from numerous forest fires stretched out over the Pacific Ocean about 400 miles south of Santiago, Chile. This true-color Moderate-resolution Imaging Spectroradiometer (MODIS) image shows the fires, which are located near the city of Temuco. The fires are indicated with red dots (boxes in the high-resolution imagery). The fires were burning near several national parks and nature reserves in an area of the Chilean Andes where tourism is very popular. Southeast of the fires, the vegetation along the banks of the Rio Negro in Argentina stands out in dark green. Image courtesy Jacques Descloitres, MODIS Land Rapid Response Team at NASA GSFC

  6. Eso's Situation in Chile

    Science.gov (United States)

    1995-02-01

    ESO, the European Southern Observatory, in reply to questions raised by the international media, as well as an ongoing debate about the so-called "Paranal case" in Chilean newspapers, would like to make a number of related observations concerning its status and continued operation in that country [1]. THE ESO OBSERVATORY SITES IN CHILE The European Southern Observatory, an international organisation established and supported by eight European countries, has been operating more than 30 years in the Republic of Chile. Here ESO maintains one of the world's prime astronomical observatories on the La Silla mountain in the southern part of the Atacama desert. This location is in the Fourth Chilean Region, some 600 km north of Santiago de Chile. In order to protect the La Silla site against dust and light pollution from possible future mining industries, roads and settlements, ESO early acquired the territory around this site. It totals about 825 sq. km and has effectively contributed to the preservation of its continued, excellent "astronomical" quality. Each year, more than 500 astronomers from European countries, Chile and elsewhere profit from this when they come to La Silla to observe with one or more of the 15 telescopes now located there. In 1987, the ESO Council [2] decided to embark upon one of the most prestigious and technologically advanced projects ever conceived in astronomy, the Very Large Telescope (VLT). It will consist of four interconnected 8.2-metre telescopes and will become the largest optical telescope in the world when it is ready. It is safe to predict that many exciting discoveries will be made with this instrument, and it will undoubtedly play a very important role in our exploration of the distant universe and its many mysteries during the coming decades. THE VLT AND PARANAL In order to find the best site for the VLT, ESO performed a thorough investigation of many possible mountain tops, both near La Silla and in Northern Chile. They showed

  7. APS Editorial Q&A: APS and Open Access

    Science.gov (United States)

    2011-04-01

    The movement toward Open Access continues to gain momentum. A brief review of APS efforts in this area will be presented by APS Editor in Chief, Gene Sprouse. Editors from Physical Review C, D, Letters, and X, Physical Review Special Topics - Accelerators and Beams, Physical Review Special Topics - Physics Education Research, and Reviews of Modern Physics will address your questions about publishing in this evolving environment.

  8. complejidad en Chile

    Directory of Open Access Journals (Sweden)

    Miguel Alejandro Bustamante-Ubilla

    2015-01-01

    Full Text Available El presente estudio tiene por objetivo caracterizar el clima organizacional al interior de 2 hospitales dealta complejidad de Chile, determinando las dimensiones más y menos influyentes. Para su desarrollose aplicó un cuestionario que consta de 71 variables agrupadas en 14 dimensiones a una muestra de561 funcionarios. La interpretación de los resultados se realizó a través del análisis del valor prome-dio estandarizado y su confiabilidad ratificada mediante el alfa de Cronbach. A partir de lo anterior, sedeterminó que las dimensiones que influyen por encima del promedio fueron: identidad, motivaciónlaboral y responsabilidad; en tanto que las dimensiones que muestran un nivel de impacto por debajodel promedio resultaron ser: equipo y distribución de personas y material, administración del conflictoy comunicación.© 2015 Universidad ICESI. Publicado por Elsevier España, S.L.U. Este es un artículo Open Access bajo lalicencia CC BY (http://creativecommons.org/licenses/by/4.0/.

  9. [Chile: Standing up again].

    Science.gov (United States)

    Reyes B, Humberto

    2010-03-01

    One of the biggest earthquakes recorded in human history has recently devastated a large part of the Chilean territory and, followed by a Tsunami, destroyed cities, seaports, fishermen's coves, bridges, and countryside houses. This cataclysm affected a large proportion of our population, leaving homeless families, no working tools for work places, hospitals, schools, public buildings, museums. However, the loss of human Uves was small compared to similar disasters. It destroyed part of the national heritage as well as damaged people's living conditions. A national movement started immediately to help and recover, and international resources, both human and technological were also set in motion. As after previous earthquakes in Chile, young M.D.'s and medical students were organized in voluntary groups backed by institutions or by their own organizations and went from large cities as Santiago and others to provide medical and psychological care to those in most need. Young members and students of other health professions (nurses, physical therapists, etc.) were included in these groups or worked in their own ones. National and international experience indicates that the forthcoming months require special care of psychological reactions and sequel (posttraumatic stress symptoms) and health consequences after water pollution, restrictions in housing and deteriorated sanitary conditions. Nevertheless, our country will stand up once more.

  10. Country watch: Chile.

    Science.gov (United States)

    Montoya Leiva, M

    1996-01-01

    Servicio Paz y Justicia (SERPAJ) is a nongovernmental organization (NGO) established in Chile in 1977. It supports fundamental human dignity and rights by fighting discrimination and exclusion based upon individual differences. SERPAJ promotes training, organization, and the political participation of community members as part of the democratic process, working mainly with the at risk women, street children, and youth of Santiago's working-class neighborhoods. Groups participate in workshops and training courses on human rights and development, civic education, and methods of non-violent community action. In 1987, SERPAJ-Sur Oriente began to include the topic of sexuality and AIDS/STDs in courses training working-class women as community human rights agents. The NGO is therefore one of the first mainstream Chilean human rights organizations to incorporate HIV/AIDS issues. A basic facts brochure was developed, followed by a pilot education project developed in one neighborhood which was then systematically replicated in other neighborhoods. The comments of some people who have participated in SERPAJ workshops are presented.

  11. It Pays to Invest in Chile

    Institute of Scientific and Technical Information of China (English)

    Li Zhen

    2011-01-01

    @@ Chile is the first country to establish coopera-tive relations with China in South America, and also the first one to support China's ac-cession to the World Trade Organization.In 2005, Chile and China signed a free trade agreement.After that, China has become Chile's largest trad-ing partner, and Chile become China's second largest partner in South America.

  12. Modernitet og forbrugskultur i Chile

    DEFF Research Database (Denmark)

    Cristoffanini, Pablo Rolando

    2012-01-01

    I de sidste årtier er Chile blevet et egentligt forbrugersamfund. Udbredelsen af forbrugskulturen og forbrugerismen er centrale fænomener i chilenernes dagligliv og har nået et omfang, som har konsekvenser for de borgere, der ikke kan deltage fuldt ud heri, noget som er typisk for et samfund med en...... ujævn økonomisk udvikling og med store sociale forskelle. Denne proces er ikke et produkt af en stille, fredelig og naturlig samfundsudvikling, således som magteliten og de toneangivende intellektuelle i Chile har fremstillet det. Som jeg vil vise, er skabelsen af et egentlig forbrugssamfund knyttet til...... til i dag. Ifølge disse er Chile blevet et moderne samfund netop i kraft af, at Chile er et ægte forbrugersamfund med alt, hvad dette indebærer, såvel materielt som symbolsk. For det tredje er billedet af Chile som en ”supermoderne” nation i den latinamerikanske kontekst en udbredt forestilling hos...

  13. Task Force on Catastrophic Antiphospholipid Syndrome (APS) and Non-criteria APS Manifestations (I): catastrophic APS, APS nephropathy and heart valve lesions.

    Science.gov (United States)

    Cervera, R; Tektonidou, M G; Espinosa, G; Cabral, A R; González, E B; Erkan, D; Vadya, S; Adrogué, H E; Solomon, M; Zandman-Goddard, G; Shoenfeld, Y

    2011-02-01

    The objectives of the 'Task Force on Catastrophic Antiphospholipid Syndrome (APS) and Non-criteria APS Manifestations' were to assess the clinical utility of the international consensus statement on classification criteria and treatment guidelines for the catastrophic APS, to identify and grade the studies that analyse the relationship between the antiphospholipid antibodies and the non-criteria APS manifestations and to present the current evidence regarding the accuracy of these non-criteria APS manifestations for the detection of patients with APS. This article summarizes the studies analysed on the catastrophic APS, APS nephropathy and heart valve lesions, and presents the recommendations elaborated by the Task Force after this analysis.

  14. China and Chile Signing Free Trade Agreement

    Institute of Scientific and Technical Information of China (English)

    Shen; Danyang

    2005-01-01

      Mr. Bo Xilai, Minister of Commerce of China, and Mr.Walker, Foreign Minister of Chile, signed the China-Chile FTA on behalf of their respective government on November 18, 2005. Chinese President Hu Jintao and Chile President Lagos attended the signing ceremony, according to a press release on the website of Network Center of MOFCOM.……

  15. China and Chile Signing Free Trade Agreement

    Institute of Scientific and Technical Information of China (English)

    Shen Danyang

    2005-01-01

    @@ Mr. Bo Xilai, Minister of Commerce of China, and Mr.Walker, Foreign Minister of Chile, signed the China-Chile FTA on behalf of their respective government on November 18, 2005. Chinese President Hu Jintao and Chile President Lagos attended the signing ceremony, according to a press release on the website of Network Center of MOFCOM.

  16. Wildfires in Chile: A review

    Science.gov (United States)

    Úbeda, Xavier; Sarricolea, Pablo

    2016-11-01

    This paper reviews the literature examining the wildfire phenomenon in Chile. Since ancient times, Chile's wildfires have shaped the country's landscape, but today, as in many other parts of the world, the fire regime - pattern, frequency and intensity - has grown at an alarming rate. In 2014, > 8000 fires were responsible for burning c. 130,000 ha, making it the worst year in Chile's recent history. The reasons for this increase appear to be the increment in the area planted with flammable species; the rejection of these landscape modifications on the part of local communities that target these plantations in arson attacks; and, the adoption of intensive forest management practices resulting in the accumulation of a high fuel load. These trends have left many native species in a precarious situation and forest plantation companies under considerable financial pressure. An additional problem is posed by fires at the wildland urban interface (WUI), threatening those inhabitants that live in Chile's most heavily populated cities. The prevalence of natural fires in Chile; the relationship between certain plant species and fire in terms of seed germination strategies and plant adaptation; the relationship between fire and invasive species; and, the need for fire prevention systems and territorial plans that include fire risk assessments are some of the key aspects discussed in this article. Several of the questions raised will require further research, including just how fire-dependent the ecosystems in Chile are, how the forest at the WUI can be better managed to prevent human and material damage, and how best to address the social controversy that pits the Mapuche population against the timber companies.

  17. Chile Energy Policy Review 2009

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2009-10-22

    Since 1990, Chile has been the fastest growing economy in Latin America thanks to sound economic management and integration into the global economy. Chile can also be proud of its energy policy achievements. The pioneering privatisation and liberalisation of its electricity sector in the 1980s was the foundation for a competitive energy sector, which has sustained the rapid growth of the Chilean economy over the past two decades. Nonetheless, Chile faces the continuing challenge of finding additional energy supplies to fuel economic growth. Chile has limited fossil energy resources and depends on imports to meet three-quarters of its energy needs. The country's electricity sector has faced three periods of significant stress over the past decade. The last episode took place in 2007/2008, when the loss of natural gas imports from Argentina was further exacerbated by a drought in the central system, where hydropower normally accounts for over half of electricity generation. Drawing on the experience of IEA member countries, the Review assesses Chile's major energy challenges and provides recommendations. Six main themes emerge: the successful liberalisation of the power sector in the 1980s; the essential role played by the state in ensuring energy security; the re-formulation of Chile's long-term energy policy; the proposed reorganisation of the institutional framework; greater independence for the system operators; and the need for a clear framework of regulation so that long-term investment decisions integrate social and environmental costs. This publication is essential reading for all who are interested in Chilean energy issues and in learning about the important role sound energy policy can play in developing a nation's economic and social welfare.

  18. [Apheresis in antiphospholipid syndrome (APS)].

    Science.gov (United States)

    De Silvestro, Giustina; Tison, Tiziana; Marson, Piero

    2012-01-01

    Antiphospholipid syndrome (APS) is a rare clinical disorder characterized by thromboembolic manifestations and/or obstetric complications. Along with the clinical symptoms and signs, serum antiphospholipid antibodies have to be detected. APS can be primary, i.e., without any concomitant disorders, or secondary to other autoimmune diseases, particularly systemic lupus erythematosus. Criteria for the diagnosis of APS have been clearly established. Hyperacute APS (or catastrophic antiphospholipid syndrome), often with a poor prognosis, must meet four criteria: involvement of three or more organs, rapid evolution of clinical manifestations, microangiopathic occlusion of small blood vessels at biopsy, and presence of antiphospholipid antibodies. The rationale for apheresis treatment is the removal of pathogenetic antibodies involved in the development of tissue damage. Our experience includes 23 patients, in particular 15 women treated for 19 pregnancies. According to the National Guidelines Program, the effectiveness of apheresis in catastrophic syndrome has a level of evidence of V/VI, with a strength of recommendation A; in highrisk pregnancy it has a level of evidence of V with a strength of recommendation B. It will be necessary to better define the prognosis of various categories of pregnant patients with APS, as well as useful laboratory parameters to monitor its clinical course and anticipate any complications of pregnancy.

  19. APS Education and Diversity Efforts

    Science.gov (United States)

    Prestridge, Katherine; Hodapp, Theodore

    2015-11-01

    American Physical Society (APS) has a wide range of education and diversity programs and activities, including programs that improve physics education, increase diversity, provide outreach to the public, and impact public policy. We present the latest programs spearheaded by the Committee on the Status of Women in Physics (CSWP), with highlights from other diversity and education efforts. The CSWP is working to increase the fraction of women in physics, understand and implement solutions for gender-specific issues, enhance professional development opportunities for women in physics, and remedy issues that impact gender inequality in physics. The Conferences for Undergraduate Women in Physics, Professional Skills Development Workshops, and our new Professional Skills program for students and postdocs are all working towards meeting these goals. The CSWP also has site visit and conversation visit programs, where department chairs request that the APS assess the climate for women in their departments or facilitate climate discussions. APS also has two significant programs to increase participation by underrepresented minorities (URM). The newest program, the APS National Mentoring Community, is working to provide mentoring to URM undergraduates, and the APS Bridge Program is an established effort that is dramatically increasing the number of URM PhDs in physics.

  20. Fourth Generation Warfare in Chile: Illicit Drug Trafficking Threats

    Science.gov (United States)

    2011-03-21

    Investigations Police of Chile (Policia de Investigaciones de Chile – PDI). Carabineros de Chile is the uniformed Chilean national police force created in...Chile also has an investigative police force, the Investigations Police of Chile (Policia de Investigaciones de Chile, PDI). This is the civil police... Investigaciones de Chile Homepage, http://www.investigaciones.cl/ (accessed February 20, 2011). 56 CONACE Homepage http://www.conacedrogas.cl/portal

  1. Women and Politics in Chile.

    Science.gov (United States)

    Kirkwood, Julieta

    1983-01-01

    Political parties in Chile of both the left and right have focused more on drawing women into their ideologies than on considering what political issues mean to women. A look at feminist thought shows how political life for women includes not only the traditional political arena but also domestic life. (IS)

  2. The biomethane potential in Chile

    Energy Technology Data Exchange (ETDEWEB)

    Seiffert, M.; Miranda, J.A. [Institute for Energy and Environment gGmbH, German Biomass Research Centre, Torgauer Strasse 116, 04347 Leipzig (Germany); Kaltschmitt, M. [Institute for Energy and Environment gGmbH, German Biomass Research Centre, Torgauer Strasse 116, 04347 Leipzig (Germany); Institute of Environmental Technology and Energy Economics, Hamburg University of Technology, Eissendorfer Strasse 40, D-21073 Hamburg (Germany)

    2009-04-15

    Within the last decade natural gas gained considerable importance in Chile. The contribution of natural gas within the energy system will increase in the future by predicted 3.6% annually until the year 2015. Due to limited resources within its own country, the energy system of Chile depends on natural gas imports preferential from Argentina. Therefore, the aim of several stakeholders from policy and industry is to reduce the share of imported primary energy within the overall energy system. In order to reach this goal, the use of domestic resources and particularly the utilisation of biomass as one of the most important renewable sources of energy in Chile could play an important role. Against this background, the goal of this paper is the analysis of the technical potentials of biomethane as a substitute for natural gas. For the production of biomethane the anaerobic or bio-chemical (i.e. Biogas) as well as the thermo-chemical conversion pathways (i.e. Bio-SNG) are considered. The results of this analysis show that biomass converted to biomethane is a promising energy provision option for Chile and it contributes to the reduction of greenhouse gas emissions. (author)

  3. AP Geography, Environmental Science Thrive

    Science.gov (United States)

    Robelen, Erik W.

    2012-01-01

    Geography may not be particularly known as a hot topic among today's students--even some advocates suggest it suffers from an image problem--but by at least one measure, the subject is starting to come into its own. Across more than 30 topics covered in the Advanced Placement (AP) program, participation in geography is rising faster than any…

  4. Acuicultura Insostenible en Chile (Unsustainable aquaculture in Chile

    Directory of Open Access Journals (Sweden)

    Sommer, Marcos

    2009-03-01

    Full Text Available ResumenLa acuicultura en Chile sólo será alternativa a la pesca si se consigue llevar su producción a parámetros de sostenibilidad, no solamente económica sino, fundamentalmente, ambiental. Con un esfuerzo dirigido hacia medidas legislativas y de control, e investigación aplicada, podríamos acercarnos a una acuicultura ambientalmente sostenible.

  5. Socialisme i Chile efter Pinochet

    DEFF Research Database (Denmark)

    Cristoffanini, Pablo Rolando

    2008-01-01

    Chile bliver ofte præsenteret som et paradigme for resten af det latinamerikanske kontinent: Et land med høj økonomisk vækst og politisk stabilitet. Landet har endda haft to socialistiske præsidenter siden 2000, den sidste den første kvindelige præsident. Succeshistorien har en bagside: De...... socialistiske regeringer har accepteret et begrænset demokrati og videreført en nyliberal økonomisk politik, der har bragt dem på konfrontationskurs med massebevægelserne og isoleret Chile fra de andre lande i regionen, der søger integration og gensidig støøte. Udgivelsesdato: Februar...

  6. Area Handbook Series: Chile: A Country Study

    Science.gov (United States)

    1982-05-01

    encomiendas , or trusteeships. Enco- menderos (those who received encomiendas ) in turn controlled the Indians. In Chile, however, there were too few...Indians to operate an encomienda system to support the many Spaniards who soon arrived-nor was there sufficient gold and silver for the Indians to pay...provided a con- 7 Chile: A Country Study venient rationale for capturing and enslaving Indians to fill the needs of the encomiendas in central Chile

  7. An AP Calculus Classroom Amusement Park

    Science.gov (United States)

    Ferguson, Sarah

    2016-01-01

    Throughout the school year, AP Calculus teachers strive to teach course content comprehensively and swiftly in an effort to finish all required material before the AP Calculus exam. As early May approaches and the AP Calculus test looms, students and teachers nervously complete lessons, assignments, and assessments to ensure student preparation.…

  8. Fellow's Apéro

    CERN Multimedia

    Staff Association

    2017-01-01

    Let's get together, meet each other, exchange experiences and ideas, and share useful information on CERN and the Staff Association. Join us for Fellow's Apéro, organised by the Staff Association on Tuesday 21 February at 16.30 in Restaurant 1. There will be drinks and snacks for everybody! We look forward to seeing you there! Please confirm your participation on Doodle http://doodle.com/poll/skvm7ucm2z78i6bt or alternatively on Facebook https://www.facebook.com/events/1862757017340069/. Your delegates in the Staff Association, Barbora & Jiri

  9. Testing of Solar Heated Domestic Hot Water System for Solahart Scandinavia ApS

    DEFF Research Database (Denmark)

    Andersen, Elsa

    1997-01-01

    The solar heating system marketed by Solahart Scandinavia ApS was tested in the Institutes test facility for SDHWsystems. The test results are described in the report.......The solar heating system marketed by Solahart Scandinavia ApS was tested in the Institutes test facility for SDHWsystems. The test results are described in the report....

  10. Rising Expectations in Brazil and Chile

    Science.gov (United States)

    Elacqua, Gregory; Alves, Fatima

    2014-01-01

    Two themes connect Brazil and Chile: one is economic success; the other is social unrest. Protests rocked cities across Brazil in June 2013, and in Chile, recent student protests turned violent. Yet living conditions in both nations are better now than they've ever been. Successful economic and social reforms over the last two decades have led to…

  11. Rising Expectations in Brazil and Chile

    Science.gov (United States)

    Elacqua, Gregory; Alves, Fatima

    2014-01-01

    Two themes connect Brazil and Chile: one is economic success; the other is social unrest. Protests rocked cities across Brazil in June 2013, and in Chile, recent student protests turned violent. Yet living conditions in both nations are better now than they've ever been. Successful economic and social reforms over the last two decades have…

  12. Antarctica: Chile’s Claim,

    Science.gov (United States)

    1987-01-01

    any decree, war, or treaty. The report, Geographic and Hydrographic His- tory of the Kingdom of Chile, whose author was Gov- ernor Manuel Amat y...men include Lieu- tenants Ponce and Torrealba of the Chilean Army and Captain Ariel Gonzalez and Corporal Rojas of the Chilean Navy. The interest in...Land, 62 of, 28-30, 36-38, Aguirre Cerda, Pedro, 82, 76, 88 93,96 "stages of growth" of, Alderete, Jeronimo de, 91 31-32 Amat y Jumient, Manuel

  13. [Antimicrobial susceptibility in Chile 2012].

    Science.gov (United States)

    Cifuentes-D, Marcela; Silva, Francisco; García, Patricia; Bello, Helia; Briceño, Isabel; Calvo-A, Mario; Labarca, Jaime

    2014-04-01

    Bacteria antimicrobial resistance is an uncontrolled public health problem that progressively increases its magnitude and complexity. The Grupo Colaborativo de Resistencia, formed by a join of experts that represent 39 Chilean health institutions has been concerned with bacteria antimicrobial susceptibility in our country since 2008. In this document we present in vitro bacterial susceptibility accumulated during year 2012 belonging to 28 national health institutions that represent about 36% of hospital discharges in Chile. We consider of major importance to report periodically bacteria susceptibility so to keep the medical community updated to achieve target the empirical antimicrobial therapies and the control measures and prevention of the dissemination of multiresistant strains.

  14. EL RACISMO AMBIENTAL EN CHILE

    Directory of Open Access Journals (Sweden)

    MATÍAS MEZA-LOPEHANDÍA

    2011-06-01

    Full Text Available El problema de la desigualdad en Chile ha sido abordado desde diferentes puntos de vista como la cuestión de la distribución de la riqueza o el acceso a los derechos sociales. Es este trabajo se observa el mismo problema pero desde la perspectiva recientemente esbozada por los movimientos sociales: la del racismo ambiental o la desigual distribución de los deshechos del desarrollo y el consumo. De esta manera se revisan sucintamente los principales conflictos que han surgido en el último tiempo a lo largo del país entre empresas públicas y privadas y comunidades locales y originarias. Así mismo se examinan las formas de organización que estas últimas han asumido y el estado actual de articulación entre ellas. De la revisión de la situación se concluye que estamos ante el surgimiento de un actor de nuevo tipo, que surge de las contradicciones del Chile neoliberal y que se diferencia del movimiento ecologista por vincular sus reivindicaciones a la defensa del territorio y al derecho a la autodeterminación de los pueblos.

  15. President of Chile at CERN

    CERN Multimedia

    2007-01-01

    The President of Chile, Michelle Bachelet, in the ATLAS cavern with, from left to right, Peter Jenni, ATLAS Spokesman, Vivian Heyl, CONICYT President, and Robert Aymar, CERN Director-General. Robert Aymar, CERN Director-General, and Vivian Heyl, CONICYT President, signing a cooperation agreement between CERN and Chile’s Comisión Nacional de Investigación Científica y Tecnológica (CONICYT).The President of Chile, Michelle Bachelet, paid a visit to CERN during her three-day tour of Switzerland. The charismatic Michelle Bachelet and her large delegation were greeted by the CERN Director-General and then taken to see the ATLAS experiment and the LHC. She also took time to meet the Chilean community working at CERN, comprising several physicists in the Theory Group and the ATLAS experiment. The meeting was followed by the signing of a cooperation agreement between CERN and Chile’s Comisión Nacional de Investigación Científi...

  16. On AP-property of Function Spaces

    Institute of Scientific and Technical Information of China (English)

    SHEN Rong-xin

    2012-01-01

    In this paper,it is discussed the AP-property of function spaces.We prove that for any compact network α for a space X which is closed under finite unions,(1) if Cα(X) is an AP-space and X is paracompact,then X is a Hurewicz space; (2) if Cα (X) is an AP-space which has countable tightness,then Cα(X) is discretely generated.

  17. Chile. A model mining country?; Chile. Ein Bergbau-Musterland?

    Energy Technology Data Exchange (ETDEWEB)

    Renner, Sven [Projektbuero der Bundesanstalt fuer Geowissenschaften und Rohstoffe (BGR) und des chilenischen Geologie und Bergbaudienstes SERNAGEOMIN, Santiago de Chile (Chile). Projekt ' Grundlagen der Sanierung von Bergbaualtlasten in Chile' ; Dalheimer, Manfred [Bundesanstalt fuer Geowissenschaften und Rohstoffe (BGR), Hannover (Germany). Abt. Internationale Zusammenarbeit Amerika

    2009-03-19

    Chile is characterised economically and culturally by mining. The copper industry is highly important. In 2007 two thirds of export proceeds were generated solely by copper, copper concentrate and other minerals. With the increase in the price of raw materials since 2004 the state income rose considerably with the result that the national debt was offset. However, this increase was barely noticeable among the wider public. Further reasons for doubt with regards to the mining industry are that a new mining project generally not only creates jobs, but also changes local structures, competes with water utilisation and usually leaves contaminated sites. The responsible politicians and mining authorities are aware of these relationships and are drawing up corresponding laws and decrees. These include the Environmental Act, the bills for mine closures and the systematic redevelopment of old mining sites. At least voluntary commitments for current large-scale mining are in force until the bills are passed. (orig.)

  18. AP calculus AB & BC crash course

    CERN Document Server

    Rosebush, J

    2012-01-01

    AP Calculus AB & BC Crash Course - Gets You a Higher Advanced Placement Score in Less Time Crash Course is perfect for the time-crunched student, the last-minute studier, or anyone who wants a refresher on the subject. AP Calculus AB & BC Crash Course gives you: Targeted, Focused Review - Study Only What You Need to Know Crash Course is based on an in-depth analysis of the AP Calculus AB & BC course description outline and actual AP test questions. It covers only the information tested on the exams, so you can make the most of your valuable study time. Written by experienced math teachers, our

  19. Chile: los mapuches y el Bicentenario Chile: Mapuches e do Bicentenario Chile: Mapuche and the Bicentennial

    Directory of Open Access Journals (Sweden)

    José Bengoa

    2011-12-01

    Full Text Available El Bicentenario de la República de Chile se conmemoró en el mes de septiembre del año 2010. Además de marcar un importante hito histórico, coincidió con un cambio político en el Gobierno del país, el que pasó de la Concertación de Partidos por la Democracia a la Alianza de partidos formada por la derecha chilena. Se cumplieron por tanto 20 años desde que en el año 1990 cambiara el Gobierno militar presidido por el general Pinochet. Ese largo tiempo, dos décadas, coincide con un período de políticas que el Estado ha implementado hacia los Pueblos Indígenas. El Proyecto “Conmemoraciones y Memorias Subalternas” ha realizado durante el año 2010 un conjunto de investigaciones de terreno y documentales tendientes a comprender del modo más objetivo y científico lo ocurrido en el período y por tanto la situación actual de las sociedades mapuches en sus complejas relaciones con la chilena.O Bicentenario da República do Chile comemorou-se no mês de Setembro do ano 2010. Junto com transformar-se num marco histórico, coincidiu com uma mudança política no Governo do país, que passou da Concertação de Partidos pela Democracia (centro-esquerda à Aliança de partidos formada pela direita chilena. Cumpriram-se por tanto 20 anos desde que em 1990 mudasse o Governo militar presidido pelo general Pinochet. Esse longo tempo, duas décadas, coincide com um período de políticas que o Estado implementou para com os Povos Indígenas. O Projeto “Comemorações e Memórias Subalternas” realizou durante o ano 2010 um conjunto de pesquisas de campo e documentais tendentes a compreender do modo mais objetivo e científico o ocorrido no período e, por tanto, a situação atual das sociedades mapuches em suas complexas relações com a chilena.The conmeration of the 200 years of the Independence of Chile was in September 2010. This year was also the political change from the Concertación de Partidos por la Democracia to the right

  20. Crecimiento pro pobre en Chile

    Directory of Open Access Journals (Sweden)

    Dante Contreras

    2008-01-01

    Full Text Available Con datos de panel para el periodo 1996-2001 y datos de corte transversal para 1990 y 2003, este artículo evalúa si el crecimiento en Chile ha sido “pro pobre”. Se emplean dos metodos: i se estima la “curva de incidencia del crecimiento” y luego se estima paramétrica y no paramétricamente la relación entre el ingreso per capita de los hogares en 1996 y el cambio en el ingreso de 1996-2001. Los resultados indican que el crecimiento ha incidido significativamente en la reducción de pobreza. Por otra parte, existe evidencia de convergencia para la mitad más pobre de la distribución de ingresos.

  1. Village microgrids: The Chile project

    Energy Technology Data Exchange (ETDEWEB)

    Baring-Gould, E.I.

    1997-12-01

    This paper describes a village application in Chile. The objective was to demonstrate the technical, economic and institutional viability of renewable energy for rural electrification, as well as to allow local partners to gain experience with hybrid/renewable technology, resource assessment, system siting and operation. A micro-grid system is viewed as a small village system, up to 1200 kWh/day load with a 50 kW peak load. It can consist of components of wind, photovoltaic, batteries, and conventional generators. It is usually associated with a single generator source, and uses batteries to cover light day time loads. This paper looks at the experiences learned from this project with regard to all of the facets of planning and installing this project.

  2. 2010 Chile Earthquake Aftershock Response

    Science.gov (United States)

    Barientos, Sergio

    2010-05-01

    The Mw=8.8 earthquake off the coast of Chile on 27 February 2010 is the 5th largest megathrust earthquake ever to be recorded and provides an unprecedented opportunity to advance our understanding of megathrust earthquakes and associated phenomena. The 2010 Chile earthquake ruptured the Concepcion-Constitucion segment of the Nazca/South America plate boundary, south of the Central Chile region and triggered a tsunami along the coast. Following the 2010 earthquake, a very energetic aftershock sequence is being observed in an area that is 600 km along strike from Valparaiso to 150 km south of Concepcion. Within the first three weeks there were over 260 aftershocks with magnitude 5.0 or greater and 18 with magnitude 6.0 or greater (NEIC, USGS). The Concepcion-Constitucion segment lies immediately north of the rupture zone associated with the great magnitude 9.5 Chile earthquake, and south of the 1906 and the 1985 Valparaiso earthquakes. The last great subduction earthquake in the region dates back to the February 1835 event described by Darwin (1871). Since 1835, part of the region was affected in the north by the Talca earthquake in December 1928, interpreted as a shallow dipping thrust event, and by the Chillan earthquake (Mw 7.9, January 1939), a slab-pull intermediate depth earthquake. For the last 30 years, geodetic studies in this area were consistent with a fully coupled elastic loading of the subduction interface at depth; this led to identify the area as a mature seismic gap with potential for an earthquake of magnitude of the order 8.5 or several earthquakes of lesser magnitude. What was less expected was the partial rupturing of the 1985 segment toward north. Today, the 2010 earthquake raises some disturbing questions: Why and how the rupture terminated where it did at the northern end? How did the 2010 earthquake load the adjacent segment to the north and did the 1985 earthquake only partially ruptured the plate interface leaving loaded asperities since

  3. Surface Observations from Punta Arenas, Chile

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Surface Observations from Punta Arenas, in extreme southern Chile. WMO station ID 85934. Period of record 1896-1954. The original forms were scanned at the Museo...

  4. 1960 Puerto Montt, Valdivia, Chile Images

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — On May 22, 1960, a Mw 9.5 earthquake, the largest earthquake ever instrumentally recorded, occurred in southern Chile. The series of earthquakes that followed...

  5. Diversidad de la familia Carabidae (Coleoptera en Chile Diversity of the family Carabidae (Coleoptera in Chile

    Directory of Open Access Journals (Sweden)

    SERGIO ROIG-JUÑENT

    2001-09-01

    Full Text Available Carabidae constituye dentro de los coléopteros chilenos, la cuarta familia en importancia por su cantidad de especies. El presente trabajo incluye una breve compilación acerca de la historia de la familia y de las primeras expediciones realizadas en Chile. También se realizan comparaciones de la diversidad de carábidos chilenos con respecto a otros países y el Neotrópico. Para Chile, se conocen 21 tribus, con 95 géneros y 365 especies, que representan el 38,8, 28,8 y 7,9 % de la fauna del Neotrópico, respectivamente. Chile posee un bajo número de tribus comparado con otros países, sin embargo, constituye un área importante por la presencia de seis tribus relictuales, principalmente pangeicas o gondwánicas. Chile posee 18 géneros endémicos (18,5 % de su fauna de Carabidae, 28 cuya distribución está restringida a Chile y Argentina y seis restringidos a Chile, Argentina y Uruguay. La cantidad de especies presentes en Chile es inferior a la que poseen otros países de América del Sur, pero la cantidad de especies endémicas es muy alta (204 y representa el 55,8 % de su fauna de carábidos. El alto grado de endemismo que posee Chile con respecto a otros países de América del Sur puede deberse a su condición de aislamiento, siendo las barreras más importantes la región desértica del norte y la cordillera de Los Andes. Este hecho también se vislumbra por la ausencia de importantes tribus neotropicales como Galeritini, Scaritini y Brachinini. También se incluyen en este trabajo claves para la identificación de todas las tribus y géneros presentes en Chile, como así también una breve descripción acerca de la diversidad y ambientes en los que se encuentra cada géneroThe family Carabidae is the fourth largest Coleoptera family in Chile. The present work includes a brief compilation on the taxonomic history of the family and the first expeditions to Chile. In addition, knowledge of carabid diversity in Chile is compared with

  6. Where Do Mexico and Chile Stand on Inclusive Education? Short Title: Inclusion in Mexico and Chile

    Science.gov (United States)

    García-Cedillo, Ismael; Romero-Contreras, Silvia; Ramos-Abadie, Liliana

    2015-01-01

    This paper discusses the background, current situation and challenges of educational integration and inclusive education in Mexico and Chile. These countries obtained similar low results on the academic achievement of their students (Mexico last and Chile second last) among OECD countries; and above average scores, among Latin-American countries.…

  7. [Papillomavirus and cervical cancer in Chile].

    Science.gov (United States)

    O'Ryan, Miguel; Valenzuela, María Teresa

    2008-11-01

    Molecular, clinical and epidemiological studies have established beyond doubt that human papiloma viruses (HPV) cause cervical cancer. The virus is also associated with genital warts and other less common cancers in oropharynx, vulva, vagina and penis. Worldwide, VPH genotypes 16 and 18 are the most common high risk genotypes, detected in near 70% of women with cervical cancer. The discovery of a cause-effect relationship between several carcinogenic microorganisms and cancer open avenues for new diagnostic, treatment and prevention strategies. In this issue of Revista Médica de Chile, two papers on HPV are presented. Guzman and colleagues demonstrate that HPV can be detected in 66% to 77% of healthy male adolescents bypolymerase chain reaction and that positivity depends on the site of the penis that is sampled. These results support the role of male to female transmission of high risk HPVs in Chile and should lead to even more active educational campaigns. The second paper provides recommendations for HPV vaccine use in Chile, generated by the Immunization Advisory Committee of the Chilean Infectious Disease Society. To issue these recommendations, the Committee analyzes the epidemiological information available on HPV infection and cervical cancer in Chile, vaccine safety and effectiveness data, and describes cost-effectiveness studies. Taking into account that universal vaccination is controversial, the Committee favors vaccine use in Chile and it's incorporation into a national program. However, there is an indication that the country requires the implementation of an integrated surveillance approach including cross matching of data obtained from HPV genotype surveillance, monitoring of vaccination coverage, and surveillance of cervical cancer. The final decision of universal vaccine use in Chile should be based on a through analysis of information.ev Mid Chile

  8. AP English language & composition crash course

    CERN Document Server

    Hogue, Dawn

    2012-01-01

    AP English Language & Composition Crash Course - Gets You a Higher Advanced Placement Score in Less Time Crash Course is perfect for the time-crunched student, the last-minute studier, or anyone who wants a refresher on the subject. AP English Language & Composition Crash Course gives you: Targeted, Focused Review - Study Only What You Need to Know Crash Course is based on an in-depth analysis of the AP English Language & Composition course description outline and actual Advanced Placement test questions. It covers only the information tested on the exam, so you can make the most of your valua

  9. Helicobacter pylori infection in Chile.

    Science.gov (United States)

    Figueroa, G; Acuña, R; Troncoso, M; Portell, D P; Toledo, M S; Valenzuela, J

    1997-11-01

    This article summarizes studies designed to evaluate the role of Helicobacter pylori infection in Chile, described in 21 reports from nine centers in various Chilean regions published between 1985 and 1995. According to their data, H. pylori infection is quite frequent among patients with a variety of gastric conditions, including adults (43%-92%) and children (6%-100%). Levels of specific IgG antibodies to H. pylori are also elevated among patients with duodenal ulcers (100%) and gastritis (86%) as well as asymptomatic adults (75%). Combination therapy with three (but not two) drugs has been proved effective, with clinical improvement, ulcer cure, and H. pylori eradication occurring in well-controlled studies. Available evidence suggests that antibiotic resistance is not a major problem in treatment. The H. pylori reinfection rate is low (4.2% per year), suggesting that combination therapy with three drugs constitutes a cost-effective alternative for treating colonized symptomatic patients. Concurrent preliminary studies revealed that antibodies to VacA but not CagA proteins correlate with disease severity in Chilean patients. It can be concluded that local research assists local administrators of health resources to implement adequate policies to prevent, control, and treat H. pylori-related pathologies.

  10. Regulated electricity retailing in Chile

    Energy Technology Data Exchange (ETDEWEB)

    Galetovic, Alexander, E-mail: alexander@galetovic.cl [Facultad de Ciencias Economicas y Empresariales, Universidad de los Andes, Santiago, Chile. Av. San Carlos de Apoquindo 2200, Las Condes, Santiago (Chile); Munoz, Cristian M., E-mail: cmunozm@aes.com [AES Gener and Departamento de Ingenieria Electrica, Universidad Catolica de Chile (Chile)

    2011-10-15

    While some countries have unbundled distribution and retailing, skeptics argue that the physical attributes of electricity make retailers redundant. Instead, it is claimed that passive pass through of wholesale prices plus regulated charges for transmission and distribution suffice for customers to benefit from competitive generation markets. We review the Chilean experience with regulated retailing and pass through of wholesale prices. We argue that when energy wholesale prices are volatile and prices are stabilized, distortions emerge. Regulated retailers gain little by mitigating or correcting them. On the contrary, sometimes price distortions increase their profits. We estimate the cost of three distortions that neither regulated retailers nor the regulator have shown any interest in correcting. - Highlights: > We review Chile's experience with regulated electricity retailing. > Distortions emerge when energy wholesale prices are volatile and prices stabilized. > Regulated retailers gain little by mitigating or correcting distortions. > Sometimes price distortions increase retailers' profits. > We estimate the cost of three distortions, which retailers have not corrected.

  11. The Revolutionary Left and Terrorist Violence in Chile.

    Science.gov (United States)

    1986-06-01

    Fraude Electoral Designada por la Facultad de Derecho de la Pontifica Universidad de Chile," in Libro Blanco del Cambio de Gobierno de Chile, Editorial...armed forces. Argentine police arrested Edgardo Enriquez, whom they deported to Chile. Humberto Sotomayor apparently left the movement, leaving Andres...often either deport them or sentence them to jail or internal -14- exile. The government seems able to capture the miristas who infiltrate into Chile

  12. [Beginning of the Microbiology education in Chile: formation centers].

    Science.gov (United States)

    Osorio, Carlos

    2015-08-01

    The first Chair of Microbiology in Chile was created in the School of Medicine of the Cañadilla at the University of Chile in 1892. Dr. Alejandro del Río Soto Aguilar was its first Professor. For almost three decades it was the only educational center for microbiologists in Chile. Among them were the first Professors of the new School of Medicine of the Catholic University of Chile and of the University of Concepción.

  13. Pentoxifylline Treatment in Acute Pancreatitis (AP)

    Science.gov (United States)

    2016-09-14

    Acute Pancreatitis (AP); Gallstone Pancreatitis; Alcoholic Pancreatitis; Post-ERCP/Post-procedural Pancreatitis; Trauma Acute Pancreatitis; Hypertriglyceridemia Acute Pancreatitis; Idiopathic (Unknown) Acute Pancreatitis; Medication Induced Acute Pancreatitis; Cancer Acute Pancreatitis; Miscellaneous (i.e. Acute on Chronic Pancreatitis)

  14. Peculiar Traits of Coarse AP (Briefing Charts)

    Science.gov (United States)

    2014-12-01

    Self Combustion 3 Thom L. Boggs Parallel ridges and valley surfaces seen at 1000 to 1500 psi Isolated AP vertical needle pockets at 1500 and 1800 psi...Negative exponents, bouncing flamlets between 2000 to 4000 psi Extremely irregular AP surface regression Hightower and Price 16 Air Force Research...supported by vertical gas jetlets from active centers? Did Boggs burn a few samples at 1000 to 2000 psi with orthorhombic main axis normal to

  15. 7 CFR 319.56-38 - Citrus from Chile.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 5 2010-01-01 2010-01-01 false Citrus from Chile. 319.56-38 Section 319.56-38... from Chile. Clementines (Citrus reticulata Blanco var. Clementine), mandarins (Citrus reticulata Blanco), and tangerines (Citrus reticulata Blanco) may be imported into the United States from Chile,...

  16. Tank 241-AP-106, Grab samples, 6AP-98-1, 6AP-98-2 and 6AP-98-3 Analytical results for the final report

    Energy Technology Data Exchange (ETDEWEB)

    FULLER, R.K.

    1999-02-23

    This document is the final report for tank 241-AP-106 grab samples. Three grab samples 6AP-98-1, 6AP-98-2 and 6AP-98-3 were taken from riser 1 of tank 241-AP-106 on May 28, 1998 and received by the 222-S Laboratory on May 28, 1998. Analyses were performed in accordance with the ''Compatability Grab Sampling and Analysis Plan'' (TSAP) (Sasaki, 1998) and the ''Data Quality Objectives for Tank Farms Waste Compatability Program (DQO). The analytical results are presented in the data summary report. No notification limits were exceeded. The request for sample analysis received for AP-106 indicated that the samples were polychlorinated biphenyl (PCB) suspects. The results of this analysis indicated that no PCBs were present at the Toxic Substance Control Act (TSCA) regulated limit of 50 ppm. The results and raw data for the PCB analysis are included in this document.

  17. Expedition Atacama - project AMOS in Chile

    Science.gov (United States)

    Tóth, J.; Kaniansky, S.

    2016-01-01

    The Slovak Video Meteor Network operates since 2009 (Tóth et al., 2011). It currently consists of four semi-automated all-sky video cameras, developed at the Astronomical Observatory in Modra, Comenius University in Bratislava, Slovakia. Two new generations of AMOS (All-sky Meteor Orbit System) cameras operate fully automatically at the Canary Islands, Tenerife and La Palma, since March 2015 (Tóth et al., 2015). As a logical step, we plan to cover the southern hemisphere from Chile. We present observational experiences in meteor astronomy from the Atacama Desert and other astronomical sites in Chile. This summary of the observations lists meteor spectra records (26) between Nov.5-13, 2015 mostly Taurid meteors, single and double station meteors as well as the first light from the permanent AMOS stations in Chile.

  18. Kepler observations of rapidly oscillating Ap, δ Scuti and γ Doradus pulsations in Ap stars

    DEFF Research Database (Denmark)

    Balona, Luis A.; Cunha, Margarida S.; Kurtz, Donald W.

    2011-01-01

    Observations of the A5p star KIC 8677585 obtained during the Kepler 10-d commissioning run with 1-min time resolution show that it is a rapidly oscillating Ap (roAp) star with several frequencies with periods near 10 min. In addition, a low frequency at 3.142 d−1 is also clearly present....... Multiperiodic γ Doradus (γ Dor) and δ Scuti (δ Sct) pulsations, never before seen in any Ap star, are present in Kepler observations of at least three other Ap stars. Since γ Dor pulsations are seen in Ap stars, it is likely that the low frequency in KIC 8677585 is also a γ Dor pulsation. The simultaneous...... presence of both γ Dor and roAp pulsations and the unexpected detection of δ Sct and γ Dor pulsations in Ap stars present new opportunities and challenges for the interpretation of these stars. Since it is easy to confuse Am and Ap stars at classification dispersions, the nature of these Ap stars...

  19. DETERMINANTES DE LA LECTURA EN CHILE

    OpenAIRE

    2007-01-01

    Los lectores se forman principalmente leyendo libros. Numerosa evidencia muestra que en Chile los niveles de lectura son bajos, tanto en términos cuantitativos como cualitativos. Existe, además, un consenso respecto de la importancia de la habilidad y el hábito de lectura tanto para el individuo como para la sociedad y la economía. El presente trabajo tiene como objetivo analizar los factores que afectan el nivel de lectura de libros en Chile. Para ello, se revisa el rol que desempeña la l...

  20. Magnetic AP Stars in the Hertzsprung-Russell Diagram

    Science.gov (United States)

    Hubrig, S.; North, P.; Mathys, G.

    2000-08-01

    The evolutionary state of magnetic Ap stars is rediscussed using the recently released Hipparcos data. The distribution of the magnetic Ap stars of mass below 3 Msolar in the H-R diagram differs from that of the normal stars in the same temperature range at a high level of significance. Magnetic stars are concentrated toward the center of the main-sequence band. This is shown in two forms of the H-R diagram: one where logL is plotted against logTeff and a version more directly tied to the observed quantities, showing the astrometry-based luminosity (Arenou & Luri) against the (B2-G)0 index of Geneva photometry. In particular, it is found that magnetic fields appear only in stars that have already completed at least approximately 30% of their main-sequence lifetime. No clear picture emerges as to the possible evolution of the magnetic field across the main sequence. Hints of some (loose) relations between magnetic field strength and other stellar parameters are found: stars with shorter periods tend to have stronger fields, as do higher temperature and higher mass stars. A marginal trend of the magnetic flux to be lower in more slowly rotating stars may possibly be seen as suggesting a dynamo origin for the field. No correlation between the rotation period and the fraction of the main-sequence lifetime completed is observed, indicating that the slow rotation in these stars must already have been achieved before they became observably magnetic. Based on data from the ESA Hipparcos satellite and on observations collected at the European Southern Observatory (La Silla, Chile; ESO programs Nos. 43.7-004, 44.7-012, 49.7-030, 50.7-067, 51.7-041, 52.7-063, 53.7-028, 54.E-0416, and 55.E-0751), at the Observatoire de Haute-Provence (Saint-Michel l'Observatoire, France), at Kitt Peak National Observatory, and at the Canada-France-Hawaii Telescope.

  1. Multiplicity of rapidly oscillating Ap stars

    CERN Document Server

    Schoeller, M; Hubrig, S; Kurtz, D W

    2012-01-01

    Rapidly oscillating Ap (roAp) stars have rarely been found in binary or higher order multiple systems. This might have implications for their origin. We intend to study the multiplicity of this type of chemically peculiar stars, looking for visual companions in the range of angular separation between 0.05" and 8". We carried out a survey of 28 roAp stars using diffraction-limited near-infrared imaging with NAOS-CONICA at the VLT. Additionally, we observed three non-oscillating magnetic Ap stars. We detected a total of six companion candidates with low chance projection probabilities. Four of these are new detections, the other two are confirmations. An additional 39 companion candidates are very likely chance projections. We also found one binary system among the non-oscillating magnetic Ap stars. The detected companion candidates have apparent K magnitudes between 6.8 and 19.5 and angular separations ranging from 0.23" to 8.9", corresponding to linear projected separations of 30-2400AU. While our study confi...

  2. Center for Geometrisk Metrologi CGM ApS, Årsberetning 2001 til DANAK

    DEFF Research Database (Denmark)

    De Chiffre, Leonardo

    Denne årsberetning omfatter CGM ApS' akkrediterede virksomhed i kalenderåret 2001. Årsberetningen er udarbejdet til DANAK (Dansk Akkreditering, Erhvervsfremme Styrelsen), som led i opfyldelsen af laboratoriets informationspligt i henhold til gældende regler (Teknisk Forskrift Nr. TF4 af 2000...

  3. Republic of Chile : Country Procurement Assessment Report

    OpenAIRE

    World Bank

    2004-01-01

    Chile's public procurement system is considered generally free of corruption, supported by probity of the civil servants, decentralization, and good budgetary and control systems. However, it is affected by deficiencies that the government recognizes, and is taking action to overcome, particularly with respect to procurement of goods and services. There is no unified comprehensive, and pub...

  4. DEZVOLTAREA CONTEMPORANĂ A TURISMULUI DIN CHILE

    Directory of Open Access Journals (Sweden)

    Maria-Mihaela Győri

    2011-01-01

    Full Text Available The contemporary development of the Chilean Tourism sector is analyzed mainly on thebasis of data supplied by the National Service of Tourism in Chile. Figures on inboundtourism, domestic tourism, lodging, employment, receipts, as well as the existing structurewithin the sector, were taken into consideration for the investigated period of 1999-2006.

  5. Statistical analysis of wind energy in Chile

    Energy Technology Data Exchange (ETDEWEB)

    Watts, David [Pontificia Universidad Catolica de Chile, Departamento de Ingenieria Electrica, Av. Vicuna Mackenna 4860, Macul, Santiago (Chile); The University of Wisconsin-Madison, 1415 Engineering Drive, WI-53706 (United States); Jara, Danilo [Pontificia Universidad Catolica de Chile, Departamento de Ingenieria Electrica, Av. Vicuna Mackenna 4860, Macul, Santiago (Chile)

    2011-05-15

    Bearing in mind the current and pressing need for an update of the existing Chilean power supply system - which has been remarkably influenced by new requirements - the search for new energy supply sources has become a top priority. The wind resource, vis-a-vis its associated mature technology features and its apparent availability throughout Chile, comes forward as a feasible option likely to play a more important role in any future national energy generation matrix. With a view to understanding the local wind resource, this document surveys a sample set of wind profiles available in the northern Chile area, thus becoming the first public survey of this kind. It also tackles theoretical energy production and capacity factors. Those became the basis of the wind modelling we undertook for Chile's participation in COP15. This paper shows wind generation is a suitable option for curbing down Greenhouse Gas Emissions (GHG) in Chile. (author)

  6. Upward trend for Chile; Andenstaat im Aufwind

    Energy Technology Data Exchange (ETDEWEB)

    Korneffel, Peter

    2010-03-15

    After an economic boom of 20 years, Chile may soon experience a change of paradigm in an economy based on renewable energy sources. Wind power is booming, and hydroelectric power is going strong as well. It will depend on the new government to see that the process of change continues. (orig.)

  7. Panteras e locas dissidentes: o ativismo queer em Portugal e Chile e suas tensões com o movimento LGBT

    OpenAIRE

    Colling, Leandro

    2014-01-01

    O texto realiza uma análise de dois coletivos de ativismo queer existentes em Portugal e Chile. Após retomar a história dos movimentos LGBT (Lésbicas, Gays, Bissexuais, Travestis, Transexuais e Transgêneros) e as suas principais conquistas, em especial em relação aos marcos legais, o artigo apresenta e analisa o ativismo queer do grupo Panteras Rosa e do Coletivo Universitário de Dissidência Sexual (CUDS). O objetivo é, ao demonstrar como esses grupos se diferenciam e entram em confronto com ...

  8. AP1000, a nuclear central of advanced design; AP1000, una central nuclear de diseno avanzado

    Energy Technology Data Exchange (ETDEWEB)

    Hernandez M, N.; Viais J, J. [ININ, 52045 Ocoyoacac, Estado de Mexico (Mexico)]. e-mail: nhm@nuclear.inin.mx

    2005-07-01

    The AP1000 is a design of a nuclear reactor of pressurized water (PWR) of 1000 M We with characteristic of safety in a passive way; besides presenting simplifications in the systems of the plant, the construction, the maintenance and the safety, the AP1000 is a design that uses technology endorsed by those but of 30 years of operational experience of the PWR reactors. The program AP1000 of Westinghouse is focused to the implementation of the plant to provide improvements in the economy of the same one and it is a design that is derived directly of the AP600 designs. On September 13, 2004 the US-NRC (for their initials in United States- Nuclear Regulatory Commission) approved the final design of the AP1000, now Westinghouse and the US-NRC are working on the whole in a complete program for the certification. (Author)

  9. Sistema de salud de Chile The health system of Chile

    Directory of Open Access Journals (Sweden)

    Víctor Becerril-Montekio

    2011-01-01

    Full Text Available En este trabajo se describe el sistema de salud de Chile, incluyendo su estructura, financiamiento, beneficiarios y recursos físicos, materiales y humanos de los que dispone. Este sistema está compuesto por dos sectores, público y privado. El sector público está formado por todos los organismos que constituyen el Sistema Nacional de Servicios de Salud y cubre aproximadamente a 70% de la población, incluyendo a los pobres del campo y las ciudades, la clase media baja y los jubilados, así como los profesionales y técnicos. El sector privado cubre aproximadamente a 17.5% de la población perteneciente a los grupos sociales de mayores ingresos. Un pequeño sector de la población, perteneciente a la clase alta, realiza pagos directos de bolsillo a proveedores privados de servicios de atención a la salud. Alrededor de 10% de la población está cubierta por otras agencias públicas, fundamentalmente los Servicios de Salud de las Fuerzas Armadas. Recientemente el sistema se reformó creando el Régimen General de Garantías en Salud, que establece un Sistema Universal con Garantías Explícitas que se tradujo, en 2005, en el Plan de Acceso Universal con Garantías Explícitas (AUGE, que garantiza el acceso oportuno a servicios de calidad para 56 problemas de salud, incluyendo cáncer en niños, cáncer de mama, trastornos isquémicos del corazón, VIH/SIDA y diabetes.This paper describes the Chilean health system, including its structure, financing, beneficiaries, and its physical, material and human resources. This system has two sectors, public and private. The public sector comprises all the organisms that constitute the National System of Health Services, which covers 70% of the population, including the rural and urban poor, the low middle-class, the retired, and the self-employed professionals and technicians.The private sector covers 17.5% of the population, mostly the upper middle-class and the high-income population. A small

  10. Formalistic approaches to A&P

    Institute of Scientific and Technical Information of China (English)

    赵倩

    2014-01-01

    A&P is a famous short story. Its simple words, the unique point of view and skillful writing technique are expressed successfully. Besides, the first-person narrator is also a good point. From Sammy’s eyes, readers can learn the character’s characteristics. Another point is the usage of symbol, the name of the store, A&P, it shows that people’s life is rich, but their spirit is barren. This article tries to analyze it by formalistic approaches.

  11. An analysis of AP600 design features

    Energy Technology Data Exchange (ETDEWEB)

    Park, Jong Kyoon; Jang, Moon Heui; Hwang, Yung Dong [Korea Atomic Energy Research Institute, Taejon (Korea, Republic of)] [and others

    1994-01-01

    In the aspect of engineering, passive safety system concept has improved the safety degree of nuclear power plant. Therefore, the objective of this study is to check on the possibility of the capacity upgrade of nuclear power plant in the case of adopting the passive safety system concept of AP 600. The characteristics of AP 600 are the advanced functions in ECCS, heat removal of containment building and residual heat removal under the passive safety system concept. The result of this study will become the basic data of capacity upgrade of nuclear power plant and will be widely used in second year project. (Author).

  12. Party Change in Chile in Comparative Perspective

    Directory of Open Access Journals (Sweden)

    Alan Angell

    2003-01-01

    Full Text Available Abstract This article looks at the changes in party systems generally in modern democracies, and argues that many trends observed internationally - growing mistrust of parties, growing electoral de-alignment - are also observed in Chile. Hence any analysis of party change in Chile has to take into account what is happening in other countries with well-established party systems. The article argues that the comparison with the past tends to be limited to the exceptional 1964-1973 period and that a more extended analysis points to many continuities in the Chilean party system. Competing arguments over whether there is new party cleavage in Chile based on the opposition between support for authoritarianism or support for democracy are also examined*.Resumen Este artículo estudia los cambios generales en los sistemas de partidos en las democracias modernas y argumenta que muchas de las tendencias que se observan internacionalmente -como el aumento en la desconfianza en los partidos, o desalineaciones electorales cada vez mayores- también se observan en Chile. De esta forma, cualquier análisis de cambios en el sistema de partidos de Chile tiene que considerar lo que está sucediendo en otros países con sistemas de partidos bien establecidos. El artículo postula que la comparación del sistema de partidos chileno con el pasado reciente tiende a estar limitado al período excepcional 1964-1973 y que un análisis más extendido implicaría muchas más continuidades de las esperadas. También se cuestiona las nuevas discusiones sobre si existe o no una nueva fisura partidaria, basada en la oposición entre el apoyo y rechazo al sistema autoritario, o el apoyo a la democracia.

  13. 2000 Johnston Site 3A-P

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Underwater Site 3A-P was established at Johnston Atoll by Dr. James Maragos, U.S. Fish & Wildlife Service, on July 3, 2000. With a start point (meter 0) at...

  14. 2000 Johnston Site 1A-P

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Underwater Site 1A-P was established at Johnston Atoll by Dr. James Maragos, U.S. Fish & Wildlife Service, on June 29, 2000. With a start point (meter 0) at...

  15. 2000 Johnston Site 2A-P

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Underwater Site 2A-P was established at Johnston Atoll by Dr. James Maragos, U.S. Fish & Wildlife Service, on June 30, 2000. With a start point (meter 0) at...

  16. 2006 Johnston Site 1A-P

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Underwater Site 1A-P was established at Johnston Atoll by Dr. James Maragos, U.S. Fish & Wildlife Service, on June 29, 2000. With a start point (meter 0) at...

  17. Structuring the AP Art History Course

    Science.gov (United States)

    Herscher, Walter R.

    2013-01-01

    While AP (Advanced Placement) Art History may be taught within the art department in many schools, social studies teachers are equally capable of teaching the course well. They have the historical background to discuss the reasons for changes in art styles. A teacher's preparation is similar to teaching a course stressing political history,…

  18. Barron's AP English literature and composition

    CERN Document Server

    Ehrenhaft EdD, George

    2016-01-01

    Includes five full-length practice AP exams with all questions answered and explained. Also features additional reviews on poetry, fiction, and drama, definitions of 175 literary and rhetorical terms, and more. Can be purchased alone or with an optional CD-ROM with two additional practice tests.

  19. Two Successful Approaches to Teaching AP Government

    Science.gov (United States)

    Ladd, Brian; Stepp, Heidi

    2013-01-01

    Amador Valley High School, in Pleasanton, California, uses two unique approaches to teaching Advanced Placement Government and Politics. AP Government consists of six units: Constitutional Underpinnings; Political Behavior and Political Beliefs; Mass Media, Interest Groups, and Political Parties; Institutions of Government; Civil Liberties and…

  20. Thermoluminescence properties of Chile Guajillo (paprika) Mexicano

    Energy Technology Data Exchange (ETDEWEB)

    Kitis, G. [Nuclear Physics Laboratory, Aristotle University of Thessaloniki, Thessaloniki 54124 (Greece)]. E-mail: gkitis@auth.gr; Cruz Zaragoza, E. [Institute of Nuclear Science, UNAM, PO Box 70-753, Mexico DF (Mexico); Furetta, C. [Physics Department, University La Sapienza, P.le A. Moro 2. 00187 Rome (Italy)

    2005-08-01

    The thermoluminescence properties of the inorganic dust extracted from the Chile Guajillo (paprika) Mexicano, were studied in order to verify the possibility of using the TL technique to discriminate between irradiated and non irradiated peppers. The inorganic dust was found to consist of quartz 60%, albite (NaAlSi{sub 3}O{sub 8}) 30%, and ortose (KAlSi{sub 3}O{sub 8}) 10%. Its thermoluminescence dose response covers the wide dose range of 1Gy-10kGy, which was attributed mainly to feldspars. Its high sensitivity and its stability over 10 irradiation-readout cycles allow the application of a single grain-single aliquot regeneration dosimetry in Chile Guajillo (paprika). Evaluations based on trapping parameters show that thermal fading at room temperature for glow-peaks above 180 deg.. C, is not a problem in the dosimetry of paprika.

  1. AE8/AP8 Implementations in AE9/AP9, IRBEM, and SPENVIS

    Science.gov (United States)

    2014-02-18

    period applies to orbit generation only; AE8/AP8 utilizes geomagnetic field models from other epochs as specified in the table below.) SHIELDOSE2 model...Cain, J. C., S. J. Hendricks, R. A. Langel, and W. V. Hudson (1967), A proposed model for the international geomagnetic reference field, 1965, J...trapped particle fluxes with the NASA models AP-8 and AE-8, Radiat. Meas., 26, pp. 947-952. International Association of Geomagnetism and Aeronomy

  2. Soviet Policy in Cuba and Chile.

    Science.gov (United States)

    1980-05-06

    document dated June 30, 1973, instructing all Communist Party members in Santiago to secure arms and to evacuate the upper class barrio alto in case of...loans. (Other reports indicated a figure of $100 million.) It was also announced in Santiago that the Soviet Union had granted $108 million for long-term...Chile at Rojo, Santiago : Universidad Tecnica del Estado, 1971. See also Luis Corvalan, El Camino de Victoria, Santiago : Impresova Horizonte, 1971, pp

  3. Volby v Chile 2009

    OpenAIRE

    2010-01-01

    Twenty years has passed from dissolution of authoritarian regime of Augusto Pinochet and in the presidential election 2009/2010 in Chile the right-wing candidate won. The era of continuous government of centre-leftist coalition, that administrated country from the period of transition, was ended off. The thesis focuses on the analysis of presidential and parliamentary elections, in the first place on the question what was the matter of triumph of the opposite candidate in the presidential ele...

  4. Tackling Social Exclusion: Evidence from Chile

    OpenAIRE

    2014-01-01

    This paper studies an innovative welfare program in Chile that combines a period of frequent home visits to households in extreme poverty, with guaranteed access to social services. Program impacts are identified using a regression discontinuity design, exploring the fact that program eligibility is a discontinuous function of an index of family income and assets. The analysis finds strong and lasting impacts of the program on the take-up of subsidies and employment services. These impacts ar...

  5. Comparative analysis between radiographic views for knee osteoarthrosis (bipedal AP versus monopedal AP

    Directory of Open Access Journals (Sweden)

    Rodrigo Pires e Albuquerque

    2013-08-01

    Full Text Available OBJECTIVE: A comparative analysis by applying the criteria of the original classification Ahlbäck in the anteroposterior (AP bipedal knee in extension and anteroposterior (AP monopodal knee in symptomatic knee arthrosis. With this analysis we intend to observe the agreement, any advantage or difference between the incidence and degree of joint involvement between the orthopedic surgeons and radiologists with the referring physician. METHODS: From January 2012 to March 2012, was a prospective study of 60 symptomatic arthrosis knees (60 patients, clinically selected group of outpatient knee and radiographic proposals submitted to the search. Of the 60 patients, 39 were female and 21 male, mean age 64 years (ranging from 50 to 84 years. Of the 60 knees studied, 37 corresponded to the right side and 23 on the left side. Statistical analysis was performed by Kappa statistics, which evaluates the interobserver agreement for qualitative data. RESULTS: According to the scale of Ahlbäck, there was a significant agreement (p < 0.0001 intra-observer in the classification of knee osteoarthritis among the five evaluators. There was a significant agreement (p < 0.0001 with inter-observer referring physician in the incidence of AP monopodal and AP bipedal for the four raters. CONCLUSION: The study found no difference between the incidence in the AP monopodal versus AP bipedal in osteoarthritis of the knee.

  6. The epidemiology of tuberculosis in Chile.

    Science.gov (United States)

    1985-01-01

    Chile's tuberculosis morbidity notification statistics suggest that there has been a 3% average annual decrease in tuberculosis cases in the last 5 years (1978-82). In addition, over the period 1974-83, there was a 50% decline in the number of deaths from tuberculosis. In 1982, there were 6941 recorded cases of tuberculosis in Chile, only 6.5% of which involved children under 15 years of age; in that same year, there were 984 deaths from tuberculosis, 14.4% of which occurred in children. The majority of cases reported (78%) involve pulmonary tuberculosis. Over 90% of children under 15 years of age are covered by Bacille Calmette-Guerin (BCG) vaccination. This was achieved by immunizing 91% of all newborns, 83% of children in their first year of school, and 98% of those in their final year. Laboratories capable of case-finding now cover 95% of Chile's total area. Since 1975, an average of 47 bacilloscopies have been performed per 1000 consultations. Abandonment of treatment has been reduced to 12% and fewer than 20% of cases require hospitalization. Finally, the introduction of shortened rifampicin treatment has reduced the case-fatality rate from 6% to 3%.

  7. Registro nuevo de Amphipyrinae en Chile A new record of Amphipyrinae from Chile

    Directory of Open Access Journals (Sweden)

    Tania S. Olivares

    2006-12-01

    Full Text Available Se registra por primera vez en Chile la especie Agrotisia subhyalina Hampson, entre las latitudes 18° 29' S 70° 20' O hasta 29° 54' S 71° 16' O (I-IV regiones en Chile. Se redescriben los genitales del macho y de la hembra y se presentan algunos aspectos taxonómicos de la especie.The species Agrotisia subhyalina Hampson is recorded for the first time from Chile (18° 29' S 70° 20' W to 29° 54' S 71° 16' W, I to IV Chilean regions. Redescriptions of male and female are presented, along with some taxonomic aspects of the species.

  8. AP stars with resolved Zeeman split lines

    Science.gov (United States)

    Mathys, G.

    1990-06-01

    High-resolution, high SNR observations of a sample of sharp-lined A stars and of Ap stars showing resolved Zeeman split lines are presented. The Fe II lines 6147.7 A and 6149.2 A unexpectedly appear to be asymmetric in all stars where they are resolved. The blue component of the 6149.2 line, which is a Zeeman doublet, is deeper and narrower than its red component. For line 6147.7, whose Zeeman pattern does not differ much from a quadruplet, the red components are deeper than the blue ones. It is shown that a partial Paschen-Back effect can account for these properties. The potential implications of this finding for studies of magnetic Ap stars are discussed.

  9. Final report for tank 241-AP-108, grab samples 8AP-96-1, 8AP-96-2 and 8AP-96-FB

    Energy Technology Data Exchange (ETDEWEB)

    Esch, R.A.

    1996-04-19

    This document is the final report deliverable for the tank 241-AP-108 grab samples. The samples were subsampled and analyzed in accordance with the TSAP. Included in this report are the results for the Waste Compatibility analyses, with the exception of DSC and thermogravimetric analysis (TGA) results which were presented in the 45 Day report (Part 2 of this document). The raw data for all analyses, with the exception of DSC and TGA, are also included in this report.

  10. An Updated AP2 Beamline TURTLE Model

    Energy Technology Data Exchange (ETDEWEB)

    Gormley, M.; O' Day, S.

    1991-08-23

    This note describes a TURTLE model of the AP2 beamline. This model was created by D. Johnson and improved by J. Hangst. The authors of this note have made additional improvements which reflect recent element and magnet setting changes. The magnet characteristics measurements and survey data compiled to update the model will be presented. A printout of the actual TURTLE deck may be found in appendix A.

  11. Using DCAT-AP for research data

    OpenAIRE

    PEREGO ANDREA; FRIIS-CHRISTENSEN Anders; VACCARI LORENZINO; TSINARAKI CHRYSI

    2016-01-01

    This paper outlines a set cross-domain requirements for the documentation of scientific data, identified during the development of the corporate data catalogue of the European Commission's Joint Research Centre (JRC). In particular, we illustrate how we have extended the DCAT application profile for European data portals (DCAT-AP) to accomodate requirements for scientific datasets, and we discuss a number of issues still to be addressed.

  12. Cultural Diversity in AP Art History

    Science.gov (United States)

    Bolte, Frances R.

    2006-01-01

    Teaching AP Art History is like running on a treadmill that is moving faster than a teacher can run. Many teachers are out of breath before the end of the term and wonder how in the world they can cover every chapter. Because time is short and art from pre-history through to the present, including the non-European traditions, must be covered, this…

  13. Perú-Chile: imágenes mutuas (Perú-Chile: mutual images

    Directory of Open Access Journals (Sweden)

    Álvaro González Riesle

    2014-06-01

    Full Text Available RESUMEN: A partir de los enfoques sobe Expansionismo-Revanchismo de Elizondo y las Imágenes en Espejo de Scott, se analizaron los contenidos de blogs referentes a imágenes mutuas entre Perú y Chile, comprendidos a partir de la fecha (16-01-2008 de presentación por parte del Perú de la Demanda ante el Tribunal de la Haya para la solución del Diferendo Limítrofe con Chile, hasta el 30-03-2011. Se han registrado intensas y variadas manifestaciones de hostilidad mutua, que respaldan la vigencia de la dinámica Expansionismo-Revanchismo en las imágenes mutuas entre Chile y Perú en los blogs analizados. Paralelamente, se detectaron contenidos correspondientes a actitudes integracionistas entre ambos países. Los resultados fundamentan la utilidad del enfoque de las Imágenes en Espejo como instrumento para el análisis de contenido de blogs portadores de mensajes de hostilidad e integración entre ambos países. Se propone una estrategia psicosocial binacional para desactivar la dinámica Expansionismo- revanchismo que contribuiría a producir catastróficas consecuencias para las generaciones actuales y futuras de ambos países; y, promover la integración fronteriza entre Tacna (Perú y Arica (Chile. ABSTRACT: The contents of blogs relating to mutual images between Peru and Chile were analyzed from the approaches about Expansionism – Revanchism of Elizondo, and The images on the mirror of Scott, included the date of the presentation (January 16th, 2008 by Peru of the demand before the International Court of Justice at the Hague for the solution of the border dispute with Chile until March 30th, 2011. There have been intense and varied manifestations of mutual hostility that support the validity of Expansionism-Revanchism dynamics in the mutual images between Chile and Peru in the analyzed blogs. At the same time, it was detected content corresponding to integrationist attitudes between the two countries. The results underlie the utility

  14. Task Force on Catastrophic Antiphospholipid Syndrome (APS) and Non-criteria APS Manifestations (II): thrombocytopenia and skin manifestations.

    Science.gov (United States)

    Cervera, R; Tektonidou, M G; Espinosa, G; Cabral, A R; González, E B; Erkan, D; Vadya, S; Adrogué, H E; Solomon, M; Zandman-Goddard, G; Shoenfeld, Y

    2011-02-01

    The objectives of the 'Task Force on Catastrophic Antiphospholipid Syndrome (APS) and Non-criteria APS Manifestations' were to assess the clinical utility of the international consensus statement on classification criteria and treatment guidelines for the catastrophic APS, to identify and grade the studies that analyze the relationship between the antiphospholipid antibodies and the non-criteria APS manifestations, and to present the current evidence regarding the accuracy of these non-criteria APS manifestations for the detection of patients with APS. This article summarizes the studies analyzed on thrombocytopenia and skin manifestations, and presents the recommendations elaborated by the Task Force after this analysis.

  15. Presence of Arctotherium (Carnivora, Ursidae, Tremarctinae in a pre-cultural level of Baño Nuevo-1 cave (Central Patagonia, Chile

    Directory of Open Access Journals (Sweden)

    López Mendoza, P.

    2015-12-01

    Full Text Available The description of an I3 assigned to Arctotherium sp. obtained from the Baño Nuevo-1 site (Central Patagonia, Chile is presented. The finding was recovered from Layer 5 and it is associated to Macrauchenia sp., Lama guanicoe, Felidae, Camelidae, Equidae and Mylodontidae, within a sterile deposit of cultural material, dated between ca. 13.500 and 11.200 BP. Despite the fact that it is only a single specimen, such finding extends the known distribution for the genus in Chile.Se presenta la descripción de un I3 asignado a Arctotherium sp. proveniente del sitio Baño Nuevo-1 (Patagonia Central, Chile. El hallazgo fue realizado en la Capa 5 y está asociado a restos de Macrauchenia sp., Lama guanicoe, Felidae, Camelidae, Equidae y Mylodontidae dentro de un depósito estéril de material cultural, datado entre los ca. 13.500 y 11.200 años AP. Aunque se trata de un único espécimen, amplía el rango de distribución conocido para este género en Chile.

  16. AIRE variations in Addison's disease and autoimmune polyendocrine syndromes (APS)

    DEFF Research Database (Denmark)

    Bøe Wolff, A S; Oftedal, B; Johansson, S

    2008-01-01

    Autoimmune Addison's disease (AAD) is often associated with other components in autoimmune polyendocrine syndromes (APS). Whereas APS I is caused by mutations in the AIRE gene, the susceptibility genes for AAD and APS II are unclear. In the present study, we investigated whether polymorphisms...... or copy number variations in the AIRE gene were associated with AAD and APS II. First, nine SNPs in the AIRE gene were analyzed in 311 patients with AAD and APS II and 521 healthy controls, identifying no associated risk. Second, in a subgroup of 25 of these patients, AIRE sequencing revealed three novel...... polymorphisms. Finally, the AIRE copy number was determined by duplex quantitative PCR in 14 patients with APS I, 161 patients with AAD and APS II and in 39 healthy subjects. In two Scandinavian APS I patients previously reported to be homozygous for common AIRE mutations, we identified large deletions...

  17. ¿Es Chile un país católico? Polémica en torno a un libro del padre Hurtado

    Directory of Open Access Journals (Sweden)

    P. Pedro Espinosa Santander

    2005-01-01

    Full Text Available Cuando a fines de 1941 el Padre Alberto Hurtado publicó su libro "¿Es Chile un País Católico?", invitaba especialmente a los jóvenes de la Acción Católica a conocer el país real: ¿cómo era de verdad Chile y su Iglesia? Alberto Hurtado con su mirada de apóstol miró a Chile desde la mirada de Jesús y remeció conciencias e incomodó a muchos con su denuncia de los males que corroían el alma nacional: miseria, injusticias, vicios, salarios miserables, falta de educación del pueblo, viviendas indignas, y junto con esto, la lejanía de los pobres de la Iglesia y la escasez de sacerdotes. Para él había una tarea pendiente que muchos esquivaban: conquistar Chile para Cristo. El libro y la invitación fueron acogidos con gran entusiasmo, por los jóvenes especialmente; pero las cr��ticas arreciaron de parte del clero y laicado conservadores. Para ellos, la visión de Hurtado era peligrosamente amarga y desconocía la labor que la Iglesia, desde la Colonia, hacía en el país formando el "alma de Chile". La polémica de fondo era una sorda crítica a Hurtado, asesor nacional de los jóvenes de la Acción Católica. El artículo muestra la polémica en torno al libro y a su autor, los diferentes actores que intervinieron y la significación eclesial de todo el proceso: ¿Era Chile un país católico?When at the end of 1941 Father Alberto Hurtado Publisher his book, "¿Es Chile un País Católico?" ("Is Chile a Catholic Country?", he especially invited the youth of Catholic Action (Acción Católica to become acquainted with the real country: What was Chile and its Church really like? Alberto Hurtado, with his characteristic view of an apostle, looked upon Chile with the gaze of Jesus and shook consciences, making many people uncomfortable with his condemnation of the evils corroding the national soul: the misery, injustices, vices, paltry salaries, lack of education, undignified living conditions and, together with all this, the

  18. Analysis list: CASP8AP2 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available CASP8AP2 Digestive tract + hg19 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/target/CAS...P8AP2.1.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/target/CASP8AP2.5.tsv http://dbarchive.bi...osciencedbc.jp/kyushu-u/hg19/target/CASP8AP2.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/colo/CAS

  19. Chile: Una Vision Politica, Economica y Social (Chile: A Political, Economic, and Social View).

    Science.gov (United States)

    Cortes-Hwang, Adriana

    1972-01-01

    This address seeks to explain in brief the historical background and political, economic, and social conditions leading to the democratic election of a Marxist president in Chile. A historical sketch of Chilean government from independence in 1810 is provided with a description of the situation just before Salvador Allende's election in 1969. Some…

  20. Chile, Latin America, and the Asia-Pacific Region

    Directory of Open Access Journals (Sweden)

    Manfred Wilhelmy

    2005-01-01

    Full Text Available Text of a presentation in the Colloquium Chile and the World, organized by the Princeton University Program in Latin American Studies, May 6, 2005, in honor of Professor Paul E.Sigmund. The views expressed have not been reviewed or endorsed by the Chile Pacific Foundation. Manfred Wilhelmy holds a Ph.D. in Politics (1973 from Princeton University

  1. Critical Perspectives on Adolescent Vocational Guidance in Chile

    Science.gov (United States)

    McWhirter, Ellen Hawley; McWhirter, Benedict T.

    2012-01-01

    In this article, the lens of critical psychology is applied to adolescent career development and vocational guidance in Chile. The authors describe and critique the status of adolescent vocational guidance in Chile, the reproduction of extant social inequities in Chilean education, and offer recommendations for enhancing vocational guidance…

  2. Honors in Chile: New Engagements in the Higher Education System

    Science.gov (United States)

    Skewes, Juan Carlos; Sampaio, Carlos Alberto Cioce; Conway, Frederick J.

    2012-01-01

    Honors programs are rare in Latin America, and in Chile they were unknown before 2003. At the Universidad Austral de Chile, an interdisciplinary group of scholars linked to environmental studies put forward a pilot project for implementing a new experience in higher education. Challenged by an educational environment where (i) apathy and…

  3. China and Chile Are to Be Free-Trade Partners

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    @@ In line with the words "We hope that Chile's Next Partner is China", Chile is believed to choose China as the new negotiation party of Free Trade Agreements after signing respectively free trade agreements with Canada, the United States, EU and ROK. On January 24, Chile's trade delegation composed of 20 members led by Kaiross Feirch, the Head of economy general department of the Ministry of Foreign Affairs paid the first visit to China to launch first five-day round of mutual trade negotiation.Kaiross Feirch, the Head of economy general department of the Ministry of Foreign Affairs of Chile and Barbirlo Kafuleirla, Chile's Ambassador to China received special visit of reporters about this round.

  4. AP600 containment purge radiological analysis

    Energy Technology Data Exchange (ETDEWEB)

    O`Connor, M.; Schulz, J.; Tan, C. [Bechtel Power Corporation (United States)] [and others

    1995-02-01

    The AP600 Project is a passive pressurized water reactor power plant which is part of the Design Certification and First-of-a-Kind Engineering effort under the Advanced Light Water Reactor program. Included in this process is the design of the containment air filtration system which will be the subject of this paper. We will compare the practice used by previous plants with the AP600 approach to meet the goals of industry standards in sizing the containment air filtration system. The radiological aspects of design are of primary significance and will be the focus of this paper. The AP600 Project optimized the design to combine the functions of the high volumetric flow rate, low volumetric flow rate, and containment cleanup and other filtration systems into one multi-functional system. This achieves a more simplified, standardized, and lower cost design. Studies were performed to determine the possible concentrations of radioactive material in the containment atmosphere and the effectiveness of the purge system to keep concentrations within 10CFR20 limits and within offsite dose objectives. The concentrations were determined for various reactor coolant system leakage rates and containment purge modes of operation. The resultant concentrations were used to determine the containment accessibility during various stages of normal plant operation including refueling. The results of the parametric studies indicate that a dual train purge system with a capacity of 4,000 cfm per train is more than adequate to control the airborne radioactivity levels inside containment during normal plant operation and refueling, and satisfies the goals of ANSI/ANS-56.6-1986 and limits the amount of radioactive material released to the environment per ANSI/ANS 59.2-1985 to provide a safe environment for plant personnel and offsite residents.

  5. Ozone mitigation tests at the APS

    Energy Technology Data Exchange (ETDEWEB)

    Kuzay, T.M.; Collins, J.T.; Pisharody, M.; Job, P.K.; Wang Zhibi

    1996-09-01

    Ozone is generated in the APS experimental stations whenever the x-ray beam has a chance to interact with air. Ozone concentrations in an experimental station have to be below a certain defined limit (current OSHA regulations specify 0.08 ppm as the maximum limit) before an experimenter can reenter the hutch. This limit is said to be currently under study for a downward adjustment. One method of depleting the ozone generated in an experimental station is mitigation through either adsorption or direct destruction. In recent tests, both methods were tried using commercially available units. Test results and some analytical predictions are presented.

  6. Wiley AP english language and composition

    CERN Document Server

    Woods, Geraldine

    2013-01-01

    Two full-length practice tests to help you score your highest Review questions with complete answers and explanations for the most popular themes on the test Study strategies and expert test-taking tips to keep you calm and focused on test day Review key exam topics and themes to maximize your score Preparing for the AP English Language and Composition test? This test-prep guide helps you perfect the skills you need to achieve your best possible score. You'll find winning test-taking tips, multiple-choice strategies, and essay guidelines, as well as great advice on getting the

  7. La atencion preescolar en Chile: desafios para la redemocratizacion (Preschool Care in Chile: Challenges for Redemocratization. Discussion Paper No. 13).

    Science.gov (United States)

    Filp, Johanna; Undurrage, Consuelo

    This paper examines the current status of programs for preschool children in Chile. Section 1 of the paper provides an overview of the situation of preschool children in Chile. The country's population includes more than 1.6 million children between the ages of 0 and 5 years 11 months, and in urban areas, 18.4 percent of children between the ages…

  8. Estudio del campo ocupacional del traductor en Santiago de Chile (A Study of Opportunities for Professional Translators in Santiago, Chile).

    Science.gov (United States)

    Cabrera, Ileana; And Others

    A study of translation as a profession in Chile covered two areas: a diagnostic study of the real need for literary, scientific, and technical translations, and a followup study of graduates of the translation degree program at the Catholic Pontifical University of Chile (Santiago). The analysis considered the relationship between the need for…

  9. The Death of Socialism in Chile

    Science.gov (United States)

    1992-06-05

    him to return. During his absence Chile was ruled by a junta lead by General Carlos Ibanez del Campo . Welcomed back in March 1925, Alessandri kept...dictatorship of Colonel (later General) Carlos Ibanez del Campo in 1931-32. The first two were the product of divisions within the political community; the last...the Investigaciones detachment, and tanks were lined up in front of the palace. At 1:30 P.M. shortly after the Air Force bombed the presidential palace

  10. Pobreza Multidimensional en Chile: 1990-2009

    OpenAIRE

    Claudia Sanhueza; Angela Denis; Francisca Gallegos

    2010-01-01

    Este trabajo presenta una propuesta de medición multidimensional de la pobreza para Chile. Siguiendo el enfoque conceptual de Amartya Sen, pobreza no es meramente insuficiencia de ingresos, sino se define como privación de capacidades para la realización de funcionamientos valiosos en la vida. Medimos carencias individuales en tres grupos de la población: niños, población económicamente activa y adultos mayores, y en cinco dimensiones: educación, salud, vivienda, empleo e ingresos. La justifi...

  11. EFECTOS DEL EMBARAZO ADOLESCENTE EN CHILE

    OpenAIRE

    LOYOLA HEUFEMANN, AMANDA

    2014-01-01

    Los efectos del embarazo adolescente en Chile han sido poco estudiados aun cuando existe diversa literatura para el resto del mundo, en especial para países desarrollados. Este trabajo estima el efecto del embarazo adolescente sobre la asistencia o completitud de la educación secundaria, años de escolaridad y participación laboral. Usando datos de corte transversal del a˜no 2012 y un enfoque de variable instrumental a trav´es del uso de la entrega comunal de la píldora anticoncept...

  12. Recent IBA setup improvements in Chile

    Energy Technology Data Exchange (ETDEWEB)

    Miranda, P.A. [Departamento de Fisica, Facultad de Ciencias, Universidad de Chile, Casilla 653, Santiago 1 (Chile)]. E-mail: pmiranda@fisica.ciencias.uchile.cl; Chesta, M.A. [Departamento de Fisica, Facultad de Ciencias, Universidad de Chile, Casilla 653, Santiago 1 (Chile); Cancino, S.A. [Departamento de Fisica, Facultad de Ciencias, Universidad de Chile, Casilla 653, Santiago 1 (Chile); Morales, J.R. [Departamento de Fisica, Facultad de Ciencias, Universidad de Chile, Casilla 653, Santiago 1 (Chile); Dinator, M.I. [Departamento de Fisica, Facultad de Ciencias, Universidad de Chile, Casilla 653, Santiago 1 (Chile); Wachter, J.A. [Departamento de Fisica, Facultad de Ciencias, Universidad de Chile, Casilla 653, Santiago 1 (Chile); Tenreiro, C. [Facultad de Ingenieria, Campus Curico, Universidad de Talca (Chile)

    2006-07-15

    This paper describes the main characteristics of the ion beam facility based on a 3.75 MeV Van de Graaff accelerator model KN3750 of HVE at University of Chile. Recent setup improvements on three beam lines available, one dedicated for PIXE analyzes, one designed for RBS-PESA analyzes and a multipurpose vacuum chamber, as well as beam energy calibration experiments of the accelerator will be summarized. Current research activities are focused on the application of the different IBA techniques for the material, biological and environmental analysis. In addition, nuclear activation analysis and the study of nuclear reactions of astrophysical interest has begun to be developed as basic research.

  13. 75 FR 10846 - The Chile Fund, Inc., et al.; Notice of Application

    Science.gov (United States)

    2010-03-09

    ... COMMISSION The Chile Fund, Inc., et al.; Notice of Application March 2, 2010. AGENCY: Securities and Exchange.... Applicants: The Chile Fund, Inc. (``Chile Fund''), Aberdeen Australia Equity Fund (``Australia Fund,'' together with the Chile Fund, the ``Current Funds''), Aberdeen Asset Management Asia Limited...

  14. The Electronic ApJ in Context

    Science.gov (United States)

    Biemesderfer, C. D.

    1995-12-01

    The on-line edition of the Astrophysical Journal provides the first opportunity for astronomical researchers to interact with the literature in a network context. Other electronic journals will follow. Astronomers will continue to develop ways to take advantage of information on the network, and these will be most effective when ApJ articles, observations from data centers, proposals for telescope time, communications with collaborators, and so on, are meshed. Astronomical literature, as a resource on the Internet, is not unique from the viewpoint of function or management, and astronomers are not unique as scholars in their desire to use the Internet as a tool to advance their work. We need to ensure as a community that all our resources for research --- journals and data --- fit in a global context on an Internet being used by everyone. In other words, we have to be sure that the ApJ fits into all the digital libraries of the future, including the ones we don't build. This paper will present a scenario in which many varied forms of information, astronomical and otherwise, can be catalogued and distributed so that they can be discovered and used by the research community.

  15. SN 2005ap: A Most Brilliant Explosion

    CERN Document Server

    Quimby, Robert M; Wheeler, J Craig; Höflich, Peter; Akerlof, Carl W; Rykoff, Eli S

    2007-01-01

    We present unfiltered photometric observations with ROTSE-III and optical spectroscopic follow-up with the HET and Keck of the most luminous supernova yet identified, SN 2005ap. The spectra taken about 3 days before and 6 days after maximum light show narrow emission lines (likely originating in the dwarf host) and absorption lines at a redshift of z=0.2832, which puts the peak unfiltered magnitude at -22.7 +/- 0.1 absolute. Broad P-Cygni features corresponding to H-alpha, CIII, NIII, and OIII, are further detected with a photospheric velocity of ~20,000 km/s. Unlike other highly luminous supernovae such as 2006gy and 2006tf that show slow photometric evolution, the light curve of SN 2005ap indicates a 1-3 week rise to peak followed by a relatively rapid decay. The spectra also lack the distinct emission peaks from moderately broadened (FWHM ~ 2,000 km/s) Balmer lines seen in SN 2006gy and SN 2006tf. We briefly discuss the origin of the extraordinary luminosity from a strong interaction as may be expected fro...

  16. [Reflections about the historical development of biomedical sciences in Chile and the role of Revista Médica de Chile: an homage on 130-years old].

    Science.gov (United States)

    Vargas Fernández, Luis

    2002-12-01

    When Revista Médica de Chile turns to be 130 years old, the author reflects about the difficulties that scientific and technological creativity faces in Chile, considering that there was a 70 years gap between its historical origin in Chile compared to developed countries. The scientific progress erases the boundaries between Biomedicine and science and technology. This progress has resulted in an improvement in the quality of scientific publications in Revista Medica de Chile. The editorial work has also contributed to this improvement. Revista Medica de Chile has obtained international recognition and stands in a good position as a medical journal in Latin America and Chile.

  17. Contributions to the mammalogy of Chile

    Science.gov (United States)

    Pine, Ronald H.; Miller, Sterling D.; Schamberger, Mel L.

    1979-01-01

    Collections of mammals were made during more than three years of biological investigations in Chile sponsored by the Corporación Nacional Forestal under the aegis of the Peace Corps (Smithsonian Environmental Program). Genera and species hitherto unreported for that country were taken and many useful data concerning distributional patterns of other (mostly little-known) species were gathered. These collections have also proved valuable in better understanding Chilean mammals from a taxonomic point of view and contribute knowledge of the species' natural history. Specimens are to be deposited in the (United States) National Museum of Natural History (USNM) or are to be retained by the Corporación Nacional Forestal, Avda, Bulnes 285, Depto. 401, Santiago. Numbers provided below are field numbers. A final division of specimens between the two institutions has not yet been made. A number of specimens reported here were not taken by Peace Corps personnel but have been obtained by the National Museum of Natural History from other sources. Specimens in the Field Museum of Natural History (FMNH) were used in making comparisons. Some of Fulk's (GWF) specimens are at Texas Tech University. Other are at the Servicio Agricola y Ganadero in Santiago (as are specimens of some introduced species taken by Schamberger). Reise's (DF) are at the Universidad de Chile-Concepción and in his personal collection.

  18. Silencio y memoria: Nocturno de Chile

    Directory of Open Access Journals (Sweden)

    Pedro Iniesta Ruiz

    2016-12-01

    Full Text Available El presente estudio, sostenido por el Trabajo de Fin de Grado Representación y ficción: Nocturno de Chile y Sostiene Pereira (2015, se introduce en la construcción literaria articulada en la obra Nocturno de Chile, de Roberto Bolaño, examinando y evaluando sus fronteras, fronteras que resultan tan movedizas como las de cualquier construcción inserta en el marco de la ficción. Las implicaciones históricas y políticas del relato hacen que su impronta testimonial cobre una fuerza inusitada, y nociones como la memoria, la violencia o el silencio ayudan a vertebrar una obra de arte verbal que logra, en el decurso de su propia narración, asediar al lector con las angustiosas imágenes de un pasado hecho presente en el camino de un tiempo político que se subyuga a la propia creación artística.

  19. Trichomonas vaginalis: the adhesins AP51 and AP65 bind heme and hemoglobin.

    Science.gov (United States)

    Ardalan, Shahed; Lee, B Craig; Garber, Gary E

    2009-04-01

    Trichomonas vaginalis is the cause of human trichomoniasis, the most common non-viral sexually transmitted disease worldwide. Although acquisition of iron by binding to host hemoglobin through distinct receptor(s) has been described, no specific heme- or hemoglobin-binding site has been reported in this parasite. To determine the presence of hemoglobin-binding protein(s), membrane proteins were subjected to hemoglobin-affinity chromatography. Eluted proteins were analysed by SDS-PAGE. Two protein bands of 48 and 63 kDa were detected. Competition assay with an excess amount of hemoglobin or hemin in hemoglobin-affinity chromatography could block the 63- and 48-kDa bands, respectively. Further analysis by mass spectrometry indicated that the 48- and 63-kDa proteins had identity with two T. vaginalis adhesins: AP51 and AP65, respectively. This study confirms the existence of multifunctional proteins in T. vaginalis, and suggested that AP51 and AP65, besides serving as adhesion molecules, could also act as heme- and hemoglobin-binding proteins.

  20. AP1000进度管理研究%The study on AP1000 Schedule management

    Institute of Scientific and Technical Information of China (English)

    李阳; 王飞鸣

    2015-01-01

    核电建设进度管理非常重要,本文针对核电站进度管理的内容、体系、管理方式等进行介绍,并结合AP1000核电技术的特点——模块化,分析其对进度管理的影响和目前存在的问题。并结合影响和问题提出了在后续AP1000建设进度管理中的几项建议。%Nuclear power plant construction progress management is very important. This paper addresses important topics including the content, system and manage methods of nuclear power plants construction. Combining the characteristics of AP1000 nuclear power technology-modular, the paper analyzed its impact on progress management and the existing problems. Depending on the impacts and problems, the paper also raised several suggestions in AP1000 modular construction.

  1. [The Vida Chile program: results and challenges with health promotion policy in Chile, 1998-2006].

    Science.gov (United States)

    Salinas, Judith; Cancino, Anselmo; Pezoa, Sergio; Salamanca, Fernando; Soto, Marina

    2007-01-01

    The Government of Chile has placed a high priority on health promotion. This is evident in the advances made through its National Plan for Health Promotion (Plan Nacional de Promoción de la Salud) and the Vida Chile National Council for Health Promotion (Consejo Nacional para la Promoción de la Salud Vida Chile). Chaired by the minister of health, Vida Chile is made up of 28 public and private institutions from around the country. Vida Chile has a network of local councils that have been established in the country's comunas (communes, or local-level divisions of the country's provinces) and that include government officials and representatives of local societal and community organizations and private businesses. This report details the methods used to evaluate the National Plan as well as provides a preliminary assessment of the technical and financial results for the 1998-2006 period. Coverage indicators (number of participants; number of accredited health-promoting schools, workplaces, and universities; and number of health promotion events) and the extent of strategy implementation were used to measure the success of the program. Health promotion activities grew markedly during this period. Among the notable accomplishments were the following four: (1) 98% of the communes now have their own community health promotion plan and intersectoral Vida Chile committee to implement the plan, (2) there has been an increase in societal and community groups involved in the health promotion strategies, (3) 34% of the primary and secondary schools have become accredited health-promoting schools, and (4) approximately 20% of the total population benefited directly from community-health-plan activities in 2006. The average per capita cost of the community health plans' activities in 2006 was US$ 6.60. The two most important factors that facilitated the operation of the local health promotion plans were participation by community and societal groups and having an adequate

  2. ESO and Chile: 10 Years of Productive Scientific Collaboration

    Science.gov (United States)

    2006-06-01

    ESO and the Government of Chile launched today the book "10 Years Exploring the Universe", written by the beneficiaries of the ESO-Chile Joint Committee. This annual fund provides grants for individual Chilean scientists, research infrastructures, scientific congresses, workshops for science teachers and astronomy outreach programmes for the public. In a ceremony held in Santiago on 19 June 2006, the European Organisation for Astronomical Research in the Southern Hemisphere (ESO) and the Chilean Ministry of Foreign Affairs marked the 10th Anniversary of the Supplementary Agreement, which granted to Chilean astronomers up to 10 percent of the total observing time on ESO telescopes. This agreement also established an annual fund for the development of astronomy, managed by the so-called "ESO-Chile Joint Committee". ESO PR Photo 21/06 ESO PR Photo 21/06 Ten Years ESO-Chile Agreement Ceremony The celebration event was hosted by ESO Director General, Dr. Catherine Cesarsky, and the Director of Special Policy for the Chilean Ministry of Foreign Affairs, Ambassador Luis Winter. "ESO's commitment is, and always will be, to promote astronomy and scientific knowledge in the country hosting our observatories", said ESO Director General, Dr. Catherine Cesarsky. "We hope Chile and Europe will continue with great achievements in this fascinating joint adventure, the exploration of the universe." On behalf of the Government of Chile, Ambassador Luis Winter outlined the historical importance of the Supplementary Agreement, ratified by the Chilean Congress in 1996. "Such is the magnitude of ESO-Chile Joint Committee that, only in 2005, this annual fund represented 8 percent of all financing sources for Chilean astronomy, including those from Government and universities", Ambassador Winter said. The ESO Representative and Head of Science in Chile, Dr. Felix Mirabel, and the appointed Chilean astronomer for the ESO-Chile Joint Committee, Dr. Leonardo Bronfman, also took part in the

  3. El Parque Portal Bicentenario en Santiago de Chile / Portal Bicentennial Park in Santiago de Chile

    Directory of Open Access Journals (Sweden)

    Beach Lobos, Myriam;

    2007-06-01

    Full Text Available Se presenta los principios que orientaron el diseño del Parque Portal Bicentenario, un parque de 50 hás. que será el eje principal de la nueva urbanización “Ciudad Parque Bicentenario”, actualmente en construcción en los terrenos del ex aeropuerto de Los Cerrillos en Santiago de Chile.The following text was submitted to the Architecture Competition together with the project drawings. It presents the principles that leaded the design. The 123 acres park will be the main axis of a new urban development in Santiago “Ciudad Parque Bicentenario” at present under construction on the area occupied by the former Cerrillos Airport, Santiago de Chile.

  4. Low Earth orbit assessment of proton anisotropy using AP8 and AP9 trapped proton models

    Science.gov (United States)

    Badavi, Francis F.; Walker, Steven A.; Santos Koos, Lindsey M.

    2015-04-01

    The completion of the International Space Station (ISS) in 2011 has provided the space research community with an ideal evaluation and testing facility for future long duration human activities in space. Ionized and secondary neutral particles radiation measurements inside ISS form the ideal tool for validation of radiation environmental models, nuclear reaction cross sections and transport codes. Studies using thermo-luminescent detectors (TLD), tissue equivalent proportional counter (TPEC), and computer aided design (CAD) models of early ISS configurations confirmed that, as input, computational dosimetry at low Earth orbit (LEO) requires an environmental model with directional (anisotropic) capability to properly describe the exposure of trapped protons within ISS. At LEO, ISS encounters exposure from trapped electrons, protons and geomagnetically attenuated galactic cosmic rays (GCR). For short duration studies at LEO, one can ignore trapped electrons and ever present GCR exposure contributions during quiet times. However, within the trapped proton field, a challenge arises from properly estimating the amount of proton exposure acquired. There exist a number of models to define the intensity of trapped particles. Among the established trapped models are the historic AE8/AP8, dating back to the 1980s and the recently released AE9/AP9/SPM. Since at LEO electrons have minimal exposure contribution to ISS, this work ignores the AE8 and AE9 components of the models and couples a measurement derived anisotropic trapped proton formalism to omnidirectional output from the AP8 and AP9 models, allowing the assessment of the differences between the two proton models. The assessment is done at a target point within the ISS-11A configuration (circa 2003) crew quarter (CQ) of Russian Zvezda service module (SM), during its ascending and descending nodes passes through the south Atlantic anomaly (SAA). The anisotropic formalism incorporates the contributions of proton narrow

  5. Low Earth orbit assessment of proton anisotropy using AP8 and AP9 trapped proton models.

    Science.gov (United States)

    Badavi, Francis F; Walker, Steven A; Santos Koos, Lindsey M

    2015-04-01

    The completion of the International Space Station (ISS) in 2011 has provided the space research community with an ideal evaluation and testing facility for future long duration human activities in space. Ionized and secondary neutral particles radiation measurements inside ISS form the ideal tool for validation of radiation environmental models, nuclear reaction cross sections and transport codes. Studies using thermo-luminescent detectors (TLD), tissue equivalent proportional counter (TPEC), and computer aided design (CAD) models of early ISS configurations confirmed that, as input, computational dosimetry at low Earth orbit (LEO) requires an environmental model with directional (anisotropic) capability to properly describe the exposure of trapped protons within ISS. At LEO, ISS encounters exposure from trapped electrons, protons and geomagnetically attenuated galactic cosmic rays (GCR). For short duration studies at LEO, one can ignore trapped electrons and ever present GCR exposure contributions during quiet times. However, within the trapped proton field, a challenge arises from properly estimating the amount of proton exposure acquired. There exist a number of models to define the intensity of trapped particles. Among the established trapped models are the historic AE8/AP8, dating back to the 1980s and the recently released AE9/AP9/SPM. Since at LEO electrons have minimal exposure contribution to ISS, this work ignores the AE8 and AE9 components of the models and couples a measurement derived anisotropic trapped proton formalism to omnidirectional output from the AP8 and AP9 models, allowing the assessment of the differences between the two proton models. The assessment is done at a target point within the ISS-11A configuration (circa 2003) crew quarter (CQ) of Russian Zvezda service module (SM), during its ascending and descending nodes passes through the south Atlantic anomaly (SAA). The anisotropic formalism incorporates the contributions of proton narrow

  6. Proximal femoral canal shape is more accurately assessed on AP hip radiographs than AP pelvis radiographs in primary hip osteoarthritis.

    Science.gov (United States)

    Merle, Christian; Waldstein, Wenzel; Gregory, Jennifer S; Goodyear, Simon R; Aspden, Richard M; Aldinger, Peter R; Murray, David W; Gill, Harinderjit S

    2013-01-01

    The objectives of the present study were to determine whether differences in the radiographic appearance of the of the proximal femoral canal exist on corresponding AP pelvis and AP hip radiographs, and whether radiographic assessment of canal shape is accurate with reference to computed tomography (CT). In a retrospective study, corresponding radiographs and CT scans of 100 consecutive patients with primary hip OA were evaluated. Active shape modelling (ASM) was performed to assess the variation in proximal femoral canal shape and to identify differences between AP hip and AP pelvis views. Differences in the medial cortical flare between radiographs and CT were quantified using least squares curve fitting. ASM identified significant differences in the assessment of canal shape on corresponding AP hip and AP pelvis views. Curve fitting demonstrated a good agreement between AP hip radiographs and CT. Agreement between AP pelvis radiographs and CT was less good. In contrast to AP pelvis radiographs, AP hip radiographs allow a more accurate and reliable assessment of proximal femoral canal shape in the frontal plane in primary hip OA. Our findings may improve stem fit in total hip arthroplasty without the routine use of CT.

  7. TRANSPARENCIA Y LEYES SECRETAS EN CHILE

    Directory of Open Access Journals (Sweden)

    Pablo Contreras V.

    2010-01-01

    Full Text Available El autor analiza el problema de constitucionalidad de las leyes secretas en Chile, en razón de las modificaciones introducidas a la Constitución en el 2005. Primero, describe brevemente el fundamento sobre la publicidad de la ley en el Estado Democrático. Luego, se analiza el nuevo principio constitucional de publicidad establecido en el artículo 8º de la Constitución. Adicionalmente, se examina la constitucionalidad de las leyes secretas desde dos puntos de vista: confrontando la compatibilidad con el principio general de transparencia -como base de la institucionalidad- y analizando la afectación en el contenido esencial del derecho fundamental de acceso a la información pública.

  8. Three halls for music performance in Chile

    Science.gov (United States)

    Delannoy, Jaime; Heuffemann, Carolina; Ramirez, Daniel; Galvez, Fernando

    2002-11-01

    The primary purpose of this work was to investigate about the present acoustic conditions of used architectonic spaces in Santiago of Chile for orchestras of classic music performance. The studied halls were three: Aula Magna Universidad de Santiago, Teatro Municipal de Nunoa, and Teatro Baquedano. The used methodology was based on studies made by L. Beranek, M. Barron, among others, in concert halls worldwide. As it guides, for the measurement procedure, physical parameters RT, EDT, C50, C80, LF, BR, G, U50 were evaluated according to norm ISO 3382. On the other hand, it has been defined, to proposal way, a questionnaire of subjective valuation directed to musicians, specialized conductors, and listeners.

  9. A DRONE FLIGHT OVER PARANAL, CHILE

    CERN Document Server

    2016-01-01

    Aerial clip (shot using a drone and a Go pro) describing ESO's astronomical observatory facilities in the Atacama desert, Northern Chile. Locations covered by the drone flight include Cerro Paranal, with the Residencia (external and internal views) and the Very Large Telescope facility on Cerro Paranal, from above and with a peek into Unit Telescope 1 and its 8,2 m diameter mirror; final image on Cerro Armazones, the site chosen for building ESO's next telescope, the E-ELT (European Extremely Large Telescope). With a 39-metre main mirror, it will be the largest optical/near-infrared telescope in the world. The Argentinian Codillera with the Llullaillaco volcano are visible in the background.

  10. Sobre lectura y escritura en Chile

    Directory of Open Access Journals (Sweden)

    Grínor Rojo

    2011-11-01

    Full Text Available Los estudios de los últimos años realizados en Chile sobre lectura, competencia de lectura y lectura de noticias sobre política, revelan valores negativos que rondan el 50. Estos datos, a los que se suman los cuarenta millones de analfabetos en América Latina, están en la base del rechazo en este artículo de la afirmación de la muerte del libro y de la frívola fe en el reemplazo del libro por el uso de las tecnologías de la información y la comunicación (llenar de computadoras las escuelas, insistiendo en cambio en atender seriamente a los lazos entre razón, libro y lectura en el desarrollo individual y de la sociedad

  11. Sobre lectura y escritura en Chile

    OpenAIRE

    Grínor Rojo

    2011-01-01

    Los estudios de los últimos años realizados en Chile sobre lectura, competencia de lectura y lectura de noticias sobre política, revelan valores negativos que rondan el 50. Estos datos, a los que se suman los cuarenta millones de analfabetos en América Latina, están en la base del rechazo en este artículo de la afirmación de la muerte del libro y de la frívola fe en el reemplazo del libro por el uso de las tecnologías de la información y la comunicación (llenar de computadoras las escuelas), ...

  12. Los valores del urbanismo en Chile

    Directory of Open Access Journals (Sweden)

    Waldo López Moya

    2015-04-01

    Full Text Available En el mes de junio de 2004 fue presentado al Senado de Chile un proyecto de ley destinado a modificar la Ley General de Urbanismo y Construcciones (LGUC, con el fin de adecuarla para permitir la formación y edificación de «áreas urbanas condicionadas» (AUC. Esto es, conjuntos residenciales urbanos, construidos fuera del límite urbano convencional. Unos, en áreas rurales ubicadas inmediatamente adyacentes al mismo, llamadas «áreas de extensión urbana condicionada» (AEUC, y otros, ubicados en áreas rurales segregadas, denominadas «áreas de desarrollo urbano condicionado» (ADUC.

  13. Improving the effectiveness of rural development policy in Chile

    NARCIS (Netherlands)

    Carter Leal, L.M.

    2016-01-01

    In Chile, agriculture remains a key economic factor for rural development. Accordingly, the Chilean government, through the Agricultural Development Institute (INDAP), provides financial support for fostering entrepreneurship among small farmers to enable them to become more competitive in global ma

  14. Project W-211, initial tank retrieval systems, description of operations for 241-AP-102 and 241-AP-104

    Energy Technology Data Exchange (ETDEWEB)

    RIECK, C.A.

    1999-02-25

    The primary purpose of the Initial Tank Retrieval Systems (ITRS) is to provide systems for retrieval of radioactive wastes stored in underground double-shell tanks (DSTS) for transfer to alternate storage, evaporation, pretreatment or treatment, while concurrently reducing risks associated with safety watch list and other DSTs. This Description of Operations (DOO) defines the control philosophy for the waste retrieval system for tanks 241-AP-102 (AP-102) and 241-AP-104 (AP-104). This DOO will provide a basis for the detailed design of the Retrieval Control System (RCS) for AP-102 and AP-104 and establishes test criteria for the RCS. The test criteria will be used during qualification testing and acceptance testing to verify operability.

  15. AP1000主系统先进性分析%The Progressiveness Analysis of the AP1000 Main System

    Institute of Scientific and Technical Information of China (English)

    李家杰

    2012-01-01

      本文总结了第三代先进非能动压水堆核电厂AP1000主系统的主要特点,对AP1000主系统的先进性进行了分析,核电厂主系统设计人员能够从该文中了解到 AP1000主系统与第二代核电厂主系统之间的差别。%  This paper summarizes the main features of the AP1000 main system of the third generation of advanced passive pressurized water reactor nuclear power plant , and analyzes the progressiveness of the AP1000 main system .From this paper, the main system designers of nuclear power factory can learn the difference between the second-generation nuclear power factory main system and AP1000 main system

  16. Chile: Political and Economic Conditions and U.S. Relations

    Science.gov (United States)

    2009-01-12

    Chile: Country Report,” Economist Intelligence Unit, December 2008. 32 Eva Vergara, “Bachelet Crea Comisión para Enfrenter Desempleo por Crisis...sexual and labor exploitation. The U.S. Department of State’s 2008 Trafficking in Persons (TIP) Report states that Chile does not fully comply with the...minimum standards for the elimination of trafficking because it’s statutory framework does not specifically prohibit labor trafficking. However

  17. Wirtschaftliche Stellung deutscher Unternehmen in Chile: Ergebnisse einer empirischen Analyse

    OpenAIRE

    Kassai, László B.

    2014-01-01

    Die Abschätzung der wirtschaftlichen Bedeutung deutscher Unternehmen in Chile anhand der Auswertung von 14 schriftlichen Interviews mit deutschen Tochtergesellschaften im Jahre 1987 ist der Inhalt dieses Beitrages. Die Einordnung erfolgt vor dem Hintergrund sowohl der wirtschaftlichen Situation der ganzen Region (Lateinamerika) als auch der industriellen Entwicklung in Chile bis 1987. Die Analyse kommt zum Schluß, daß die im Durchschnitt lang ansässigen Unternehmen a) eine rege Innovations...

  18. Genetic differentiation between 'Araucana' creole and 'Hampshire Down' sheeps in Chile

    Directory of Open Access Journals (Sweden)

    Silvana Bravo

    2015-03-01

    Full Text Available Genetic diversity studies in domestic animals allow evaluating genetic variation within and among breeds mainly for conservation purposes. In Chile exist isolated recovery programs, conservation and characterization of animal genetic resources, a consequence of which the vast majority of them have not been characterized, poorly used, and some of them have become extinct. The aim of this research was to determine genetic diversity and relationship between 'Araucana' creole and 'Hampshire Down' sheeps based on microsatellite markers; sheep breeds with similar phenotypic characteristics, raised in the south of Chile. A total of 64 'Araucana' sheep ('Araucana' from Freire, AF: 27, 'Araucana' from Padre Las Casas, AP: 10, 'Araucana' from Chol Chol, AC: 15, 'Araucana' from Villarrica, AV: 12 and 43 'Hampshire Down' sheep ('Hampshire' from Marchigue, HM: 18, 'Hampshire' from Valdivia, HV: 11, 'Hampshire' from San José, HS: 14 were analyzed using 17 microsatellite markers for determine the genetic diversity and relationship between breeds. A total of 284 alleles were observed with average polymorphic information content equal to 0.76, showing that the microsatellites panel used was highly informative. Estimated heterozygosity ranged from 0.73 in 'Hampshire Down' to 0.85 in 'Araucana'. The low inbreeding or endogamy coefficient (F IS, 0.022 and total inbreeding estimate (F IT, 0.070 indicated low level of inbreeding within and among breeds. The phylogenetic tree showed a separation between HS and HV, and the other sheep populations. The results indicated high genetic variability, low inbreeding, and low genetic differentiation, except for HV and HS, and were in according with geographical location and breeding practices.

  19. Top-up operation experience at APS.

    Energy Technology Data Exchange (ETDEWEB)

    Emery, L.

    1999-03-31

    The Advanced Photon Source (APS) is a 7-OeV, third-generation synchrotrons radiation source. To provide more stable beam for users, in September 1998 we began commissioning a new operating mode called ''top-up.'' In this mode, the beam current does not decay but is maintained at a high level using frequent injection, while photon shutters are open and photon beams are delivered to users. The hardware, software, and safety requirements for top-up will be reported. Safety issues related to injection with open photon shutters are covered in companion papers in this conference. Recent operational experience includes testing aspects of top-up injection and delivering beam to X-ray users for a few hours with fractional current stability of 10{sup {minus}3}. We expect to run several top-up operation shifts in Spring 1999. Issues of importance are orbit and emittance transients during the injection and scheduling of injection pulses for the convenience of users.

  20. Hippidion saldiasi Roth, 1899 (Mammalia, Perissodactyla en el Pleistoceno tardío de Calama, norte de Chile Late Pleistocene Hippidion saldiasi Roth, 1899 (Mammalia, Perissodactyla from Calama, northern Chile

    Directory of Open Access Journals (Sweden)

    MARÍA TERESA ALBERDI

    2007-06-01

    Full Text Available Se describen restos del género Hippidion procedentes de la zona del desierto de Atacama (Calama, Segunda Región de Chile. El conjunto analizado corresponde a un esqueleto bastante completo proveniente del yacimiento Betecsa 1, así como escasas unidades del yacimiento Kamac Mayu. En ambos sitios se identifica H. saldiasi. A partir de dos dataciones radiométricas por AMS del ejemplar estudiado, los restos se sitúan estratigráficamente en el Pleistoceno Superior (21.070 ± 100 AP y 21.380 ± 100 14C AP. Se infieren datos ambientales y de dieta a partir de análisis de isótopos estables en los restos de Hippidion saldiasi del sitio Betecsa 1 cuyo valor de δ13C en hueso fue de -15,45 y el valor en esmalte de dientes fue de -16,68, sugiriendo una alimentación con pastos C3. El cráneo recuperado es el primero conocido de esta especieThis paper describes the Hippidion bones recovered from the Atacama Desert (Calama, Second Region of Chile. The analyzed assemblage corresponds to a nearly complete skeleton from Betecsa 1 site and more poorly preserved remains from Kamac Mayu site. In both H. saldiasi is identified. Two 14C radiometric determinations indicate late Pleistocene age for these remains (21,070 ± 100 BP and 21,380 ± 100 BP. Environmental and diet inferences from stable isotope analysis are also presented. The δ13C value from Betecsa 1 horses (-15.45 from bone sample and -16.68 from enamel sample suggest a dietary adaptation exclusively C3 feeders. This is the first skull and associated skeleton recovered of this species

  1. AP233: An Information Model for Systems Engineering

    Science.gov (United States)

    Siebes, Georg

    2009-01-01

    In today's world, information is abundant. We have no problems generating it. But we are challenged to find, organize, and exchange information. center dot A standardized model of information can help. Such a model nearly completed its development for Systems Engineering. It is referred to as AP233 (AP = Application Protocol).

  2. APS extends open access to all its journals

    CERN Multimedia

    Thomas, Kim

    2006-01-01

    "Physics research promoter and publisher the American Physical Society (APS) is to extend open access to all its journals. Th APS previously made its five print journals available through subscriptions, and its two e-journals (Physical Review Special Topics and Physics Educatoin Research) on an open access basis." (1/2 page)

  3. A novel spotted fever group Rickettsia infecting Amblyomma parvitarsum (Acari: Ixodidae) in highlands of Argentina and Chile.

    Science.gov (United States)

    Ogrzewalska, Maria; Nieri-Bastos, Fernanda A; Marcili, Arlei; Nava, Santiago; González-Acuña, Daniel; Muñoz-Leal, Sebastián; Ruiz-Arrondo, Ignacio; Venzal, José M; Mangold, Atilio; Labruna, Marcelo B

    2016-04-01

    The tick Amblyomma parvitarsum (Acari: Ixodidae) has established populations in Andean and Patagonic environments of South America. For the present study, adults of A. parvitarsum were collected in highland areas (elevation >3500 m) of Argentina and Chile during 2009-2013, and tested by PCR for rickettsial infection in the laboratory, and isolation of rickettsiae in Vero cell culture by the shell vial technique. Overall, 51 (62.2%) out of 82 A. parvitarsum adult ticks were infected by spotted fever group (SFG) rickettsiae, which generated DNA sequences 100% identical to each other, and when submitted to BLAST analysis, they were 99.3% identical to corresponding sequence of the ompA gene of Rickettsia sp. strain Atlantic rainforest. Rickettsiae were successfully isolated in Vero cell culture from two ticks, one from Argentina and one from Chile. DNA extracted from the third passage of the isolates of Argentina and Chile were processed by PCR, resulting in partial sequences for three rickettsial genes (gltA, ompB, ompA). These sequences were concatenated and aligned with rickettsial corresponding sequences available in GenBank. Phylogenetic analysis revealed that the A. pavitarsum rickettsial agent grouped under high bootstrap support in a clade composed by the SFG pathogens R. sibirica, R. africae, R. parkeri, Rickettsia sp. strain Atlantic rainforest, and two unnamed SFG agents of unknown pathogenicty, Rickettsia sp. strain NOD, and Rickettsia sp. strain ApPR. The pathogenic role of this A. parvitarsum rickettsia cannot be discarded, since several species of tick-borne rickettsiae that were considered nonpathogenic for decades are now associated with human infections.

  4. Stratification in Ap star atmospheres: Simulations

    Science.gov (United States)

    Cowley, Charles R.; Castelli, Fiorella

    2017-01-01

    It is now well established that the atmospheres of Ap stars can be chemically stratified (cf. Babel, A\\&A 258, 645, 1992; Ryabchikova et al. A\\&A 384, 545, 2002). The most convincing cases have been made with the profiles of very strong lines, such as Ca II K. Weaker line profiles are less obvious indicators. The collective behavior of sets or groups of lines have also been used. For example, if higher abundances are derived for strong lines in an atmosphere with zero microturbulence, one may assume that the absorbing species has been pushed into the higher photospheres. An example are the medium-strong Mn II lines in HgMn stars. In this paper, we probe this assumption by calculating line strengths with various assumed stratification models, and then determining abundances from those lines using an {\\bf unstratified} model with the same Teff and log(g). We use the model from Castelli, Kurucz \\& and Hubrig (A\\&A, 508, 401, 2009) for HR 6000, whose spectrum shows numerous indications of stratification. A variety of stratification models are considered, for example, ones where the majority of an absorbing species is concentrated above (or below) $log(\\tau_{5000}$ = -2.0. Cloud models are also investigated, where a species is concentrated within a range of photospheric depths. Curves of growth are generated in unstratified atmospheres for lines by holding the abundance fixed, and increasing log(gf). Similar curves are made in stratified models, and the ratios of strong to weak linesare compared with and without stratification. The effects of stratification on ionization are also investigated, as well as on the profiles of strong lines. We find, in agreement with previous work, that severe abundance jumps are sometimes required to account for some of the observed peculiarities.

  5. La Medialuna: un edificio para Chile/The Crescent, a building for Chile

    Directory of Open Access Journals (Sweden)

    Moreira Recchione, Alberto

    2007-12-01

    Full Text Available Se refiere los antecedentes históricos sobre la escuela ecuestre de la jineta y su introducción en las faenas agrícola-ganaderas chilenas. Se reseña el nacimiento del rodeo como deporte nacional chileno y los requerimientos del complejo espacio de la “fiesta del rodeo”: un problema arquitectónico y también urbanístico./ The equestrian school of "La Jineta" in Chile, and the architecture for the national holiday of "rodeo."

  6. Social Networks and Political Parties in Chile

    Directory of Open Access Journals (Sweden)

    Adler Lomnitz, Larissa

    2002-09-01

    Full Text Available This paper describes the origin and evolution of two Chilean political parties (the Radical Party and the Christian Democrat Party through the analysis of the social networks that originated and composed them. The aim of this study is to propose a model of national political cultures on the basis of the structure of social networks related to power and of the symbol system, which legitimizes it. The structure of social networks, horizontal and vertical, are based on reciprocal or redistributive forms of exchange, on what is being exchanged and on the articulation between networks. In every society there are symmetrical and asymmetrical exchanges, which produce horizontal and vertical networks. These networks interact among themselves to form the social fabric. The dominance of some over others and how they combine, delineate the character of the political culture (authoritarian vs. egalitarian. Chile is a multiparty country within which there are cohorts of horizontal groups of friends, who informally exercise a central control over their members and create invisible boundaries setting them apart from others, in which leadership is under constrains. The result is both a strong presidential system based on an almost fanatic legitimacy, combined with factionalism and a strong parliamentary system.

  7. Macroeconomic fluctuations and bank behavior in Chile

    Directory of Open Access Journals (Sweden)

    Jorge E. Restrepo

    2008-03-01

    Full Text Available The purpose of this study is to analyze bank behavior in Chile over time, looking at how their balance sheets and performance move both in the short and long run, and how they react to macroeconomic shocks. The evolution of banking aggregates over an 18 year period (1989-2006, using quarterly data is examined. Techniques common in the real business cycle literature are applied to establish empirical patterns. Robustness tests using several filters are performed. The effects of macro shocks on banking variables are analyzed, both by means of an event study, and by estimating impulse responses with VARs. The results show that credit lags the cycle, demand deposits lead it, both being procyclical, while the capital adequacy ratio (CAR is countercyclical. In addition, a shock to interest rates reduces loans (total, commercial, consumption, and increases non performing loans (NPL and the capital adequacy ratio (CAR. A shock to GDP growth has a positive effect on loans, return over equity (ROE, and a negative impact on NPL and CAR.

  8. Financiamiento Solidario para Vivienda en Chile

    Directory of Open Access Journals (Sweden)

    Mauricio Rojas Mujica

    2007-01-01

    Full Text Available El Programa de Desarrollo Solidario (PDS del Banco del Desarrollo consiste en brindar apoyo financiero y formativo a mujeres de escasos recursos a lo largo de todo Chile, a través de un crédito solidario, sin ningún otro tipo de garantía que la confianza, la responsabilidad y la solidaridad. En este Programa se trabaja con grupos de al menos 8 mujeres de muy escasos recursos que no tienen acceso al sistema bancario tradicional por no contar con ingresos demostrables ni estables. El apoyo financiero se canaliza a través de créditos solidarios. El apoyo formativo consiste en un trabajo en forma previa al otorgamiento de los créditos y luego un seguimiento periódico del grupo, durante todo el periodo de reembolso del crédito. A la fecha, han participado en este programa más de 10.000 mujeres, estimándose que más de 6.000 de ellas han dedicado estos préstamos al mejoramiento de la calidad de su vivienda, movilizando en forma directa más de 2 millones de dólares.

  9. [Nutritive value of shellfish consumed in Chile].

    Science.gov (United States)

    Pak, N; Vera, G; Araya, H

    1985-03-01

    The purpose of the present study was to determine the protein quality and digestibility of shellfish commonly consumed in Chile, and to estimate its contribution to the protein needs of the Chilean population. The shellfish studied were chorito (Mytilus edulis chilensis), macha (Mesodesma donacium), loco (Concholepas concholepas), cholga (Aulacomya ater), erizo (Loxechinus albus) and almeja (no specific variety). The NPU method was used to determine protein quality. The percentage of protein adequacy for adult rations was calculated according to FAO/WHO 1973. The contribution of shellfish to the protein availability according to the family income of the Santiago population, was also calculated. Most of the shellfish presented NPU values of about 70; the lowest values were found for loco (54.9) and macha (63.3). The apparent and true digestibility gave an average of 83.6 and 90.4, respectively. The percentage of protein adequacy of habitual rations ranged between 27% (erizo) and 58% (loco). The availability of shellfish protein in relation to total protein increased from 0.4 to 2.5% when income increased. It is concluded therefore, that shellfish protein is, in general, of good quality. Nevertheless, it might be considered of poor influence insofar as fulfilling the protein needs of the population studied, whatever its socioeconomic level.

  10. [Mental health in Chile and Finland: Challenges and lessons].

    Science.gov (United States)

    Retamal C, Pedro; Markkula, Niina; Peña, Sebastián

    2016-07-01

    This article analyses and compares the epidemiology of mental disorders and relevant public policies in Chile and Finland. In Chile, a specific mental health law is still lacking. While both countries highlight the role of primary care, Finland places more emphasis on participation and recovery of service users. Comprehensive mental health policies from Finland, such as a successful suicide prevention program, are presented. Both countries have similar prevalence of mental disorders, high alcohol consumption and high suicide rates. In Chile, the percentage of total disease burden due to psychiatric disorders is 13% and in Finland 14%. However, the resources to address these issues are very different. Finland spends 4.5% of its health budget on mental health, while in Chile the percentage is 2.2%. This results in differences in human resources and service provision. Finland has five times more psychiatric outpatient visits, four times more psychiatrists, triple antidepressant use and twice more clinical guidelines for different psychiatric conditions. In conclusion, both countries have similar challenges but differing realities. This may help to identify gaps and potential solutions for public health challenges in Chile. Finland’s experience demonstrates the importance of political will and long-term vision in the construction of mental health policies.

  11. [The evolution theory in the medical sciences in Chile].

    Science.gov (United States)

    Cruz-Coke, R

    1994-02-01

    The evolutionist ideas of Lamarck, Darwin and Haeckel entered the country through the arrival of their books. "On the origin of Species" arrived in Chile in 1869. The most outstanding immigrant european physicians that discussed these ideas were Rodulfo A Phillippi (1808-1904) and Juan José Brunner (1825-1899). Both discussed Darwin's ideas in their books and conferences as academics of the Faculty of Medicine of the University of Chile. The first Chilean physicians that read and discussed the validity of evolution theory were Adolfo Valderrama (1834-1902) and Pedro Candia Salgado. Both wrote articles about this matter in Revista Médica de Chile in 1872 and 1874. The professor of general biology, Juan Noé Crevani, italian physician and zoologist that arrived in Chile in 1912, was the first to teach directly the concepts of the evolution theory until his death in 1947. Professor Noé founded the great biological school of the twentieth century in Chile and his disciples introduced the concepts of Mendelian theory and neodarwinism in the decade of fifties. The theory of evolution was taught as a chapter of general biology in the Faculty of Medicine between 1913 and 1947, but its practical applications to medicine were introduced with the birth of medical genetics in the decade of fifties and the foundation of Chilean Genetics society in 1964, under the direction of professors Danko Brncic and Gustavo Hoecker, both awarded with the National Sciences Prize.

  12. AP600 design certification thermal hydraulics testing and analysis

    Energy Technology Data Exchange (ETDEWEB)

    Hochreiter, L.E.; Piplica, E.J.

    1995-09-01

    Westinghouse Electric Corporation, in conjunction with the Department of Energy and the Electric Power Research Institute, have been developing an advanced light water reactor design; the AP600. The AP600 is a 1940 Mwt, 600Mwe unit which is similar to a Westinghouse two-loop Pressurized Water Reactor. The accumulated knowledge on reactor design to reduce the capital costs, construction time, and the operational and maintenance cost of the unit once it begins to generate electrical power. The AP600 design goal is to maintain an overall cost advantage over fossil generated electrical power.

  13. A new gap separation mechanism for APS insertion devices.

    Energy Technology Data Exchange (ETDEWEB)

    Trakhtenberg, E. M.; Tcheskidov, V.; Den Hartog, P. K.; Deriy, B.; Erdmann, M.; Makarov, O.; Moog, E. R.

    1999-10-25

    A new gap separation mechanism for use with the standard Advanced Photon Source (APS) 3.3-cm-period undulator magnetic structures has been designed and built and the first system has been installed in the APS storage ring. The system allows a minimum magnetic gap of 10 mm for use with the APS 8-mm insertion device vacuum chambers. The mechanism is a bolted steel frame structure with a simple 4-motor mechanical drive train. The control system uses servomotors with incremental rotary encoders and virtual absolute linear encoders.

  14. 75 FR 19658 - Preserved Mushrooms From Chile, China, India, and Indonesia; Determinations

    Science.gov (United States)

    2010-04-15

    ... (Second Review)] Preserved Mushrooms From Chile, China, India, and Indonesia; Determinations On the basis...)), that revocation of the antidumping duty orders on preserved mushrooms from Chile, China, India, and... (April 2010), entitled Preserved Mushrooms from Chile, China, India, and Indonesia: Investigation...

  15. 76 FR 65933 - Importation of Fresh Baby Kiwi From Chile Under a Systems Approach

    Science.gov (United States)

    2011-10-25

    ... Health Inspection Service 7 CFR Part 319 RIN 0579-AD37 Importation of Fresh Baby Kiwi From Chile Under a... United States of baby kiwi fruit from Chile, subject to a systems approach. Under this systems approach... baby kiwi from Chile using mitigation measures other than fumigation with methyl bromide....

  16. 75 FR 32901 - Notice of Determination of Pest-Free Areas in the Republic of Chile

    Science.gov (United States)

    2010-06-10

    ... Chile AGENCY: Animal and Plant Health Inspection Service, USDA. ACTION: Notice. SUMMARY: We are advising the public that we are recognizing an additional area of the Republic of Chile as a pest-free area for... the documentation submitted by the Republic of Chile, which we made available to the public review...

  17. CHILE: An Evidence-Based Preschool Intervention for Obesity Prevention in Head Start

    Science.gov (United States)

    Davis, Sally M.; Sanders, Sarah G.; FitzGerald, Courtney A.; Keane, Patricia C.; Canaca, Glenda F.; Volker-Rector, Renee

    2013-01-01

    Background: Obesity is a major concern among American Indians and Hispanics. The Child Health Initiative for Lifelong Eating and Exercise (CHILE) is an evidence-based intervention to prevent obesity in children enrolled in 16 Head Start (HS) Centers in rural communities. The design and implementation of CHILE are described. Methods: CHILE uses a…

  18. 7 CFR 319.56-23 - Apricots, nectarines, peaches, plumcot, and plums from Chile.

    Science.gov (United States)

    2010-01-01

    ... Chile. 319.56-23 Section 319.56-23 Agriculture Regulations of the Department of Agriculture (Continued... and Vegetables § 319.56-23 Apricots, nectarines, peaches, plumcot, and plums from Chile. (a... from Chile in accordance with this section and all other applicable provisions of this subpart. 3 3...

  19. 19 CFR 10.490 - Goods re-entered after repair or alteration in Chile.

    Science.gov (United States)

    2010-04-01

    ... Chile. 10.490 Section 10.490 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND... States-Chile Free Trade Agreement Goods Returned After Repair Or Alteration § 10.490 Goods re-entered after repair or alteration in Chile. (a) General. This section sets forth the rules which apply...

  20. 75 FR 22369 - Certain Preserved Mushrooms From Chile, India, Indonesia, and the People's Republic of China...

    Science.gov (United States)

    2010-04-28

    ... International Trade Administration Certain Preserved Mushrooms From Chile, India, Indonesia, and the People's... antidumping duty orders on certain preserved mushrooms (mushrooms) from Chile, India, Indonesia, and the... reviews of the antidumping duty orders on mushrooms from Chile, India, Indonesia, and the PRC, pursuant...

  1. 75 FR 3756 - Preserved Mushrooms from Chile, China, India, and Indonesia

    Science.gov (United States)

    2010-01-22

    ... TRADE COMMISSION Preserved Mushrooms from Chile, China, India, and Indonesia AGENCY: United States... duty orders on preserved mushrooms from Chile, China, India, and Indonesia. SUMMARY: The Commission... orders on preserved mushrooms from Chile, China, India, and Indonesia would be likely to lead...

  2. 77 FR 12903 - Suggestions for Environmental Cooperation Pursuant to the United States-Chile Environmental...

    Science.gov (United States)

    2012-03-02

    ... Suggestions for Environmental Cooperation Pursuant to the United States-Chile Environmental Cooperation Agreement ACTION: Notice of preparation of the 2012-2014 U.S.-Chile Environmental Cooperation Work Program... suggestions regarding items for inclusion in a new work program for implementing the U.S.-Chile...

  3. Effect of multifunctional protein YB-1 on the AP site cleavage by AP endonuclease 1 and tyrosyl phosphodiesterase 1

    Directory of Open Access Journals (Sweden)

    Ovchinnikov L. P.

    2012-07-01

    Full Text Available Apurinic/apyrimidinic sites (AP sites which represent one of the most abundantly generated DNA lesions in the cell are generally repaired by base excision repair (BER pathway. Multifunctional protein YB-1 is known to participate in cellular response to genotoxic stress and was shown to interact with several components of BER – DNA glycosylases NTH1, NEIL2, DNA polymerase and DNA ligase III. Therefore, it is of great interest to investigate the influence of YB-1 on one of the major BER enzymes, responsible for AP site cleavage, AP endonuclease APE1, and on tyrosyl phosphodiesterase Tdp1, participating in APE1 independent pathway of AP site repair. Aim. Effect of multifunctional protein YB-1 on the AP site cleavage by the activities of APE1 and Tdp1 was studied. Methods. Gel-mobility shift assays and enzyme activity tests. Results. YB-1 was shown to inhibit the cleavage of AP site located in single-stranded DNA by both APE1 and Tdp1. Stimulation of APE1 activity on protruding double-stranded DNA in the presence of YB-1 was observed, whereas no effect on Tdp1-mediated cleavage of AP site in double-stranded DNA was found. Conclusions. YB-1 can modulate the repair of AP sites in DNA by both positively stimulating APE1 during the classic BER of AP sites and avoiding a possible generation of doublestrand breaks, arising from the cleavage of single-stranded portion of DNA substrate already used by different DNA-processing pathway

  4. The Unexpected Awakening of Chaitén Volcano, Chile

    Science.gov (United States)

    Carn, Simon A.; Pallister, John S.; Lara, Luis; Ewert, John W.; Watt, Sebastian; Prata, Alfred J.; Thomas, Ronald J.; Villarosa, Gustavo

    2009-06-01

    On 2 May 2008, a large eruption began unexpectedly at the inconspicuous Chaitén volcano in Chile's southern volcanic zone. Ash columns abruptly jetted from the volcano into the stratosphere, followed by lava dome effusion and continuous low-altitude ash plumes [Lara, 2009]. Apocalyptic photographs of eruption plumes suffused with lightning were circulated globally. Effects of the eruption were extensive. Floods and lahars inundated the town of Chaitén, and its 4625 residents were evacuated. Widespread ashfall and drifting ash clouds closed regional airports and cancelled hundreds of domestic flights in Argentina and Chile and numerous international flights [Guffanti et al., 2008]. Ash heavily affected the aquaculture industry in the nearby Gulf of Corcovado, curtailed ecotourism, and closed regional nature preserves. To better prepare for future eruptions, the Chilean government has boosted support for monitoring and hazard mitigation at Chaitén and at 42 other highly hazardous, active volcanoes in Chile.

  5. Desigualdad Geográfica en Chile

    Directory of Open Access Journals (Sweden)

    Claudio A. Agostini

    2007-03-01

    Full Text Available Despite success in reducing poverty over the last twenty years, inequality in Chile has remained virtually unchanged, making Chile one of the least equal countries in the world. High levels of inequality have been shown to hamper further reductions in poverty as well as economic growth and local inequality has been shown to affect such outcomes as violence and health. The study of inequality at the local level is thus crucial for understanding the economic well-being of a country. Local measures of inequality have been difficult to obtain, but recent theoretical advances have enabled the combination of survey and census data to obtain estimators of inequality that are robust at disaggregated geographic levels. In this paper, we employ this methodology to produce consistent estimators of inequality for every county in Chile. We find a great deal of variation in inequality, with countylevel Gini coefficients ranging from 0.41 to 0.63.

  6. Globalization, Inequality, and Transnational Activism: A Case Study on Chile

    Directory of Open Access Journals (Sweden)

    Moctezuma Garcia

    2013-09-01

    Full Text Available Globalization has transformed how states are governed through a neoliberal economic approach that reinforces an unregulated capitalist market. An emphasis on Chile is important because it was the first state in Latin America to apply neoliberalism and has been hailed as a prime example for other developing states to integrate similar strategies to strengthen the local economy. However, inequality continues to persist despite economic gains. A combination of historical struggles affecting victims of the Pinochet era and present struggles with poverty, have resulted in a constant conflict between the power elite and the rest of society. Social movements in Chile have played a pivotal role in raising international awareness and pressuring the local government to protect the rights of highly vulnerable populations. A focus on transnational activism provides an effective medium for local and international advocates to work together toward holding Chile accountable for addressing social disparities.

  7. The Unexpected Awakening of Chaitén Volcano, Chile

    Science.gov (United States)

    Carn, Simon A.; Zogorski, John S.; Lara, Luis; Ewert, John W.; Watt, Sebastian; Prata, Alfred J.; Thomas, Ronald J.; Villarosa, Gustavo

    2009-01-01

    On 2 May 2008, a large eruption began unexpectedly at the inconspicuous Chaitén volcano in Chile's southern volcanic zone. Ash columns abruptly jetted from the volcano into the stratosphere, followed by lava dome effusion and continuous low-altitude ash plumes [Lara, 2009]. Apocalyptic photographs of eruption plumes suffused with lightning were circulated globally. Effects of the eruption were extensive. Floods and lahars inundated the town of Chaitén, and its 4625 residents were evacuated. Widespread ashfall and drifting ash clouds closed regional airports and cancelled hundreds of domestic flights in Argentina and Chile and numerous international flights [Guffanti et al., 2008]. Ash heavily affected the aquaculture industry in the nearby Gulf of Corcovado, curtailed ecotourism, and closed regional nature preserves. To better prepare for future eruptions, the Chilean government has boosted support for monitoring and hazard mitigation at Chaitén and at 42 other highly hazardous, active volcanoes in Chile.

  8. Tank characterization report for double shell tank 241-AP-104

    Energy Technology Data Exchange (ETDEWEB)

    Winkelman, W.D., Westinghouse Hanford

    1996-08-07

    This document summarizes the information on the historical uses, present status, and the sampling and analysis results of waste stored in Tank 241-AP-104. This report supports the requirements of Tri-Party Agreement Milestone M-44-09.

  9. A hot-spare injector for the APS linac.

    Energy Technology Data Exchange (ETDEWEB)

    Lewellen, J. W.

    1999-04-13

    Last year a second-generation SSRL-type thermionic cathode rf gun was installed in the Advanced Photon Source (APS) linac. This gun (referred to as ''gun2'') has been successfully commissioned and now serves as the main injector for the APS linac, essentially replacing the Koontz-type DC gun. To help ensure injector availability, particularly with the advent of top-up mode operation at the APS, a second thermionic-cathode rf gun will be installed in the APS linac to act as a hot-spare beam source. The hot-spare installation includes several unique design features, including a deep-orbit Panofsky-style alpha magnet. Details of the hot-spare beamline design and projected performance are presented, along with some plans for future performance upgrades.

  10. Lumbar pedicle screw placement: Using only AP plane imaging

    Directory of Open Access Journals (Sweden)

    Anil Sethi

    2012-01-01

    Conclusion: Placement of pedicle screws under fluoroscopic guidance using AP plane imaging alone with tactile guidance is safe, fast, and reliable. However, a good understanding of the radiographic landmarks is a prerequisite.

  11. Biogeografía marina de Chile continental Marine biogeography of continental Chile

    Directory of Open Access Journals (Sweden)

    PATRICIO A. CAMUS

    2001-09-01

    Full Text Available Por casi un siglo, varios autores han analizado los patrones de distribución de la fauna y flora marina del Pacífico de Sudamérica y de la costa de Chile en particular, con el propósito de establecer el número de las unidades biogeográficas presentes. Si bien los patrones generales actuales son relativamente bien conocidos, la mayoría de los estudios se ha enfocado en las discontinuidades distribucionales y en propuestas de clasificación más que en los factores y procesos dinámicos que han formado las unidades espaciales identificadas. Aun en el caso de las clasificaciones, las conclusiones publicadas se basan principalmente en el análisis de uno o pocos grupos seleccionados, y presentan diferencias importantes en los criterios de selección de los grupos, el número de especies involucrado y la metodología usada. Por otra parte, las discrepancias entre estudios específicos tienden a obscurecer un fenómeno relevante y de mayor escala como es la dinámica de las biotas, uno de los aspectos biogeográficos menos conocidos en Chile. En tal contexto, este trabajo presenta una revisión de literatura sobre la biogeografía marina de Chile y sus aspectos asociados, con los siguientes objetivos: (a resumir las características oceanográficas, climáticas y geomorfológicas de la costa continental de Chile; (b discutir 27 clasificaciones biogeográficas publicadas para la costa chilena, analizando los criterios y procedimientos usados por los autores, sus conclusiones principales, y la concordancia entre los estudios; (c evaluar los procesos dispersivos y vicariantes asociados a los desplazamientos y modificaciones de las biotas de la región, en función de los antecedentes disponibles sobre las condiciones existentes y los principales eventos ocurridos durante los períodos Terciario y Cuaternario; y (d proponer un escenario de cambio biogeográfico basado en determinantes históricas y su influencia en la formación, carácter y din

  12. Analysis and projections of physics in Chile

    Energy Technology Data Exchange (ETDEWEB)

    Soto, Leopoldo; Zambra, Marcelo [Comision Chilena de EnergIa Nuclear, Casilla 188D, Santiago (Chile); Loewe, Marcelo [Pontificia Universidad Catolica de Chile, Facultad de Fisica, Av. Vicuna Mackenna 4860, Santiago (Chile); Gutierrez, Gonzalo; Molina, Mario [Universidad de Chile, Facultad de Ciencias, Las Palmeras 3425, Nunoa, Santiago (Chile); Barra, Felipe; Lund, Fernando [Universidad de Chile, Facultad de Ciencias Fisicas y Matematicas, Av. Blanco Encalada 2008, Santiago (Chile); Saavedra, Carlos [Universidad de Conception, Departamento de Fisica, Esteban Iturra S/N, Barrio Universitario, Conception (Chile); Haberle, Patricio [Universidad Tecnica Federico Santa MarIa, Departamento de Fisica, Av. Espana 1680, Valparaiso (Chile)], E-mail: lsoto@cchen.cl

    2008-11-01

    In the present work, an assessment of the Physics research capacity in Chile is presented. For this, the period between 2000 and June 2005 has been studied. In this period almost 200 physicists have contributed to scientific production in terms of ISI publications. Amongst these 200, {approx}160 correspond to theoretical physicists and only {approx}40 to experimental physicists; {approx}178 are men and only {approx}22 are women. A more detailed analysis shows that {approx}160 physicists have at least one appearance in ISI publications per year considering the last 3 years. Ten years ago, a similar criteria (at least one appearance per year in ISI articles, considering mobile three-year periods), the number of active physicists in the Chilean community was estimated at 70. Therefore, the Chilean active physicists' community has doubled in 10 years. There exist 20 centres in which scientific research is developed: 18 university centres, a government institute and a private institute. As regards scientific productivity, both as related to disciplines or research areas, and well as in relation to research centres, it is found that, generally, scientific production, in a particular area in Physics or in a research centre, is directly related to the number of corresponding researchers; that is to say, the percentage of the national productivity in an area or research centre corresponds to its share in the total number of physicists in the country. A geographical analysis shows that 50% of the productivity corresponds to Santiago and 50% to the rest of the country. The impact of the different funds for research is assessed, also: FONDECYT, Presidential Chairs and large projects and centres of excellence. According to Physics researchers opinion, Fondo Nacional de Ciencia y TecnologIa (FONDECYT, National Fund fro Science and Technology) has become the best instrument to support researchi activities in Chile. However, the amount of projects awarded has practically not

  13. Roles of AP-2 in clathrin-mediated endocytosis.

    Directory of Open Access Journals (Sweden)

    Emmanuel Boucrot

    Full Text Available BACKGROUND: The notion that AP-2 clathrin adaptor is an essential component of an endocytic clathrin coat appears to conflict with recent observations that substantial AP-2 depletion, using RNA interference with synthesis of AP-2 subunits, fails to block uptake of certain ligands known to internalize through a clathrin-based pathway. METHODOLOGY/PRINCIPAL FINDINGS: We report here the use of in vivo imaging data obtained by spinning-disk confocal microscopy to study the formation of clathrin-coated structures at the plasma membranes of BSC1 and HeLa cells depleted by RNAi of the clathrin adaptor, AP-2. Very few clathrin coats continue to assemble after AP-2 knockdown. Moreover, there is a total absence of clathrin-containing structures completely lacking AP-2 while all the remaining coats still contain a small amount of AP-2. These observations suggest that AP-2 is essential for endocytic coated-pit and coated-vesicle formation. We also find that AP-2 knockdown strongly inhibits light-density lipoprotein (LDL receptor-mediated endocytosis, as long as cells are maintained in complete serum and at 37 degrees C. If cells are first incubated with LDL at 4 degrees C, followed by warming, there is little or no decrease in LDL uptake with respect to control cells. LDL uptake at 37 degrees C is also not affected in AP-2 depleted cells first deprived of LDL by incubation with either serum-starved or LDL-starved cells for 24 hr. The LDL-deprived cells display a significant increase in endocytic structures enriched on deeply invaginated tubes that contain LDL and we suggest that under this condition of stress, LDL might enter through this alternative pathway. CONCLUSIONS/SIGNIFICANCE: These results suggest that AP-2 is essential for endocytic clathrin coated-pit and coated-vesicle formation. They also indicate that under normal conditions, functional endocytic clathrin coated pits are required for LDL internalization. We also show that under certain

  14. Army and Marine Corps Active Protection System (APS) Efforts

    Science.gov (United States)

    2016-08-30

    Expedited NDI effort. The Marines have a number of unique APS requirements—including the ability to be transported by ship and withstand salt water...in urban environments. Such constraints could limit the usefulness of APS in certain combat scenarios. Collateral Damage In a manner similar to...fired at short range, in open area or urban environment, AT Guided Missiles, High Explosive AT and Kinetic Energy rounds. The Iron Fist is

  15. Army and Marine Corps Active Protection System (APS) Efforts

    Science.gov (United States)

    2016-08-30

    Summary Active Protection Systems (APSs) are subsystems integrated into or installed on a combat vehicle to automatically acquire, track, and respond...Protection System (APS) Efforts Congressional Research Service 1 Why This Issue Is Important for Congress Active Protection Systems (APSs) are...of these systems are highly susceptible to “soft kill” APS, which underlies the importance of both soft and hard kill capabilities. 20 In addition

  16. The Dushak–Erekdag Survey of roAp Stars

    Indian Academy of Sciences (India)

    Tatyana Dorokhova; Nikolay Dorokhov

    2005-06-01

    The search of roAp stars at Mt. Dushak–Erekdag Observatory was started in 1992 using the 0.8m Odessa telescope equipped with a two-star high-speed photometer. We have observed more than a dozen stars so far and discovered HD 99563 as roAp star while BD+8087 is suspected to have rapid oscillations. Negative results of our observations for the search of rapid oscillations in four stars in NGC 752 are also discussed.

  17. GeoDCAT-AP: Use cases and open issues

    OpenAIRE

    PEREGO ANDREA; FRIIS-CHRISTENSEN Anders; Lutz, Michael

    2016-01-01

    This paper illustrates some issues and use cases identified during the design and implementation of GeoDCAT-AP, a metadata profile aiming to provide a representation of geospatial metadata compliant with the DCAT application profile for European data portals (DCAT-AP). In particular, the paper focuses on those issues that may have a possible relevance also outside the geospatial domain, covering topics concerning metadata profile-based negotiation, publishing metadata on the Web, represen...

  18. AP-102/104 Retrieval control system qualification test procedure

    Energy Technology Data Exchange (ETDEWEB)

    RIECK, C.A.

    1999-05-18

    This Qualification Test Procedure documents the results of the qualification testing that was performed on the Project W-211, ''Initial Tank Retrieval Systems,'' retrieval control system (RCS) for tanks 241-AP-102 and 241-AP-104. The results confirm that the RCS has been programmed correctly and that the two related hardware enclosures have been assembled in accordance with the design documents.

  19. The Seismogenic Coupling Zone in Central Chile - Amphibious Experiments SPOC (Subduction Processes Off Chile)

    Science.gov (United States)

    Krawczyk, C. M.; Stiller, M.; Mechie, J.; Lueth, S.; Wigger, P.; Oncken, O.; Reichert, C.; Bataille, K.

    2003-12-01

    Nearly all interplate megathrust earthquakes occur in the seismogenic coupling zone between converging plates. In the area of the 1960 Chile earthquake (Mw = 9.5), we aim at a quantitative understanding of the seismicity and its relation to processes operating at depth and at the surface. As a first step, the offshore experiment SPOC with RV SONNE was combined with an onshore-offshore, active-passive seismic experiment between 36\\deg and 39\\deg S, crossing the rupture area of the 1960 Chile earthquake. The campaign comprised: (1) a 2-D wide-angle component recording chemical shots and airgun pulses along three consecutive E-W onshore profiles; (2) a seismic reflection experiment in the onshore-offshore transition; and (3) a 3-D component which recorded both active and passive sources. Offshore, the upper plate is split into many segments with pronounced forearc basins and a narrow accretionary wedge. A thick subduction channel seems to cause a non-frontally accreting subduction mode. Along the westernmost part of the southernmost E-W refraction seismic line, the profile spread of the active reflection seismic survey at 38\\deg 15' S was 54 km long, and also recorded the airgun shots of the marine profile with the first 18 km of its spread. Different mainly eastward dipping reflection bands are observed. Between 5-25 km depth the internal structure of the Palaeozoic accretionary wedge is described. Reflections between 16-42 km correlate with Wadati-Benioff seismicity and are interpreted as imaging the top of the downgoing plate. In the central part of the profile a break in reflectivity located below the axis of the coastal cordillera more or less coincides with the intersection between the oceanic plate and the continental Moho. This break in reflectivity also approximately correlates with the downdip end of the seismogenic plate interface as defined by geodetic modelling. These new seismic data provide the geometry of the subduction zone in the area, and hence

  20. [Measles: the disease, epidemiology, history and vaccination programs in Chile].

    Science.gov (United States)

    Delpiano, Luis; Astroza, Leonor; Toro, Jorge

    2015-08-01

    Measles, one of most important inmuno-preventable diseases, remains as a worldwide concern issue with an important morbidity and mortality. Particularly in the America region declared free of measles in 2010 by WHO, they still appear imported cases that origin outbreaks of variable magnitude in susceptible subjects usually none vaccinated which is the current situation in Santiago, the capital city of Chile. In this review we present characteristics of the etiological agent, the disease, epidemiological aspects with national historical focus, impact of immunization programs and outbreaks in Chile, in order to contribute to knowledge and management of this always present public health problem.

  1. MORTALIDAD POR ABORTO EN CHILE: ANALISIS EPIDEMIOLOGICO 1985-2000

    OpenAIRE

    Szot M,Jorge; Moreno W,Cristina

    2003-01-01

    El aborto, por su contribución a la mortalidad materna, ha sido tradicionalmente un problema de salud pública en América Latina y en Chile. En la actualidad, si bien es cierto la mortalidad por esta causa ha disminuido, la cantidad de abortos realizados permanece alta. Por este motivo, se ha querido efectuar una caracterización desde la perspectiva epidemiológica de la mortalidad por aborto ocurrido en Chile entre 1985 y 2000. Los resultados confirman la baja en la mortalidad durante el perío...

  2. ADAPTACION DE ESPECIES DE BAMBU DE CLIMA TEMPLADO EN CHILE

    OpenAIRE

    CAMPOS ROASIO, JORGE NELSON

    2005-01-01

    Hasta la fecha no se había estudiado la posibilidad de adaptar especies exóticas de las mejores especies de bambú, a las condiciones agroclimáticas de Chile con fines industriales. Sólo había pequeñas muestras de adaptación de algunas especies, las que fueron traídas a Chile básicamente con fines ornamentales. Considerando estos antecedentes y la existencia a nivel mundial de más de 1.300 especies, algunas de las cuales se desarrollan en climas templados, se desarrolló el proyecto “Adap...

  3. Chile: Political and Economic Conditions and U.S. Relations

    Science.gov (United States)

    2010-09-22

    9 Julieta Palma and Raúl Urzúa, Anti-Poverty Policies and Citizenry: The "Chile Solidario" Experience, United Nations Educational, Scientific and...heavy machinery, oil , aircraft, electrical machinery, and motor vehicles. In 2009, the United States was Chile’s top source of imports and the second...45% to 67% of the total supply between 1990 and 2006. Chile now imports about 99% of its crude oil , 72% of its natural gas, and 92% of its coal.79

  4. Chile: Inauguración de la universidad Alberto Hurtado.

    Directory of Open Access Journals (Sweden)

    Fernando Montes SJ.

    1998-03-01

    Full Text Available El 20 de octubre de 1997, se inauguró en Santiago de chile la Universidad Alberto Hurtado, dirigida por la Compañía de Jesús. En esa ocasión, su Rector, Fernando Montes S.J, pronunció su discurso inaugural en presencia del presidente chileno Eduardo Frei, del expresidente Patricio Alwing y de unas mil personas, entre senadores, diputados, figuras políticas, académicas y religiosas de Chile. Encuentro produce aquí el texto completo del discurso del Padre Montes S. J.

  5. Scenarios for wind power in Brazil, Argentina and Chile; Cenarios para a energia eolio eletrica no Brasil, Argentina e Chile

    Energy Technology Data Exchange (ETDEWEB)

    Dedecca, Joao Gorestein; Nogueira, Larissa Goncalves; Jannuzzi, Gilberto de Martino [Universidade Estadual de Campinas (UNICAMP), SP (Brazil). Fac. de Engenharia Mecanica. Dept. de Energia], emails: jdedecca@fem.unicamp.br, larissa@fem.unicamp.br, januzzi@fem.unicamp.br; Gomes, Rodolfo Dourado [International Energy Initiative-Latin America (IEI-LA), Campinas, SP (Brazil)], email: rodolfo@iei-la.org

    2010-07-01

    The Chilean, Argentinean and Brazilian power matrixes presented in the last two decades a growth of the non-renewable energy sources share, especially fossil sources, mainly in installed capacity and in a lesser degree in energy production. Greenpeace and the European Renewable Energy Council have elaborated a reference energy scenario together with a scenario analyzing the institution of ample measures for the promotion of renewable energy sources. Feed-in tariffs and auction or bidding mechanisms implemented in Brazil and Argentina and the renewable portfolio standard implemented in Chile allied with the wind industry state in these countries indicate that Chile and Argentina will fulfill the 2020 wind power installed capacity predicted in the reference scenarios, while Brazil will reach the energy revolution scenario prediction. Important energy policy changes are required if the Chile and Argentina energy revolution scenarios wind power installed capacity are to become a reality in 2020. (author)

  6. AP1000模块化施工分析%Analysis of the AP1000 Modular Construction

    Institute of Scientific and Technical Information of China (English)

    邹玮

    2014-01-01

    文章针对AP1000机组模块化施工的技术和进度特点进行了分析,特别是对AP1000模块化施工面临的挑战和问题进行了深入的分析.这些挑战和问题有些是首台AP1000机组所特有的,有些将在后续AP1000机组建设过程中继续存在,文章分别阐述并提出了几项建议措施.

  7. Production and consumption of energy in Chile 1987. Produccion y consumo de energia en Chile 1987

    Energy Technology Data Exchange (ETDEWEB)

    1987-01-01

    Presents information, at a national level, on production and consumption of various types of energy, including statistical data on commercial deals (hydrocarbons, coal) and the activities of the companies (hydromechanical energy, vegetable wastes for power generation and biogas). Electrical energy is described in detail. The first chapter presents an energy overview of the country and its energy sources, evaluating each one in order to obtain the total energy produced in Chile. The second chapter deals with electric power in the country, classifying power installed, generated and consumed by category of producer, consumer and generating type. The third chapter discusses the planned capacity of the Zonas Electricas, and the fourth chapter reviews the characteristics of the installations, production statistics, consumption and operation of the grid.

  8. CHILE'S RUSH TO FREE TRADE AGREEMENTS El frenesí de Chile por los Tratados de Libre Comercio

    Directory of Open Access Journals (Sweden)

    LESLIE WEHNER

    2011-01-01

    Full Text Available This article analyses the reasons for Chile's aggressive Free Trade Agreement (FTA policy. Assessing both how the Chilean government has converged with the export sector and how the government has been able to co-opt, soften and divide those on the losing side of any FTA policy, are key to understanding Chile's vast number of FTAs. However, FTAs are also a constitutive part of a country's foreign policy, which converts these accords into a vehicle for the achievement of state goals dealing with economic issues and power configurations and expectations. It is the interplay between domestic groups' interests and the state's foreign policy goals that explain Chile's rush to FTAs.Este artículo analiza las razones que llevan a Chile a implementar una política agresiva de Tratados de Libre Comercio (TLC. Para comprender el porqué del frenesí y del número de acuerdos se evalúa cómo el gobierno de Chile logra converger con el sector exportador, y cómo coopta, divide y disminuye a los grupos perdedores de esta política. Sin embargo, los TLC son además parte de la política exterior de un país; lo que hace de estos acuerdos un vehículo para alcanzar objetivos estratégicos para el Estado. Es la interrelación entre los intereses de grupos domésticos y los objetivos de política exterior del Estado los que explican el porqué del frenesí de Chile por alcanzar un alto número de TLC.

  9. Nuevos registros de Phthiraptera (Artropoda: Insecta) en Lama pacos Linnaeus 1758, en Chile New records of Phthiraptera (Artropoda: Insecta) in Lama pacos Linnaeus 1758, in Chile

    OpenAIRE

    González-Acuña,D.; I. CABEZAS; Moreno, L; Castro, D

    2007-01-01

    Se cita a Microthoracius mazzai (Werneck 1932) y Bovicola breviceps (Rudow 1866) por primera vez en Chile, y se confirma la presencia de M. praelongiceps (Neumann 1909) parasitando alpacas en la comuna de General Lagos (I Región), Chile. Se discute la importancia de los presentes registros.For the first time in Chile, the presence of Microthoracius mazzai (Werneck 1932) and Bovicola breviceps (Rudow 1866), are reported, and the presence of M. praelongiceps (Neuman 1909) parasiting alpacas in ...

  10. Data of evolutionary structure change: 1AP4A-1CLMA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1AP4A-1CLMA 1AP4 1CLM A A ---------------------------------------...DDS LTEEQIAEFKEAFALFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLSLMARKMKEQDSEEELIEAFKVFDR...36 1CLM A 1CLMA

  11. DNA cleavage at the AP site via β-elimination mediated by the AP site-binding ligands.

    Science.gov (United States)

    Abe, Yukiko S; Sasaki, Shigeki

    2016-02-15

    DNA is continuously damaged by endogenous and exogenous factors such as oxidation and alkylation. In the base excision repair pathway, the damaged nucleobases are removed by DNA N-glycosylase to form the abasic sites (AP sites). The alkylating antitumor agent exhibits cytotoxicity through the formation of the AP site. Therefore blockage or modulation of the AP site repair pathway may enhance the antitumor efficacy of DNA alkylating agents. In this study, we have examined the effects of the nucleobase-polyamine conjugated ligands (G-, A-, C- and T-ligands) on the cleavage of the AP site. The G- and A-ligands cleaved DNA at the AP site by promoting β-elimination in a non-selective manner by the G-ligand, and in a selective manner for the opposing dT by the A-ligand. These results suggest that the nucleobase-polyamine conjugate ligands may have the potential for enhancement of the cytotoxicities of the AP site.

  12. Energy from the Andes. The hydropower plant La Confluencia in Chile; Energie aus den Anden. Die Wasserkraftanlage La Confluencia in Chile

    Energy Technology Data Exchange (ETDEWEB)

    Mueller, Mathias [Hochschule Regensburg (Germany). Bauingenieurwesen

    2012-11-01

    The author of the contribution under consideration reports on the hydropower plant La Confluencia situated nearly 150 km south of Santiago de Chile (Chile). La Confluencia is a project development of a Norwegian-Australian joint venture of SN Power utilities (Oslo, Norway) and Pacific Hydro (Melbourne, Australia). Constructora Hochtief Tecsa (Santiago, Chile) took over the order to construct the plant completely including planning, construction, equipment and operation. The system concept was developed in collaboration with Poeyry Energy (Zurich, Switzerland). The plant design was devised in cooperation with Intertechne (Curitiba, Brazil), EDIC Ingenieros (Santiago, Chile) and Geocontrol (Madrid, Spain).

  13. An AP4B1 frameshift mutation in siblings with intellectual disability and spastic tetraplegia further delineates the AP-4 deficiency syndrome.

    Science.gov (United States)

    Abdollahpour, Hengameh; Alawi, Malik; Kortüm, Fanny; Beckstette, Michael; Seemanova, Eva; Komárek, Vladimír; Rosenberger, Georg; Kutsche, Kerstin

    2015-02-01

    The recently proposed adaptor protein 4 (AP-4) deficiency syndrome comprises a group of congenital neurological disorders characterized by severe intellectual disability (ID), delayed or absent speech, hereditary spastic paraplegia, and growth retardation. AP-4 is a heterotetrameric protein complex with important functions in vesicle trafficking. Mutations in genes affecting different subunits of AP-4, including AP4B1, AP4E1, AP4S1, and AP4M1, have been reported in patients with the AP-4 deficiency phenotype. We describe two siblings from a non-consanguineous couple who presented with severe ID, absent speech, microcephaly, growth retardation, and progressive spastic tetraplegia. Whole-exome sequencing in the two patients identified the novel homozygous 2-bp deletion c.1160_1161delCA (p.(Thr387Argfs*30)) in AP4B1. Sanger sequencing confirmed the mutation in the siblings and revealed it in the heterozygous state in both parents. The AP4B1-associated phenotype has previously been assigned to spastic paraplegia-47. Identification of a novel AP4B1 alteration in two patients with clinical manifestations highly similar to other individuals with mutations affecting one of the four AP-4 subunits further supports the observation that loss of AP-4 assembly or functionality underlies the common clinical features in these patients and underscores the existence of the clinically recognizable AP-4 deficiency syndrome.

  14. Great Chile Earthquake of May 22, 1960 - Anniversary Edition

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — On May 22, 1960 (19:11 UTC), a Mw 9.5 earthquake occurred in southern Chile (39.5 S, 74.5 W). This was the largest earthquake ever instrumentally recorded. (It was...

  15. Dynamics of Investment for Market-Oriented Farmers in Chile

    NARCIS (Netherlands)

    Reyes, A.; Kuyvenhoven, A.; Lensink, R.; Moll, H.A.J.

    2012-01-01

    Using panel data from a survey conducted in 2006 and 2008 of 177 market-oriented farmers in central Chile, we investigate investment under imperfect capital markets. Specifically we determine the impact of formal credit constraints on fixed investment. By controlling for endogeneity problems, we fin

  16. The Credit Constraints of Market-Oriented Farmers in Chile

    NARCIS (Netherlands)

    Reyes, Alvaro; Lensink, Robert

    2011-01-01

    Using data from two surveys conducted in 2006 and 2008 with 177 farmers, this article determines whether market-oriented farmers in central Chile are credit constrained, and it identifies the main factors that influence formal credit provision. In so doing, this study explicitly tests whether social

  17. Neoliberal Education and Student Movements in Chile: Inequalities and Malaise

    Science.gov (United States)

    Cabalin, Cristian

    2012-01-01

    This article examines the major consequences of the neoliberal education system implemented in Chile during the dictatorship of Augusto Pinochet and how two important student movements contested this structure. In 2006 and 2011, thousands of students filled the streets to demand better public education, more social justice and equal opportunities.…

  18. Transit Search from Antarctica and Chile - Comparison and Combination

    CERN Document Server

    Fruth, T; Csizmadia, Sz; Dreyer, C; Eigmüller, P; Erikson, A; Kabath, P; Pasternacki, T; Rauer, H; Titz-Weider, R; Abe, L; Agabi, A; Gonçalves, I; Guillot, T; Mékarnia, D; Rivet, J -P; Crouzet, N; Chini, R; Lemke, R; Murphy, M

    2014-01-01

    Observing sites at the East-Antarctic plateau are considered to provide exceptional conditions for astronomy. The aim of this work is to assess its potential for detecting transiting extrasolar planets through a comparison and combination of photometric data from Antarctica with time series from a midlatitude site. During 2010, the two small aperture telescopes ASTEP 400 (Dome C) and BEST II (Chile) together performed an observing campaign of two target fields and the transiting planet WASP-18b. For the latter, a bright star, Dome C appears to yield an advantageous signal-to-noise ratio. For field surveys, both Dome C and Chile appear to be of comparable photometric quality. However, within two weeks, observations at Dome C yield a transit detection efficiency that typically requires a whole observing season in Chile. For the first time, data from Antarctica and Chile have been combined to extent the observational duty cycle. This approach is both feasible in practice and favorable for transit search, as it i...

  19. Sowing Consumers in the Garden of Mass Retailing in Chile

    DEFF Research Database (Denmark)

    Ossandón, José

    2014-01-01

    It is known that some key elements of modern consumer credit were originally developed in department stores. However, almost no attention has been given to new developments in this area. This paper studies the case of retail credit in Chile. Special attention is given to a particular technique kn...

  20. Studies to Control Endemic Typhoid Fever in Chile

    Science.gov (United States)

    1985-09-01

    Society for Microbiology, Chapter 16. 10. Medina E, Yrarrazaval M. (1983) Fiebre tifoidea en Chile: Consideraciones epideniologicas. Revista Medica de...R. (1975) Enteroparasitosis en manipuladores del’ arýa de salud oriente de Santiago. Boletin Chileno de Parasitologia 27: 115-116. 15. RiE.tori C

  1. Education with ICT in South Korea and Chile

    Science.gov (United States)

    Sanchez, Jaime; Salinas, Alvaro; Harris, Jordan

    2011-01-01

    This article presents a linear-analytical case study on the development of ICT within the educational systems of Chile and South Korea. Through a comprehensive meta-data analysis and bibliographic review, we collected information on both educational systems and their ICT adoption policies. Key differences necessary to understand how both countries…

  2. Oil and Gas Emergency Policy: Chile 2012 update

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2012-09-06

    Chile has experienced several serious energy supply incidents over the last decade, including major droughts, a sustained gas supply cut from Argentina (since 2004), and a major earthquake in early 2010 which affected electricity networks and refineries, and caused several black-outs. Due to Chile's unique and sinuous geography - it runs 4 300 kilometres from North to South and only 175 kms from East to West- the country's energy markets are regionally disjointed, particularly as the regional gas and electricity grids are not connected. In the arid North, energy demand is dominated by the mining industry, and operates based on a separate thermal-based Sistema Interconectado Norte Grande (SING) electricity grid. The more densely-populated central region (including Santiago) operates on the more hydro-dependent Sistema Interconectado Central (SIC) electricity grid. The southernmost, hydro-rich regions of the country are not connected to the rest of Chile in terms of electricity and gas. The following report is based on an IEA Emergency Response Assessment carried out in 2010 and 2011 which looked specifically at Chile's capacity to respond to short-term emergencies in oil, gas and electricity.

  3. How Chile is taking its first steps towards nuclear

    Energy Technology Data Exchange (ETDEWEB)

    Mitev, Lubomir [NucNet, Brussels (Belgium)

    2014-08-15

    Chile's Association of Engineers is urging the government to launch a programme of new nuclear build due to the rising electricity demand that could lead to four reactors being in operation by 2030. Fernando Sierpe, head of the association's nuclear power committee, talks to NucNet about plans, progress and possible obstacles.

  4. Regional metallogenic structure based on aeromagnetic data in northern Chile

    Science.gov (United States)

    Zhu, Xiao-San; Lu, Min-Jie

    2016-12-01

    Chile is a very important country that forms part of the Andean metallogenic belts. The Atacama and Domeyko fault systems in northern Chile control the tectonic-magmatic activities that migrate eastward and the types of mineral resources. In this paper, we processed and interpreted aeromagnetic data from northern Chile using reduction to pole, upward field continuation, the second derivative calculation in the vertical direction, inclination angle calculation, and analytical signal amplitude analysis. We revealed the locations and planar distribution characteristics of the regional deep faults along the NNE and NS directions. Furthermore, we observed that the major reasons for the formation of the tectonic-magmatic rocks belts were the nearly parallel deep faults distributed from west to east and multiple magmatic activities along these faults. We ascertained the locations of volcanic mechanisms and the relationships between them using these regional deep faults. We deduced the spatial distributions of the basic-intermediate, basic, and acidic igneous rocks, intrusive rocks, and sedimentary sequences. We showed the linear positive magnetic anomalies and magnetic anomaly gradient zones by slowly varying the background, negative magnetic anomaly field, which indicated the presence of strong magmatic activities in these regional deep faults; it also revealed the favorable areas of copper and polymetallic mineralization. This study provides some basic information for further research on the geology, structural characteristics, and mineral resource prospecting in northern Chile.

  5. Severe mortality impact of the 1957 influenza pandemic in Chile

    DEFF Research Database (Denmark)

    Chowell, Gerardo; Simonsen, Lone; Fuentes, Rodrigo

    2016-01-01

    INTRODUCTION: Epidemiological studies of the 1957 influenza pandemic are scarce, particularly from lower income settings. METHODS: We analyzed the spatial-temporal mortality patterns of the 1957 influenza pandemic in Chile including detailed age-specific mortality data from a large city and inves...

  6. Accreditation in Higher Education in Chile: Results and Consequences

    Science.gov (United States)

    Espinoza, Oscar; Gonzalez, Luis Eduardo

    2013-01-01

    Purpose: The purpose of this paper is to analyze and discuss the results that the accreditation system implemented in Chile has brought to higher education institutions and undergraduate and graduate programs, taking into account both its positive and negative implications. Design/methodology/approach: The examination of the Chilean accreditation…

  7. Popular Education for Peasant Communities in Chile. Chapter 21.

    Science.gov (United States)

    Infante R., Isabel; Letelier G., Eugenia

    The rural population of Chile has been served poorly by the formal educational system, rural educational attainment lags behind that of urban areas, and outmigration and alienation of rural youth are high. In the past decade, popular education has attempted to educate rural people and put them in control of their destinies by drawing on popular…

  8. New species of Anisophya Karabag from Chile (Orthoptera: Tettigoniidae: Phanopterinae)

    Science.gov (United States)

    Many of the most primitive Neotropical bush katydids (Phaneropterinae) — including species of Cosmophyllum Blanchard, Stenophylla Brunner von Wattenwyl, Marenestha Brunner von Wattenwyl, Anisophya Karabag, Coryphoda Brunner von Wattenwyl, and Burgilis Stål — are endemic in Chile. The Chilean species...

  9. How Local Market Pressures Shape Leadership Practices: Evidence from Chile

    Science.gov (United States)

    Carrasco, Alejandro; Fromm, Germán

    2016-01-01

    Chile is well known worldwide for its extensive use of market-driven mechanisms in education. Using a case study strategy in three schools, this paper shows that "universal" voucher system and mixed provision (co-existence of subsidised private and state-funded schools) policies are reshaping school management practices. The paper draws…

  10. Creating Dialogues: Exploring the "Good Early Childhood Educator" in Chile

    Science.gov (United States)

    Viviani, Maria

    2016-01-01

    The aim of this study was to explore the different ways in which a number of Chilean stakeholders conceptualise the "good early childhood educator" in Chile. In a context where new foreign narratives are increasingly dominating the field and the recent standardisation of the educators' professional role is being implemented, this…

  11. 75 FR 11583 - The Chile Fund, Inc.; Notice of Application

    Science.gov (United States)

    2010-03-11

    ... From the Federal Register Online via the Government Publishing Office SECURITIES AND EXCHANGE COMMISSION The Chile Fund, Inc.; Notice of Application March 8, 2010. AGENCY: Securities and Exchange... Company Act of 1940 (the ``Act'') for an exemption from section 17(a) of the Act. Applicant: The...

  12. The Impact of Chile's School Feeding Program on Education Outcomes

    Science.gov (United States)

    McEwan, Patrick J.

    2013-01-01

    Chile operates one of the oldest and largest school feeding programs in Latin America, targeting higher-calorie meals to relatively poorer schools. This paper evaluates the impact of higher-calorie meals on the education outcomes of public, rural schools and their students. It applies a regression-discontinuity design to administrative data,…

  13. [Health research and health technology assessment in Chile].

    Science.gov (United States)

    Espinoza, Manuel Antonio; Cabieses, Báltica; Paraje, Guillermo

    2014-01-01

    Health research is considered an essential element for the improvement of population health and it has been recommended that a share of the national health budget should be allocated to develop this field. Chile has undertaken efforts in the last decades in order to improve the governmental structure created to promote the development of health research, which has increased human resources and funding opportunities. On the other hand, the sustained economic growth of Chile in the last decades suggests that the health expenditure will maintain its increasing trend in the following years. This additional funding could be used to improve coverage of current activities performed in the health system, but also to address the incorporation of new strategies. More recently, health technology assessment (HTA) has been proposed as a process to support decisions about allocation of resources based on scientific evidence. This paper examines the relationship between the development of health research and the HTA process. First, it presents a brief diagnosis of the situation of health research in Chile. Second, it reviews the conceptual basis and the methods that account for the relationship between a HTA process and the development of health research. In particular, it emphasizes the relevance of identifying information gaps where funding additional research can be considered a good use of public resources. Finally, it discusses the challenges and possible courses of action that Chile could take in order to guarantee the continuous improvement of an articulated structure for health research and HTA.

  14. Prevention of aspiration pneumonia (AP) with oral care.

    Science.gov (United States)

    Tada, Akio; Miura, Hiroko

    2012-01-01

    AP is a major cause of morbidity and mortality in elderly patients, especially frail elderly patients. The aim of this article is to review effect of oral care, including oral hygiene and improvement of oral function, on the prevention of AP among elderly people in hospitals and nursing homes. There is now a substantial body of work studying the effect of oral care on the prevention of respiratory diseases. Oral hygiene, consisting of oral decontamination and mechanical cleaning by dental professionals, has resulted in significant clinical effects (decreased incidence of pneumonia and decreased mortality from respiratory diseases) in clinical randomized trials. Moreover, studies examining oral colonization by pneumonia pathogens have shown the effect of oral hygiene on eliminating these pathogens. In addition, swallowing training has been shown to improve the movement and function of swallowing-related muscles, also resulting in decreased incidence of pneumonia. These findings support the contention that oral care is effective in the prevention of AP.

  15. Westinghouse plans global new builds for AP1000

    Energy Technology Data Exchange (ETDEWEB)

    Mitev, Lubomir [NucNet, Brussels (Belgium)

    2014-10-15

    Interview with Danny Roderick, Westinghouse Electric Company, President and Chief Executive Officer since September 2012, about perspectives and future plans for AP1000 new build worldwide. Within three to four years there wille be 'shovels in the ground' for three new AP1000 reactors in the UK, as well as new units in China and Bulgaria. Four AP1000 reactors are under construction in the United States at Vogtle and VC Summer, and soon at Turkey Point. Additionally Danny Roderick spoke about the acquisition of NuGen, technology transfer, the influence of the Ukraine crises on the nuclear market in East Europe and the future need for more nuclear worldwide and in the UK and Bulgaria.

  16. Jazz en Chile: su historia y función social Jazz in Chile: its history and social function

    Directory of Open Access Journals (Sweden)

    Álvaro Menanteau

    2008-12-01

    Full Text Available Este artículo presenta una visión general de la historia del jazz en Chile que destaca la función social de esta música y el cambio que tuvo a través del tiempo. Estos cambios se relacionaron con diferentes valoraciones de la práctica jazzística local. En un principio el jazz fue música popular masiva. Posteriormente fue valorado estéticamente por un segmento de élite, quienes eran profesionales en áreas no musicales y en muchos casos eran instrumentistas aficionados. En una tercera etapa, músicos profesionales asumieron la práctica del jazz como una plataforma para fusionar el lenguaje jazzístico con recursos tomados de la música tradicional chilena. Este tránsito del jazz en Chile está cruzado por factores socioeconómicos y estéticos, que se analizan en el trabajo.The article presents an overview of the history of jazz in Chile on the basis of the social function of jazz and the changes it has underwent over the years in terms of the valúes it has represented for Chilean society. Initially jazz was considered as mass popular music. Afterwards it was valued in aesthetic terms by a group belonging to the élite of Chilean society. Many of them belonged to non-music professions and in some cases were amateur musicians. Most recently professional musicians took up jazz as the basis for combining the jazz style with elements belonging to traditional music of Chile. This process in Chile is also influenced by social, economic and aesthetic aspects which are explored in this article.

  17. First Magnetic Doppler Images of a roAp star

    Science.gov (United States)

    Lüftinger, T.; Kochukhov, O.; Ryabchikova, T.; Weiss, W. W.; Ilyin, I.

    2007-06-01

    We present the first analysis of the magnetic field geometry and elemental abundance distributions on the surface of a rapidly oscillating Ap (roAp) star, using an elaborate magnetic Doppler Imaging (MDI) code (Piskunov et al. 2002, Kochukhov et al. 2002), inv, which allows to reconstruct simultaneously and consistently the magnetic field geometry and abundance distributions on a stellar surface without any a priori assumptions. We analysed Stokes I and V time series obtained with the SOFIN polarimeter and recovered the magnetic field and surface abundance structures of Fe and Nd (among others). These two elements are found to be anticorrelated.

  18. THE PARALLEL RECURSIVE AP ADAPTIVE ALGORITHM BASED ON VOLTERRA SERIES

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    Aiming at the nonlinear system identification problem, a parallel recursive affine projection (AP) adaptive algorithm for the nonlinear system based on Volterra series is presented in this paper. The algorithm identifies in parallel the Volterra kernel of each order, recursively estimate the inverse of the autocorrelation matrix for the Volterra input of each order, and remarkably improve the convergence speed of the identification process compared with the NLMS and conventional AP adaptive algorithm based on Volterra series. Simulation results indicate that the proposed method in this paper is efficient.

  19. Berberine inhibits cyclin D1 expression via suppressed binding of AP-1 transcription factors to CCND1 AP-1 motif

    Institute of Scientific and Technical Information of China (English)

    Ye LUO; Yu HAO; Tai-ping SHI; Wei-wei DENG; Na LI

    2008-01-01

    Aim: To verify the suppressive effect of berberine on the proliferation of the human pulmonary giant cell carcinoma cell line PG and to demonstrate the mecha-nisms behind the antitumoral effects of berberine. Methods: The proliferative effects of PG cells were detected by 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide colorimetry. The cell cycle was examined by flow cytometry. The expression level of cyclin D1 was detected by RT-PCR. The activities of the activating protein-1 (AP-1) and NF-κB signaling pathways related to cyclin D1 were examined by luciferase assay. The cytoplasmic level of c-Jun was detected by Western blot analysis. An electrophoretic mobility shift assay was used to examiae the binding of transcription factors to the cyclin D1 gene (CCNDl) AP-1 motif. Results: The results showed that the proliferation of PG cells treated with different concentrations (10, 20, and 40 μg/mL) of berberine for 24 and 48 h was suppressed significantly compared to the control group. After treatment with berberine, the proportion of PG cells at the G0/G1 phase increased, while cells at the S and G2/M phases decreased. Berberine could inhibit the expression of cyclin D1 in PG cells. Berberine inhibited the activity of the AP-1 signaling pathway, but had no significant effect on the NF-κB signaling pathway. Berberine suppressed the expression of c-Jun and decreased the binding of tran-scription factors to the CCND1 AP-1 motif. Conclusion: Berberine suppresses the activity of the AP-1 signaling pathway and decreases the binding of transcrip-tion factors to the CCND1 AP-1 motif. This is one of the important mechanisms behind the antitumoral effects of berberine as a regulator of cyclin D1.

  20. ESO Delegation to Visit Chile: the Chile-Eso Treaty and Paranal

    Science.gov (United States)

    1994-05-01

    The ESO Council, in its extraordinary session on 28 April 1994, among other matters discussed the relations with the Republic of Chile and the situation around Paranal mountain [1], the designated site for the ESO Very Large Telescope (VLT). Council decided to send a high ranking delegation to Santiago de Chile to discuss with Chilean authorities the pending problems, including the finalisation of the new Treaty between the Republic of Chile and ESO and the legal aspects of the Paranal location. The ESO delegation will consist of Dr. Peter Creola (President of ESO Council), Dr. Catherine Cesarsky (Vice-President of ESO Council), Dr. Henrik Grage (Former Vice-President of ESO Council) and Professor Riccardo Giacconi (ESO Director General), the latter accompanied by his advisers. The delegation will arrive in Chile during the second half of May 1994. The ESO delegation will meet with the Chilean Minister of Foreign Affairs, Mr. Carlos Figueroa, and the Secretary of State in the Ministry of Foreign Affairs, Mr. Jose Miguel Insulza. Other meetings at high level are being planned. The delegation will report about these discussions to the ESO Council during its ordinary session on 7 - 8 June 1994. FOUR PARANAL PHOTOS AVAILABLE A series of four photos which show the current status of the work at Paranal has been prepared. Photographic colour prints for use by the media can be requested from the ESO Information and Photographic Service (please remember to indicate the identification numbers). [1] See ESO Press Release 07/94 of 21 April 1994. PHOTO CAPTIONS ESO PR PHOTO 08/94-1: CERRO PARANAL This aerial photo of the Paranal mountain, the designated site for the ESO Very Large Telescope (VLT), was obtained on 22 March 1994. Paranal is situated in the driest part of the Chilean Atacama desert, approx. 130 km south of the city of Antofagasta, and about 12 km from the Pacific Ocean. In this view towards the West, the ocean is seen in the background. The altitude is 2650 metres

  1. The Paschen-Back effect in the Li I 6708 Å line and the presence of lithium in cool magnetic Ap stars

    Science.gov (United States)

    Kochukhov, O.

    2008-05-01

    theoretical calculations when assuming the Li I identification. Including the Paschen-Back effect improves the agreement with observations, especially for HD 154708. Conclusions: Results of our study confirm the Li I identification proposed for the 6708 Å line in cool Ap stars. Based on observations collected at the European Southern Observatory, Paranal, Chile (ESO program 68.D-0254 and programs 072.D-0138, 077.D-0150 retrieved through the ESO Archive).

  2. Integrating Particulate Representations into AP Chemistry and Introductory Chemistry Courses

    Science.gov (United States)

    Prilliman, Stephen G.

    2014-01-01

    The College Board's recently revised curriculum for advanced placement (AP) chemistry places a strong emphasis on conceptual understanding, including representations of particle phenomena. This change in emphasis is informed by years of research showing that students could perform algorithmic calculations but not explain those calculations…

  3. Penetration dynamics of AP8 in thin ceramic tiles

    NARCIS (Netherlands)

    Abadjieva, E.; Khoe, Y.S.

    2013-01-01

    The interaction of thin ceramic tiles with AP8 (WC core, 7,62 mm) at 1000 m/s velocity has been studied experimentally and numerically. “Thin” ceramic tiles refers here to ratio of the tile thickness (t) to the projectile diameter, (d), t/d@ 1, as they are both in the same order. The method applied

  4. Research on CoAP%CoAP协议研究

    Institute of Scientific and Technical Information of China (English)

    刘紫青; 程燕; 关联; 桑梓勤; 郝俊瑞

    2013-01-01

    For some M2M applications, there exists problems of constrained networks and nodes, and the HTTP isn't applicable. The Constrained Application Protocol (CoAP) is described and analyzed in this paper, and the mapping between CoAP and HTTP is also included. Then, the comparison of the two protocols is researched. Finally, it can be concluded that CoAP is simple and its overhead is very low, which can well meet the application layer' s communications requirements in the constrained environment.%针对某些M2M应用中存在网络和节点资源受限的情况,不适用HTTP,介绍和分析了受限应用协议CoAP(Constrained Application Protocol)的特点及其与HTTP的映射,并将CoAP和HTTP进行对比研究,发现CoAP简单、开销小,能很好地满足资源受限环境的应用层通信需求.

  5. Simbolic boundaries and middle classes. Social mobility in Chile

    Directory of Open Access Journals (Sweden)

    Mayarí Castillo

    2016-07-01

    Full Text Available After more than three decades of the implementation of the policies of structural adjustment in Chile, the middle classes increased their weight in the social structure and changed their economic sector, occupation and trajectories of social mobility. This article analyzes the perceptionof symbolic boundaries, which emerging of these macro-processes and shapes the subjectivity of middle class subjects into upward mobility processes and modifies their perceptions of inequality. Whit this objective the paper presents a qualitative analysis of cases in which discursive components like meritocracy, the effort and the idea of “barriers/obstacles” became a key discursive axis. This article is inscribed within the recent studies on middle classes for the Chilean case, which focus specially on the cultural aspects after reproduction of stratification and inequality in Chile.

  6. Nuevos inmigrantes en Chile: Los determinantes de su actividad emprendedora

    Directory of Open Access Journals (Sweden)

    Claudio MANCILLA

    2014-01-01

    Full Text Available En Chile es poca la literatura que estudia a los inmigrantes desde una perspectiva económica, y menos la que aborda su actitud emprendedora (a pesar de que son proporcionalmente más emprendedores que los habitantes locales. El objetivo de este trabajo es estudiar los factores que influyen en el emprendimiento de los in - migrantes sudamericanos en Chile. Se utilizó un modelo logit ajustado para even - tos extraños para determinar el impacto sobre la probabilidad de emprendimiento individual. Algunos resultados indican que el tiempo de residencia, forma legal de ingreso al país, nivel educacional y experiencia previa de emprendimiento, influyen en la probabilidad de crear una actividad empresarial.

  7. [Chile: political education and a critical reading of television].

    Science.gov (United States)

    Mattelart, M

    1979-01-01

    A study of television was conducted in Chile in 1971. There is a discontinuous aspect in the requests of the public, especially in times of crisis and rupture with the traditional order. In order to measure the various levels of appreciation and critique raised by the television in various areas of the working class in Chile, the poblaciones (peripheric residential zones) were chosen as the place for the study. 100 interviews were conducted. 60% of the people questioned were sympathizers or militants of the various left wing parties; the other 40% were sympathizers or militants of the opposition (Christian democracy, National party and right wing of the radical party). Television does not make any distinction between the publics, but the public makes distinctions between the effects of television. Melodramas and detective programs have the largest adhesion in the popular public of Latin America.

  8. Reforma educativa y política en Chile

    Directory of Open Access Journals (Sweden)

    Alan Angell

    1997-06-01

    Full Text Available This article examines two important educational reforms introduced since the return to democracy in Chile. The first one was targeted at the poorest 10% of schools in Chile. The second was a fundamental reform of the primary educational sector. Both have been successful in meeting their objectives, and mark a fundamental shift from the educational reforms of the Pinochet government. The reasons for the success of the reforms are broken down into political, institutional and operational factors. In essence, a small team of trained educational reformers, with widespread support and strong backing from the Minister of Education and the President were able to overcome the resistance of the bureaucrats of the Ministry of Education and that of the school teachers union.

  9. Conservation easements and mining: The case of Chile

    Science.gov (United States)

    Root-Bernstein, M.; Montecinos Carvajal, Y.; Ladle, R.; Jepson, P.; Jaksic, F.

    2013-12-01

    Private protected areas (PPAs) are important designations with the potential to complement and improve public protected area (PA) networks in many countries. PPAs come in many forms and offer a wide variety of incentives, rights, responsibilities, and protections. One popular model, now being considered for adoption in Chile, is the conservation easement. In this article, we examine how well conservation easements would perform as PPA designations in countries such as Chile that have strong mining industries. Mining, and other concessions, in PAs is emerging as an important point of contention between conservation and development. PPA designations should be carefully designed to offer protections that conform to standards that will complement PA networks, that are perpetual, and that require a publically accountable and transparent process to overturn or modify.

  10. Codex Alimentarius Commission: Its Importance in Chile´s Food Safety History

    OpenAIRE

    2014-01-01

    Throughout Chile´s food safety history, the Codex Alimentarius and its Commission have been crucial to its development. Particularly, the Codex Alimentarius Commission (CAC) has been a reference in food standard setting for Chile. In order to share the experience of Chile in the development of its national food control systems and the role the CAC has played in it, a summary of the history and important milestones is presented in this paper.

  11. Entrepreneurship in Chile from a Viewpoint of a Foreign Investor

    OpenAIRE

    Česká, Markéta

    2016-01-01

    This bachelor thesis focuses on entrepreneurship in Chile from a viewpoint of a foreign investor. The main objective is to depict the business environment of Chile, using an example of a real business case. The first part concentrates on PESTLE analysis of Chile. Second part focuses on the conditions of launching and running a business in that country. In the third part a hotel project is analysed and relevant conclusions are drawn.

  12. [Public health infrastructure investment difficulties in Chile: concessions and public tenders].

    Science.gov (United States)

    Goyenechea, Matías

    2016-05-12

    This paper seeks to highlight the problems of gaps in health infrastructure in Chile, and to analyze the mechanisms by which it is provided. In Chile this is done in two ways: the first is through competitive bidding or sector-wide modality. The second way is through hospital concessions. Both mechanisms have had difficulties in recent years, which are reported. Finally, we propose ways to improve the provision of health infrastructure in Chile.

  13. Studies to Control Endemic Typhoid Fever in Chile

    Science.gov (United States)

    1982-01-29

    immunologic familiarity with I this antigen, sera collected 10 days after immunization were examined by IgM "ELISA. In this instance significant rises of 0...do not have the same immunologic familiarity with S. typhi 0 antigen as Chilean children. U.S. adults respond to immun.zation as often with a primary...vaccination between May 3 and June 18, 1982. -25- REFERENCES 1. Departamento Planificacion Estadistica, Mjnisterio de Salud, Santiago Chile. 2. Ristori

  14. Ancient Leishmaniasis in a Highland Desert of Northern Chile

    OpenAIRE

    Maria Antonietta Costa; Carney Matheson; Lucia Iachetta; Agustín Llagostera; Otto Appenzeller

    2009-01-01

    BACKGROUND: Leishmaniasis is an infectious disease endemic today in many areas of South America. METHODOLOGY: We discovered morphologic and molecular evidence of ancient infections in 4 female skulls in the archaeological cemetery of Coyo Oriente, in the desert of San Pedro de Atacama, Northern Chile. The boney facial lesions visible in the skulls could have been caused by a number of chronic infections including chronic Leishmaniasis. This diagnosis was confirmed using PCR-sequenced analyses...

  15. Strategic Challenges in the Regional Environment Facing Chile

    Science.gov (United States)

    2004-03-19

    relationship between criminal groups and drug dealers. Carabineros (Uniformed Police Force) and Investigaciones de Chile (Investigation Police) have...2004; available from <http://www.latercera.cl/ articulo /0,5819,3255_5664_49521165,00.html>; Internet; accessed 02 Feb 2004. 21 Military Studies and... articulo /0,5819,3255_5664_49521165,00.html> Internet. Accessed 02 February 2004. Williams, Phil. “New Contexts, Smart Enemies” in Non-State Threats and Future Wars, ed. Robert Bunker, Portland: Frank Cass & Co., 2003

  16. The Student Movement in Chile: Origins, trajectory and impact

    OpenAIRE

    Beranová, Marie

    2013-01-01

    Latin America cannot be conceived without acknowledging the social movements, which are often the engines of political and social changes on the continent. Until recently, Chile appeared to be the country where the social order was perceived as the most accomplished in relation to its politically unstable neighbouring countries, as well as in relation to its proper history. The 2011 student movement, which is the most significant social movement within the last twenty years of the Chilean his...

  17. Chile; Staff Report for the 2015 Article IV Consultation

    OpenAIRE

    2015-01-01

    This 2015 Article IV Consultation highlights that the GDP growth of Chile has remained lackluster over the past year. The main force behind the economic slowdown in 2014 has been the sharp fall in private investment, mainly the consequence of the end of the mining boom, but also reflecting the uncertainty and adjustment costs associated with the structural reform agenda. The IMF staff expects growth to increase modestly to 2.5 percent in 2015, mainly thanks to strong fiscal support. Private d...

  18. Seabird eggs as bioindicators of chemical contamination in Chile

    Energy Technology Data Exchange (ETDEWEB)

    Cifuentes, Jacqueline Munoz; Becker, Peter H.; Sommer, Ute; Pacheco, Patricia; Schlatter, Roberto

    2003-11-01

    Seabird eggs are proposed as biomonitors of chemical contamination in Chile. - Seabird eggs were used as bioindicators of chemical contamination in Chile. Brown-hooded Gull (Larus maculipennis), Kelp Gull (Larus dominicanus), Trudeau's Tern (Sterna trudeaui), Neotropic Cormorant (Phalacrocorax brasilianus), and Pink-footed Shearwater (Puffinus creatopus) eggs were sampled at different breeding sites during the 1990s. Mercury and organochlorines (PCBs, DDT, HCB, HCH, and PCP) were quantified to reveal the interspecific differences, spatial and temporal trends in contamination levels. Trudeau's Tern displayed the highest levels of mercury (486 ng g{sup -1} wet weight). The highest {sigma}DDT concentrations were measured in Brown-hooded Gulls (726 ng g{sup -1}). PCB levels were similar among the species (102-236 ng g{sup -1}), but the composition of the PCB mixture was different in Pink-footed Shearwaters. With the exception of the Brown-hooded Gull, all species studied presented similar and low levels of organochlorines ({sigma}OHa). Residues of PCB and related compounds were not detected in any of the seabird eggs analyzed in Chile. Geographical variation was low, although levels of industrial chemicals were slightly higher in eggs from Concepcion Bay, and agricultural chemicals in eggs from Valdivia. Also interannual variation was low, but some evidence was found of decreasing levels in gull eggs throughout the time of the study. The causes of the low levels and small variability in space and time of environmental chemicals in Chilean seabirds are discussed. We propose the use of seabirds in future monitoring of the development of chemical contamination in Chile.

  19. Annuity Markets in Chile : Competition, Regulation - and Myopia?

    OpenAIRE

    Walker, Eduardo

    2006-01-01

    The author studies annuity rates in Chile and relates them with industry competition. He finds (1) that annuity insurance companies paying higher broker commissions paid lower annuity rates; and (2) a structural break of the long-run elasticity of annuity rates to the risk-free rate in 2001. Moreover, this structural break coincided with the submission of a new draft pension law proposing greater transparency in annuity markets and a generalized drop in broker commissions. The high commission...

  20. Energy Recovery from Municipal Solid Waste (MSW) in Chile

    Energy Technology Data Exchange (ETDEWEB)

    Berg, A.; Carrasco, J.C. (Unidad de Desarrollo Tecnologico, Univ. de Concepcion, Concepcion (Chile)); Neugebauer, J. (Polysius AG (ThyssenKrupp Technologies AG), 59269 Beckum (Germany)). e-mail: aberg@udt.cl

    2008-10-15

    MSW amount, along with its disposition cost and environmental impacts have been significantly increasing in Chile. Therefore, goal of current study is to evaluate viable technological solutions for the energetic recovery of MSW. Experimental work in the city Concepcion has been performed on pre-treatment processes. Results show that an appropriate physical separation leads to fractions with specific characteristics, therefore applicable for different energetic uses. Keywords: Municipal solid waste (MSW), combustion, biogas, developing countries.

  1. Controlling Light Pollution in Chile A Status Report.

    Science.gov (United States)

    Smith, Malcolm G.; Sanhueza, P.; Schwarz, H. E.; Walker, A. R.

    2006-12-01

    In 1999, after 6 years of intense work wirh Chilean authoritie Eduardo Frei Ruiz-Tagle, the then President of Chile signed into law Supreme Decree 686, the environmentally-linked "Norma Luminica". This, in effect, required that lighting in the three astronomically-sensitive Regions of Northern Chile (II Paranal,Armazones III Las Campanas IV La Silla, Tololo, Pachon) be directed downwards instead of into the sky. Various grace periods up to a maximum of five years were specified for different types of lighting. Street lighting was due to be fully compliant by 1st October, 2005. 70% of the street lighting in these 3 Regions now meets specifications and work continues towards full compliance. More sophisticated draft legislation is under consideration with several Chilean national authorities. This may include international lighting norms, energy-saving caps and measures to address energy-saving, environmental and human-health issues. With vigilance, these measures are likely to extend the useful life of all existing and major planned observatories in Chile by several decades.

  2. [Early detection of cervical cancer in Chile: time for change].

    Science.gov (United States)

    Léniz Martelli, Javiera; Van De Wyngard, Vanessa; Lagos, Marcela; Barriga, María Isabel; Puschel Illanes, Klaus; Ferreccio Readi, Catterina

    2014-08-01

    Mortality rates for cervical cancer (CC) in Chile are higher than those of developed countries and it has an unequal socioeconomic distribution. The recognition of human papilloma virus (HPV) as the causal agent of cervical cancer in the early 80's changed the prevention paradigms. Current goals are to prevent HPV infection by vaccination before the onset of sexual activity and to detect HPV infection in women older than 30 years. This article reviews CC prevention and early detection methods, discusses relevant evidence to support a change in Chile and presents an innovation proposal. A strategy of primary screening based on HPV detection followed by triage of HPV-positive women by colposcopy in primary care or by cytological or molecular reflex testing is proposed. Due to the existence in Chile of a well-organized nationwide CC prevention program, the replacement of a low-sensitivity screening test such as the Papanicolau test with a highly sensitive one such as HPV detection, could quickly improve the effectiveness of the program. The program also has a network of personnel qualified to conduct naked-eye inspections of the cervix, who could easily be trained to perform triage colposcopy. The incorporation of new prevention strategies could reduce the deaths of Chilean women and correct inequities.

  3. Teenage sexuality and rights in Chile: from denial to punishment.

    Science.gov (United States)

    Casas, Lidia; Ahumada, Claudia

    2009-11-01

    While Chile sees itself as a country that has fully restored human rights since its return to democratic rule in 1990, the rights of teenagers to comprehensive sexuality education are still not being met. This paper reviews the recent history of sexuality education in Chile and related legislation, policies and programmes. It also reports a 2008 review of the bylaws of 189 randomly selected Chilean schools, which found that although such bylaws are mandatory, the absence of bylaws to prevent discrimination on grounds of pregnancy, HIV and sexuality was common. In relation to how sexual behaviour and discipline were addressed, bylaws that were non-compliant with the law were very common. Opposition to sexuality education in schools in Chile is predicated on the denial of teenage sexuality, and many schools punish sexual behaviour where transgression is perceived to have taken place. While the wider Chilean society has been moving towards greater recognition of individual autonomy and sexual diversity, this cultural shift has yet to be reflected in the government's political agenda, in spite of good intentions. Given this state of affairs, the Chilean polity needs to recognise its youth as having human rights, or will continue to fail in its commitment to them.

  4. Privatization of Social Security: Lessons from Chile Privatization of Social Security: Lessons from Chile

    Directory of Open Access Journals (Sweden)

    Peter Diamond

    1994-03-01

    Full Text Available In Chile, all covered workers must save 10% of monthly earnings wilh a highly regulated intermediary Ihat monages a single fund and provides survivors and disability insurance. Workers pay a commission charge, in addition to the mandatory 10%, to finance this insurance and to cover the costs and profits of the intermediaries. On becoming eligible to receive benefits, a worker can choose between a sequence of phased withdrawals and a real annuity. In addition, there is a sizable guaranteed minimum pension. Unlike the purchased annuities, the minimum pension is not indexed, but adjusted by Ihe government from time to time. The Chilean reform gets high marks for defending the system from polilical risk and for its effects on capital accumulation and on the functioning of the capital markel. The Chilean reform gets low marks for the provision of insurance and for administrative cost. Perhaps the most surprising aspect of the Chilean reform is the high cost of running a privatized social security system, higher than the "inefficient" system thal it replaced. Valdes-Prieto has estimated that the average administrative charge per effective affiliate while active is 2.94% of average taxable earnings. This is close to 30% of the 10% mandatory saving rate. The cost per person is not far from costs observed in older privately-managed pension systems. However, it is higher than administrative cost in well-run unified government-managed systems. The issue here is the administrative efficiency of the primte markel, not anything particularly costly about the Chilean system. In Chile, all covered workers must save 10% of monthly earnings wilh a highly regulated intermediary Ihat monages a single fund and provides survivors and disability insurance. Workers pay a commission charge, in addition to the mandatory 10%, to finance this insurance and to cover the costs and profits of the intermediaries. On becoming eligible to receive benefits, a worker can choose

  5. Seroepidemiology of human toxoplasmosis in Chile Seroepidemiología de la toxoplasmosis en Chile

    Directory of Open Access Journals (Sweden)

    Maria del C. Contreras

    1996-12-01

    Full Text Available A series of already published and unpublished seroepidemiological surveys for toxoplasmosis, carried out in Chile in 1982-1994, is reviewed, expanded and analyzed. The surveys included 76,317 apparently healthy individuals of different ages (0.57% of the country's total population, from 309 urban and rural-periurban localities. Urban groups were integrated by blood donors, delivering mothers and middle grade schoolchildren, while rural-periurban individuals corresponded to unselected family groups. Blood samples were collected in filter paper. The presence of antibodies to Toxoplasma gondii was determined by the indirect hemagglutination test (IHAT, titers > 16 were considered positive. The test resulted positive in 28,124 (36.9% of the surveyed people. Two hundred and six (0.3% individuals presented IHAT titers > 1000, probably corresponding to acute or reactivated infections. A progressive increase of positive IHAT from northern to southern regions of the country was noted, phenomenom probably related to geographical conditions and to a higher production and consumption of different types of meat in the latter regions. It is postulated that ingestion of T. gondii cysts by humans is epidemiologically as important as ingestion of oocysts. The results presented stress the epidemiological importance of toxoplasmosis in humans, and warn about eventual implications in immunocompromised patients and in transplacental transmission, organ transplants and transfusions.En este trabajo se revisa, se amplía y se analiza en conjunto una serie de encuestas seroepidemiológicas sobre toxoplasmosis efectuadas en Chile entre 1982 y 1994, utilizando la reacción de hemaglutinación indirecta (RHAI. El estudio incluyó 76.317 personas aparentemente sanas de diferentes edades (0,57% de la problación total del país, procedentes de 309 localidades urbanas y rural-periurbanas. Los grupos urbanos estuvieron constituídos por donantes de sangre, parturientas y

  6. Environmental management in Chile: The power plants case; Gestion ambiental en Chile: Caso de las centrales termoelectricas

    Energy Technology Data Exchange (ETDEWEB)

    Jadrijevic, Maritza [Comision Nacional del Medio Ambiente, (Chile)

    1996-12-31

    In this paper are presented the general aspects of the historic evolution o the legal norms on environmental matters in Chile; general aspects of the electric generation system and the instruments of environmental management currently applied in the fossil fueled power plants, such as: the assessment system of the environmental impact; compliance of the air quality and emissions Standards and plans for decontamination [Espanol] En este trabajo se dan a conocer aspectos generales de la evolucion historica de las normas juridicas en materia ambiental en Chile; aspectos generales del sistema de generacion electrica y los instrumentos de gestion ambiental que actualmente se aplican a las plantas de generacion termoelectricas, tales como: el sistema de evaluacion de impacto ambiental; cumplimiento de normas de la calidad de aire y de emision y, planes de descontaminacion

  7. Hacia un nuevo modelo de desarrollo rural en Chile

    Directory of Open Access Journals (Sweden)

    Daniel Toro

    2016-07-01

    Full Text Available Uno de los sectores sociales más vulnerables en Chile se encuentra íntimamente relacionado al minifundio, a la ruralidad y al trabajador agrícola. La realidad de la industria agraria nacional está determinada por su inherente naturaleza estacional, por la escasez hídrica y por la alta tendencia hacia la informalidad de las relaciones laborales, factores que en conjunto merman la calidad de vida de la población y disminuyen las posibilidades de desarrollo del mundo rural. El diagnóstico es el de una absoluta desvinculación con el mundo social y con el desarrollo económico exhibido en las grandes urbes del país. Por su parte, las estrategias gubernamentales que han pretendido impulsar el desarrollo rural en el país, no han contemplado la total complejidad de sus territorios y se han limitado a fomentar el desarrollo productivo agrícola y a mejorar la cobertura de servicios básicos de la población. El presente artículo, problematiza lo rural como fenómeno sociológico a partir de la resignificación del concepto a lo largo de su historia epistemológica, analizando críticamente el modelo de desarrollo rural presente en Chile. Abstract One of the poorest social strata in Chile is related to small farmsteads, rurality, and farmworker dependent.The reality of the national agricultural industry is determined by it’s seasonal nature, water scarcity and because of it’s high propensity to informality in labor relations. Together, these factors diminish the quality of life and the posibilities of development of rural population. The diagnosis of rurality in Chile is synonim of marginality. Meanwhile, government strategies that have sought to boost rural development have not considered the full complexity of rural territories and have been limited to encourage agricultural production and to improve basic services of the population. This paper problematises the rural concept rural as sociological phenomenon. In addition, the prevailing

  8. [Mortality in Chile 1955-1975: trends and causes].

    Science.gov (United States)

    Taucher, E

    1978-12-01

    Sources for data on mortality in Chile are available from the Instituto National de Estadistica, and from the Servicio National de Salud. For the purpose of this study every possible effort was made to get valid data, relying on the national death register, and on medical certificates of death. Between 1953 and 1963 the mortality rate was 12-13/1000; it abruptly descended in 1973, and rose again, to reach the level of 7.2/1000 in 1975. Male mortality is higher than female mortality. In the years 1974-1975 the mortality rate descended considerably for infants and for children 1-4. If one compares mortality rates in Chile and Sweden for 1975, it is obvious that modern medical technology and different sanitary conditions are responsible for the low mortality rate in Sweden. As to the causes of mortality, 9 diseases are responsible for more than 90% of deaths. During the past 15 years death from cancer was about 110/1000, while violent deaths and deaths by accidents augmented. The death rate for respiratory diseases decreased significantly in 1974-1975. In comparing causes of death in Chile and in the U.S. one notices that respiratory diseases, infectious diseases, and circulatory diseases account for a great number of deaths in Chile, while in the U.S. accidents account for 73.4% of deaths in the 15-24 year old group. Tuberculosis, which has almost disappeared in the U.S., accounts for 5% of deaths in Chile in the 15-44 year old group. Such differences are due to cultural, social and economic diversity in the structure of the 2 countries. Pneumonia still accounts for 50% of infant mortality, and malnutrition for about 39% of mortality of children under 5. Still, most causes of death, like diarrhea in children, could be avoided with proper diagnosis and treatment. Nutrition, sanitary conditions, medical attention, and socioeconomic conditions are finally responsible if Chilean mortality rates still are much higher than those of developed countries.

  9. Field survey of the 16 September 2015 Chile tsunami

    Science.gov (United States)

    Lagos, Marcelo; Fritz, Hermann M.

    2016-04-01

    On the evening of 16 September, 2015 a magnitude Mw 8.3 earthquake occurred off the coast of central Chile's Coquimbo region. The ensuing tsunami caused significant inundation and damage in the Coquimbo or 4th region and mostly minor effects in neighbouring 3rd and 5th regions. Fortunately, ancestral knowledge from the past 1922 and 1943 tsunamis in the region along with the catastrophic 2010 Maule and recent 2014 tsunamis, as well as tsunami education and evacuation exercises prompted most coastal residents to spontaneously evacuate to high ground after the earthquake. There were a few tsunami victims; while a handful of fatalities were associated to earthquake induced building collapses and the physical stress of tsunami evacuation. The international scientist joined the local effort from September 20 to 26, 2015. The international tsunami survey team (ITST) interviewed numerous eyewitnesses and documented flow depths, runup heights, inundation distances, sediment deposition, damage patterns, performance of the navigation infrastructure and impact on the natural environment. The ITST covered a 500 km stretch of coastline from Caleta Chañaral de Aceituno (28.8° S) south of Huasco down to Llolleo near San Antonio (33.6° S). We surveyed more than 40 locations and recorded more than 100 tsunami and runup heights with differential GPS and integrated laser range finders. The tsunami impact peaked at Caleta Totoral near Punta Aldea with both tsunami and runup heights exceeding 10 m as surveyed on September 22 and broadcasted nationwide that evening. Runup exceeded 10 m at a second uninhabited location some 15 km south of Caleta Totoral. A significant variation in tsunami impact was observed along the coastlines of central Chile at local and regional scales. The tsunami occurred in the evening hours limiting the availability of eyewitness video footages. Observations from the 2015 Chile tsunami are compared against the 1922, 1943, 2010 and 2014 Chile tsunamis. The

  10. Una arteria norte-sur y el Santiago de Chile „non plus ultra’: la historia de un largo trayecto. / A north-south artery and Santiago de Chile 'non plus ultra

    Directory of Open Access Journals (Sweden)

    María Isabel Pavez Reyes

    2011-06-01

    Full Text Available Este escrito resume la prehistoria e historia del Complejo Vial Norte-Sur, de Santiago de Chile, como parte de las acciones del Estado de Chile, en la época del urbanismo realizado por el sector público. /This paper summarizes the prehistory and history of North-South Road Complex, Santiago de Chile, as part of the actions of the State of Chile, at the time of planning by the public sector.

  11. Nuevos registros de Phthiraptera (Artropoda: Insecta en Lama pacos Linnaeus 1758, en Chile New records of Phthiraptera (Artropoda: Insecta in Lama pacos Linnaeus 1758, in Chile

    Directory of Open Access Journals (Sweden)

    D González-Acuña

    2007-01-01

    Full Text Available Se cita a Microthoracius mazzai (Werneck 1932 y Bovicola breviceps (Rudow 1866 por primera vez en Chile, y se confirma la presencia de M. praelongiceps (Neumann 1909 parasitando alpacas en la comuna de General Lagos (I Región, Chile. Se discute la importancia de los presentes registros.For the first time in Chile, the presence of Microthoracius mazzai (Werneck 1932 and Bovicola breviceps (Rudow 1866, are reported, and the presence of M. praelongiceps (Neuman 1909 parasiting alpacas in the General Lagos area (I Region is also confirmed. The importance of this situation is discussed in the present report.

  12. 76 FR 78231 - Notice of Decision To Authorize the Importation of Fresh Cape Gooseberry Fruit With Husks From Chile

    Science.gov (United States)

    2011-12-16

    ... continental United States of fresh Cape gooseberry fruit (Physalis peruviana L.) with husks from Chile. Based... fresh Cape gooseberry fruit (Physalis peruviana L.) with husks from Chile. We solicited comments on...

  13. Diffusion and Settling in Ap/Bp Stars

    Energy Technology Data Exchange (ETDEWEB)

    Turcotte, S

    2003-04-09

    Ap/Bp stars are magnetic chemically peculiar early A and late B type stars of the main sequence. They exhibit peculiar surface abundance anomalies that are thought to be the result of gravitational settling and radiative levitation. The physics of diffusion in these stars are reviewed briefly and some model predictions are discussed. While models reproduce some observations reasonably well, more work is needed before the behavior of diffusing elements in a complex magnetic field is fully understood.

  14. On the progenitor of the Type Ic supernova 2002ap

    NARCIS (Netherlands)

    Smartt, SJ; Ramirez-Ruiz, E; Gilmore, GF; Meikle, WPS; Ferguson, AMN; Knapen, JH

    2002-01-01

    This Letter presents wide-field optical and near-IR (UBVRIHalphaK') images of the galaxy M74 that were taken between 0.6 and 8.3 yr before the discovery of the Type Ic supernova 2002ap. We have located the position of the supernova on these images with an accuracy of 0."3. We find no sign of a proge

  15. A Low-Power CoAP for Contiki

    OpenAIRE

    Kovatsch M.; Duquennoy S.; Dunkels A.

    2011-01-01

    Internet of Things devices will by and large be battery-operated, but existing application protocols have typically not been designed with power-efficiency in mind. In low-power wireless systems, power-efficiency is determined by the ability to maintain a low radio duty cycle: keeping the radio off as much as possible. We present an implementation of the IETF Constrained Application Protocol (CoAP) for the Contiki operating system that leverages the ContikiMAC low-powe...

  16. Characteristics of shigellosis outbreaks in the AP of Vojvodina

    OpenAIRE

    2009-01-01

    Introduction. Shigellosis causes around 165 million infections and around 1 million deaths in the world every year. Two thirds of both infections and deaths are among children younger than 10. Shigellosis mainly spreads by direct or indirect contact, but water- and food-borne outbreaks are not rare. Material and methods. A descriptive epidemiological method was used to analyse characteristics of shigellosis outbreaks in the AP of Vojvodina in the period 1979-2005. Results. During this period ...

  17. Diffusion and Settling in Ap/Bp Stars

    CERN Document Server

    Turcotte, S

    2003-01-01

    Ap/Bp stars are magnetic chemically peculiar early A and late B type stars of the main sequence. They exhibit peculiar surface abundance anomalies that are thought to be the result of gravitational settling and radiative levitation. The physics of diffusion in these stars are reviewed briefly and some model predictions are discussed. While models reproduce some observations reasonably well, more work is needed before the behavior of diffusing elements in a complex magnetic field is fully understood.

  18. Essay: Computers in the APS Editorial Office: The Early Years

    Science.gov (United States)

    Adams, Peter

    2009-03-01

    APS journals in the late 1960s began to move from hot-metal print shops to tailor-made typewriters, next to special keyboards and a small computer, then to completely photocomposed journal pages. At the same time, internal editorial operations were being converted from paper handling and data records to completely electronic procedures. By 1990, it became feasible for authors to submit manuscripts to the journal electronically.

  19. Heterologous expression of ApGSMT2 and ApDMT2 genes from Aphanothece halophytica enhanced drought tolerance in transgenic tobacco.

    Science.gov (United States)

    He, Ying; He, Chunmei; Li, Lihua; Liu, Zhili; Yang, Aifang; Zhang, Juren

    2011-01-01

    The glycine-methylation biosynthetic pathway of glycinebetaine (GB) has been investigated, but only a few studies on GB accumulation in transgenic higher plants have utilized this pathway. In this study, two methyltransferase genes named ApGSMT2 and ApDMT2, encoding proteins catalyzing GB biosynthesis from glycine, were cloned from a relative strain of Aphanothece halophytica. The potential roles of ApGSMT2 and ApDMT2 in GB synthesis were first examined in transgenic Escherichia coli, which had increased levels of GB and improved salt tolerance. Then ApGSMT2 and ApDMT2 were transferred into tobacco. Compared with transgenic tobacco expressing betA, transgenic tobacco co-expressing ApGSMT2 and ApDMT2 accumulated more GB and exhibited enhanced drought resistance with better germination performance, higher relative water content, less cell membrane damage and better photosynthetic capacity under drought stress. We concluded that the ApGSMT2 and ApDMT2 genes cloned in this study will be very useful for engineering GB-accumulating transgenic plants with enhanced drought resistance.

  20. Long-term stability of the APS storage ring

    Energy Technology Data Exchange (ETDEWEB)

    Friedsam, H.; Penicka, M.; Error, J.

    1999-10-26

    The Advanced Photon Source (APS), a third-generation synchrotrons light source, was commissioned in 1995 at Argonne ''National Laboratory and has been fully-operational for beamline users since 1997. The APS storage ring can accommodate up to 68 user beamlines; about 70% of the available beamlines are currently in use by various collaborative access teams (CATS). The 7-GeV synchrotrons light source produces light in the soft to hard x-ray range that is used for research in such areas as x-ray instrumentation; material, chemical and atomic sciences; biology; and geo/soil/ environmental sciences. For the successful operation of an x-ray light source such as the Advanced Photon Source, the long-term stability of the concrete floor supporting the beam components and user beamlines is crucial. Settlements impact the orbit and location of the x-ray source points as well as the position of the x-ray beamlines. This paper compares the results of two successive resurveys of the APS accelerator components performed in 1995 and 1998.

  1. AP Theory IV: Intrinsic Topological Quantum Langlands Theory

    CERN Document Server

    Winkelnkemper, H E

    2010-01-01

    Without using any moduli, sheaves, stacks, nor any analytic, nor category-type arguments, we exhibit an analogue to Geometric Langlands Theory in an entirely model-independent, non-perturbative,purely smooth topological context in Artin Presentation Theory. A basic initial feature is that AP Theory, as a whole, is already, ab initio, a universal canonical 2D sigma-model, targeting smooth, compact, simply-connected 4-manifolds with a connected boundary, and its topological Planckian quantum starting point, as well as its cone-like, infinitely-generated at each stage, graded group of homology-preserving, but topology-changing transitions/interactions, exhibit the most general qualitative S-duality. We first point out the numerous mathematically rigorous, model-free, (i.e., intrinsic), topological AP analogues with the heuristic Kapustin-Witten version of Geometric Langlands theory, as well as the crucial differences between the two theories. The latter have to exist since AP Theory deals, a priori, essentially ...

  2. 76 FR 18511 - Notice of Decision To Issue Permits for the Importation of Fresh Figs From Chile into the...

    Science.gov (United States)

    2011-04-04

    ..., and baby kiwi fruit from Chile. We solicited comments on the notice for 60 days ending on April 12... fresh pomegranates and baby kiwi from Chile into the United States,\\2\\ published in the Federal Register... pomegranates and baby kiwi from Chile in our May 2010 notice. The commenter stated that fumigation of...

  3. 78 FR 70276 - Trade Mission to Colombia, Peru, Chile, Panama, and Ecuador in Conjunction With Trade Winds-The...

    Science.gov (United States)

    2013-11-25

    ... International Trade Administration Trade Mission to Colombia, Peru, Chile, Panama, and Ecuador in Conjunction..., International Trade Administration is organizing a trade mission to Colombia, Peru, Chile, Panama and Ecuador... from the USFCS, including in Colombia, Peru, Chile, Panama and Ecuador. Each trade mission stop...

  4. Ontological disorders: nightmares, psychotropic drugs and evil spirits in southern Chile

    NARCIS (Netherlands)

    Bonelli, C.

    2012-01-01

    This article explores several equivocations in the relationship between state healthcare workers and the Pehuenche population in southern Chile. In particular, it focuses on radical differences in understanding the body, personhood, sleeping and dreaming. In Alto Bío Bío, Chile, while healthcare wor

  5. [Claudio Costa Casaretto M.D. (1914-1999) in Revista Medica de Chile].

    Science.gov (United States)

    Goic, A

    1999-10-01

    The work of Dr. Claudio Costa Casaretto covers a broad field in the history of Medicine in Chile. He contributed with the historical aspects in the Centennial issue of Revista Médica de Chile in July, 1972. He published 85 papers in this journal in a lapse of 20 years. In his works, he investigated about medical personalities with the highest relevance for Chilean medicine such as Dr. William Blest, graduated in Edinburgh and director of the first Medicine Course in Chile in 1833, the French obstetrician Dr. Lorenzo Sazie, first Dean of the Faculty of Medicine of the University of Chile in 1843 and Dr. Eloisa Díaz, first physician graduated in Chile and South America in 1887. He published the translation from Latin of Juan Ignacio Molina's verses "Elegies to smallpox", Chilean writer and erudite of the XVIII century. He also undertook the origins of Universidad de San Felipe (1737), Universidad de Chile (1842) and Pontificia Universidad Católica de Chile (1889) and the main educational events occurred in the Faculty of Medicine of the University of Chile, during the past century. He also published about the public health situation and sanitary care during the XIX century, about the conflict between private and public teaching and other political events of the past century. The work of Dr. Costa as a whole, is a real history textbook of Chilean Medicine. Dr. Costa and Dr. Enrique Laval are the most important Chilean medical historians of the XX century.

  6. Credit constraints in rural financial markets in Chile: determinants and consequences

    NARCIS (Netherlands)

    Reyes, A.

    2011-01-01

    Using data from two surveys carried out in 2006 and 2008 on 177 farmers in Chile, this study measures access to credit and empirically determine the effects of credit constraints on investment and production for market-oriented farmers in central Chile. More specifically, four issues are dealt with:

  7. 75 FR 28059 - Actual Effects of the Free Trade Agreements With Chile, Australia, and Singapore

    Science.gov (United States)

    2010-05-19

    ... COMMISSION Actual Effects of the Free Trade Agreements With Chile, Australia, and Singapore AGENCY: United... Singapore. DATES: July 15, 2010: Deadline for filing written submissions. December 13, 2010: Transmittal of...) concluded with Chile, Singapore, and Australia. In its report the Commission will-- (1) With respect to...

  8. 76 FR 14320 - Importation of Figs and Pomegranates From Chile Under a Systems Approach

    Science.gov (United States)

    2011-03-16

    ... allowed. Importation of pomegranates (Punica granatum) from Chile is allowed if the fruit is fumigated... Pomegranate (Punica granatum) and Fig (Ficus carica) from Chile Imported into the Continental United States.... Fresh figs (Ficus carica) and fresh pomegranates (Punica granatum) may be imported into the...

  9. Citizenship ‘from Above’? The Case of Chile, 1964-2010

    NARCIS (Netherlands)

    Van der Ree, Gerard

    2011-01-01

    During the last fifty years, citizenship in Chile has been re-interpreted and reformulated in different ways. By combining top-down and bottom-up approaches towards citizenship, this article argues that the reformulation of citizenship in Chile has been brought about through both state-initiated pro

  10. Cold atoms observed for the first time at the Universidad de Santiago de Chile

    Energy Technology Data Exchange (ETDEWEB)

    Olivares, Ignacio E; Aguilar, Felipe [Departamento de Fisica, Universidad de Santiago de Chile, Avenida Ecuador 3493, Estacion Central, Santiago (Chile); Aguirre-Gomez, J G [Center for Quantum Optics and Quantum Information, Departamento de Fisica, Universidad de Conception Avenida Esteban Iturra s/n Barrio Universitario, Conception (Chile)], E-mail: ignacio.olivares@gmail.com

    2008-11-01

    A cloud of cold {sup 85}Rb atoms was recently observed for the first time in Chile in a magneto optical trap using a Rb getter. We also observed cooling and trapping of the {sup 87}Rb isotope. This experience represents a preliminary result for an ongoing effort to promote the experimental research in the field of quantum optics in Chile.

  11. Apprenticeship in Latin America: The INACAP Program in Chile. A Case Study. Occasional Paper #6.

    Science.gov (United States)

    Corvalan-Vasquez, Oscar E.

    The development of apprenticeship programs in several Latin American countries was investigated with a focus on the results of an industrial apprenticeship program in Santiago, Chile. The program studied was the Instituto Nacional de Capacitacion Profesional (INACAP), the national vocational training institute of Chile. The purpose of the study…

  12. Strepsicrates smithiana Walsingham (Lepidoptera, Tortricidae: first record from Chile and a newly documented host plant

    Directory of Open Access Journals (Sweden)

    Héctor A. Vargas

    2012-09-01

    Full Text Available Strepsicrates smithiana Walsingham (Lepidoptera, Tortricidae: first record from Chile and a newly documented host plant. Strepsicrates smithiana Walsingham, 1892 (Lepidoptera, Tortricidae is recorded for the first time from Chile. Male and female adults were reared from leaf-tying larvae collected on Myrica pavonis (Myricaceae, which is a new host plant record for S. smithiana.

  13. 77 FR 64106 - Renewable Energy and Energy Efficiency Trade Policy Mission to Chile

    Science.gov (United States)

    2012-10-18

    ... policy mission participation fees. Commercial Setting: Chile's fast growing economy and business friendly.... In a speech on February 28, 2012, President Pi era announced the Government of Chile (GoC) would... growth for years to come. ITA's U.S. and Foreign Commercial Service (US&FCS) at the U.S. Embassy...

  14. The Adolescent Novel in AP English: A Response to Patricia Spencer.

    Science.gov (United States)

    McGee, Tim

    1992-01-01

    Discusses the absence of adolescent literature in Advanced Placement (AP) English classes. Describes how a class of AP students and their teacher benefited from reading Robert Cormier's "The Chocolate War." (PRA)

  15. Recombinant thermostable AP exonuclease from Thermoanaerobacter tengcongensis: cloning, expression, purification, properties and PCR application

    DEFF Research Database (Denmark)

    Dabrowski, Slawomir; Brillowska-Dabrowska, Anna; Ahring, Birgitte Kiær

    2013-01-01

    Apurinic/apyrimidinic (AP) sites in DNA are considered to be highly mutagenic and must be corrected to preserve genetic integrity, especially at high temperatures. The gene encoding a homologue of AP exonuclease was cloned from the thermophilic anaerobic bacterium Thermoanaerobacter tengcongensis...... (14000 kU) of pure His6-tagged Tte AP (153 kU/mg) from 1 liter of culture. The optimal conditions of Tte AP endo-, exonuclease and 3'-nuclease activity were investigated using fluorescein labeled dsDNA with inserted AP sites and ssDNA. Optimal Tte AP endonuclease activity was observed at 70-75 degrees C...... DNA templates. Tte AP exonuclease eliminated AP-sites in DNA template and improved the efficiency of DNA amplification....

  16. Conservación de la biodiversidad en Chile: Nuevos desafíos y oportunidades en ecosistemas terrestres y marinos costeros Biodiversity conservation in Chile: New challenges and opportunities in terrestrial and marine coastal ecosystems

    Directory of Open Access Journals (Sweden)

    CARMEN JORQUERA-JARAMILLO

    2012-09-01

    Full Text Available La pérdida de la biodiversidad producida por el crecimiento demográfico, la demanda por recursos y la actividad productiva es contradictoria con el reconocimiento de su importancia. En ecosistemas terrestres, el Sistema Nacional de Áreas Protegidas del Estado (SNASPE contiene cerca del 19 % del territorio de Chile continental; aunque no representa todos los ecosistemas con especies amenazadas, puede ser complementado implementando nuevas áreas protegidas públicas (AP y privadas (APP. El desarrollo de áreas marinas protegidas (AMP es incipiente, y algunas iniciativas comparten la responsabilidad de conservación con los usuarios locales. En Chile, un conjunto de reglamentos, normas legales y tratados internacionales promueven distintas oportunidades de conservación en ecosistemas terrestres y marinos costeros, de las cuales emergen nuevos desafíos. Entre estos destacan, estandarizar la clasificación de especies según categorías de conservación en un protocolo internacional y optimizar las metodologías para seleccionar áreas prioritarias, ambos criterios indispensables para decidir qué y dónde conservar. Otro desafío es integrar el valor intrínseco de la biodiversidad con los servicios ecosistémicos que presta para instaurar una cultura participativa. Esto mejoraría la efectividad de las distintas estrategias de protección y uso sustentable de la biodiversidad al incorporar la educación y la participación ciudadana desde una perspectiva biocultural. La educación fomenta la conservación de la naturaleza al hacernos conscientes de nuestro entorno; mientras que la participación involucra a los ciudadanos como un actor más en la toma de decisiones, procurando la aplicación efectiva de las estrategias de conservación de la biodiversidad.Biodiversity loss caused by population growth, the demand of resources and productive activities is inconsistent with the recognition of its importance. In terrestrial ecosystems, the

  17. NRC confirmatory AP600 safety system phase I testing in the ROSA/AP600 test facility

    Energy Technology Data Exchange (ETDEWEB)

    Rhee, G.S.; Kukita, Yutaka; Schultz, R.R.

    1996-03-01

    The NRC confirmatory phase I testing for the AP600 safety systems has been completed in the modified ROSA (Rig of Safety Assessment) test facility located at the Japan Atomic Energy Research Institute (JAERI) campus in Tokai, Japan. The test matrix included a variety of accident scenarios covering both design and beyond-design basis accidents. The test results indicate the AP600 safety systems as reflected in ROSA appear to perform as designed and there is no danger of core heatup for the accident scenarios investigated. In addition, no detrimental system interactions nor adverse effects of non-safety systems on the safety system functions were identified. However, three phenomena of interest have been identified for further examination to determine whether they are relevant to the AP600 plant. Those three phenomena are: (1) a potential for water hammer caused by rapid condensation which may occur following the actuation of the automatic depressurization system (ADS), (2) a large thermal gradient in the cold leg pipe where cooled water returns from the passive residual heat removal system and forms a thermally stratified layer, and (3) system-wide oscillations initiating following the ADS stage 4 actuation and persisting until the liquid in the pressurizer drains and steam generation in the core becomes insignificant.

  18. FRANX. Application for analysis and quantification of the APS fire; FRANK. Aplicacion para el analisis y cuantificacion de los APS de incendios

    Energy Technology Data Exchange (ETDEWEB)

    Snchez, A.; Osorio, F.; Ontoso, N.

    2014-07-01

    The FRANX application has been developed by EPRI within the Risk and Reliability User Group in order to facilitate the process of quantification and updating APS Fire (also covers floods and earthquakes). By applying fire scenarios are quantified in the central integrating the tasks performed during the APS fire. This paper describes the main features of the program to allow quantification of an APS Fire. (Author)

  19. Uma insólita visita: Fidel Castro no Chile de Allende An uncommon visit: Fidel Castro in Allende’s Chile

    Directory of Open Access Journals (Sweden)

    Alberto Aggio

    2003-01-01

    Full Text Available Este artigo busca expor sinteticamente o que foi a viagem que Fidel Castro realizou ao Chile em novembro de 1971, e também refletir a respeito tanto das estratégias políticas evidenciadas por Castro em sua estadia no Chile, quanto sobre as conseqüências que derivaram dessas estratégias para o processo conhecido como a "experiência chilena". Conclui afirmando que, se não se pode atribuir à visita de Fidel toda a confrontação que mais tarde iria se estabelecer no Chile, também não se pode isentar integralmente o dirigente cubano de uma certa responsabilidade quanto à situação que se impôs. Esta viagem de Fidel ao Chile de Allende foi uma viagem incomum, distinta de qualquer padrão diplomático, e abrigou silenciosamente uma profunda disputa política no interior da esquerda latino-americana que permaneceu por muito tempo desconhecida.This paper discusses briefly the meaning of Fidel Castro’s visit to Chile in November 1971; it intends as well to present a reflection on both the political strategies shown by Fidel during his stay in Chile and its consequence for the process known as "the Chilean experience". It takes us to assume that if all confrontation that occurred in Chile late on cannot be attributed to this visit, neither can Fidel be considered completely free from responsibility for it. This visit to Allende’s Chile was uncommon, different from all diplomatic patterns; it resulted in a silent and deep political dispute in the Latin-American Left, which remained unknown for much time.

  20. AP Studio Art as an Enabling Constraint for Secondary Art Education

    Science.gov (United States)

    Graham, Mark A.

    2009-01-01

    Advanced Placement (AP) Studio Art is an influential force in secondary art education as is evident in the 31,800 portfolios submitted for review in 2008. From the perspectives of a high school educator and AP Reader, this author has observed how the constraints of the AP program can be used to generate support for high school art programs and…

  1. Using a Classroom Response System to Improve Multiple-Choice Performance in AP[R] Physics

    Science.gov (United States)

    Bertrand, Peggy

    2009-01-01

    Participation in rigorous high school courses such as Advanced Placement (AP[R]) Physics increases the likelihood of college success, especially for students who are traditionally underserved. Tackling difficult multiple-choice exams should be part of any AP program because well-constructed multiple-choice questions, such as those on AP exams and…

  2. FÍSICA: SU TRAYECTORIA EN CHILE (1800-1960

    Directory of Open Access Journals (Sweden)

    CLAUDIO GUTIÉRREZ GALLARDO

    2006-12-01

    Full Text Available El artículo presenta el desarrollo de la Física en Chile desde los comienzos de la República hasta 1960, poniendo énfasis en el desarrollo interno de la disciplina, la evolución de su concepción y la transmisión de su saber. El trabajo enfrenta el mito de la inexistente tradición científica en Chile, mostrando que en el caso de la Física ha habido un largo y sostenido desarrollo. En este desarrollo de la Física se distinguen cuatro etapas: (1 como capítulo de la Filosofía Escolástica; (2 como ciencia útil o indistinguible de la ingeniería; (3 como ciencia cultural y centro de una concepción científica del mundo; y (4 como disciplina con problemas propios, donde la investigación deviene parte central de su desarrollo. Para el historiador de la ciencia la novedad es que su desarrollo sigue una lógica donde los parámetros locales tienen una influencia muy significativa en comparación con aquellos determinados por el desarrollo mundial de la disciplinaThis paper presents the development of Physics in Chile from the beginnings of the Republic until the year 1960, emphasizing the internal development of the discipline, the evolution of its conception and the transmission of its body of knowledge. This work faces the myth of the non-existent scientific tradition in Chile by showing in the case of Physics a long and sustained development. In this development we distinguish four stages of Physics: (1 As a chapter of Scholastic Philosophy; (2 As a discipline closely related to engineering and real-life problems; (3 As cultural science and base of a scientific view of the world; (4 As a discipline with its own problems, where research becomes a central part of its development. For the science historian the novelty is that this development follows a logic where the local parameters have strong influence as compared to those determined by the universal development of the discipline

  3. Quaternary pollen record from laguna de tagua tagua, chile.

    Science.gov (United States)

    Heusser, C J

    1983-03-25

    Pollen of southern beech and podocarp at Laguna de Tagua Tagua during the late Pleistocene indicates that cooler and more humid intervals were a feature of Ice Age climate at this subtropical latitude in Chile. The influence of the southern westerlies may have been greater at this time, and the effect of the Pacific anticyclone was apparently weakened. The climate today, wet in winter and dry in summer, supports broad sclerophyll vegetation that developed during the Holocene with the arrival of paleo-Indians and the extinction of mastodon and horse.

  4. Geopolitics representation: Chile and Argentina in southern ice fields

    Directory of Open Access Journals (Sweden)

    Karen Isabel Manzano Itura

    2015-11-01

    Full Text Available Geopolitics, from concept named in 1917 by Rudolf Kjellén has been in continuous evolution until today. Since the incorporation of the representations, the first concept has been of vital importance in different territorial conflicts’ analysis. By means of a geopolitical analysis, the present article intends to understand the geopolitical representations in the area of southern ice fields, the last boundaries issue that still remains in abeyance between Chile and Argentina and how is that both countries have discussed the problem on a basis of representations, in which maps have been the image of each one facing the other, favoring in this way competition between states.

  5. Desarrollo de la Energía Mareomotriz en Chile.

    Directory of Open Access Journals (Sweden)

    Daniel Vega Salinas

    2014-10-01

    Full Text Available El presente artículo trata una revisión del estado del arte de la energía marina, que puede ser generada por las mareas o el oleaje, se analizaron las experiencias a nivel mundial, así como se estudió la factibilidad técnica y económica de la instalación de esta fuente de energía en Chile, específicamente para la industria del cultivo de salmón.

  6. Fruit production in Chile: bright past, uncertain future

    Directory of Open Access Journals (Sweden)

    Jorge B. Retamales

    2011-10-01

    Full Text Available In 2007 (the last agricultural census, Chile had 308, 445 ha of fruit orchards: an increase of almost 32% from the previous census (1997. The most important species were table grapes (20%, avocados (13% and apples (12%. Some 22% of the fruit crops growing area corresponded to juvenile orchards; within the species with higher proportion of juvenile orchards were prunes (42% and blueberries (56%. Most orchards are located between latitude 27º18` S (Copiapó and 40º36´S (Puerto Varas. The industry is driven by the export component which accounts for more than 50% of the fruits produced. In the crop season 2009-2010, approximately 254 million boxes (around 2.5 million tons were exported, representing over US$ 3.5 million. Processed and fresh fruits represented 8.2 and 26.7% of the total forest and agricultural Chilean exports in 2008, respectively. The main markets for this fruits were USA/Canada (42% and Europe (32%. The fruit grower receives, on average, 12-16% of the total price of the fruit in its final destination. Each year the fruit industry employs 450.000 people directly, of which 1/3 are permanent. Even though the fruit industry employs the highest proportion of the agricultural labor and the growing area has increased in the last 20 years, the proportion of agricultural employment has decreased from 19.5% in 1989 to 10.8% in 2008. It might also be noted that Chile invests only 0.7% of the GDP in research. In the last 40 years, the fruit industry has been a motor for the Chilean economic development, but the lower rates of currency exchange, the rising costs of energy (oil, electricity, and the increasing scarcity of hand labor have drastically reduced the profitability and are putting at risk the viability of a large proportion of the fruit orchards in Chile. It is estimated that this season around 65% of the orchards will have a negative economic balance in their operations. Higher investment in research, improvements in fruit quality

  7. MOVILIDAD SUSTENTABLE EN CHILE: OPORTUNIDADES, EXPERIENCIAS LOCALES Y REFERENCIAS GLOBALES

    OpenAIRE

    Jorge Díaz Tejeda

    2012-01-01

    Este artículo propone Premisas Conceptuales, Premisas Metodológicas y el desarrollo de Aspectos Estratégicos para la implementación de soluciones a la Movilidad Urbana. Se inspira en las ideas, experiencias e investigaciones de diversas personas quienes abordan desde lógicas puntuales aspectos temáticos específicos en el marco de la Planificación Urbana en general y de las aplicaciones en Transporte en particular. Chile atraviesa por una oportunidad histórica, quizás paradójicamente, a partir...

  8. Medication Overdoses at a Public Emergency Department in Santiago, Chile

    Directory of Open Access Journals (Sweden)

    Pablo Aguilera, MD

    2016-01-01

    Full Text Available Introduction: While a nationwide poison control registry exists in Chile, reporting to the center is sporadic and happens at the discretion of the treating physician or by patients’ self-report. Moreover, individual hospitals do not monitor accidental or intentional poisoning in a systematic manner. The goal of this study was to identify all cases of intentional medication overdose (MO that occurred over two years at a large public hospital in Santiago, Chile, and examine its epidemiologic profile. Methods: This study is a retrospective, explicit chart review conducted at Hospital Sótero del Rio from July 2008 until June 2010. We included all cases of identified intentional MO. Alcohol and recreational drugs were included only when they were ingested with other medications. Results: We identified 1,557 cases of intentional MO and analyzed a total of 1,197 cases, corresponding to 0.51% of all emergency department (ED presentations between July 2008 and June 2010. The median patient age was 25 years. The majority was female (67.6%. Two peaks were identified, corresponding to the spring of each year sampled. The rate of hospital admission was 22.2%. Benzodiazepines, selective serotonin reuptake inhibitors, and tricyclic antidepressants (TCA were the causative agents most commonly found, comprising 1,044 (87.2% of all analyzed cases. Acetaminophen was involved in 81 (6.8% cases. More than one active substance was involved in 35% of cases. In 7.3% there was ethanol co-ingestion and in 1.0% co-ingestion of some other recreational drug (primarily cocaine. Of 1,557 cases, six (0.39% patients died. TCA were involved in two of these deaths. Conclusion: Similar to other developed and developing nations, intentional MO accounts for a significant number of ED presentations in Chile. Chile is unique in the region, however, in that its spectrum of intentional overdoses includes an excess burden of tricyclic antidepressant and benzodiazepine overdoses, a

  9. Estrategia de desarrollo del sector privado (PSDS) para Chile

    OpenAIRE

    Roberto Zahler

    2006-01-01

    El objetivo de este informe es desarrollar el "outline" elaborado por el BID, para perfilar una propuesta de estrategia que podría ser adoptada por el Banco para apoyar el desarrollo del sector privado en Chile. El informe sostiene que el sector público chileno viene desarrollando, desde hace tiempo políticas de desarrollo que, acompañadas por una interacción con el sector privado (buscando un adecuado marco de actuación para las actividades de éste), han constituido un éxito en la Región. Es...

  10. Lejos de NYC: El hip-hop en Chile

    OpenAIRE

    Rainer Quitzow

    2005-01-01

    En este artículo se abordan las manifestaciones concretas de una forma cultural urbana exportada desde Occidente a los países en desarrollo. A través de una reconstrucción de la historia de la cultura hip hop en Chile, se han intendado esbozar algunas conclusiones sobre su influencia en la formación de una identidad cultural urbana, tratando además de relacionar el desarrollo histórico del movimiento y de las prácticas actuales de la juventud en Santiago con tendencias más amplias en la socie...

  11. Large groups in the Chile-UK quasar survey

    CERN Document Server

    Newman, P R; Campusano, L E; Graham, M J; Newman, Peter R.; Clowes, Roger G.; Campusano, Luis E.; Graham, Matthew J.

    1997-01-01

    The Chile-UK quasar survey, a new-generation 140 deg^2 UVX survey to B = 20, is now \\sim 25 per cent complete. The catalogue currently contains 319 quasars and 93 emission line galaxies. Using the minimal-spanning tree method, we have independently confirmed the \\sim 200 h^-1 Mpc group of quasars at z \\simeq 1.3 discovered by Clowes & Campusano (1991). We have discovered a new \\sim 150 h^-1 Mpc group of 13 quasars at median z \\simeq 1.51. The null hypothesis of a uniform, random distribution is rejected at a level of significance of 0.003 for both groups.

  12. Increasing organ donation by presumed consent and allocation priority: Chile.

    Science.gov (United States)

    Zúñiga-Fajuri, Alejandra

    2015-03-01

    Chile, a middle-income country, recently joined Israel and Singapore as the world's only countries to require reciprocity as a precondition for organ transplantation. The Chilean reform includes opt-out provisions designed to foster donation and priority for organ transplantation for registered people. Although the reform has had serious difficulties in achieving its mission, it can be reviewed by other countries that seek to address the serious shortage of organs. As increased organ donation can substantially enhance or save more lives, the effect on organ availability due to incentives arising from rules of preference should not be underestimated.

  13. Peumus boldus (Monimiaceae, Magnoliopsida) una especie silvestre promisoria de Chile

    OpenAIRE

    San Martín Acebedo, José; Doll, Ursula

    1998-01-01

    Se organiza y sintetiza la información relacionada con la botánica, ecología y el contenido químico de extraíbles de hojas, corteza y madera de Peumus boldus (Monimiaceae, Magnoliopsida), árbol siempreverde, autóctono, endémico y termófilo de los bosques y matorrales esclerófilos naturales del área mediterránea de Chile. La popularidad y conocimiento de la especie tiene arraigo en la medicina popular empírica, dado el efecto farmacológico atribuible fundamentalmente, al alcaloide boldina, pre...

  14. The Intertemporal Approach to the Current Account: Evidence for Chile

    Directory of Open Access Journals (Sweden)

    Sergio A. Salas Landeau

    2002-03-01

    Full Text Available This paper studies the existence of "excess" current-account imbalances in Chile in the 1960-1999 period. This phenomenon is modelled using present value tests that allow for variable interest rates and exchange rate fluctuations. Despite its simplicity, most of the observed imbalances in the current account are accounted for by the model. Results suggest that using models where agents behave as forward-looking rational agents, is a valid framework. Moreover, the analysis highlights the rel-evance of variable interest rates and exchange rates. Results also imply that capital controls, that were widely used in the period under study, were not effective.

  15. Chanco formation, a potential Cretaceous reservoir, central Chile

    Energy Technology Data Exchange (ETDEWEB)

    Cecione, G.

    1983-07-01

    The Chanco embayment lies 300 km SSW of Santiago, Chile. The sequence within this basin above the metamorphic basement is: Chanco Formation (very clean sandstone), Quiriquina Formation (glauconitic sandstone, rich in organic matter), and Navidad Group (a very good caprock). This section thus contains reservoir, source and caprocks, and is therefore very promising for petroleum investigations. The offshore C-1 well yielded salt-water with gas shows, and two wells drilled onshore yielded shows of gas. The C-1 well lies on a gently-dipping EW-striking anticlinal structure, the presence of which makes the area very prospective.

  16. Plant-specific insertions in the soybean aspartic proteinases, soyAP1 and soyAP2, perform different functions of vacuolar targeting.

    Science.gov (United States)

    Terauchi, Kaede; Asakura, Tomiko; Ueda, Haruko; Tamura, Tomoko; Tamura, Kentaro; Matsumoto, Ichiro; Misaka, Takumi; Hara-Nishimura, Ikuko; Abe, Keiko

    2006-07-01

    Most aspartic proteinases (APs) of plant origin are characterized by the presence of plant-specific insertion (PSI) in their primary structure. PSI has been reported to function as signals for both transport of AP molecules from the endoplasmic reticulum (ER) and for their targeting to the vacuole. To determine the functions of the PSIs in soyAP1 and soyAP2 identified in our previous study, we examined their subcellular localization by transient expression of a green fluorescent protein (GFP) fusion protein in the protoplasts of Arabidopsis suspension-cultured cells. Both soyAP1-GFP and soyAP2-GFP were targeted to the vacuole. To confirm the role of the PSI, we prepared PSI-deleted soyAP1 and soyAP2, and investigated their vacuolar targeting by the same method. While the former deletion mutant was always transported to the vacuole, the latter sometimes remained in the ER and was only sometimes transported to the vacuole. These observations indicated that, in the case of soyAP1, the PSI is not involved in vacuolar targeting, also suggesting that the function of the PSI differs depending on its origin.

  17. Structural characterization of the N-terminal mineral modification domains from the molluscan crystal-modulating biomineralization proteins, AP7 and AP24.

    Science.gov (United States)

    Wustman, Brandon A; Morse, Daniel E; Evans, John Spencer

    2004-08-05

    The AP7 and AP24 proteins represent a class of mineral-interaction polypeptides that are found in the aragonite-containing nacre layer of mollusk shell (H. rufescens). These proteins have been shown to preferentially interfere with calcium carbonate mineral growth in vitro. It is believed that both proteins play an important role in aragonite polymorph selection in the mollusk shell. Previously, we demonstrated the 1-30 amino acid (AA) N-terminal sequences of AP7 and AP24 represent mineral interaction/modification domains in both proteins, as evidenced by their ability to frustrate calcium carbonate crystal growth at step edge regions. In this present report, using free N-terminal, C(alpha)-amide "capped" synthetic polypeptides representing the 1-30 AA regions of AP7 (AP7-1 polypeptide) and AP24 (AP24-1 polypeptide) and NMR spectroscopy, we confirm that both N-terminal sequences possess putative Ca (II) interaction polyanionic sequence regions (2 x -DD- in AP7-1, -DDDED- in AP24-1) that are random coil-like in structure. However, with regard to the remaining sequences regions, each polypeptide features unique structural differences. AP7-1 possesses an extended beta-strand or polyproline type II-like structure within the A11-M10, S12-V13, and S28-I27 sequence regions, with the remaining sequence regions adopting a random-coil-like structure, a trait common to other polyelectrolyte mineral-associated polypeptide sequences. Conversely, AP24-1 possesses random coil-like structure within A1-S9 and Q14-N16 sequence regions, and evidence for turn-like, bend, or loop conformation within the G10-N13, Q17-N24, and M29-F30 sequence regions, similar to the structures identified within the putative elastomeric proteins Lustrin A and sea urchin spicule matrix proteins. The similarities and differences in AP7 and AP24 N-terminal domain structure are discussed with regard to joint AP7-AP24 protein modification of calcium carbonate growth.

  18. Parasites of the Green-backed Firecrown (Sephanoides sephaniodes in Chile Parásitos del picaflor chico (Sephanoides sephaniodes en Chile

    Directory of Open Access Journals (Sweden)

    Daniel González-Acuña

    2011-12-01

    Full Text Available Gastrointestinal and external parasites from 12 Green-backed Firecrown (Sephanoides sephaniodes were collected between January 2004 and December 2008 from the Biobío Region south-central Chile and Santiago (central Chile. Helminths collected included 1 trematode species (Mosesia sp. and 1 cestode species (Hymenolepis trinidadensis. The mite Proctophyllodes huitzilopchtlii was the only ectoparasite species found. All these parasites represent new records for Chile and the first parasites reported for this host species.Se recolectaron parásitos internos (gastrointestinales y externos de 12 picaflores (Sephanoides sephaniodes entre enero del 2004 y diciembre del 2008, de la región del Biobío en el centro-sur de Chile y en Santiago, en la región central de Chile. Los helmintos recolectados incluyeron 1 especie de trematodo (Mosesia sp. y 1 de cestodo (Hymenolepis trinidadensis. Únicamente se encontró 1 especie de ectoparásito, el ácaro Proctophyllodes huitzilopchtlii. Todos los parásitos mencionados representan nuevos registros para Chile y se registran por primera vez para este hospedero.

  19. Free-living benthic marine invertebrates in Chile Invertebrados bentónicos marinos de vida libre en Chile

    Directory of Open Access Journals (Sweden)

    MATTHEW R LEE

    2008-03-01

    Full Text Available A comprehensive literature review was conducted to determine the species richness of all the possible taxa of free-living benthic marine invertebrates in Chile. In addition, the extent of endemism to the Pacific Islands and deep-sea, the number of non-indigenous species, and the contribution that the Chilean benthic marine invertebrate fauna makes to the world benthic marine invertebrate fauna was examined. A total of 4,553 species were found. The most speciose taxa were the Crustacea, Mollusca and Polychaeta. Species richness data was not available for a number of taxa, despite evidence that these taxa are present in the Chilean benthos. The Chilean marine invertebrate benthic fauna constitutes 2.47 % of the world marine invertebrate benthic fauna. There are 599 species endemic to the Pacific Islands and 205 in the deep-sea. There are 25 invasive or non-indigenous species so far identified in Chile. Though the Chilean fauna is speciose there is still a considerable amount of diversity yet to be described, particularly amongst the small bodied invertebrates and from the less well explored habitats, such as the deep-seaSe realizó una revisión exhaustiva de la literatura para determinar la riqueza de especies de todos los taxa de invertebrados bentónicos de vida libre en Chile. Además, se analizó el endemismo de invertebrados marinos bentónicos para las islas chilenas del Pacífico y el mar profundo y el número de especies no indígenas; del mismo modo que la contribución de estos invertebrados a la riqueza mundial de invertebrados bentónicos marinos. Para Chile se acumuló un total de 4.553 especies de invertebrados bentónicos. Los taxa con más especies fueron Crustacea, Mollusca y Polychaeta. En algunos taxa de invertebrados no se encontró información sobre la diversidad de especies presentes en Chile, a pesar de existir evidencia de que éstos están presentes en el bentos marino chileno. Los invertebrados bentónicos marinos

  20. Moluscos dulceacuícolas exóticos en Chile Exotic freshwater mollusks in Chile

    Directory of Open Access Journals (Sweden)

    Sergio Letelier V.

    2007-10-01

    Full Text Available Las especies de moluscos exóticas dulceacuícolas registradas en esta contribución, corresponden a ejemplares recolectados en humedales en acuarios comerciales o interceptados en barreras aduaneras, así como de referencias bibliográficas. Un total de 7 especies pertenecientes a 6 géneros fueron identificadas: Pomacea bridgesii; Helobia sp.; Thiara (Melanoides tuberculata; Melanoides maculata; Physa sp.; Physella venustula y Biomphalaria sp. Melanoides maculata fue recolectada en el río Lluta y clasificada como especie criptogénica. Los moluscos exóticos recolectados podrían tener éxito en su establecimiento si se considera la vulnerabilidad de los hábitats nativos debido al cambio en las condiciones climáticas globales o a las elevaciones térmicas producidas en el sector costero por los fenómenos de El Niño. En este sentido, las especies subtropicales observadas se podrían considerar como no endémicas y vectores potenciales de zoonosis parasitarias. Las principales vías de introducción de moluscos dulceacuícolas exóticos se derivaron del intercambio comercial, por lo cual, y frente a su incremento interregional, se hace necesario recopilar datos ecológicos y taxonómicos adecuados que permitan evaluar el riesgo de su establecimiento, así como servir de base para la aplicación de futuros tratamientos en bioseguridad.The exotic freshwater mollusk species we report here were collected in wetlands, commercial aquariums, or were given to us by government officials who intercepted some exotic species at customs offices. Other records came from the specialized literature. These species are Pomacea bridgesii; Helobia sp.; Thiara (Melanoides tuberculata; Melanoides maculata; Physa sp., Physella venustula and Biomphalaria sp. It is not clear how Melanoides maculata, found in the Río Lluta, reached Chile. The exotic species collected could expand their ranges in Chilean territory given global environmental and climate change or the

  1. Generic effluent monitoring system certification for AP-40 exhauster stack

    Energy Technology Data Exchange (ETDEWEB)

    Glissmeyer, J.A.; Davis, W.E.; Bussell, J.H.; Maughan, A.D.

    1997-09-01

    Tests were conducted to verify that the Generic Effluent Monitoring System (GEMS), as applied to the AP-40 exhauster stack, meets all applicable regulatory performance criteria for air sampling systems at nuclear facilities. These performance criteria address both the suitability of the air sampling probe location and the transport of the sample to the collection devices. The criteria covering air sampling probe location ensure that the contaminants in the stack are well mixed with the airflow at the probe location such that the extracted sample represents the whole. The sample transport criteria ensure that the sampled contaminants are quantitatively delivered to the collection device. The specific performance criteria are described in detail in the report. The tests demonstrated that the GEMS/AP-40 system meets all applicable performance criteria. The contaminant mixing tests were conducted by Pacific Northwest National Laboratory (PNNL) at the wind tunnel facility, 331-H Building, using a mockup of the actual stack. The particle sample transport tests were conducted by PNNL at the Numatec Hanford Company`s 305 Building. The AP-40 stack is typical of several 10-in. diameter stacks that discharge the filtered ventilation air from tank farms at the U.S. Department of Energy`s Hanford Site in Richland, Washington. The GEMS design features a probe with a single shrouded sampling nozzle, a sample delivery line, and sample collection system. The collection system includes a filter holder to collect the sample of record and an in-line detector head and filter for monitoring beta radiation-emitting particles. Unrelated to the performance criteria, it was found that the record sample filter holder exhibited symptoms of sample bypass around the particle collection filter. This filter holder should either be modified or replaced with a different type. 10 refs., 8 figs., 6 tabs.

  2. Initial diagnostics commissioning results for the APS injector subsystems

    Science.gov (United States)

    Lumpkin, A.; Chung, Y.; Kahana, E.; Patterson, D.; Sellyey, W.; Smith, T.; Wang, X.

    1995-05-01

    In recent months the first beams have been introduced into the various injector subsystems of the Advanced Photon Source (APS). An overview will be given of the diagnostics results on beam profiling, beam position monitors (BPMs), loss rate monitors (LRMs), current monitors (CMs), and photon monitors on the low energy transport lines, positron accumulator ring (PAR), and injector synchrotron (IS). Initial measurements have been done with electron beams at energies from 250 to 450 MeV and 50 to 400 pC per macrobunch. Operations in single turn and stored beam conditions were diagnosed in the PAR and IS.

  3. Operation of the APS photoinjector drive laser system.

    Energy Technology Data Exchange (ETDEWEB)

    Li, Y.; Accelerator Systems Division (APS)

    2008-08-04

    The APS photoinjector drive laser system has been in operation since 1999 and is achieving a performance level exceeding the requirement of stable operation of the LEUTL FEL system. One remarkable number is the UV energy stability of better than 2% rms, sometimes less than 1% rms. This report summarizes the operation experience of the laser system and the improvements made along the way. We also outline the route of upgrade of the system and some frontier laser research and development opportunities in ultrabright electron beam generation.

  4. Desarrollo y Estudio del protocolo Observe para CoAP

    OpenAIRE

    Gimeno Gimenez, Javier

    2013-01-01

    Premi Accenture al millor Projecte Final de Carrera, Treball Fi de Grau, Master Thesis, en l'Àrea de Serveis Telemàtics (curs 2012-2013) [ANGLÈS] In the context of the wireless sensor networks, an implementation of the observer pattern for CoAP is done. The implementation is done both for the nodes of the network and for a proxy that will allow to establish object-observer relationships between sensors inside the WSN and elements outside the network. [CASTELLÀ] En el contexto de las red...

  5. Ethernet ring protection with managed FDB using APS payload

    Science.gov (United States)

    Im, Jinsung; Ryoo, Jeong-dong; Joo, Bheom Soon; Rhee, J.-K. Kevin

    2007-11-01

    Ethernet ring protection (ERP) is a new technology based on OAM (operations, administration, and maintenance) being standardized by the ITU-T G.8032 working group. In this paper, we present the recent development of Ethernet ring protection which is called FDB (filtering database) flush scheme and propose a new Ethernet ring protection technique introducing a managed FDB using APS to deliver information how to fix FDB selectively. We discuss the current development of the ERP technology at ITU-T and performance comparisons between different proposals.

  6. Frecuencia de micobacterias ambientales en Chile en el año 2008 Frequency of environmental mycobacterium in Chile. 2008

    OpenAIRE

    Angélica Scappaticcio B; Maritza Velasco R; Tamara Leiva C; Juan Carlos Rodríguez D

    2011-01-01

    Objetivos: Conocer la frecuencia de aislamientos de micobacterias ambientales en Chile en el año 2008. Material y Métodos: Se recibieron 600 cultivos desde 22 laboratorios de Bacteriología de la Tuberculosis de los distintos Servicios de Salud de la red que comprende el Programa de Control de la Tuberculosis del país, durante un período de cuatro meses del año 2008. Quinientos cuarenta y cinco (90,8%) correspondieron a localización pulmonar y 55 (9,2%) a extrapulmonar. Se confirmó la alcohol-...

  7. Chile y la globalización: una dependencia potencialmente peligrosa Chile and globalization: a potentially dangerous dependence

    Directory of Open Access Journals (Sweden)

    Fernando Duque

    2007-02-01

    Full Text Available Este ensayo tiene varios propósitos. Primero, discutir el concepto de globalización en sus diferentes acepciones, particularmente, la económica, la política y la cultural. En segundo lugar, intenta tratar de describir y demostrar el enorme grado de dependencia que Chile tiene del actual proceso globalizador. En tercer término, se trata de señalar que la actual globalización, es un proceso similar al que ha ocurrido en otras épocas de la historia. Especialmente se comenta en detalle el análisis del profesor Ferguson quien compara la actual globalización con la que ocurrió a fines del siglo XIX y comienzos del XX. Se concluye que el actual proceso de globalización es tan volátil, inestable y peligroso como fue la globalización decimonónica. Se concluye también indicando que es altamente probable que el actual proceso globalizador, termine en forma similar a como terminó la globalización 1870-1914. Finalmente se argumenta que debido a que Chile está geográficamente ubicado en la parte más austral del hemisferio sur, es probable que el país salga relativamente intacto de la conflagración que se avecina.This article begins by discussing the different meanings of globalization, especially the economic, political and social ones. It then describes how Chile is greatly dependent on the current globalization process, as well as points out that this process is similar to others that have taken place in other times in history. It discusses in detail professor Ferguson's analysis comparing the current globalization with the one that occurred at the end of the 19th century and the beginning of the 20th. The article concludes that the current process is as volatile, unstable and dangerous as that of the 19th century, and that it is highly probable that it will end as that of 1870-1914. It also argues that since Chile is on the southernmost part of the southern hemisphere, it will be relatively preserved from the oncoming conflagration.

  8. Síndrome pulmonar por hantavirus Andes en Chile CARDIOPULMONARY SYNDROME DUE TO ANDES VIRUS IN CHILE

    Directory of Open Access Journals (Sweden)

    CONSTANZA CASTILLO H.

    2002-01-01

    Full Text Available Desde 1993 han ocurrido 204 casos de Síndrome Cardiopulmonar por Hantavirus (SCPH en Chile. Los brotes epidémicos comenzaron en el sur y avanzan hacia el norte del país. Los más afectados son varones jóvenes, obreros agrícolas o forestales. En Chile, el SCPH es causado por el virus Andes, cuyo reservorio es el Oligorizomys longicaudatus (ratón de cola larga, que se distribuye desde la III Región al sur. El cuadro clínico es similar al descrito en EE.UU., caracterizado por una fase prodrómica que simula un estado gripal o cuadro gastrointestinal febril y que agrava por la aparición de edema pulmonar agudo e inestabilidad hemodinámica (fase cardiopulmonar. Sin embargo, cursa con mayores alteraciones hemorragí-paras y compromiso renal. La mortalidad inicial fue sobre 50% y actualmente es de alrededor del 33,3%. La presente revisión incluye: historia de la enfermedad, reservorio, modos de transmisión, patogenia, cuadro clínico, diagnóstico, tratamiento y medidas de prevenciónSince 1993, 204 cases of Hantavirus cardiopulmonary syndrome (HCPS occurred in Chile. Epidemic began in the south and moved thereafter to the northern regions. The disease affected predominantly young males, who worked in agricultural labours or as timber workers. The HCPS in Chile is caused by the Andes virus. The reservoir is the wild rat Oligoryzomis longicaudatus distributed from the III to the XII Region. The clinical features are similar to those described for Sin Nombre Virus. The disease has a prodromal stage characterised by fever, muscular pain, with or without gastrointestinal manifestations, followed by the rapid onset of respiratory insufficiency and haemodynamic unstability. Andes virus courses more often with haemorrhagic disorders and overt renal failure, than Sin Nombre Virus. The initial mortality was over 50% and declined to 33,3% in the last year. History of hantavirus-diseases, reservoir, and mode of contagion, pathogenesis, clinical

  9. AP/二茂铁衍生物混合体系的热感度研究%Study on thermal sensitivity of AP and ferrocene derivative mixtures

    Institute of Scientific and Technical Information of China (English)

    王宁; 赵孝彬; 罗岚; 李彦荣; 段卫毅

    2011-01-01

    通过局部热感度试验和DSC-TG联用仪,研究了高氯酸铵(AP)和一种二茂铁衍生物(EMT)混合体系的热感度.结果表明,减小AP粒度或增加EMT含量,能缩小AP高低温分解峰之间的差距,提高AP低温分解量,混合物的局部热感度增加.AP存在下,EMT的侧链容易发生断裂,断裂后的二茂铁或二茂铁离子活性体对AP分解起催化作用.此外,EMT 不利于AP的质子转移过程,但对HClO4的分解有较强催化作用.%Thermal sensitivity of AP and ferrocene derivative (EMT) mixtures was studied by partial thermal sensitivity and DSC-TG coupling. The results indicate that reducing AP particle size or increasing the content of EMT can shorten the gap between high-temperature thermal decomposition peak of AP and low-temperature thermal decomposition peak of AP, enhance the low-temperature thermad decomposition amount of AP,and increase partial thermal sensitivity about mixtures of AP and EMT. In the presence of AP, side-chain of EMT is easily ruptured. Residual main skeleton, ferrocene or ferrocene ion, is the real catalyst to thermal decomposition of AP. Furthermore, EMT inhabits proton transfer process of AP, but it is a strong catalysis of EMT to decomposition of HCIO4, one of initial decomposition product of AP.

  10. NF-κB/AP-1-Targeted Inhibition of Macrophage-Mediated Inflammatory Responses by Depigmenting Compound AP736 Derived from Natural 1,3-Diphenylpropane Skeleton

    Directory of Open Access Journals (Sweden)

    Van Thai Ha

    2014-01-01

    Full Text Available AP736 was identified as an antimelanogenic drug that can be used for the prevention of melasma, freckles, and dark spots in skin by acting as a suppressor of melanin synthesis and tyrosinase expression. Since macrophage-mediated inflammatory responses are critical for skin health, here we investigated the potential anti-inflammatory activity of AP736. The effects of AP736 on various inflammatory events such as nitric oxide (NO/prostaglandin (PG E2 production, inflammatory gene expression, phagocytic uptake, and morphological changes were examined in RAW264.7 cells. AP736 was found to strongly inhibit the production of both NO and PGE2 in lipopolysaccharide- (LPS- treated RAW264.7 cells. In addition, AP736 strongly inhibited both LPS-induced morphological changes and FITC-dextran-induced phagocytic uptake. Furthermore, AP736 also downregulated the expression of multiple inflammatory genes, such as inducible NO synthase (iNOS, cyclooxygenase- (COX- 2, and interleukin- (IL- 1β in LPS-treated RAW264.7 cells. Transcription factor analysis, including upstream signalling events, revealed that both NF-κB and AP-1 were targeted by AP736 via inhibition of the IKK/IκBα and IRAK1/TAK1 pathways. Therefore, our results strongly suggest that AP736 is a potential anti-inflammatory drug due to its suppression of NF-κB-IKK/IκBα and AP-1-IRAK1/TAK1 signalling, which may make AP736 useful for the treatment of macrophage-mediated skin inflammation.

  11. Overexpression of ligase defective E6-associated protein, E6-AP, results in mammary tumorigenesis.

    Science.gov (United States)

    Ramamoorthy, Sivapriya; Tufail, Rozina; Hokayem, Jimmy El; Jorda, Mercy; Zhao, Wei; Reis, Zizi; Nawaz, Zafar

    2012-02-01

    E6-associated protein (E6-AP) is a dual function protein. It acts as an E3 ubiquitin-protein ligase enzyme and coactivator of steroid hormone receptors such as estrogen (ERα) and progesterone (PR) receptors. It promotes the degradation of ERα and PR through the ubiquitin-proteasome pathway. Furthermore, it has been shown that the levels of E6-AP are inversely associated with that of ERα in human breast tumors. But the role of wild-type human E6-AP and its ubiquitin-protein ligase activity in mammary tumorigenesis is still unknown. To investigate this role, the authors utilized transgenic mice lines that specifically overexpress either the wild-type human E6-AP (E6-AP(WT)) or the ubiquitin-protein ligase defective E6-AP that contains C833S mutation (E6-AP(C833S)) in the mammary gland. To further substantiate the role of E6-AP in the development of breast tumorigenesis, it was also examined the expression of E6-AP in a large cohort of human breast cancer samples. The transgenic mice that overexpress wild-type E6-AP (E6-AP(WT)) fail to develop mammary tumors. Unlike the E6-AP(WT) mice, the E6-AP(C833S) mice that overexpress ubiquitin-protein ligase defective E6-AP protein develop mammary hyperplasia with a median latency of 18 months. These observations suggest that the inactivation of the ubiquitin-protein ligase function of E6-AP is sufficient to initiate the process of mammary tumor development. Furthermore, the data also suggests that E6-AP exerts its effects on target cells by modulating the protein levels and functions of ERα and PR. In addition, it was found in human breast cancer patients that the level of E6-AP is decreased in invasive breast tumors compared to normal breast tissue. Moreover, the authors also show that the survival patterns for E6-AP negative patients were worse compared to E6-AP positive patients. Taken together, these data suggests that E6-AP may act as a tumor suppressor in breast.

  12. EL ACTO DE NOMBRARSE MISTRAL EN POEMA DE CHILE

    Directory of Open Access Journals (Sweden)

    Magda Sepúlveda Eriz

    2009-11-01

    Full Text Available La viajera espectral de Poema de Chile reflexiona sobre la adopción del nombre Mistral. Los fundamentos de esta elección van desde retornar a una intimidad anterior, la escena primigenia del campo, hasta el rechazo a la sociedad urbana. Este acto moderno de autonominarse constituye una atribución consciente frente al menoscabo y a los insultos recibidos en una posición representativa anterior. En vista de lo cual, la fantasma reclama los lugares, las palabras, los bienes y exige la recomposición de los cuerpos despedazados por el discurso blanco y etnocéntrico.The travelling spectrum of Poema de Chile reflects on the adoption of the name Mistral. The causes of this choice gofrom coming back to a previous intimacy -the original scene of the country- to the rejection of the urban society. The name she gives herself is a conscious act and therefore, a modern one, which is used as a response to the damage she received when she was in a previous situation. As a result, the ghost calls for the places, the language and the goods that were stolen, and she demands to recover the bodies that were torn by the white and ethnocentric discourse.

  13. Abortion in Chile: the practice under a restrictive regime.

    Science.gov (United States)

    Casas, Lidia; Vivaldi, Lieta

    2014-11-01

    This article examines, from a human rights perspective, the experience of women, and the practices of health care providers regarding abortion in Chile. Most abortions, as high as 100,000 a year, are obtained surreptitiously and clandestinely, and income and connections play a key role. The illegality of abortion correlates strongly with vulnerability, feelings of guilt and loneliness, fear of prosecution, physical and psychological harm, and social ostracism. Moreover, the absolute legal ban on abortion has a chilling effect on health care providers and endangers women's lives and health. Although misoprostol use has significantly helped to prevent greater harm and enhance women's agency, a ban on sales created a black market. Against this backdrop, feminists have taken action in aid of women. For instance, a feminist collective opened a telephone hotline, Linea Aborto Libre (Free Abortion Line), which has been crucial in informing women of the correct and safe use of misoprostol. Chile is at a crossroads. For the first time in 24 years, abortion law reform seems plausible, at least when the woman's life or health is at risk and in cases of rape and fetal anomalies incompatible with life. The political scenario is unfolding as we write. Congressional approval does not mean automatic enactment of a new law; a constitutional challenge is highly likely and will have to be overcome.

  14. Identification of trypanosomes isolated from reduviidae from north Chile.

    Science.gov (United States)

    Schaub, G A; Schottelius, J

    1984-01-01

    Examination of 54 Triatoma infestans from a village near the European Southern Observatory La Silla in Chile and of 9 Triatoma spinolai from the territory of the observatory showed that 10 T. infestans were infected with trypanosomatids. Mice were infected with in vitro cultures initiated with five different trypanosomatid isolates and treated with the immunosuppressive drug cyclophosphamide to increase the parasitemia of the flagellates. Evidence of the presence of T. cruzi was provided by a comparative biometrical analysis of blood trypomastigotes and the occurrence of intracellular amastigotes. Three methods for further identification were used: examination of kDNA ultrastructure, disc electrophoresis of soluble proteins and the Aaptos papillata II lectin induced agglutination. We obtained the following results for all isolates: (1) presence of a central band of the kDNA; (2) T. cruzi specific double bands of the protein patterns; (3) positive reaction with Aaptos papillata II. No differences between the five isolates from Chile and T. cruzi or T. cruzi-like strains from other countries could be observed. Based on these results an infection of the bugs with T. rangeli and T. conorhini could be excluded.

  15. FERROCARRILES EN LA ZONA AUSTRAL DE CHILE, 1869-1973

    Directory of Open Access Journals (Sweden)

    Mateo Martinic B.

    2005-12-01

    Full Text Available En este artículo se entrega una visión completa acerca de los ferrocarriles construidos y explotados en la región austral de Chile y se ofrece asimismo una explicación sobre su modesta expresión hist��rica, cosa notable en un territorio como la Patagonia chilena en cuya colonización y desarrollo ulterior fue importante la utilización de la tecnología industrial moderna. Se dan a conocer también algunas interesantes iniciativas ferrocarrileras que no llegaron a materializarseIn spite of the important development in Chilean Patagonia between circa 1870 an 1973, particulary in the old Magellan Territory, an almost surprising fact was that in between many incorporated industrial technology the railroad, a paradigm of modernity, had a scarce representation. In this paper, a complete review about railroads settled and exploted in southernmost Chile is done and a explanation of its modest expression and some interesting projects that necer became materialized which explains the emptiness in the historical information on the subject

  16. [Blood supply during disasters: the experience of Chile in 2010].

    Science.gov (United States)

    Vásquez, Marcela; Maldonado, Mónica; Tagle, Federico; León, Sergio; Soto, Alejandra; Mena, Aaron; Toro, Carla

    2011-05-01

    A review of the management of blood supply and its administration during disasters was conducted based on the experience of several events that occurred primarily from 2000-2010, particularly the earthquake that measured 8.8 on the Richter scale that struck central and southern Chile on 27 February 2010. The objective was to provide information that could be useful in improving response plans and strategies during potential future disasters. The descriptive information on response procedures was obtained from interviews, internal reports, and the computer database from the Maule regional blood production center. The results lead to the conclusion that to respond efficiently and effectively to the need for blood in the immediate wake of a disaster it is essential to have both a centralized management system that facilitates the supply and administration of blood and volunteers with competence in health that are willing to swiftly arrive during these events. A change in the profile of blood donors during such emergencies was also observed. In Chile, for example, during the two weeks after the earthquake, the ratio of male/female donors was reversed. There was 61.1% participation by women, whereas in the week before the event women accounted for only 37%.

  17. THE CLIMATE OF NORTHERN CHILE: MEAN STATE, VARIABILITY AND TRENDS

    Directory of Open Access Journals (Sweden)

    R. D. Garreaud

    2011-01-01

    Full Text Available Este manuscrito documenta las características principales del clima del norte de Chile, lugar donde se ubican, y donde se proyecta, la instalación de varios observatorios astronómicos. Primeramente se provee de una descripción del clima regional a una escala espacial amplia, donde se describe la importancia relativa de la celda de Hadley, del Monsón Sud-Americano, y perturbaciones extra-tropicales en dar forma al estado promedio de la temperatura, precipitación y vientos en la región. Entonces, se describen los efectos de la Oscilación del Sur-El Niño para producir algún nivel de variabilidad inter-anual en el clima del norte de Chile. Se concluye este trabajo, basándose en lo expuesto en estudios recientes, con un resumen de las tendencias observadas y proyecciones en el cambio climático para lo que resta del siglo XXI.

  18. Pharmacovigilance in veterinary medicine in Chile: a pilot study.

    Science.gov (United States)

    Iragüen, D; Urcelay, S; San Martín, B

    2011-04-01

    Iragüen, D., Urcelay, S., San Martín, B. Pharmacovigilance in veterinary medicine in Chile: a pilot study. J. vet. Pharmacol. Therap.34, 108-115. In Chile, there is no present government policy to survey and analyse adverse drug reactions (ADRs) in the field of veterinary medicine. The intent of this study is to assess, for the first time, ADR frequency in treated animals. To this purpose, a 6-month period pilot study based on WHO recommendations was conducted to monitor ADRs in cats and dogs for frequently used drugs and common labelled signs. Of a total of 149 detected ADRs, 29 (6 in cats and 23 in dogs) were notified by means of ADR report forms, while the rest was identified after reviewing patient clinical records, thus evidencing strong under-reporting problems. More than 70% of ADRs were related to antimicrobials, vaccines and tranquilizers. In dogs, there was a significant effect on ADRs' presentation when acepromazine, amoxicillin, carprofen, ivermectin, sextuple vaccine (polyvalent vaccine that confers immunity against canine distemper virus, canine parvovirus, Leptospira canicola, L. icterohemmoragiae, canine adenovirus type 2 and canine parainfluenza virus) and phytomenadione (subcutaneous injection) were administered. In the case of cats, a significant influence on ADRs was detected when acepromazine, amoxicillin or vitamin K was administered. Present results suggest the need for a pharmacovigilance programme in veterinary medicine for timely ADR-presenting drug detection and drug safety improvement.

  19. Spearfishing to depletion: evidence from temperate reef fishes in Chile.

    Science.gov (United States)

    Godoy, Natalio; Gelcich, L Stefan; Vásquez, Julio A; Castilla, Juan Carlos

    2010-09-01

    Unreliable and data-poor marine fishery landings can lead to a lack of regulatory action in fisheries management. Here we use official Chilean landing reports and non-conventional indicators, such as fishers' perceptions and spearfishing competition results, to provide evidence of reef fishes depletions caused by unregulated spearfishing. Results show that the three largest and most emblematic reef fishes targeted mainly by spearfishers (> 98% of landings) [Graus nigra (vieja negra), Semicossyphus darwini (sheephead or pejeperro), and Medialuna ancietae (acha)] show signs of depletion in terms of abundance and size and that overall the catches of reef fishes have shifted from large carnivore species toward smaller-sized omnivore and herbivore species. Information from two snorkeling speargun world championships (1971 and 2004, Iquique, Chile) and from fishers' perceptions shows the mean size of reef fish to be declining. Although the ecological consequences of reef fish depletion are not fully understood in Chile, evidence of spearfishing depleting temperate reef fishes must be explicitly included in policy debates. This would involve bans or strong restrictions on the use of SCUBA and hookah diving gear for spearfishing, and minimum size limits. It may also involve academic and policy discussions regarding conservation and fisheries management synergies within networks of no-take and territorial user-rights fisheries areas, as a strategy for the sustainable management of temperate and tropical reef fisheries.

  20. Desarrollo metropolitano integrado: El caso de Santiago de Chile

    Directory of Open Access Journals (Sweden)

    Paulina Schiappacasse

    2015-04-01

    Full Text Available El Área Metropolitana de Santiago (AMS ocupa un rol significativo en términos demográficos y de desarrollo económico en Chile. Sin embargo existen debilidades importantes en el establecimiento de mecanismos adecuados que permitan definir su orientación estratégica en un marco global competitivo; esta situación se intensifica en la medida que las áreas metropolitanas en Chile, no poseen una institucionalidad definida y un marco legal que las sustente. El AMS esta siendo afectada por cambios estructurales típicos en la evolución de las grandes metrópolis, con las consecuentes externalidades negativas que incrementan las dificultades para enfrentar y orientar su crecimiento y para establecer instancias de colaboración entre los diferentes actores involucrados. En este artículo se analiza la situación del AMS, en el marco de la discusión internacional, en relación a las metas estratégicas necesarias para el logro de un desarrollo metropolitano sustentable. La intención es contribuir al debate nacional actual en torno a la revisión y cambio de las políticas de planificación, en particular, aquellas orientadas a enfrentar los procesos dinámicos que están experimentando las ciudades.

  1. Peru-Chile upwelling dynamics under climate change

    Science.gov (United States)

    Oerder, Véra; Colas, Francois; Echevin, Vincent; Codron, Francis; Tam, Jorge; Belmadani, Ali

    2015-02-01

    The consequences of global warming on the Peru-Chile Current System (PCCS) ocean circulation are examined with a high-resolution, eddy-resolving regional oceanic model. We performed a dynamical downscaling of climate scenarios from the IPSL-CM4 Coupled General Circulation Model (CGCM), corresponding to various levels of CO2 concentrations in the atmosphere. High-resolution atmospheric forcing for the regional ocean model are obtained from the IPSL atmospheric model run on a stretched grid with increased horizontal resolution in the PCCS region. When comparing future scenarios to preindustrial (PI) conditions, the circulation along the Peru and Chile coasts is strongly modified by changes in surface winds and increased stratification caused by the regional warming. While the coastal poleward undercurrent is intensified, the surface equatorial coastal jet shoals and the nearshore mesoscale activity are reinforced. Reduction in alongshore wind stress and nearshore wind stress curl drive a year-round reduction in upwelling intensity off Peru. Modifications in geostrophic circulation mitigate this upwelling decrease in late austral summer. The depth of the upwelling source waters becomes shallower in warmer conditions, which may have a major impact on the system's biological productivity.

  2. [Revista Médica de Chile in the year 2009].

    Science.gov (United States)

    Reyes B, Humberto; Andresen H, Max; Palma H, Joaquín

    2009-08-01

    During the first semester of 2009 Revista Médica de Chile has received an increasing number of manuscripts. Close to 30% were rejected while most other are in the process of being improved by the authors after receiving criticisms by external peer reviewers and the editors. The time lag between acceptance and publication of manuscripts is on an average six months. During 2008, 10% of articles published were submitted by authors from countries other than Chile and most of them were printed in English. Impact factor and other indexes provided by the ISI Web of Knowledge showed a promising improvement in 2008. The International Advisory Committee and the National Editorial Committee were renewed, a new Section on Laboratory Medicine was incorporated and several minor changes were done in design and format, in the title page and the issues' content. The main problems to be faced relate to the increasing cost of editing and printing, with a reduction in commercial advertising historically contributed by the pharmaceutical industry. Another major concern is to stimulate governmental agencies, scientific societies and universities to establish a national independent registry of clinical trials, that should become a mandatory requisite for every manuscript submitted to Chilean medical journals, reporting clinical trials performed in the country; foreign manuscripts should document the satisfaction of an identical requisite in their original source.

  3. Oxygenation variability off Northern Chile during the last two centuries

    Directory of Open Access Journals (Sweden)

    J. A. Díaz-Ochoa

    2010-07-01

    Full Text Available The Peru Chile Current ecosystem is characterized by high biological productivity and important fisheries. Although this system is likely to be severely affected by climate change, its response to current global warming is still uncertain. In this paper we analyze 10–166 year old sediments in two cores collected in Mejillones Bay, an anoxic sedimentary setting favorable for preservation of proxies. Based on a 166 year chronology we used indicators of bottom water oxygenation proxies (Mo, V, S, and the (lycopane+n-C35/n-C31 ratio and surface water productivity (biogenic opal, counts of diatom valves, biogenic Ba, organic carbon and chlorins to reconstruct environmental variations in Mejillones Bay. We find that at decadal scales, and during the last two centuries, a shift in the coastal marine ecosystem off Northern Chile took place which was characterized by intense ENSO-like activity and large fluctuations in biological export productivity, in bottom water oxygenation, and increased eolic activity (inferred from Ti/Al and Zr/Al. On top of this short-term variability, a gradual increase of sulfidic conditions has occurred being even more intensified since the early 1960s.

  4. Lejos de NYC: El hip-hop en Chile

    Directory of Open Access Journals (Sweden)

    Rainer Quitzow

    2005-03-01

    Full Text Available En este artículo se abordan las manifestaciones concretas de una forma cultural urbana exportada desde Occidente a los países en desarrollo. A través de una reconstrucción de la historia de la cultura hip hop en Chile, se han intendado esbozar algunas conclusiones sobre su influencia en la formación de una identidad cultural urbana, tratando además de relacionar el desarrollo histórico del movimiento y de las prácticas actuales de la juventud en Santiago con tendencias más amplias en la sociedad chilena. En particular, se ha intentado determinar si el hip hop proporciona un formato significativo para la expresión de los problemas de los jóvenes urbanos de Chile, o si es parte de lo que algunos autores denominan una “pérdida cultural”, como consecuencia del capitalismo global y el imperialismo cultural de Estados Unidos.

  5. Assessing computer waste generation in Chile using material flow analysis.

    Science.gov (United States)

    Steubing, Bernhard; Böni, Heinz; Schluep, Mathias; Silva, Uca; Ludwig, Christian

    2010-03-01

    The quantities of e-waste are expected to increase sharply in Chile. The purpose of this paper is to provide a quantitative data basis on generated e-waste quantities. A material flow analysis was carried out assessing the generation of e-waste from computer equipment (desktop and laptop PCs as well as CRT and LCD-monitors). Import and sales data were collected from the Chilean Customs database as well as from publications by the International Data Corporation. A survey was conducted to determine consumers' choices with respect to storage, re-use and disposal of computer equipment. The generation of e-waste was assessed in a baseline as well as upper and lower scenarios until 2020. The results for the baseline scenario show that about 10,000 and 20,000 tons of computer waste may be generated in the years 2010 and 2020, respectively. The cumulative e-waste generation will be four to five times higher in the upcoming decade (2010-2019) than during the current decade (2000-2009). By 2020, the shares of LCD-monitors and laptops will increase more rapidly replacing other e-waste including the CRT-monitors. The model also shows the principal flows of computer equipment from production and sale to recycling and disposal. The re-use of computer equipment plays an important role in Chile. An appropriate recycling scheme will have to be introduced to provide adequate solutions for the growing rate of e-waste generation.

  6. Chile. Actores Populares en la Protesta Nacional, 1983-1984

    Directory of Open Access Journals (Sweden)

    Marisa REVILLA BLANCO

    2009-11-01

    Full Text Available RESUMEN: Los acontecimientos y los actores implicados en las movilizaciones producidas en Santiago de Chile en 1983-84, son el objeto de andlisis de este artículo. Tras una breve exposición del contexto económico y político, se describen los rasgos fundamentales y la evolución de las protestas. Del análisis de los hechos se deducen tres objetivos implícitos en las movilizaciones: recuperación de la identidad política y social, integración polltica de los excluidos y democracia. Los resultados son dispares; mientras en el plano político se produce una derrota, en lo referente a la expresividad de las acciones y al problema de la integración, las movilizaciones fueron exitosas.ABSTRACT: ThLs article focuses on the events and actors involved in the mobilizations tha took place in Santiago de Chile between 1983-1984. After a short exposition of the political and economic context, it describes the main characteristics and the protest's evolution. Three implicit objetives can be identified from the demostrations: the recovering of social and political identity, the political integration of the excluded people and democracy. The results are inequal; while on the political level a defeat ocurs, with regard to the expressiveness of the actions and the integration's problem, the mobilizations were successful.

  7. Isotopic composition and origin of the precipitation in Northern Chile

    Energy Technology Data Exchange (ETDEWEB)

    Aravena, R. [Department of Earth Sciences, University of Waterloo, Waterloo (Canada); Suzuki, O. [Exploracion y Desarrollo de Recursos Hidricos, Santiago (Chile); Pena, H. [Direccion General de Aguas, Ministerio de Obras Publicas, Santiago (Chile); Pollastri, A. [Comision Chilena de Energia Nuclear, Santiago (Chile); Fuenzalida, H. [Departamento de Geofisica, Universidad of Chile, Santiago (Chile); Grilli, A. [Empresa Metropolitana de Obras Sanitarias, Santiago (Chile)

    1999-06-01

    A 3 a data set of isotopes in precipitation from northern Chile show a very distinct pattern, with {delta}{sup 18}O values ranging between -18 and -15per thousand at high altitude stations, compared to {delta}{sup 18}O values between -10 and -6per thousand at the lower altitude areas. The {sup 18}O-depleted values observed in the high altitude area, the Altiplano, are related to processes that affect the air masses that originated over the Atlantic, cross the Amazon Basin (continental effect), ascend the Andes (altitude effect) and precipitated (convective effect) in the Altiplano. It is postulated that a second source of moisture, associated with air masses from the Pacific, may contribute to the {sup 18}O-enriched values observed in the lower altitude areas. Similar isotopic patterns are documented in springs and groundwater indicating that the data presented in this paper are an accurate representation of the long term behavior isotopic composition of rain in northern Chile. (Copyright (c) 1999 Elsevier Science B.V., Amsterdam. All rights reserved.)

  8. An overview of the dinosaur fossil record from Chile

    Science.gov (United States)

    Rubilar-Rogers, David; Otero, Rodrigo A.; Yury-Yáñez, Roberto E.; Vargas, Alexander O.; Gutstein, Carolina S.

    2012-08-01

    In Chile, the record of dinosaurs in Jurassic and Cretaceous sediments is often restricted to footprints, with few skeletal remains. Tetanuran theropods are known in the Upper Jurassic, and bones of titanosaur sauropods in the Late Cretaceous, including partial skeletons (e.g. Atacamatitan chilensis Kellner et al.). Also from the late Cretaceous, an ornithopod vertebra, a pair of theropod teeth and one tarsometatarsus of a gaviiform bird (Neogaeornis wetzeli Lambrecht) have been reported. The Cenozoic fossil record comprises abundant and well-preserved marine birds from Eocene and Miocene units, with a specially abundant record of Sphenisciformes and less frequently, Procellariiformes. There is an excellent Miocene-Pliocene record of other birds such as Odontopterygiformes, including the most complete skeleton ever found of a pelagornithid, Pelagornis chilensis Mayr and Rubilar-Rogers. Fossil birds are also known from Pliocene and Pleistocene strata. A remarkable collection of birds was discovered in lacustrine sediments of late Pleistocene age associated to human activity. The perspectives in the study of dinosaurs in Chile are promising because plenty of material stored in institutional collections is not described yet. The record of Chilean dinosaurs is relevant for understanding the dynamics and evolution of this group of terrestrial animals in the western edge of Gondwana, while Cenozoic birds from the Region may contribute to the understanding of current biogeography for instance, the effect of the emergence and establishment of the Humboldt Current.

  9. Tendencias generales en la toponimia del Norte Grande de Chile

    Directory of Open Access Journals (Sweden)

    Guillermo Latorre

    1997-09-01

    Full Text Available En este trabajo el autor se propone examinar las facetas más salientes de la preponderancia del sustrato indígena en la toponimia mayor del Norte Grande, asunto poco o nada tratado en descripciones del español de Chile. Pasa revista a voces como "Arica", "Chañaral", "Iquique", "Taltal", "Tocopilla", "Chuquicamata", "Andes", "Antofagasta", "Calama", "Pica", "Loa" y otras. Finalmente, da algunas explicaciones de esa marcada presencia de topónimos autóctonos a pesar de cinco siglos de dominio español. (In this paper, the author examines the most salient features of the prevalence of indigenous backgrounds in the toponymy of Northernmost Chile, an aspect barely tackled, or simply neglected, in the descriptions of Chilean Spanish. The author reviews terms such as "Arica", "Chañaral", "Iquique", "Taltal", "Tocopilla", "Chuquicamata", "Andes", "Antofagasta", "Calama", "Pica", "Loa", and others. Also, some explanations are offered that may justify the notorious presence of native placenames, in spite of five centuries of Spanish domination.

  10. Molecular Basis for Enhancement of the Meiotic DMCI Recombinase by RAD51AP1

    Energy Technology Data Exchange (ETDEWEB)

    Dray, Eloise; Dunlop, Myun Hwa; Kauppi, Liisa; San Filippo, Joseph San; Wiese, Claudia; Tsai, Miaw-Sheue; Begovic, Sead; Schild, David; Jasin, Maria; Keeney, Scott; Sung, Patrick

    2010-11-05

    Homologous recombination is needed for meiotic chromosome segregation, genome maintenance, and tumor suppression. RAD51AP1 (RAD51 Associated Protein 1) has been shown to interact with and enhance the recombinase activity of RAD51. Accordingly, genetic ablation of RAD51AP1 leads to enhanced sensitivity to and also chromosome aberrations upon DNA damage, demonstrating a role for RAD51AP1 in mitotic homologous recombination. Here we show physical association of RAD51AP1 with the meiosis-specific recombinase DMC1 and a stimulatory effect of RAD51AP1 on the DMC1-mediated D-loop reaction. Mechanistic studies have revealed that RAD51AP1 enhances the ability of the DMC1 presynaptic filament to capture the duplex DNA partner and to assemble the synaptic complex, in which the recombining DNA strands are homologously aligned. We also provide evidence that functional co-operation is dependent on complex formation between DMC1 and RAD51AP1, and that distinct epitopes in RAD51AP1 mediate interactions with RAD51 and DMC1. Finally, we show that RAD51AP1 is expressed in mouse testes, and that RAD51AP1 foci co-localize with a subset of DMC1 foci in spermatocytes. These results suggest that RAD51AP1 also serves an important role in meiotic homologous recombination.

  11. Lack of CD2AP disrupts Glut4 trafficking and attenuates glucose uptake in podocytes.

    Science.gov (United States)

    Tolvanen, Tuomas A; Dash, Surjya Narayan; Polianskyte-Prause, Zydrune; Dumont, Vincent; Lehtonen, Sanna

    2015-12-15

    The adapter protein CD2-associated protein (CD2AP) functions in various signaling and vesicle trafficking pathways, including endosomal sorting and/or trafficking and degradation pathways. Here, we investigated the role of CD2AP in insulin-dependent glucose transporter 4 (Glut4, also known as SLC2A4) trafficking and glucose uptake. Glucose uptake was attenuated in CD2AP(-/-) podocytes compared with wild-type podocytes in the basal state, and CD2AP(-/-) podocytes failed to increase glucose uptake in response to insulin. Live-cell imaging revealed dynamic trafficking of HA-Glut4-GFP in wild-type podocytes, whereas in CD2AP(-/-) podocytes, HA-Glut4-GFP clustered perinuclearly. In subcellular membrane fractionations, CD2AP co-fractionated with Glut4, IRAP (also known as LNPEP) and sortilin, constituents of Glut4 storage vesicles (GSVs). We further found that CD2AP forms a complex with GGA2, a clathrin adaptor, which sorts Glut4 to GSVs, suggesting a role for CD2AP in this process. We also found that CD2AP forms a complex with clathrin and connects clathrin to actin in the perinuclear region. Furthermore, clathrin recycling back to trans-Golgi membranes from the vesicular fraction containing GSVs was defective in the absence of CD2AP. This leads to reduced insulin-stimulated trafficking of GSVs and attenuated glucose uptake into CD2AP(-/-) podocytes.

  12. Complexity in Size, Recurrence and Source of Historical Earthquakes and Tsunamis in Central Chile

    Science.gov (United States)

    Cisternas, M.

    2013-05-01

    Central Chile has a 470-year-long written earthquake history, the longest of any part of the country. Thanks to the early and continuous Spanish settlement of this part of Chile (32°- 35° S), records document destructive earthquakes and tsunamis in 1575, 1647, 1730, 1822, 1906 and 1985. This sequence has promoted the idea that central Chile's large subduction inter-plate earthquakes recur at regular intervals of about 80 years. The last of these earthquakes, in 1985, was even forecast as filling a seismic gap on the thrust boundary between the subducting Nazca Plate and the overriding South America Plate. Following this logic, the next large earthquake in metropolitan Chile will not occur until late in the 21st century. However, here I challenge this conclusion by reporting recently discovered historical evidence in Spain, Japan, Peru, and Chile. This new evidence augments the historical catalog in central Chile, strongly suggests that one of these earthquakes previously assumed to occur on the inter-plate interface in fact occurred elsewhere, and forces the conclusion that another of these earthquakes (and its accompanying tsunami) dwarfed the others. These findings complicate the task of assessing the hazard of future earthquakes in Chile's most populated region.

  13. Luteolin, a flavonoid, inhibits AP-1 activation by basophils.

    Science.gov (United States)

    Hirano, Toru; Higa, Shinji; Arimitsu, Junsuke; Naka, Tetsuji; Ogata, Atsushi; Shima, Yoshihito; Fujimoto, Minoru; Yamadori, Tomoki; Ohkawara, Tomoharu; Kuwabara, Yusuke; Kawai, Mari; Matsuda, Hisashi; Yoshikawa, Masayuki; Maezaki, Naoyoshi; Tanaka, Tetsuaki; Kawase, Ichiro; Tanaka, Toshio

    2006-02-03

    Flavonoids including luteolin, apigenin, and fisetin are inhibitors of IL-4 synthesis and CD40 ligand expression by basophils. This study was done to search for compounds with greater inhibitory activity of IL-4 expression and to clarify the molecular mechanisms through which flavonoids inhibit their expression. Of the 37 flavonoids and related compounds examined, ayanin, luteolin, and apigenin were the strongest inhibitors of IL-4 production by purified basophils in response to anti-IgE antibody plus IL-3. Luteolin did not suppress Syk or Lyn phosphorylation in basophils, nor did suppress p54/46 SAPK/JNK, p38 MAPK, and p44/42 MAPK activation by a basophilic cell line, KU812 cells, stimulated with A23187 and PMA. However, luteolin did inhibit phosphorylation of c-Jun and DNA binding activity of AP-1 in nuclear lysates from stimulated KU812 cells. These results provide a fundamental structure of flavonoids for IL-4 inhibition and demonstrate a novel action of flavonoids that suppresses the activation of AP-1.

  14. Abnormal lithium abundance in several Ap-Bp stars

    CERN Document Server

    Shavrina, A; Drake, N A; Kudryavtsev, D O; Gopka, V F; Yushchenko, V A; Yushchenko, A V

    2013-01-01

    Using observations of rapidly rotating roAp star HD 12098, obtained with 6m telescope of SAO RAS in 2005-2008 in nine rotational phases (0.001-0.817), and code V. Tsymbal ROTATE we identified 3 lithium spots on the surface of star, one of them coincided with the position of one magnetic pole and two others are located near the other pole, symmetrically with respect to it. Perhaps magnetic field of the star has a more complex structure than the dipole (Shavrina 2008). Lithium abundance in the spots is greater than cosmic one. It can be explained by diffusion of lithium in the presence of a magnetic field or by production of lithium in the reactions of "spallation" on the surface of star near the magnetic poles (see, for example, Goriely 2007). Enhanced lithium abundances was also determined for other two slowly rotating Ap stars HR 465 and HD 965. The analysis is performed using a synthetic spectrum method taking into account magnetic splitting of lines by the SYNTHM code of Khan (2004).

  15. Data Aggregation Gateway Framework for CoAP Group Communications

    Directory of Open Access Journals (Sweden)

    Minki Cha

    2016-11-01

    Full Text Available In this paper, a data aggregation gateway framework (DA-GW for constrained application protocol (CoAP group communications is proposed. The DA-GW framework is designed to improve the throughput performance and energy efficiency of group communication to monitor and control multiple sensor devices collectively with a single user terminal. The DA-GW consists of four function blocks—the message analyzer, group manager, message scheduler and data handler—and three informative databases—the client database, resource database and information database. The DA-GW performs group management and group communication through each functional block and stores resources in the informative databases. The DA-GW employs international standard-based data structures and provides the interoperability of heterogeneous devices used in various applications. The DA-GW is implemented using a Java-based open source framework called jCoAP to evaluate the functions and performance of the DA-GW. The experiment results showed that the DA-GW framework revealed better performance than existing group communication methods in terms of throughput and energy consumption.

  16. Pulsation models for the roAp star HD 134214

    CERN Document Server

    Saio, H; Weiss, W W; Matthews, J M; Ryabchikova, T

    2011-01-01

    Precise time-series photometry with the MOST satellite has led to identification of 10 pulsation frequencies in the rapidly oscillating Ap (roAp) star HD 134214. We have fitted the observed frequencies with theoretical frequencies of axisymmetric modes in a grid of stellar models with dipole magnetic fields. We find that, among models with a standard composition of $(X,Z) = (0.70,0.02)$ and with suppressed convection, eigenfrequencies of a $1.65\\,{\\rm M}_\\odot$ model with $\\log T_{\\rm eff} = 3.858$ and a polar magnetic field strength of 4.1kG agree best with the observed frequencies. We identify the observed pulsation frequency with the largest amplitude as a deformed dipole ($\\ell = 1$) mode, and the four next-largest-amplitude frequencies as deformed $\\ell = 2$ modes. These modes have a radial quasi-node in the outermost atmospheric layers ($\\tau \\sim 10^{-3}$). Although the model frequencies agree roughly with observed ones, they are all above the acoustic cut-off frequency for the model atmosphere and hen...

  17. The new AP Physics exams: Integrating qualitative and quantitative reasoning

    Science.gov (United States)

    Elby, Andrew

    2015-04-01

    When physics instructors and education researchers emphasize the importance of integrating qualitative and quantitative reasoning in problem solving, they usually mean using those types of reasoning serially and separately: first students should analyze the physical situation qualitatively/conceptually to figure out the relevant equations, then they should process those equations quantitatively to generate a solution, and finally they should use qualitative reasoning to check that answer for plausibility (Heller, Keith, & Anderson, 1992). The new AP Physics 1 and 2 exams will, of course, reward this approach to problem solving. But one kind of free response question will demand and reward a further integration of qualitative and quantitative reasoning, namely mathematical modeling and sense-making--inventing new equations to capture a physical situation and focusing on proportionalities, inverse proportionalities, and other functional relations to infer what the equation ``says'' about the physical world. In this talk, I discuss examples of these qualitative-quantitative translation questions, highlighting how they differ from both standard quantitative and standard qualitative questions. I then discuss the kinds of modeling activities that can help AP and college students develop these skills and habits of mind.

  18. RAD51AP1-deficiency in vertebrate cells impairs DNA replication.

    Science.gov (United States)

    Parplys, Ann C; Kratz, Katja; Speed, Michael C; Leung, Stanley G; Schild, David; Wiese, Claudia

    2014-12-01

    RAD51-associated protein 1 (RAD51AP1) is critical for homologous recombination (HR) by interacting with and stimulating the activities of the RAD51 and DMC1 recombinases. In human somatic cells, knockdown of RAD51AP1 results in increased sensitivity to DNA damaging agents and to impaired HR, but the formation of DNA damage-induced RAD51 foci is unaffected. Here, we generated a genetic model system, based on chicken DT40 cells, to assess the phenotype of fully inactivated RAD51AP1 in vertebrate cells. Targeted inactivation of both RAD51AP1 alleles has no effect on either viability or doubling-time in undamaged cells, but leads to increased levels of cytotoxicity after exposure to cisplatin or to ionizing radiation. Interestingly, ectopic expression of GgRAD51AP1, but not of HsRAD51AP1 is able to fully complement in cell survival assays. Notably, in RAD51AP1-deficient DT40 cells the resolution of DNA damage-induced RAD51 foci is greatly slowed down, while their formation is not impaired. We also identify, for the first time, an important role for RAD51AP1 in counteracting both spontaneous and DNA damage-induced replication stress. In human and in chicken cells, RAD51AP1 is required to maintain wild type speed of replication fork progression, and both RAD51AP1-depleted human cells and RAD51AP1-deficient DT40 cells respond to replication stress by a slow-down of replication fork elongation rates. However, increased firing of replication origins occurs in RAD51AP1-/- DT40 cells, likely to ensure the timely duplication of the entire genome. Taken together, our results may explain why RAD51AP1 commonly is overexpressed in tumor cells and tissues, and we speculate that the disruption of RAD51AP1 function could be a promising approach in targeted tumor therapy.

  19. Identification of Cargo for Adaptor Protein (AP) Complexes 3 and 4 by Sucrose Gradient Profiling.

    Science.gov (United States)

    Pertl-Obermeyer, Heidi; Wu, Xu Na; Schrodt, Jens; Müdsam, Christina; Obermeyer, Gerhard; Schulze, Waltraud X

    2016-09-01

    Intracellular vesicle trafficking is a fundamental process in eukaryotic cells. It enables cellular polarity and exchange of proteins between subcellular compartments such as the plasma membrane or the vacuole. Adaptor protein complexes participate in the vesicle formation by specific selection of the transported cargo. We investigated the role of the adaptor protein complex 3 (AP-3) and adaptor protein complex 4 (AP-4) in this selection process by screening for AP-3 and AP-4 dependent cargo proteins. Specific cargo proteins are expected to be mis-targeted in knock-out mutants of adaptor protein complex components. Thus, we screened for altered distribution profiles across a density gradient of membrane proteins in wild type versus ap-3β and ap-4β knock-out mutants. In ap-3β mutants, especially proteins with transport functions, such as aquaporins and plasma membrane ATPase, as well as vesicle trafficking proteins showed differential protein distribution profiles across the density gradient. In the ap-4β mutant aquaporins but also proteins from lipid metabolism were differentially distributed. These proteins also showed differential phosphorylation patterns in ap-3β and ap-4β compared with wild type. Other proteins, such as receptor kinases were depleted from the AP-3 mutant membrane system, possibly because of degradation after mis-targeting. In AP-4 mutants, membrane fractions were depleted for cytochrome P450 proteins, cell wall proteins and receptor kinases. Analysis of water transport capacity in wild type and mutant mesophyll cells confirmed aquaporins as cargo proteins of AP-3 and AP-4. The combination of organelle density gradients with proteome analysis turned out as a suitable experimental strategy for large-scale analyses of protein trafficking.

  20. 储氢合金/AP/HTPB推进剂燃烧性能研究%Investigation on Combustion Properties of Hydrogen Storage Alloy/AP/HTPB Propellant

    Institute of Scientific and Technical Information of China (English)

    窦燕蒙; 罗运军; 李国平; 葛震

    2013-01-01

    AI/AP/HTPB propellant and hydrogen storage alloy/AP/HTPB propellant were prepared and their properties were characterized by DSC,PDSC,explosion heat and burning rate test. DSC and PDSC test results show that hydrogen storage alloy has catalysis on condensed phase reactions of AP/HTPB propellant in which main decomposition temperature is decreased by 21.67℃,and 15. 67 ℃ at 0. 1MPa and 5MPa,respectively while condensed phase reaction heat is increased by 105. 97% and 21. 87% separately. Explosion heat test results show that hydrogen storage alloy has catalysis on gas phase reactions of AP/HTPB propellant in which gas phase reaction heat is increased by 4. 74% . Burning rate test results show that hydrogen storage alloy can increase burning rate of AP/HTPB propellant. Further studies indicate that possible correlation exist between burning rate and explosion heat of Al/AP/HTPB propellant and hydrogen storage alloy/AP/HTPB propellant. The burning rate-explosion heat formula is summed up.%制备了Al/AP/HTPB推进剂和储氢合金/AP/HTPB推进剂,并对它们进行了DSC,PDSC,爆热和燃速测试.DSC和PDSC测试结果表明,储氢合金对AP/HTPB推进剂的凝聚相反应有催化作用,在0.1MPa和5MPa下,使其凝聚相主分解温度分别降低21.67℃和15.67℃,凝聚相反应热分别提高105.97%和21.87%;爆热测试结果表明,储氢合金对AP/HTPB推进剂的气相反应有催化作用,使气相反应热提高4.74%;燃速结果表明,储氢合金可以提高AP/HTPB推进剂的燃速.进一步研究表明,A1/AP/HTPB推进剂和储氢合金/AP/HTPB推进剂的燃速与爆热存在一定的相关性.总结出了燃速-爆热关系式.

  1. Expansion and Functional Divergence of AP2 Group Genes in Spermatophytes Determined by Molecular Evolution and Arabidopsis Mutant Analysis

    Directory of Open Access Journals (Sweden)

    Pengkai Wang

    2016-09-01

    Full Text Available The APETALA2 (AP2 genes represent the AP2 group within a large group of DNA-binding proteins called AP2/EREBP. The AP2 gene is functional and necessary for flower development, stem cell maintenance, and seed development, whereas the other members of AP2 group redundantly affect flowering time. Here we study the phylogeny of AP2 group genes in spermatophytes. Spermatophyte AP2 group genes can be classified into AP2 and TOE types, six clades, and we found that the AP2 group homologs in gymnosperms belong to the AP2 type, whereas TOE types are absent, which indicates the AP2 type gene are more ancient and TOE type was split out of AP2 type and losing the major function. In Brassicaceae, the expansion of AP2 and TOE type lead to the gene number of AP2 group were up to six. Purifying selection appears to have been the primary driving force of spermatophyte AP2 group evolution, although positive selection occurred in the AP2 clade. The transition from exon to intron of AtAP2 in Arabidopsis mutant leads to the loss of gene function and the same situation was found in AtTOE2. Combining this evolutionary analysis and published research, the results suggest that typical AP2 group genes may first appear in gymnosperms and diverged in angiosperms, following expansion of group members and functional differentiation. In angiosperms, AP2 genes (AP2 clade inherited key functions from ancestors and other genes of AP2 group lost most function but just remained flowering time controlling in gene formation. In this study, the phylogenies of AP2 group genes in spermatophytes was analyzed, which supported the evidence for the research of gene functional evolution of AP2 group.

  2. Agreement between the Government of the Republic of Chile and ESO for Establishing a New Center for Observation in Chile - ALMA

    Science.gov (United States)

    2002-10-01

    On October 21, 2002, the Minister of Foreign Affairs of the Republic of Chile, Mrs. María Soledad Alvear and the ESO Director General, Dr. Catherine Cesarsky , signed an Agreement that authorizes ESO to establish a new center for astronomical observation in Chile . This new center for astronomical observation will be for the Atacama Large Millimeter Array (ALMA) , the largest ground based astronomical project for the next decades. On this occasion, Minister Alvear stated that "we want to have ALMA working as soon as possible, which will constitute a pride not only to Chilean scientists but for the whole country and in particular, for the community of the Antofagasta Region" . ESO Director General Cesarsky said that "signing this agreement between the Government of Chile and ESO is a historical step in the astronomical collaboration between Chile and ESO and it will allow Chile to host, once again, a project of worldwide interest and impact" . ALMA is a joint project on equal basis between ESO and AUI (Associated Universities, Inc.). These organizations represent the scientific interests of Europe on one side and the United States with Canada on the other side. Chilean astronomers are closely involved with the project and 10% of the observing time will be reserved for Chilean science. ALMA will be built in the Andes, on the Plateau of Chajnantor (see the Chajnantor Photo Gallery ), 5000 metres above sea level and 60 km East of the town of San Pedro de Atacama. The array will be comprised of 64 antennas with unprecedent sensitivity and angular resolution that will allow studying the origin of galaxies, stars and planets, opening new horizons for astronomy, and being able to observe galaxies across the universe where stars are being formed. The agreement now signed between ESO and the Government of the Republic of Chile recognizes the interest that the ALMA Project has for Chile, as it will deepen and strengthen the cooperation in scientific and technological matters

  3. Constitutive Expression of Sense & Antisense PtAP3, an AP3 Homologue Gene of Populus tomentosa, Affects Growth and Flowering Time in Transgenic Tobacco

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    To analyze the function of PtAP3, an APETALA3 (AP3) homologue gene isolated from Populus tomentosa Carr., the full length sequence (1 797 bp) and a fragment (870 bp) of PtAP3 were fused to a CaMV 35S promoter of pBI121 to generate the sense and antisense constructs of PtAP3. These constructs were transformed into tobacco by Agrobacterium infection of leaf disks and selection on kanamycin medium. Some sense and antisense transgenic tobacco plants were obtained by PCR and Southern blot analysis. Great phenotypic differences in transgenic tobacco plants were observed. Almost all of sense PtAP3 to transgenic tobaccos showed a higher growth rate than those of antisense transformants and a few developed pregnancy earlier than wild type seedlings and antisense transformants under the same conditions.

  4. A new record of Equus (Mammalia: Equidae from the Late Pleistocene of central-south Chile Un nuevo registro de Equus (Mammalia: Equidae para el Pleistoceno Superior de Osorno, Chile

    Directory of Open Access Journals (Sweden)

    OMAR P RECABARREN

    2011-12-01

    Full Text Available Fourteen dental and bone parts of a horse excavated from the Pilauco paleontological site, Osorno (40°39' S-73°07' W are analysed and interpreted. This site was formed in association with a peat bog located on the banks of the old Damas River and has conserved abundant late Pleistocene mammalian fauna and flora materials. A date of 11457 ± 140 14C yrs B.P. was obtained from a molar and agrees with our stratigraphic age model. We have identified the fossils as pertaining to the species Equus (Amerhippus andium, which confirms its presence in central-south Chile. Furthermore, the recorded geographic location indicate that the metapodial adaptations of the specimens previously described agree with the reconstructed late Pleistocene landscape of Pilauco, dominated by soft volcanic soils and isolated forest patches over large extensions of grasslands.Se analizan e interpretan 14 fósiles correspondientes a dientes y huesos de caballo registrados en el sitio Pilauco, Osorno (40°39' S-73°07' W. El sitio se formó asociado a un pantano en un borde del antiguo río Damas; en él se ha conservado abundante material de mastofauna y flora pleistocénica. Una fecha radiocarbónica de 11457 ± 140 A.P obtenida de un molar, es concordante con el modelo de edad del sitio. La identificación taxonómica permite asociar a los fósiles a la especie Equus (Amerhippus andium, lo que confirma la presencia de la especie en el centro-sur de Chile. Por otra parte, la posición geográfica de los hallazgos y la reconstrucción del paisaje indicarían que se trata de ejemplares cuyas adaptaciones en los metapodios son concordantes para el paisaje pleistocénico de Pilauco dominado por suelos volcánicos blandos, con presencia de bosquetes dispersos en grandes extensiones de praderas de gramíneas.

  5. [Residues of tetracycline and quinolones in wild fish living around a salmon aquaculture center in Chile].

    Science.gov (United States)

    Fortt Z, Antonia; Cabello C, Felipe; Buschmann R, Alejandro

    2007-02-01

    The presence of residues of tetracycline, quinolones and antiparasitic drugs was investigated in wild fish captured around salmon aquaculture pens in Cochamó, Region X, Chile. Residues of both antibiotics were found in the meta [corrected] of two species of wild fish that are consumed by humans, robalo (Elginops maclovinus) and cabrilla (Sebastes capensis) [corrected] These findings suggest that the antibiotic usage in salmon aquaculture in Chile has nvironmental implications that may affect human and animal health. More studies are needed in Chile to determine the relevance of these findings for human and animal health and the environment to regulate this use of antibiotics.

  6. Hydrogeologische Untersuchungen der Geothermalfelder von Puyehue und Cordón Caulle, Chile

    OpenAIRE

    2003-01-01

    -Resumen extendido- Investigaciones realizadas en conjunto con la Universidad de Chile, en las áreas geotermales activas entre Lago Ranco y Lago Rupanco en el Sur de Chile (40.5ºS) han sido enfocadas a establecer balances hídricos e hidroquímicos. Esta tesis muestra los resultados de dos estudios de terreno realizados en las temporadas enero-marzo 2001 y enero-febrero 2002, y una investigación bibliográfica y recopilación de datos llevada a cabo en Chile. Los cálculos del caudal total se bas...

  7. 50 años de música electroacústica en Chile Electroacustic Music in Chile: Fifty years

    Directory of Open Access Journals (Sweden)

    Federico Schumacher Ratt

    2007-12-01

    Full Text Available Cincuenta años han pasado desde que León Schidlowsky compusiera Nacimiento, la primera obra electroacústica chilena. Cincuenta años de una historia a menudo desconocida, compuesta de algunos éxitos resonantes, de desarrollos a veces truncos y de silencios bastante expresivos. La música electroacústica en Chile ha tenido un desarrollo pendular: de momentos de gran pasión e interés ha pasado al desconocimiento casi absoluto, y viceversa. A pesar de ya medio siglo de historia en el país -y algo más en el mundo- pareciera que los alcances y posibilidades de la música electroacústica, o más bien del concepto que en ella subyace (la tecnología aplicada a la música, en este caso más precisamente, la informática musical, no son en nuestro medio aún lo suficientemente bien analizados, comprendidos y proyectados en cuanto a la producción musical actual y futura. En este artículo, intentamos aproximarnos a las posibilidades y exigencias que ofrece actualmente esta disciplina desde el punto de vista del análisis, de la composición y de la interpretación musical. Como ubicación, se revisará algo de nuestra historia poniendo el acento en los extremos, en sus inicios y en los años que nos son más próximosFifty years ago, León Schidlowsky wrote Nacimiento (Birth, the first electroacustic work in composed Chile. Fifty years have elapsed of a history which very frequently has been forgotten. It is mude up of resounding achievements, periods of development, sometimes interrupted, and very meaningful gaps. Like a pendulum, electroacustic music in Chile has swung from periods of great passion and interest to other periods when has been practically ignored, and viceversa. In spite of almost half a century of history in Chile and a slightly longer period in the world, it would seem that the extent and possibilities of electroacustic music or better, the concept underlying this music -a technology applied to music, or more precisely to

  8. RAD51AP2, a novel vertebrate- and meiotic-specific protein, sharesa conserved RAD51-interacting C-terminal domain with RAD51AP1/PIR51

    Energy Technology Data Exchange (ETDEWEB)

    Kovalenko, Oleg V.; Wiese, Claudia; Schild, David

    2006-07-25

    Many interacting proteins regulate and/or assist the activities of RAD51, a recombinase which plays a critical role in both DNA repair and meiotic recombination. Yeast two-hybrid screening of a human testis cDNA library revealed a new protein, RAD51AP2 (RAD51 Associated Protein 2), that interacts strongly with RAD51. A full-length cDNA clone predicts a novel vertebrate specific protein of 1159 residues, and the RAD51AP2 transcript was observed only in meiotic tissue (i.e. adult testis and fetal ovary), suggesting a meiotic-specific function for RAD51AP2. In HEK293 cells the interaction of RAD51 with an ectopically-expressed recombinant large fragment of RAD51AP2 requires the C-terminal 57 residues of RAD51AP2. This RAD51-binding region shows 81% homology to the C-terminus of RAD51AP1/PIR51, an otherwise totally unrelated RAD51-binding partner that is ubiquitously expressed. Analyses using truncations and point mutations in both RAD51AP1 and RAD51AP2 demonstrate that these proteins use the same structural motif for RAD51 binding. RAD54 shares some homology with this RAD51-binding motif, but this homologous region plays only an accessory role to the adjacent main RAD51-interacting region, which has been narrowed here to 40 amino acids. A novel protein, RAD51AP2, has been discovered that interacts with RAD51 through a C-terminal motif also present in RAD51AP1.

  9. Duplication of AP1 within the Spinacia oleracea L. AP1/FUL clade is followed by rapid amino acid and regulatory evolution.

    Science.gov (United States)

    Sather, D Noah; Golenberg, Edward M

    2009-02-01

    The AP1/FUL clade of MADS box genes have undergone multiple duplication events among angiosperm species. While initially identified as having floral meristem identity and floral organ identity function in Arabidopsis, the role of AP1 homologs does not appear to be universally conserved even among eudicots. In comparison, the role of FRUITFULL has not been extensively explored in non-model species. We report on the isolation of three AP1/FUL genes from cultivated spinach, Spinacia oleracea L. Two genes, designated SpAPETALA1-1 (SpAP1-1) and SpAPETALA1-2 (SpAP1-2), cluster as paralogous genes within the Caryophyllales AP1 clade. They are highly differentiated in the 3', carboxyl-end encoding region of the gene following the third amphipathic alpha-helix region, while still retaining some elements of a signature AP1 carboxyl motifs. In situ hybridization studies also demonstrate that the two paralogs have evolved different temporal and spatial expression patterns, and that neither gene is expressed in the developing sepal whorl, suggesting that the AP1 floral organ identity function is not conserved in spinach. The spinach FRUITFULL homolog, SpFRUITFULL (SpFUL), has retained the conserved motif and groups with Caryophyllales FRUITFULL homologs. SpFUL is expressed in leaf as well as in floral tissue, and shows strong expression late in flower development, particularly in the tapetal layer in males, and in the endothecium layer and stigma, in the females. The combined evidence of high rates of non-synonymous substitutions and differential expression patterns supports a scenario in which the AP1 homologs in the spinach AP1/FUL gene family have experienced rapid evolution following duplication.

  10. Tidal Energy Resource Assessment in Chacao Channel, Chile

    Science.gov (United States)

    Guerra, M.; Suarez, L.; Cienfuegos, R.; Thomson, J. M.

    2014-12-01

    The Chacao Channel, located in Los Lagos region in Chile (41º S; 73º W), is a highly energetic tidal channel, with a complex hydrodynamics resulting from the propagation of tidal waves through a narrow channel. The channel flow exhibits bi-directional tidal currents up to 4 to 5 m/s along with a high tidal range up to 6 m in its east end (Aiken, 2008: Cáceres et al., 2003). The channel has previously been identified as one of the most attractive sites in Chile for tidal energy extraction (Garrad Hassan and Partners, 2009); however this statement is based on global model predictions over coarse bathymetric information. In this investigation, the first hydrodynamic characterization of the Chacao channel is carried out in order to assess the hydrokinetic power available and to select the most interesting spots where the first tidal energy extraction devices might be installed in Chile. The Chacao channel hydrodynamic characterization and resource assessment is carried out in two stages: field measurements and numerical hydrodynamic modeling. The first stage involves a 10 m resolution multi-beam bathymetry of the channel, sea-level measurements using 6 tidal gauges distributed over the channel berms, tidal current measurements with 6 ADCPs distributed along the channel, and detailed measurements of turbulence in a specific spot in the channel using the Tidal Turbulence Mooring (TTM) developed by Thomson et al. (2013). In a second stage, numerical hydrodynamic modeling using FVCOM (Chen et al., 2003) was prepared for the entire Chacao channel region, using the field data collected in the first stage for calibration and validation of the model. The obtained results allow us to define suitable sites for marine energy extraction, finding large areas with 30 to 60 m depths where horizontal currents are above 1.5 m/s during 60% of the time of a 28 days tidal cycle, however the high levels of turbulence detected by the TTM indicate the need for more detailed studies on the

  11. Adding the human dimension to drought: an example from Chile

    Science.gov (United States)

    Rangecroft, Sally; Van Loon, Anne; Maureira, Héctor; Rojas, Pablo; Alejandro Gutiérrez Valdés, Sergio; Verbist, Koen

    2016-04-01

    Drought and water scarcity are important hazards and can lead to severe socio-economic impacts in many regions of the world. Given the interlinked interactions and feedbacks of hydrological droughts and their impacts and management, we need tools to evaluate these complexities and effects on the availability of water resources. Here we use a real-world case study of the Huasco basin (Northern Chile) in which we quantify the influence of human activities on hydrological drought signals. In this arid region, Andean snowmelt provides water essential for users, with agriculture acting as the main water consumer (85% of total). An increasing water demand from different water sectors (agriculture, mining, and domestic water usage) has increased pressure on available water and its management. Consequently, the Santa Juana dam was built by 1995 to increase irrigation security for downstream users, and recent management and restrictions have been established with the objective to limit impacts of hydrological droughts across the basin. The feedbacks between water availability and water management are explored for this water stressed region in Chile. Hydro-meteorological (e.g. precipitation, temperature, streamflow, reservoir levels) variables have been analysed to assess trends and drought patterns. Data over the past three decades has indicated a decrease in surface water supply, with the basin entering a situation of water scarcity during the recent multiyear drought (2007 - to-date), partly caused by meteorological drought and partly by abstraction. During this period, water supply failed to meet the demands of water users, resulting in the implementation of water restrictions. As well as the necessary continuous hydro-meteorological data, here we used information on human water users and scenario modeling, allowing for the analysis and quantification of feedbacks. This work highlights the importance of local knowledge, especially in understanding water laws, rights

  12. AP fuels and the potential of renewable diesel

    Energy Technology Data Exchange (ETDEWEB)

    Berkley, Mark; Seifkar, Navid; O' Shea, Michael; Peters, Christopher

    2010-09-15

    The decrease in demand for forestry products has been detrimental to the Province of Quebec's industrial base. With increasing energy security and environmental concerns the promotion of innovative technologies is adamant. AP Fuels Inc. has undertaken the development of a biomass-to-liquids facility proposed herein as a hybrid design, combining biomass and natural gas capable of producing diesel and other liquid fuels. The facility would consume 2,200,000 tonnewet per year of biomass and produce 10,600 bbl/day of liquid fuels. Forestry-derived F-T fuels have notable advantages including: improved performance; ultra-low sulphur content; reduced emissions, particulates and fouling; and production of fewer by-products.

  13. Aerosol Polarimetry Sensor (APS): Design Summary, Performance and Potential Modifications

    Science.gov (United States)

    Cairns, Brian

    2014-01-01

    APS is a mature design that has already been built and has a TRL of 7. Algorithmic and retrieval capabilities continue to improve and make better and more sophisticated used of the data. Adjoint solutions, both in one dimensional and three dimensional are computationally efficient and should be the preferred implementation for the calculation of Jacobians (one dimensional), or cost-function gradients (three dimensional). Adjoint solutions necessarily provide resolution of internal fields and simplify incorporation of active measurements in retrievals, which will be necessary for a future ACE mission. Its best to test these capabilities when you know the answer: OSSEs that are well constrained observationally provide the best place to test future multi-instrument platform capabilities and ensure capabilities will meet scientific needs.

  14. Towards a theory of rapidly oscillating Ap stars

    CERN Document Server

    Gough, Douglas

    2011-01-01

    Peculiar A stars are so named because they exhibit abundance peculiarities in their atmospheres. It is believed that these arise as a result of differentiation of chemical species in large magnetic spots in which convective mixing is inhibited: there might be just two antipodal spots, whose axis is inclined to the axis of rotation. Many of the Ap stars that are rotating slowly also pulsate, with periods substantially shorter than the period of the fundamental radial mode. The pulsations appear to be nonradial, but axisymmetric, with their common axis usually aligned with the axis of the spots. In this lecture I shall first discuss the magnetic suppression of convection in the spots, and then I shall try to explain the pulsation phenomenon, reviewing some of the suggestions that have been made to explain the alignment and the excitation mechanism, and finally raising some issues that need to be addressed.

  15. Fabrication and Testing of Deflecting Cavities for APS

    Energy Technology Data Exchange (ETDEWEB)

    Mammosser, John; Wang, Haipeng; Rimmer, Robert; Jim, Henry; Katherine, Wilson; Dhakal, Pashupati; Ali, Nassiri; Jim, Kerby; Jeremiah, Holzbauer; Genfa, Wu; Joel, Fuerst; Yawei, Yang; Zenghai, Li

    2013-09-01

    Jefferson Lab (Newport News, Virginia) in collaboration with Argonne National Laboratory (Argonne, IL) has fabricated and tested four first article, 2.8 GHz, deflecting SRF cavities, for Argonne's Short-Pulse X-ray (SPX) project. These cavities are unique in many ways including the fabrication techniques in which the cavity cell and waveguides were fabricated. These cavity subcomponents were milled from bulk large grain niobium ingot material directly from 3D CAD files. No forming of sub components was used with the exception of the beam-pipes. The challenging cavity and helium vessel design and fabrication results from the stringent RF performance requirements required by the project and operation in the APS ring. Production challenges and fabrication techniques as well as testing results will be discussed in this paper.

  16. Aneurisma gigante del apéndice auricular izquierdo

    OpenAIRE

    Francisco L. Moreno-Martínez; González Alfonso,Osvaldo; Lagomasino Hidalgo,Álvaro L; González Díaz,Alejandro; Oliva Céspedes,Carlos; López Bernal,Omaida J

    2006-01-01

    Los aneurismas de la aurícula izquierda son raros y pueden ser congénitos o adquiridos. Los que interesan la pared libre o el apéndice auricular son entidades más raras aún, hasta 2002 sólo existían 49 casos reportados en la aurícula izquierda y 8 en la derecha. La manifestación clínica más frecuente es la aparición de arritmias auriculares incesantes o recurrentes y pueden presentarse embolias sistémicas que pueden dar al traste con la vida del paciente. Presentamos el caso de una paciente a...

  17. Measurement of sextupole orbit offsets in the APS storage ring.

    Energy Technology Data Exchange (ETDEWEB)

    Borland, M.

    1999-04-16

    Horizontal orbit errors at the sextuples in the Advanced Photon Source (APS) storage ring can cause changes in tune and modulation of the beta functions around the ring. To determine the significance of these effects requires knowing the orbit relative to the magnetic center of the sextuples. The method considered here to determine the horizontal beam position in a given sextupole is to measure the tune shift caused by a change in the sextupole strength. The tune shift and a beta function for the same plane uniquely determine the horizontal beam position in the sextupole. The beta function at the sextupole was determined by propagating the beta functions measured at nearby quadrupoles to the sextupole location. This method was used to measure the sextupole magnetic center offset relative to an adjacent beam position monitor (BPM) at a number of sextupole locations. We report on the successes and problems of the method as well as an improved method.

  18. Los patelogastrópodos intermareales de Chile y Perú Intertidal limpets of Chile and Peru

    Directory of Open Access Journals (Sweden)

    CARMEN ESPOZ

    2004-06-01

    Full Text Available En este estudio se entrega un sistema de clasificación que refleja las relaciones de parentesco, inferidas a partir del análisis de la región 16S de ADN mitocondrial, de los patelogastrópodos que habitan en la zona intermareal a lo largo de la costa rocosa de Chile y Perú. Además, se incluye el análisis comparativo de estos patelogastrópodos en relación con la estructura, la morfología y los patrones de color de la concha, los dientes de la rádula y la anatomía corporal. Adicionalmente, se entrega información respecto de la distribución y ecología para todos los miembros de este grupo. Los resultados muestran que la fauna Lottiidae de Chile y Perú consiste en al menos nueve especies de patelogastrópodos intermareales. Esto es, ocho especies de patelogastrópodos agrupadas dentro del clado monofilético Scurria (S. variabilis, S. zebrina, S. viridula, S. plana, S. scurra, S. araucana, S. ceciliana y una especie no determinada y un "taxón problemático" asignado preliminarmente dentro del género Lottia (Lottia orbignyi. El grupo está presente entre los 5º S y 54º S, registrándose en los niveles intermareales superior, medio e inferior, desde zonas expuestas a protegidas del oleaje. A nivel intraespecífico, los resultados nos permiten proponer la sinonimia de S. parasitica con S. variabilis, y de S. ceciliana con S. boehmita. Según esto, S. variabilis presentaría al menos tres ecofenotipos: (1 en sustratos rocosos a lo largo de todo su rango geográfico, (2 sobre las conchas de Fissurella crassa y F. limbata principalmente en Chile centro-sur y (3 sobre las placas del chitón Enoplochiton niger en el norte de Chile y sur del Perú. Por su parte, S. ceciliana es una especie de patelogastrópodo que presenta un patrón morfológico y de coloración de la concha altamente variable. En general, la alta variabilidad del patrón de color y morfología de la concha sitúa a estos patelogastrópodos entre los más complejos y

  19. Chile: Neoliberalismo y subdesarrollo económico

    Directory of Open Access Journals (Sweden)

    Raúl Concha Monardes

    2014-12-01

    Full Text Available Se expone que el Régimen Militar que gobernó a Chile entre 1973 y 1990 ejecutó reformas  económicas y sociales con el objetivo declarado de crear una nueva economía. Presentado como  el modelo que terminaría con los atrasos del país hasta convertirlo en uno plenamente desarrollado, los gobiernos democráticos que le sucedieron, han mantenido vigente la fórmula hasta el día de hoy. Este artículo esboza algunas de las causas que podrían explicar el bloqueo chileno hacia el desarrollo económico.

  20. Crecimiento, Empleo e Impuestos al Trabajo: Chile 1998-2001

    OpenAIRE

    Raphael Bergoeing; Felipe Morandé

    2002-01-01

    Desde 1984 y hasta 1997, la economía chilena experimentó un crecimiento per cápita promedio de 5,4 por ciento, lo que la ubica dentro de las economías exitosas del mundo de las últimas dos décadas. Sin embargo, entre 1998 y 2001 esa tasa cayó bruscamente a 1,2 por ciento por año. Este artículo analiza el rol de la acumulación de factores y la eficiencia en su uso durante los últimos 20 años en Chile para entender la evolución del producto, en el contexto de un modelo de crecimiento neoclásico...

  1. [Fecal microbiota transplantation: first case report in Chile and review].

    Science.gov (United States)

    Espinoza, Ricardo; Quera, Rodrigo; Meyer, Lital; Rivera, Daniela

    2014-08-01

    Clostridium difficile (CD) infection is increasing in frequency and severity in in-hospital and outpatient clinical settings, with a recurrence that can reach 30% after first episode. The recurrences are usually treated with longer courses of metronidazole or vancomycin. Other treatments have been used, such as probiotics, fidaxomicin, rifaximin, immunoglobulins and monoclonal antibodies against toxins A and B. Fecal microbiota transplantation (FMT) has emerged as a promising strategy in this group of patients, with effectiveness greater than 90%. We present the first case reported in Chile of this therapeutic strategy in a patient with Crohn's disease and recurrent CD infection who presented after the fecal transplantation an Escherichia coli bacteremia, suggesting the need for caution in the use of this strategy. 10 months after the FMT the patient presented a new episode of E. coli bacteremia and two episodes of diarrhea due to CD infection, treated both of them with vancomycin with good clinical response.

  2. Chile: la persistencia de las memorias antagónicas

    Directory of Open Access Journals (Sweden)

    Gilda Waldman Mitnick

    2009-01-01

    Full Text Available A pesar de los años transcurridos en democracia, en Chile siguen persistiendo las sombras del pasado dictatorial. El país todavía no ha logrado realizar el duelo por un pasado tan doloroso, y las memorias antagónicas y contrapuestas siguen vigentes. Ello se manifiesta, por ejemplo, en los conflictos generados en torno a la conmemoración del 11 de septiembre, en los polémicos debates por los memoriales erigidos en honor de personajes políticos de izquierda y de derecha, así como en las contradictorias miradas respecto a uno de los personajes más emblemáticos de la represión dictatorial, Miguel Krassnoff, tal como aparece en dos libros de reciente publicación.

  3. Participación electoral en Chile, 1988-2001

    Directory of Open Access Journals (Sweden)

    Patricio Navia

    2004-01-01

    Full Text Available Este trabajo muestra que la participación electoral en Chile hoy no es menor a la observada hasta antes de 1973. La alta tasa de participación en 1988 representa una comprensible anomalía. Después de 15 años sin votar, los chilenos participaron entusiastamente en el plebiscito. Pero a partir de entonces, la tasa de participación tendió a la baja hasta llegar a fines de los 90 a niveles similares a los observados antes del quiebre democrático de 1973. Usando un marco teórico que aborda la participación como una función basada en costos y beneficios, discute la participación electoral en Chile en un contexto internacional, subrayando las diferencias y similitudes de los patrones existentes antes de 1973 y después de 1988, enfatizando tanto lógicas de inscripción como de participación electoral. Al hacerlo, aborda la tensión que existe entre un electorado estable y un número creciente de personas no inscritas para votar. Por último, identifica algunas propuestas que permitirían eliminar las trabas institucionales que han llevado a la formación de dos clases de adultos, aquellos que estando inscritos están obligados a votar y los que al no estar inscritos no pueden sufragar. Puntualmente, argumenta que al automatizar la inscripción se puede incorporar a todos sin tener siquiera que entrar a discutir la obligatoriedad del votoContrary to a widespread belief, post-1990 electoral participation in Chile is not lower than before 1973. The high turnout rates observed in 1988 constitute an understandable anomaly. After 15 years without elections, Chileans enthusiastically participated in the plebiscite. Yet, after that event, turnout rates fell during the 1990s to levels similar to those observed before 1973. Using a theoretical framework that defines turnout as a function based on cost and benefits, I discuss electoral participation in Chile in an international context, highlighting the differences and similarities between the

  4. A failed platform: The Citizen Consensus Conference travels to Chile.

    Science.gov (United States)

    Ureta, Sebastián

    2016-05-01

    This article starts by reviewing the setbacks that the recent Science and Technology Studies literature has identified in the functioning of technologies of democracy, the different arrangements that look to enact deliberation on technoscientific issues. Putting a focus on the Citizen Consensus Conference, it then proposes that several of these setbacks are related to the kind of "work" that these technologies are expected to do, identifying two kinds of it: performing a laboratory-based experiment and constituting a platform for the dissemination of facts. It then applies this framework to study a Citizen Consensus Conference carried out in Chile in 2003. After a detailed genealogy of the planning, implementation and afterlife of this exercise, the article concludes that several of the limitations experienced are derived from a "successful outcome" conceived as solely running a neat lab-based experiment, arguing for the need to incorporate its functioning as a platform with all the associated transformations and messiness.

  5. Hantavirus pulmonary syndrome, Southern Chile, 1995-2012.

    Science.gov (United States)

    Riquelme, Raúl; Rioseco, María Luisa; Bastidas, Lorena; Trincado, Daniela; Riquelme, Mauricio; Loyola, Hugo; Valdivieso, Francisca

    2015-04-01

    Hantavirus is endemic to the Region de Los Lagos in southern Chile; its incidence is 8.5 times higher in the communes of the Andean area than in the rest of the region. We analyzed the epidemiologic aspects of the 103 cases diagnosed by serology and the clinical aspects of 80 hospitalized patients during 1995-2012. Cases in this region clearly predominated during winter, whereas in the rest of the country, they occur mostly during summer. Mild, moderate, and severe disease was observed, and the case-fatality rate was 32%. Shock caused death in 75% of those cases; high respiratory frequency and elevated creatinine plasma level were independent factors associated with death. Early clinical suspicion, especially in rural areas, should prompt urgent transfer to a hospital with an intensive care unit and might help decrease the high case-fatality rate.

  6. Site Protection Efforts at the AURA Observatory in Chile

    Science.gov (United States)

    Smith, R. Chris; Sanhueza, Pedro; Smith, Malcolm G.

    2016-10-01

    The AURA Observatory site in northern Chile, which includes Cerro Tololo and Cerro Pachon, has been operational for over 50 years now, facing a variety of challenges to its long-term future. The site now hosts over 20 operational telescopes, ranging from small projects with 0.4m telescopes to the Blanco 4m, the SOAR 4.1m, and the 8m Gemini-South telescopes. In addition, we have recently begun the construction of the Large Synoptic Survey Telescope (LSST) on the summit of Cerro Pachon. We summarize our efforts over the past 20-30 years to highlight the importance of site protection through education and public outreach as well as through more recent promotion of IDA certifications in the region and support for the World Heritage initiatives described by others in this conference.

  7. [Scarlet fever epidemic during year 1929 in Chile].

    Science.gov (United States)

    Laval R, Enrique

    2009-04-01

    Scarlet fever is endemic in Chile, with relatively low morbidity and periodic exacerbations every 4 or 5 years, which can become epidemics. From 1921 to 1927, the number of patients hospitalized in the country fluctuated from 15 to 65 per year, until an epidemic involving nearly 3.000 patients started at the end of 1928 and continued during all 1929. 978 patients died, 537 (52.5%) were from Santiago. Public Health authorities confronted this emergency with prevention, prophylaxis, isolation and treatment measures and 558 beds were disposed for patient hospitalization. Vaccination trials were undertaken and specific treatment with antitoxins was used in patients with toxic clinical cases, having satisfactory results. Convalescent patients were controlled in order to stop the spread of the infection. After approximately 3 years, this disease returned to its regular endemicity.

  8. FACTORS RELATED TO TOTAL ENERGY EXPENDITURE IN OLDER ADULTS (CHILE).

    Science.gov (United States)

    Pakozdi, Tamara; Leiva, Laura; Bunout, Daniel; Barrera, Gladys; de la Maza, María Pía; Henriquez, Sandra; Hirsch, Sandra

    2015-10-01

    Objetivo: evaluar el Gasto Energético Total (GET) en ancianos sanos que viven institucionalizados o independientes en Chile. Método: se evaluaron veintisiete jovenes (27-30 años), 27 adultos mayores institucionalizados (> 65 años ) y 27 ancianos independientes (> 65 años). Se midió la composición corporal utilizando absorciometría bifotónica de rayos X. Se calculó el gasto energético por actividad física (GEAF) y el gasto energético total (GET) utilizando acelerómetros Actiheart; se aplicó Mini Nutritional Assessment (MNA) y se midió el Timed Up and Go (TUG). Resultados: el GEAF fue 171, 320 y 497 kcal/día en ancianos institucionalizados, independientes y jóvenes, respectivamente (p.

  9. [Vaccines against hepatitis A and B in Chile].

    Science.gov (United States)

    Valenzuela, M Teresa

    2009-06-01

    The mode of transmission and epidemiological approach for hepatitis A and B are different. However, both are preventable with vaccines whose efficacy and long lasting protection has been demonstrated. This review describes the secular tendency of both infections in Chile, their risk factors that have contributed to their persistence in the country and the interventions that have been carried out to reduce the disease burden. Although the vaccine for hepatitis B was incorporated to the immunization program in 2005, the vaccine for hepatitis A persists in the list of interventions that must be assumed with priority by the Ministry of Health. If Chilean health authorities pretend to reach the enteric disease indicators of developed countries, they must accelerate the epidemiological transition towards the elimination of hepatitis A.

  10. Climatology of surface ultraviolet-radiation in Valparaiso, Chile

    Energy Technology Data Exchange (ETDEWEB)

    Cordero, Raul R. [Universidad Tecnica Federico Santa Maria, Ave. Espana 1680, Valparaiso (Chile) and Escuela Superior Politecnica del Litoral, Km. 30, 5 Via Perimetral, Guayaquil (Ecuador)]. E-mail: raul.cordero@usm.cl; Roth, Pedro [Universidad Tecnica Federico Santa Maria, Ave. Espana 1680, Valparaiso (Chile); Georgiev, Aleksandar [Technical University of Sofia, 4023 Plovdiv (Bulgaria); Silva, Luis da [Universidad Tecnica Federico Santa Maria, Ave. Espana 1680, Valparaiso (Chile)

    2005-11-15

    Despite the lack of long-term records, it is possible to describe many of the short term characteristics, dependencies and climatology of surface UV irradiance. This paper describes the climatology of on ground UV irradiance at Valparaiso (33.05 deg. S, 71.63 deg. W, sea level), Chile. The dependence of UV-B irradiance on ozone and on other climate variables is discussed with reference to our observations conducted during the last four years. Special attention was paid to detect 'ozone events' by surface UV irradiance measurements. By analyzing time series of the UV-B/UV-A ratio, we suppressed the cloud variability effect and detected events that implied ozone column changes of about 15%. According to our measurements, during the last four years, the ozone column over Valparaiso was not affected negatively by the Antarctic ozone hole phenomenon.

  11. DEMETER Satellite Observations of Particle Burst Prior to Chile Earthquake

    CERN Document Server

    Zhang, Zhenxia; Shen, Xuhui; Ma, Yuqian; Chen, Huaran; You, Xinzhao; Yuan, Yahong

    2010-01-01

    The lithosphere activity during seismogenic or occurrence of one earthquake may emit electromagnetic wave which propagate to ionosphere and radiation belt, then induce disturbance of electric and magnetic field and the precipitation of high energy charged particles. This paper, based on the data detected by DEMETER satellite, present the high energy charged particle burst(PB) with 4 to 6 times enhancement over the average value observed about ten days days before Chile earthquake. The obvious particle burst was also observed in the northern hemisphere mirror points conjugate of epicenter and no PB events in different years over the same epicenter region was found. The energy spectra of the PBs are different from the one averaged within the first three months in 2010. At the same time, the disturbance of the VLF electric spectrum in ionosphere over the epicenter detected by the DEMETER satellite are also observed in the same two orbits. Those observations from energetic PB and VLF electric spectrum disturbance...

  12. [Human resources for health in Chile: the reform's pending challenge].

    Science.gov (United States)

    Méndez, Claudio A

    2009-09-01

    Omission of human resources from health policy development has been identified as a barrier in the health sector reform's adoption phase. Since 2002, Chile's health care system has been undergoing a transformation based on the principles of health as a human right, equity, solidarity, efficiency, and social participation. While the reform has set forth the redefinition of the medical professions, continuing education, scheduled accreditation, and the introduction of career development incentives, it has not considered management options tailored to the new setting, a human resources strategy that has the consensus of key players and sector policy, or a process for understanding the needs of health care staff and professionals. However, there is still time to undo the shortcomings, in large part because the reform's implementation phase only recently has begun. Overcoming this challenge is in the hands of the experts charged with designing public health strategies and policies.

  13. MOVILIDAD SUSTENTABLE EN CHILE: OPORTUNIDADES, EXPERIENCIAS LOCALES Y REFERENCIAS GLOBALES

    Directory of Open Access Journals (Sweden)

    Jorge Díaz Tejeda

    2012-01-01

    Full Text Available Este artículo propone Premisas Conceptuales, Premisas Metodológicas y el desarrollo de Aspectos Estratégicos para la implementación de soluciones a la Movilidad Urbana. Se inspira en las ideas, experiencias e investigaciones de diversas personas quienes abordan desde lógicas puntuales aspectos temáticos específicos en el marco de la Planificación Urbana en general y de las aplicaciones en Transporte en particular. Chile atraviesa por una oportunidad histórica, quizás paradójicamente, a partir de un evento de catástrofe ocurrido en Febrero del 2010; esta oportunidad es la de re-plantear el proceso de Planificación Urbana bajo los alcances del Desarrollo Sustentable.

  14. Identidad y fronteras urbanas en Santiago de Chile

    Directory of Open Access Journals (Sweden)

    Francisca Márquez

    2003-12-01

    Full Text Available Este articulo analiza a través de un ejercicio etnográfico los procesos de construcción identitaria de los habitantes de barrios pobres y medios de la ciudad de Santiago de Chile. Se plantea que las identidades que alli se construyen son expresión de los procesos de segregación urbana de la ciudad de Santiago y ellas dan cuenta del debilitamiento de un modelo urbano asentado en la heterogeneidad social, la noción de espacio público y valores como la ciudadanía política y la integración social. Paradojalmente, esta misma segregación urbana abre también paso a un imaginario y una práctica de vida comunitaria y tribal que refuerza y protege al nosotros de la peligrosidad de los otros.

  15. How was the UNAIDS drug access initiative implemented in Chile?

    Science.gov (United States)

    Brousselle, Astrid; Champagne, François

    2004-01-01

    In 1997, UNAIDS decided to implement Drug Access Initiatives (DAI) in four different pilot-countries. We studied the implementation of the DAI in Chile as part of the evaluation program conducted by the 'Agence Nationale de Recherche sur le SIDA' (ANRS/France). The objective was to understand how the politico-organizational dynamic influenced the implementation process of the DAI. Approximately 50 semi-directed interviews and observation activities were conducted with the actors who participated in the implementation of the DAI or who played a role in the HIV/AIDS context. The program theory models were established and their evolution analyzed. This article offers an original analysis of an international HIV/AIDS drug access program that was put in place at a time when such programs were seen as a priority by international and governmental institutions. It also offers some insights for the creation of international projects that will be locally implemented.

  16. [Health care reform in Chile: 2005 to 2009].

    Science.gov (United States)

    Valdivieso D, Vicente; Montero L, Joaquín

    2010-08-01

    Five years ago Chile implemented a Health Care Reform to reduce the great inequalities in health care provision that affects the low- income, high-risk segment of its population. A universal care plan ("AUGE") was designed to make medical coverage available to all Chilean citizens suffering from one of a specified, growing list of diseases (66 at present time). The diseases are prioritized by the Ministry of Health and its inclusion in the plan is revised periodically by an Advisory Committee according to four cardinal criteria: burden of disease, effectiveness of treatment, specific capacity of the health system and financial costs. The plan is funded by the state and enforced by law through a set of four specific guarantees: access, opportunity, quality and financial protection. This paper reviews the origin and development of the reform, the benefits and drawbacks of the application of the specific guarantees and the perception of the public regarding its strengths and weaknesses.

  17. A serological survey of leptospirosis in sheep in Chile.

    Science.gov (United States)

    Zamora, J; Riedemann, S; Tadich, N

    1999-01-01

    In order to investigate exposure to Leptospira spp. in sheep in the Xth Region in the south of Chile, 629 ovine serum samples were collected from 11 convenience selected sheep farms, using within farm random sampling. The sera collected were examined for antibodies to the following serovars; icterohaemorrhagiae, autumnalis, hardjo, pomona, ballum, and canicola, using the Microscopic Agglutination Test. Ten out of eleven flocks had sheep which were seropositive for at least one Leptospira spp. Positive tests, the majority at low titres, were obtained from 36/629 (5.7%) of all the serum samples tested. The most frequently detected serovars were, in descending order: icterohaemorrhagiae, autumnalis and hardjo. The greatest proportion of positive samples came from sheep which were over 30 months old.

  18. Nursing leadership in Chile: a concept in transition.

    Science.gov (United States)

    Alarcon, Ana M; Astudillo, Paula R; Barrios, Sara A; Rivas, Edith E

    2002-10-01

    The purposes of this two-year research study were to uncover Chilean nurses' perspectives of the elements that comprise leadership, and to identify challenges faced by nurse leaders in modern health administration. The research question is, What are the structural components that define and characterize nursing leadership in Chile? Nine nurses from different professional backgrounds volunteered to take part in audiorecorded successive interviews. The research methodology was a kind of grounded theory. Findings suggest that leadership is characterized mainly by exerting a positive influence on others based on good communication, knowledge of management, and a futurist vision of the nursing profession. Crisis and transition in nursing leadership were associated with external and internal forces, such as reforms in healthcare organizations and changes in the nursing conceptual framework.

  19. Enhanced Antimicrobial Activity of AamAP1-Lysine, a Novel Synthetic Peptide Analog Derived from the Scorpion Venom Peptide AamAP1

    Directory of Open Access Journals (Sweden)

    Ammar Almaaytah

    2014-04-01

    Full Text Available There is great interest in the development of antimicrobial peptides as a potentially novel class of antimicrobial agents. Several structural determinants are responsible for the antimicrobial and cytolytic activity of antimicrobial peptides. In our study, a new synthetic peptide analog, AamAP1-Lysine from the naturally occurring scorpion venom antimicrobial peptide AamAP1, was designed by modifying the parent peptide in order to increase the positive charge and optimize other physico-chemical parameters involved in antimicrobial activity. AamAP1-Lysine displayed potent antibacterial activity against Gram-positive and Gram-negative bacteria. The minimum inhibitory concentration was in the range of 5 to 15 µM with a 10 fold increase in potency over the parent peptide. The hemolytic and antiproliferative activity of AamAP1-Lysine against eukaryotic mammalian cells was minimal at the concentration range needed to inhibit bacterial growth. The antibacterial mechanism analysis indicated that AamAP1-Lysine is probably inducing bacterial cell death through membrane damage and permeabilization determined by the release of β-galactosidase enzyme from peptide treated E. coli cells. DNA binding studies revealed that AamAP1-Lysine caused complete retardation of DNA migration and could display intracellular activities in addition to the membrane permeabilization mode of action reported earlier. In conclusion, AamAP1-Lysine could prove to be a potential candidate for antimicrobial drug development in future studies.

  20. Anisakid parasites in commercial hake ceviche in southern Chile.

    Science.gov (United States)

    Torres-Frenzel, Pablo; Torres, Patricio

    2014-07-01

    The objective of this research was to determine the occurrence of anisakid nematode larvae in hake ceviche sold in restaurants in Valdivia (39°48'S, 73°14'W) and Niebla (39°49'S, 73°22'W), Chile. Between August and November 2012, 78 portions of ceviche were collected (6 from each of the 13 restaurants that sell this product). Each portion was weighed and divided into approximately 30-g samples, which were placed in petri dishes with 0.15 M NaCl. All samples were manually shredded and then examined with a stereomicroscope. Muscles of 41 southern hake (Merluccius australis), a fish sold fresh in Valdivia, also were examined by candling to determine the presence of anisakid larvae. The presence of Pseudoterranova larvae in ceviche sold in Chile was identified for the first time. The pH of ceviche ranges from 4.1 to 4.8, which favors the presence of viable anisakid larvae that tolerate the acid pH similar to that found in the stomach of their mammalian host. No significant differences (P > 0.05) in the prevalence, mean abundance, and mean density of anisakid larvae in ceviche were found between localities. Larvae were detected in ceviche from 3 of 6 restaurants in Valdivia and 4 of 7 restaurants in Niebla. Of the 78 examined portions of ceviche, 21.8% had larvae. The prevalence of viable larvae was 16.7 and 7.1% in the examined portions from Valdivia and Niebla, respectively. In the 41 hake muscle samples from Valdivia, the prevalence (4.9%), mean abundance (0.1), and mean density (0.03) was the same for Pseudoterranova and Anisakis larvae. No inspection processes or pretreatments are currently in place for raw fish to achieve safe conditions for ceviche in restaurants from Valdivia and Niebla.

  1. Chile: todas íbamos a ser reinas

    Directory of Open Access Journals (Sweden)

    Rodrigo Mardones Z

    2007-01-01

    Full Text Available El artículo describe los acontecimientos políticos del año 2006 marcados por la elección y asunción de Michelle Bachelet a la presidencia de Chile en marzo, y la muerte del ex dictador Augusto Pinochet en diciembre. Aunque el nuevo Gobierno prometía una altísima sintonía con la gente, y aunque el desempeño económico ha sido bueno, las instituciones políticas exhiben una creciente desafección ciudadana iniciada tempranamente con la movilización estudiantil secundaria, y una seguidilla de escándalos de corrupción. Una parte de estos problemas puede adjudicarse al propio Gobierno, incluida la débil conformación del gabinete de ministros; sin embargo, es el momento de la Concertación -coalición que lleva 17 años en el poder- lo que explica el mayor desgasteThe paper describes the political events of 2006, featuring the election and assumption of Michelle Bachelet as Chile's President in March, and the death of the former dictator Augusto Pinochet in December. Even though the new Government augured in tune with the citizenship, and despite good economic performance, the political institutions exhibit a growing distrust from citizens, which started early with demonstrations of high school students, and a rollover of corruption scandals. In part, these problems can be seen as the Government's own fault, including a weak cabinet of ministers. However, the main reason for most of the wear away is the current moment of the Concertación, the ruling coalition with 17 years in power

  2. La isla de calor estival en Temuco, Chile

    Directory of Open Access Journals (Sweden)

    Alicia Capelli de Steffens

    2001-01-01

    Full Text Available Temuco es una ciudad localizada en el centro sur de Chile (38º 45’ S y 72º 40’ W. Morfológicamente, el sitio de la ciudad corresponde a las terrazas fluviales del río Cautín que se desarrollan en forma encajonada entre los cerros Ñielol (350 m y Conunhueno (360 m. Esta ciudad se ha desarrollado rápidamente en las últimas décadas, por lo tanto es necesario conocer el efecto antrópico en la misma. Para evaluar parte de ese efecto se analiza la isla de calor urbana estival en la ciudad de Temuco, Chile. Se efectuaron mediciones de temperatura del aire y humedad a través de la ciudad para determinar la forma y la intensidad de la isla de calor urbano. Se utilizaron estaciones móviles e información de una estación meteorológica fija. La ciudad presenta un comportamiento térmico diferente a lo largo del día. Durante el día genera una isla de calor que responde en líneas generales al modelo ideal de calentamiento urbano. La intensidad de la isla calórica (∆Tu-r fue 6.3ºC y 1.2ºC durante el día y la noche, respectivamente. La influencia de los cerros que limitan la ciudad es importante. El estudio confirma la idea que el clima urbano de una ciudad es un mosaico de microclimas que interactuan continuamente.

  3. Trophic interactions in northern Chile upwelling ecosystem, year 1997

    Directory of Open Access Journals (Sweden)

    Mónica E Barros

    2014-11-01

    Full Text Available A food web model is constructed to describe predator-prey interactions, community structure and trophic flows in northern Chile upwelling ecosystem (18°20'S, 24°S, for the year 1997. The model is built using the Ecopath with Ecosim software version 6.4, and encompasses 21 functional groups, ranging from primary producers (phytoplankton to top predators (birds and marine mammals, the principal fishing resources and the fishery. Input parameters required to build the model were gathered from specialized literature, grey literature and our own estimates. The results indicated that the total biomass (B T was estimated at 624.7 ton km-2. The combined biomass of small pelagic fish represented 26% of B T, while the combined biomass of demersal fish represented only 0.1% of B T. These results highlight the importance of pelagic fish in this system. Predation mortality resulted to be the main source of mortality. Nevertheless, fishing mortality was important in anchovy, mackerel, common dolphinfish and jack mackerel. The mean trophic level of the fishery was estimated as 3.7, with landings sustained mainly by anchovy. Primary production required to sustain the landings (PPR was estimated at 7.5% of calculated total net primary production, which is lower than PPR estimates in other upwelling ecosystems. The average trophic transfer efficiency was 18%, which is in the range (10-20% informed for marine ecosystems. Results indicate that in 1997 the northern Chile marine ecosystem was characterized for being a system far from maturity, dominated in terms of biomass and flows by the pelagic realm.

  4. Ancient Leishmaniasis in a highland desert of Northern Chile.

    Directory of Open Access Journals (Sweden)

    Maria Antonietta Costa

    Full Text Available BACKGROUND: Leishmaniasis is an infectious disease endemic today in many areas of South America. METHODOLOGY: We discovered morphologic and molecular evidence of ancient infections in 4 female skulls in the archaeological cemetery of Coyo Oriente, in the desert of San Pedro de Atacama, Northern Chile. The boney facial lesions visible in the skulls could have been caused by a number of chronic infections including chronic Leishmaniasis. This diagnosis was confirmed using PCR-sequenced analyses of bone fragments from the skulls of the affected individuals.Leishmaniasis is not normally found in the high-altitude desert of Northern Chile; where the harsh climate does not allow the parasite to complete its life cycle. The presence of Leishmaniasis in ancient skulls from the region implies infection by the protozoan in an endemic area-likely, in our subjects, to have been the lowlands of North-Eastern Argentina or in Southern Bolivia. CONCLUSIONS: We propose that the presence of the disease in ancient times in the high altitude desert of San Pedro de Atacama is the result of an exogamic system of patrilocal marriages, where women from different cultures followed their husbands to their ancestral homes, allowing immigrant women, infected early in life, to be incorporated in the Atacama desert society before they became disfigured by the disease. The present globalization of goods and services and the extraordinary facile movement of people across borders and continents have lead to a resurgence of infectious diseases and re-emergence of infections such as Leishmaniasis. We show here that such factors were already present millennia ago, shaping demographic trends and the epidemiology of infections just as they do today.

  5. Lung cancer and arsenic concentrations in drinking water in Chile.

    Science.gov (United States)

    Ferreccio, C; González, C; Milosavjlevic, V; Marshall, G; Sancha, A M; Smith, A H

    2000-11-01

    Cities in northern Chile had arsenic concentrations of 860 microg/liter in drinking water in the period 1958-1970. Concentrations have since been reduced to 40 microg/liter. We investigated the relation between lung cancer and arsenic in drinking water in northern Chile in a case-control study involving patients diagnosed with lung cancer between 1994 and 1996 and frequency-matched hospital controls. The study identified 152 lung cancer cases and 419 controls. Participants were interviewed regarding drinking water sources, cigarette smoking, and other variables. Logistic regression analysis revealed a clear trend in lung cancer odds ratios and 95% confidence intervals (CIs) with increasing concentration of arsenic in drinking water, as follows: 1, 1.6 (95% CI = 0.5-5.3), 3.9 (95% CI = 1.2-12.3), 5.2 (95% CI = 2.3-11.7), and 8.9 (95% CI = 4.0-19.6), for arsenic concentrations ranging from less than 10 microg/liter to a 65-year average concentration of 200-400 microg/liter. There was evidence of synergy between cigarette smoking and ingestion of arsenic in drinking water; the odds ratio for lung cancer was 32.0 (95% CI = 7.2-198.0) among smokers exposed to more than 200 microg/liter of arsenic in drinking water (lifetime average) compared with nonsmokers exposed to less than 50 microg/liter. This study provides strong evidence that ingestion of inorganic arsenic is associated with human lung cancer.

  6. When memory becomes heritage: Experiences from Santiago, Chile

    Directory of Open Access Journals (Sweden)

    Chiara Bianchini, Maria

    2014-12-01

    Full Text Available This article explores the relationships between memory politics and urban heritage in the construction of a twenty-first century democratic society. It focuses on the case of Chile and concentrates on three examples of public buildings in the capital city, Santiago. Given what can be considered a difficult heritage –linked to the recent experience of dictatorship and state sponsored violence– these buildings have been in recent years objects of heritage politics, directed to address a public memory related to those events. Based on these case studies, the article critically discusses the materialization of the dominant human rights discourse in the current memory politics affecting Santiago’s urban heritage.Este artículo aborda las relaciones entre políticas de memoria y patrimonio urbano en el proceso de construcción de una sociedad democrática del siglo XXI. El análisis se centra en el caso de Chile y presenta tres ejemplos de edificios públicos de la capital, Santiago. Los tres sitios representan lo que puede considerarse un patrimonio difícil –vinculado a una reciente experiencia de dictadura y violencia de Estado– y, por esta razón, han sido objeto, en años recientes, de políticas patrimoniales dirigidas a gestionar la memoria pública de esos eventos. A través de estos casos, el artículo analiza críticamente la materialización del discurso dominante de los derechos humanos en las actuales políticas de memoria que afectan al patrimonio urbano de Santiago.

  7. The state of solar energy resource assessment in Chile

    Energy Technology Data Exchange (ETDEWEB)

    Ortega, Alberto; Escobar, Rodrigo [Mechanical and Metallurgical Engineering Department, Pontificia Universidad Catolica de Chile, Vicuna Mackenna 4860, Macul, Santiago (Chile); Colle, Sergio [Laboratorios de Engenharia de Processos de Conversao e Tecnologia de Energia - LEPTEN, Mechanical Engineering Department, Universidade Federal de Santa Catarina, Florianopolis (Brazil); de Abreu, Samuel Luna [IFSC - Instituto Federal de Santa Catarina, Campus Sao Jose, Sao Jose - SC (Brazil)

    2010-11-15

    The Chilean government has determined that a renewable energy quota of up to 10% of the electrical energy generated must be met by 2024. This plan has already sparked interest in wind, geothermal, hydro and biomass power plants in order to introduce renewable energy systems to the country. Solar energy is being considered only for demonstration, small-scale CSP plants and for domestic water heating applications. This apparent lack of interest in solar energy is partly due to the absence of a valid solar energy database, adequate for energy system simulation and planning activities. One of the available solar radiation databases is 20-40 years old, with measurements taken by pyranographs and Campbell-Stokes devices. A second database from the Chilean Meteorological Service is composed by pyranometer readings, sparsely distributed along the country and available from 1988, with a number of these stations operating intermittently. The Chilean government through its National Energy Commission (CNE) has contracted the formulation of a simulation model and also the deployment of network of measurement stations in northern Chile. Recent efforts by the authors have resulted in a preliminary assessment by satellite image processing. Here, we compare the existing databases of solar radiation in Chile. Monthly mean solar energy maps are created from ground measurements and satellite estimations and compared. It is found that significant deviation exists between sources, and that all ground-station measurements display unknown uncertainty levels, thus highlighting the need for a proper, country-wide long-term resource assessment initiative. However, the solar energy levels throughout the country can be considered as high, and it is thought that they are adequate for energy planning activities - although not yet for proper power plant design and dimensioning. (author)

  8. [Revista Médica de Chile in the year 2012].

    Science.gov (United States)

    Reyes B, Humberto; Bustos-González, Atilio; Andresen H, Max; Palma H, Joaquín

    2013-08-01

    During the year 2012, 539 manuscripts were submitted to this journal, following an increasing trend in the recent decade. Rejection rate was 33%. This higher number of submissions demanded a larger number and wider scope of external reviews, retarding the editorial process. The mean time lapse from reception to acceptance (or rejection) was 6.3 months (range 2-14) and from acceptance to publication 5.3 months (range 3-7). Research articles were 43.9% of published manuscripts and the remaining articles were Reviews, Special Articles, Case Reports, articles on Medical Ethics, Medical Education, Evidence Based Medicine, Public Health, History of Medicine, Letters to the Editor and others. Thirty seven published manuscripts (14.6%) came from foreign countries and 9 of them were published with full text in English. The 2012 Impact Factor was 0.360, showing little variation from previous years, locating the journal in the upper part of quartil 4 in the ISI-JCR category "Medicine, General and Internal", while the SCImago Journal & Country Rank locates the Revista in quartil 2 of its category "Medicine (miscellaneous)". In contrast with the low citation rate, the number of visits to the open access electronic version in www.scielo.cl averages over 3 million visits per year, illustrating that the interest among readers outnumbers the country's expectable readership. Only 22% of articles declared to have received financial help from entities external to the institution where the work was performed, coming mainly from Chilean Governmental competitive funds. The aim of Revista Médica de Chile is to provide readers and authors a valuable source of information about current relevant topics in general and internal medicine, progress in related specialties and updates in basic sciences, rendering them available to Health professionals in Chile and worldwide, following international standards of ethical and scientific quality in medical publications.

  9. Dengue-1 virus isolation during first dengue fever outbreak on Easter Island, Chile.

    Science.gov (United States)

    Perret, Cecilia; Abarca, Katia; Ovalle, Jimena; Ferrer, Pablo; Godoy, Paula; Olea, Andrea; Aguilera, Ximena; Ferrés, Marcela

    2003-11-01

    Dengue virus was detected for the first time in Chile, in an outbreak of dengue fever on Easter Island. The virus was isolated in tissue culture and characterized by reverse transcription-polymerase chain reaction as being dengue type 1.

  10. Dengue-1 Virus Isolation during First Dengue Fever Outbreak on Easter Island, Chile

    OpenAIRE

    Perret, Cecilia; Abarca, Katia; Ovalle, Jimena; Ferrer, Pablo; Godoy, Paula; Olea, Andrea; Aguilera, Ximena; Ferrés, Marcela

    2003-01-01

    Dengue virus was detected for the first time in Chile, in an outbreak of dengue fever on Easter Island. The virus was isolated in tissue culture and characterized by reverse transcription–polymerase chain reaction as being dengue type 1.

  11. The Press Conference for the 7th China Auto International (Chile & Peru) Exhibition Tour Held

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    @@ On September 9,2009,the press conference and the flag presentation cercmony of the 7th China Auto International (Chile & Peru) Exhibition Tour (CAIET) was held at the auditorium of China Council for the Promotion of International Trade (CCPIT).

  12. Vervoortihelcon, a new genus of the subfamily Helconinae Foerster (Hymenoptera: Braconidae) from Chile

    NARCIS (Netherlands)

    Achterberg, van C.

    1998-01-01

    A new genus of the tribe Helconini Foerster (Braconidae: Helconinae), Vervoortihelcon (type species: Vervoortihelcon scaramozzinoi spec, nov.) from Chile is described and illustrated. The new subtribe Vervoortihelconina is named to include the new genus.

  13. Phosphate geochemistry, mineralization processes, and Thioploca distribution in shelf sediments off central Chile

    DEFF Research Database (Denmark)

    Holmkvist, Lars; Arning, Esther T.; Küster-Heins, Kathrin

    2010-01-01

    mineralization, and occurrence of dense communities of the filamentous sulfur bacteria, Thioploca spp., on the continental shelf off central Chile during the austral summer when high phytoplankton productivity and anoxic bottom water prevailed. Freshly deposited phytodetritus stimulated extremely high sulfate...

  14. CCPIT Successfully Signed Preferential Certificate of under the China-Chile Free Trade Agreement

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    @@ On March 1, 2010,China and Chile signed China-Peru Free Trade Agreement. in Beijing.After the two countries completing the domestic legal procedures, this agreement has been fully implemented since March 1, 2010.

  15. 75 FR 8111 - Preserved Mushrooms From Chile, China, India, and Indonesia

    Science.gov (United States)

    2010-02-23

    ... From the Federal Register Online via the Government Publishing Office INTERNATIONAL TRADE COMMISSION Preserved Mushrooms From Chile, China, India, and Indonesia AGENCY: United States International Trade Commission. ACTION: Revised schedule for the subject reviews. DATES: Effective Date: February...

  16. 无线网络钓鱼 AP 攻击检测技术研究%RESEARCH ON DETECTION TECHNOLOGY OF FISHING AP ATTACK IN WIRELESS NETWORK

    Institute of Scientific and Technical Information of China (English)

    金双齐; 凌捷

    2016-01-01

    With the popularisation of WLAN,the attacks against wireless network are increasingly growing.Wireless fishing AP attack, through passive or active way,induces users to connect fishing AP,and then catches users’sensitive information,it is currently one of the abused attack modes.In light of this,we proposed an improved fishing AP attack detection method,by using diminishing variation of TTL value as well as comprehensively analysing the gateway and routing information,it realises validity detection on AP.Experimental results showed that this method can effectively detect the attacks including wireless fishing AP and wireless man-in-the-middle.%随着无线局域网应用的普及,针对无线网络的攻击方式也逐渐增多。无线钓鱼 AP 攻击通过被动或主动方式诱使用户连接钓鱼 AP,进而获取用户的敏感信息,是当前被滥用的攻击方式之一。针对这种情况,提出一种改进的钓鱼 AP 攻击检测方法,通过利用 TTL 值的递减变化,以及综合分析网关与路由信息,实现对 AP 的合法性检测。实验结果表明,该方法能够有效地检测无线钓鱼 AP 和无线中间人等攻击。

  17. Study on the thermal decomposition behavior of RDX/AP/HTPB propellant%RDX/AP/HTPB推进剂热分解特性研究

    Institute of Scientific and Technical Information of China (English)

    陈沛; 赵凤起; 阴翠梅

    2002-01-01

    利用高压差示扫描量热仪(PDSC)研究了RDX/AP/HTPB推进剂系列配方的热分解性能,发现配方组分的改变对RDX/AP/HTPB推进剂的热分解性能有影响,突出表现在RDX/AP/HTPB推进剂中RDX分解峰变宽,AP放热分解效应增强.推进剂中添加Al粉后,RDX的分解受到抑制,而AP的分解却得到增强.

  18. The Invisible Blockade and the Covert War: U.S. Relations with Chile, 1970-1973

    Science.gov (United States)

    1979-06-01

    Their disappointment has been emotion- ally presented by Gary MacEoin, who stated: 2 This Chilean exDerience has a much wider meaning for mankind...de Chile-100%) Dow (Dow Quimica Chilena-100%, Petroquimica Dow-70%) Ford (Ford Motor de Chile-100%) General Cable (MADECO-approximately 50%) General...Electric (Electromat-majority) General Tire (INSA-37%) :BEC (Concretos Ready-Mix-100%) International Chemical Fibers ( Quimica Industrial-60%) ITT

  19. Protection of Existing and Potential Astronomical Sites in Chile - an Update.

    Science.gov (United States)

    Smith, M. G.; Sanhueza, P.; Norman, D.; Schwarz, H.; Orellana, D.

    2002-12-01

    The IAU's Working Group on Controlling Light Pollution (iauwg) has declared Mauna Kea and a wide strip of Northern Chile between Antofagasta and Chajnanator as top priorities for its efforts to protect existing and potential sites in the Northern and Southern hemispheres respectively. This report provides an update on the iauwg's co-ordinated efforts to protect areas around the major international optical observatories in Chile, as well as the "Chilean Special Zone" (CSZ) mentioned above. This zone is of current and potential interest for the installation of extremely large optical telescopes and includes the ALMA radio-astronomy site. The CSZ is potentially vulnerable to adverse effects of mining in the region. Progess has been made in demonstrating to local mining interests within the CSZ the economic advantages of quality lighting. Educational and outreach activities to a variety of target audiences are building on legislation covering dark skies - itself part of work by the Chilean government to protect the natural heritage of Chile. Substantial good will was generated by an international, bilingual conference held last March in Chile. Just in the region around AURA's Observatory in Chile (Gemini South, CTIO and SOAR), a portable planetarium has been used to reach out to over 600 teachers and 65,000 pupils in the RedLaSer schools network within the last three years. This has attracted the direct interest of Chile's Ministry of Education. Videoconferencing over Internet2 is being used for educational purposes between Chile and various sites in the US. The NSF- initiated Mamalluca municipal observatory now receives more visitors than all the international observatories in Chile combined and is the focus of an expanding local industry of astronomical eco-tourism. Most of this work was supported by funding from, or via, the US NSF through CTIO and Gemini, and from ESO, OCIW, CONAMA and the IDA.

  20. Santiago de Chile, ¿ejemplo de una reestructuración capitalista global?

    Directory of Open Access Journals (Sweden)

    Luis Fuentes

    2004-12-01

    Full Text Available Términos como "ciudad global", "ciudad difusa", "ciudad dual", entre otros, merecen ser rediscutidos y contrastados con el proceso de transformaciones experimentado por Santiago de Chile producto de la reestructuración capitalista. En este sentido, este trabajo pretende discutir acerca de la conveniencia de otorgar a la capital de Chile éstos y otros adjetivos frecuentemente utilizados en la literatura urbanística internacional.

  1. Is Chile Complying with its Light Pollution Regulations? A Status Report

    Science.gov (United States)

    Smith, M. G.; Sanhueza, P.; Schwarz, H. E.; Walker, A. R.

    2005-12-01

    Monte Patria is the first Municipality in Chile to comply fully with Supreme Decree 686, the Chilean, environmentally-based legislation governing exterior lighting in Northern Chile - the "norma luminica". "Before" and "after" photographs of Monte Patria were published in last June's issue of "Physics Today", in the context of the global effort to control light pollution. Some photographs of other Chilean towns have been obtained for this poster and for display at the International Dark Sky Association's stand at this meeting. Highlights include detailed midnight and dawn panoramas taken by us during October, 2005 - the month in which the six-year "grace period" for all external lighting in northern Chile's astronomically-sensitive 2nd, 3rd and 4th Regions was supposed to come into full compliance. It is clear that significant progress is being made. The chief obstacle has been financial. Large-scale changeout of street lighting requires an outlay of many millions of dollars from cash-strapped municipalities. Chile's central government has moved in to provide financing at the 80-100/% level in many cases. Once Chile's congressional elections are over, we will be able to judge the political will to complete the changeover. Various large mining operations are currently engaged in major lighting changeovers; such changes are especially important in the various mines that are directly visible from existing major observatories in Northern Chile. The importance to astronomy is that full compliance with DS686 will, on average, extend the potential useful life of all the major optical observatories in Northern Chile by several decades. Funding for the Office for the Protection of the Quality of the Skies of Chile (OPCC) is provided by the Chilean National Environment Committee (CONAMA), NOAO, Gemini, ESO and the Las Campanas Observatory of the Carnegie Institute of Washington.

  2. HPV16 E6 and E6AP differentially cooperate to stimulate or augment Wnt signaling

    Energy Technology Data Exchange (ETDEWEB)

    Sominsky, Sophia, E-mail: sophia.tab@gmail.com [Department of Clinical Microbiology and Immunology, Sackler School of Medicine, Tel Aviv University, Tel Aviv 69978 (Israel); Kuslansky, Yael, E-mail: ykuslansky@gmail.com [Department of Clinical Microbiology and Immunology, Sackler School of Medicine, Tel Aviv University, Tel Aviv 69978 (Israel); Shapiro, Beny, E-mail: benyshap@gmail.com [Department of Clinical Microbiology and Immunology, Sackler School of Medicine, Tel Aviv University, Tel Aviv 69978 (Israel); Jackman, Anna, E-mail: jackman@post.tau.ac.il [Department of Clinical Microbiology and Immunology, Sackler School of Medicine, Tel Aviv University, Tel Aviv 69978 (Israel); Haupt, Ygal, E-mail: ygal.haupt@petermac.org [Research Division, The Peter MacCallum Cancer Centre, East Melbourne (Australia); Rosin-Arbesfeld, Rina, E-mail: arina@post.tau.ac.il [Department of Clinical Microbiology and Immunology, Sackler School of Medicine, Tel Aviv University, Tel Aviv 69978 (Israel); Sherman, Levana, E-mail: lsherman@post.tau.ac.il [Department of Clinical Microbiology and Immunology, Sackler School of Medicine, Tel Aviv University, Tel Aviv 69978 (Israel)

    2014-11-15

    The present study investigated the roles of E6 and E6AP in the Wnt pathway. We showed that E6 levels are markedly reduced in cells in which Wnt signaling is activated. Coexpression of wild-type or mutant E6AP (C820A) in Wnt-activated cells stabilized E6 and enhanced Wnt/β-catenin/TCF transcription. Expression of E6AP alone in nonstimulated cells elevated β-catenin level, promoted its nuclear accumulation, and activated β-catenin/TCF transcription. A knockdown of E6AP lowered β-catenin levels. Coexpression with E6 intensified the activities of E6AP. Further experiments proved that E6AP/E6 stabilize β-catenin by protecting it from proteasomal degradation. This function was dependent on the catalytic activity of E6AP, the kinase activity of GSK3β and the susceptibility of β-catenin to GSK3β phosphorylation. Thus, this study identified E6AP as a novel regulator of the Wnt signaling pathway, capable of cooperating with E6 in stimulating or augmenting Wnt/β-catenin signaling, thereby possibly contributing to HPV carcinogenesis. - Highlights: • The roles of E6 and E6AP in the Wnt pathway were investigated. • E6AP stabilizes E6 and enhances E6 activity in augmentation of Wnt signaling. • E6AP cooperates with E6 to stabilize β-catenin and stimulate Wnt/β-catenin signaling. • E6AP and E6 act through different mechanisms to augment or stimulate Wnt signaling.

  3. On the evolution of the magnetic field of Ap star $\\alpha^2$ CVn

    CERN Document Server

    Bychkov, V D; Madej, J; Topilskaya, G P

    2016-01-01

    New high-precision measurements of the longitudinal magnetic field of Ap stars suggest the existence of secular intrinsic variations of the global magnetic field in some stars. We argue that such changes are apparent in the Ap star $\\alpha^2$ CVn in the time scale of $\\sim$ 10 years, which results from the analysis of literature data. Therefore, such an observation implies, that the rate of magnetic field evolution of Ap stars is much higher than was previously thought.

  4. Solar cooking and wood in Chile, energetical alternatives; Cocina solares y manejo de lena en Chile, alternativas energeticas.

    Energy Technology Data Exchange (ETDEWEB)

    Serrano, R. P.

    2004-07-01

    Firewood in Latin America is, after petroleum, the second primary source of energy. In Chile, the statistics have shown that the total use of energy produce by firewood fluctuates between 16 and 21% from which the residential sector represents 54%. There are great social and environmental impacts produced by the use of firewood. For the near future, it will be difficult to eradicate the firewood consumption in Latin America. In looking for sustainable use of firewood to produce energy, NGOs have developed efficient systems for production, management and consume of it. For this research we will focus on the efficient use of biomass and solar energy use for cooking, both to be applied in suitable places. The paper shows Chilean experiences on both, biomass and solar energy production, and how these programs have impacted the national statistics in energy consumption. (Author)

  5. Present knowledge on the fossil mammals record from Chile; Estado actual del conocimiento de los mamiferos fosiles de Chile

    Energy Technology Data Exchange (ETDEWEB)

    Canto, J.; Yanez, J.; Rovira, J.

    2010-07-01

    An updated revision is presented regarding fossil mammals of aquatic and terrestrial environments. This update includes up to year 2008. Those registrations of doubtful assignation or that couldn't be confirmed were not considered in this review. These new registrations are classified in four groups of time that extend from the Late Eocene-Early Oligocene to the Pleistocene-Recent. The evidence shows that the greatest quantity of fossils are concentrated from the Early Miocene to the Middle Miocene reaching 37 (41.5%) genus of a total of 77 and 54 (49.5%) fossil species of a total of 89. It is observed a significant increase in works devoted to paleontology of mammal fossils in Chile between 1981-2008. (Author)

  6. LBB在AP1000技术中的应用%The Application of LBB in AP1000 Technology

    Institute of Scientific and Technical Information of China (English)

    蒋冬梅; 杜颖; 袁小兰

    2015-01-01

    压水堆核电厂的设计基准事故定义为主管道双端断裂,这一假设过于保守.管道的失效方式往往是先出现破口而后再泄漏,即所谓的先漏后破( Leak Before Break,简称LBB) ,而不是双端断裂. LBB准则是防止核电厂压力管道发生灾难性破裂事故的重要评定准则.本文介绍了LBB评定技术在国外的发展情况和意义,阐述了LBB在AP1000核电厂中的应用情况及LBB评价的理论基础.%Design basis accident of pressurized water reactor nuclear power plant was de-fined as main pipeline double-end fracture, this assumption is too conservative. Pipeline failure modes often appear as first Break then Leak,that is so-called the Leak Before Break ( Leak Before Break,LBB) ,rather than double end fracture. LBB is an important evalua-tion criteria of preventing pressure piping catastrophic rupture accident of nuclear power plant . This paper briefly introduces the development situation and the significance of the o-verseas LBB assessment technology and expounds the application of LBB in AP1000 nucle-ar power plant and the theoretical basis of LBB assessment.

  7. The Bulimulidae (Mollusca: Pulmonata) from the Región de Atacama, northern Chile

    Science.gov (United States)

    2015-01-01

    The bulimulid genus Bostryx Troschel, 1847 is the most species-rich genus of land snails found in Chile, with the majority of its species found only in the northern part of the country, usually in arid coastal zones. This genus has been sparsely studied in Chile and there is little information on their distribution, diversity or ecology. Here, for the first time, a formal analysis of the diversity of bulimulids in the Región de Atacama, northern Chile, is reported. Of the seventeen species recorded for the area, most of them were efectively found in the field collections and one record was based on literature. Five taxa are described as new: Bostryx ancavilorum sp. nov., Bostryx breurei sp. nov., Bostryx calderaensis sp. nov., Bostryx ireneae sp. nov. and Bostryx valdovinosi sp. nov., and the known geographic distribution of seven species is extended. Results reveal that the Región de Atacama is the richest region in terrestrial snails in Chile, after the Juan Fernández Archipelago. All of the terrestrial molluscan species occurring in the area are endemic to Chile, most of them with restricted geographic distributions along the coastal zones, and none of them are currently protected by law. Further sampling in northern Chile will probably reveal more snail species to be discovered and described. PMID:26587346

  8. CHILES Con Pol: An ultra-deep JVLA survey probing galaxy evolution and cosmic magnetism

    Science.gov (United States)

    Hales, Christopher A.; Momjian, Emmanuel; van Gorkom, Jacqueline; Rupen, Michael P.; Greiner, Maksim; Ensslin, Torsten A.; Bonzini, Margherita; Padovani, Paolo; Harrison, Ian; Brown, Michael L.; Gim, Hansung; Yun, Min S.; Maddox, Natasha; Stewart, Adam; Fender, Rob P.; Tremou, Evangelia; Chomiuk, Laura; Peters, Charee; Wilcots, Eric M.; Lazio, Joseph

    2015-08-01

    We are undertaking a 1000 hour campaign with the Karl G. Jansky VLA to survey 0.2 square degrees of the COSMOS field in full polarization continuum at 1.4 GHz. Our observations are part of a joint program with the spectral line COSMOS HI Large Extragalactic Survey (CHILES). When complete, we expect our CHILES Continuum Polarization (CHILES Con Pol) survey to reach an SKA-era sensitivity of 500 nJy per 4 arcsecond resolving beam, the deepest view of the radio sky yet. CHILES Con Pol will open new and fertile parameter space, with sensitivity to star formation rates of 10 Msun per year out to an unprecedented redshift of z=2, and ultra-luminous infrared galaxies and sub-millimeter galaxies out to redshifts of z=8 and beyond. This rich resource will extend the utility of radio band studies beyond the usual radio quasar and radio galaxy populations, opening sensitivity to the starforming and radio-quiet AGN populations that form the bulk of extragalactic sources detected in the optical, X-ray, and infrared bands. In this talk I will outline the key science of CHILES Con Pol, including galaxy evolution and novel measurements of intergalactic magnetic fields. I will present initial results from the first 180 hours of the survey and describe our forthcoming Data Release 1. I invite the astronomical community to consider unique science that can be pursued with CHILES Con Pol radio data.

  9. Un Plan Regulador para Cartagena, una ciudad de la costa central de Chile: una visión de futuro en 1976. / A master plan for Cartagena, a city on the central coast of Chile: a vision in 1976

    Directory of Open Access Journals (Sweden)

    Pavez Reyes,María Isabel

    2009-12-01

    Full Text Available Se presenta la reseña de un proyecto de planificación urbana, conforme a la escuela desarrollada por la FAU de la Universidad de Chile, durante la etapa madura del Estado Planificador Urbano-Regional chileno. / It provides an overview of an urban planning project, developed under the FAU School of the University of Chile, during the mature stage of the Urban-Regional Planning State of Chile.

  10. K-AP: Generating specified K clusters by efficient Affinity Propagation

    KAUST Repository

    Zhang, Xiangliang

    2010-12-01

    The Affinity Propagation (AP) clustering algorithm proposed by Frey and Dueck (2007) provides an understandable, nearly optimal summary of a data set. However, it suffers two major shortcomings: i) the number of clusters is vague with the user-defined parameter called self-confidence, and ii) the quadratic computational complexity. When aiming at a given number of clusters due to prior knowledge, AP has to be launched many times until an appropriate setting of self-confidence is found. The re-launched AP increases the computational cost by one order of magnitude. In this paper, we propose an algorithm, called K-AP, to exploit the immediate results of K clusters by introducing a constraint in the process of message passing. Through theoretical analysis and experimental validation, K-AP was shown to be able to directly generate K clusters as user defined, with a negligible increase of computational cost compared to AP. In the meanwhile, K-AP preserves the clustering quality as AP in terms of the distortion. K-AP is more effective than k-medoids w.r.t. the distortion minimization and higher clustering purity. © 2010 IEEE.

  11. A Weighted K-AP Query Method for RSSI based Indoor Positioning

    DEFF Research Database (Denmark)

    Huo, Huan; Liu, Xiufeng; Li, Jifeng

    2016-01-01

    The paper studies the establishment of offline fingerprint library based on RSSI (Received Signal Strength Indication), and proposes WF-SKL algorithm by introducing the correlation between RSSIs. The correlations can be transformed as AP fingerprint sequence to build the offline fingerprint library....... To eliminate the positioning error caused by instable RSSI value, WF-SKL can filter the noise AP via online AP selection, meanwhile it also reduces the computation load. WF-SKL utilizes LCS algorithm to find out the measurement between the nearest neighbors, and it proposes K-AP (P,Q) nearest neighbor queries...

  12. Isolation, classification and transcription profiles of the AP2/ERF transcription factor superfamily in citrus.

    Science.gov (United States)

    Xie, Xiu-lan; Shen, Shu-ling; Yin, Xue-ren; Xu, Qian; Sun, Chong-de; Grierson, Donald; Ferguson, Ian; Chen, Kun-song

    2014-07-01

    The AP2/ERF gene family encodes plant-specific transcription factors. In model plants, AP2/ERF genes have been shown to be expressed in response to developmental and environmental stimuli, and many function downstream of the ethylene, biotic, and abiotic stress signaling pathways. In citrus, ethylene is effective in regulation citrus fruit quality, such as degreening and aroma. However, information about the citrus AP2/ERF family is limited, and would enhance our understanding of fruit responses to environmental stress, fruit development and quality. CitAP2/ERF genes were isolated using the citrus genome database, and their expression patterns analyzed by real-time PCR using various orange organs and samples from a fruit developmental series. 126 sequences with homologies to AP2/ERF proteins were identified from the citrus genome, and, on the basis of their structure and sequence, assigned to the ERF family (102), AP2 family (18), RAV family (4) and Soloist (2). MEME motif analysis predicted the defining AP2/ERF domain and EAR repressor domains. Analysis of transcript accumulation in Citrus sinensis cv. 'Newhall' indicated that CitAP2/ERF genes show organ-specific and temporal expression, and provided a framework for understanding the transcriptional regulatory roles of AP2/ERF gene family members in citrus. Hierarchical cluster analysis and t tests identified regulators that potentially function during orange fruit growth and development.

  13. Heterologous expression in Tritrichomonas foetus of functional Trichomonas vaginalis AP65 adhesin

    Directory of Open Access Journals (Sweden)

    Alderete JF

    2005-03-01

    Full Text Available Abstract Background Trichomonosis, caused by Trichomonas vaginalis, is the number one, nonviral sexually transmitted infection that has adverse consequences for the health of women and children. The interaction of T. vaginalis with vaginal epithelial cells (VECs, a step preparatory to infection, is mediated in part by the prominent surface protein AP65. The bovine trichomonad, Tritrichomonas foetus, adheres poorly to human VECs. Thus, we established a transfection system for heterologous expression of the T. vaginalis AP65 in T. foetus, as an alternative approach to confirm adhesin function for this virulence factor. Results In this study, we show stable transfection and expression of the T. vaginalis ap65 gene in T. foetus from an episomal pBS-ap65-neo plasmid. Expression of the gene and protein was confirmed by RT-PCR and immunoblots, respectively. AP65 in transformed T. foetus bound to host cells. Specific mAbs revealed episomally-expressed AP65 targeted to the parasite surface and hydrogenosome organelles. Importantly, surface-expression of AP65 in T. foetus paralleled increased levels of adherence of transfected bovine trichomonads to human VECs. Conclusion The T. vaginalis AP65 adhesin was stably expressed in T. foetus, and the data obtained using this heterologous system strongly supports the role of AP65 as a prominent adhesin for T. vaginalis. In addition, the heterologous expression in T. foetus of a T. vaginalis gene offers an important, new approach for confirming and characterizing virulence factors.

  14. Differential role of SH2-B and APS in regulating energy and glucose homeostasis.

    Science.gov (United States)

    Li, Minghua; Ren, Decheng; Iseki, Masanori; Takaki, Satoshi; Rui, Liangyou

    2006-05-01

    SH2-B and APS, two members of a pleckstrin homology and SH2 domain-containing adaptor family, promote both insulin and leptin signaling in a similar fashion in cultured cells. In addition, APS mediates insulin-stimulated activation of the c-Cbl/CAP/TC10 pathway in cultured adipocytes. Here we characterized genetically modified mice lacking SH2-B, APS, or both to determine the physiological roles of these two proteins in animals. Disruption of the SH2-B gene resulted in obesity, hyperglycemia, hyperinsulinemia, and glucose intolerance. Conversely, deletion of the APS gene did not alter adiposity, energy balance, and glucose metabolism. Energy intake, energy expenditure, fat content, body weight, and plasma insulin, leptin, glucose, and lipid levels were similar between APS(-/-) and WT littermates fed either normal chow or a high-fat diet. Moreover, deletion of APS failed to alter insulin and glucose tolerance. APS(-/-)/SH2-B(-/-) double knockout mice also developed energy imbalance, obesity, hyperleptinemia, hyperinsulinemia, hyperglycemia, and glucose intolerance; however, plasma leptin and insulin levels were significantly lower in APS(-/-)/SH2-B(-/-) than in SH2-B(-/-) mice. These results suggest that SH2-B, but not APS, is a key positive regulator of energy and glucose metabolism in mice.

  15. APS-U Definitions of Signs and Conventions Related to Magnets

    Energy Technology Data Exchange (ETDEWEB)

    Doose, Charles [Argonne National Lab. (ANL), Argonne, IL (United States). Accelerator Systems Division; Jain, Animesh [Brookhaven National Lab. (BNL), Upton, NY (United States). Superconducting Magnet Division

    2014-08-21

    The APS-U is planned to be a 4th generation hard X-ray light source utilizing a multi-bend achromat (MBA) magnet lattice. The MBA lattice will be installed in the existing APS storage ring enclosure. The stored electron beam will circulate clockwise when viewed from above. The X-ray beamlines will for the most part exit at the same source points as the present APS. This document defines the signs and conventions related to the APS-U MBA magnets. Included in this document are: the local magnet coordinate system, definitions of mechanical and magnetic centers, definitions of multipole field errors, magnetic roll angle, and magnet polarities.

  16. Qué se investiga en relación a enfermedad pulmonar obstructiva crónica en Chile CHRONIC OBSTRUCTIVE PULMONARY DISEASE RESEARCH IN CHILE

    OpenAIRE

    MANUEL OYARZÚN G.

    2002-01-01

    Con el propósito de conocer qué se investiga sobre enfermedad pulmonar obstructiva (EPOC) en Chile, se realizó una búsqueda bibliográfica acerca de las publicaciones en revistas biomédicas de investigaciones sobre EPOC realizadas en Chile. Se revisó los índices MEDLINE y LILACS entre 1982 y 2001. Además, se revisó los resúmenes que comunican investigaciones sobre EPOC presentados a los 5 últimos Congresos Anuales Chilenos sobre Enfermedades Respiratorias. Los temas más frecuentes de las publi...

  17. Preface: 18th Aps-Sccm and 24th Airapt

    Science.gov (United States)

    Collins, Gilbert; Moore, David S.; Yoo, Choong-Shik; Buttler, William; Furlanetto, Michael; Evans, William

    2014-05-01

    The 18th Biennial International Conference of the APS Topical Group on Shock Compression of Condensed Matter in conjunction with the 24th Biennial International Conference of the International Association for the Advancement of High Pressure Science & Technology (AIRAPT) was held at the Westin Hotel in Seattle, Washington from 7-12 July, 2013. This is only the second time that these two organizations have held a Joint Conference — the first was 20 years previous (1993) in Colorado Springs, Colorado. Seattle was chosen for this joint conference because of its central location for the world-wide attendees as well as its metropolitan vibrancy. The scientific program consisted of 858 scheduled presentations organized into 23 topical areas and included contributed (537), invited (95), and plenary (6) lectures, as well as two poster sessions with 110 posters each. The scientific focus of the Joint Conference was on fundamental and applied research topics related to the static or dynamic compression of condensed matter. This multidisciplinary field of research encompasses areas of physics, chemistry, materials science, mechanics, geophysics and planetary physics, and applied mathematics. Experimental, computational and theoretical studies all play important roles. The organizers endeavored to intertwine static and dynamic experimental alongside computational and theoretical studies of similar materials in the organization of the sessions. This goal was aided by the addition of three special focus sessions on deep carbon budget, high energy density materials, and dynamic response of materials. 722 scientists and engineers from 25 countries registered at the conference, including 132 students from 12 countries. The attendee countries represented included: Argentina (2), Australia (2), Brazil (3), Canada (25), China (22), Czech Republic (2), France (35), Germany (19), India (6), Israel (21), Italy (10), Japan (49), Netherlands (1), Poland (1), Portugal (2), Russia (26

  18. Analysis of human reliability in the APS of fire. Application of NUREG-1921; Analisis de Fiabilidad Humana en el APS de Incendios. Aplicacion del NUREG-1921

    Energy Technology Data Exchange (ETDEWEB)

    Perez Torres, J. L.; Celaya Meler, M. A.

    2014-07-01

    An analysis of human reliability in a probabilistic safety analysis (APS) of fire aims to identify, describe, analyze and quantify, in a manner traceable, human actions that can affect the mitigation of an initiating event produced by a fire. (Author)

  19. Radioactive air emissions notice of construction for installation and operation of a waste retrieval system and tanks 241-AP-102 and 241-AP-104 project

    Energy Technology Data Exchange (ETDEWEB)

    DEXTER, M.L.

    1999-11-15

    This document serves as a notice of construction (NOC) pursuant to the requirements of Washington Administrative Code (WAC) 246 247-060, and as a request for approval to modify pursuant to 40 Code of Federal Regulations (CFR) 61 07 for the installation and operation of one waste retrieval system in the 24 1 AP-102 Tank and one waste retrieval system in the 241 AP 104 Tank Pursuant to 40 CFR 61 09 (a)( 1) this application is also intended to provide anticipated initial start up notification Its is requested that EPA approval of this application will also constitute EPA acceptance of the initial start up notification Project W 211 Initial Tank Retrieval Systems (ITRS) is scoped to install a waste retrieval system in the following double-shell tanks 241-AP 102-AP 104 AN 102, AN 103, AN-104, AN 105, AY 102 AZ 102 and SY-102 between now and the year 2011. Because of the extended installation schedules and unknowns about specific activities/designs at each tank, it was decided to submit NOCs as that information became available This NOC covers the installation and operation of a waste retrieval system in tanks 241 AP-102 and 241 AP 104 Generally this includes removal of existing equipment installation of new equipment and construction of new ancillary equipment and buildings Tanks 241 AP 102 and 241 AP 104 will provide waste feed for immobilization into a low activity waste (LAW) product (i.e. glass logs) The total effective dose equivalent (TEDE) to the offsite maximally exposed individual (MEI) from the construction activities is 0 045 millirem per year The unabated TEDE to the offsite ME1 from operation of the mixer pumps is 0 042 millirem per year.

  20. TinyCoAP: A Novel Constrained Application Protocol (CoAP Implementation for Embedding RESTful Web Services in Wireless Sensor Networks Based on TinyOS

    Directory of Open Access Journals (Sweden)

    Anna Calveras

    2013-05-01

    Full Text Available In this paper we present the design and implementation of the Constrained Application Protocol (CoAP for TinyOS, which we refer to as TinyCoAP. CoAP seeks to apply the same application transfer paradigm and basic features of HTTP to constrained networks, while maintaining a simple design and low overhead. The design constraints of Wireless Sensor Networks (WSNs require special attention in the design process of the CoAP implementation. We argue that better performance and minimal resource consumption can be achieved developing a native library for the operating system embedded in the network. TinyOS already includes in its distribution an implementation of CoAP called CoapBlip. However, this is based on a library not originally designed to meet the requirements of TinyOS. We demonstrate the effectiveness of our approach by a comprehensive performance evaluation. In particular, we test and evaluate TinyCoAP and CoapBlip in a real scenario, as well as solutions based on HTTP. The evaluation is performed in terms of latency, memory occupation, and energy consumption. Furthermore, we evaluate the reliability of each solution by measuring the goodput obtained in a channel affected by Rayleigh fading. We also include a study on the effects that high workloads have on a server.

  1. AP-2δ is a crucial transcriptional regulator of the posterior midbrain.

    Directory of Open Access Journals (Sweden)

    Katrin Hesse

    Full Text Available Ap-2 transcription factors comprise a family of 5 closely related sequence-specific DNA binding proteins that play pivotal and non-redundant roles in embryonic organogenesis. To investigate the function of Ap-2δ, wδe analyzed its expression during embryogenesis and generated Ap-2δ-deficient mice. In line with the specific expression pattern of Ap-2δ in the mesencephalic tectum and the dorsal midbrain, Ap-2δ-deficient mice failed to maintain the colliculus inferior, a derivative of the dorsal midbrain, as a consequence of increased apoptotic cell death. To identify specific Ap-2δ target genes in cells of the developing dorsal midbrain, we performed whole genome analysis of cDNA expression levels. This approach identified a set of 12 putative target genes being expressed in the developing midbrain, including the transcription factors Pitx2, Mef2c, Bhlhb4 and Pou4f3. Using chromatin immunoprecipitation (CHIP we showed that some of these genes are direct targets of Ap-2δ. Consistently, we demonstrate that Ap-2δ occupies and activates the Pou4f3 and Bhlhb4 promoters. In addition, known Pou4f3 target genes were downregulated in the posterior midbrain of Ap-2δ-deficient mice. Despite the absence of a central part of the auditory pathway, the presence of neuronal responses to sounds in the neocortex of Ap-2δ-deficient mice indicates that auditory information from the brainstem still reaches the neocortex. In summary, our data define Ap-2δ as an important transcription factor, specifying gene expression patterns required for the development of the posterior midbrain.

  2. Scribble1/AP2 Complex Coordinates NMDA Receptor Endocytic Recycling

    Directory of Open Access Journals (Sweden)

    Nicolas H. Piguel

    2014-10-01

    Full Text Available The appropriate trafficking of glutamate receptors to synapses is crucial for basic synaptic function and synaptic plasticity. It is now accepted that NMDA receptors (NMDARs internalize and are recycled at the plasma membrane but also exchange between synaptic and extrasynaptic pools; these NMDAR properties are also key to governing synaptic plasticity. Scribble1 is a large PDZ protein required for synaptogenesis and synaptic plasticity. Herein, we show that the level of Scribble1 is regulated in an activity-dependent manner and that Scribble1 controls the number of NMDARs at the plasma membrane. Notably, Scribble1 prevents GluN2A subunits from undergoing lysosomal trafficking and degradation by increasing their recycling to the plasma membrane following NMDAR activation. Finally, we show that a specific YxxR motif on Scribble1 controls these mechanisms through a direct interaction with AP2. Altogether, our findings define a molecular mechanism to control the levels of synaptic NMDARs via Scribble1 complex signaling.

  3. Initial commissioning results from the APS loss monitor system

    Science.gov (United States)

    Patterson, Donald R.

    1997-01-01

    The design of the beam loss monitor system for the Argonne National Laboratory Advanced Photon Source is based on using a number of air dielectric coaxial cables as long ionization chambers. Results to date show that the loss monitor is useful in helping to determine the cause of injection losses and losses large enough to limit circulating currents in the storage ring to short lifetimes. Sensitivities ranging from 13 to 240 pC of charge collected in the injector BTS (booster-to-storage-ring) loss monitor per picocoulomb of loss have been measured, depending on the loss location. These results have been used to predict that the storage ring loss monitor leakage current limit of 10 pA per cable should allow detection of losses resulting in beam lifetimes of 100 hours or less with 100 mA stored beam. Significant DC bias levels associated with the presence of stored beam have been observed. These large bias levels are most likely caused by the loss monitor responding to hard x-ray synchrotron radiation. No such response to synchrotron radiation was observed during earlier tests at SSRL. However, the loss monitor response to average stored beam current in APS has provided a reasonable alternative to the DC current transformer (DCCT) for measuring beam lifetimes.

  4. New Beam Position Monitor System Design for the APS Injector

    Science.gov (United States)

    Lill, R.; Singh, O.; Arnold, N.

    2002-12-01

    Demands on the APS injector have evolved over the last few years to the point that an upgrade to the existing beam position monitor (BPM) electronics is required. The injector is presently being used as a source for both the low-energy undulator test line (LEUTL) project and the top-up mode of operation. These new requirements and the fact that many new rf receiver components are available at reasonable cost make this upgrade very desirable at this time. The receiver topology selected is a logarithmic processor, which is designed around the Analog Devices AD8313 log amplifier demodulation chip. This receiver will become the universal replacement for all injector applications measuring positions signals from 352 to 2856 MHz with minimum changes in hardware and without the use of a downconverter. The receiver design features integrated front-end gain and built-in self test. The data acquisition being considered at this time is a 100-MHz, 12-bit transient recorder digitizer. The latest experimental and commissioning data and results will be presented.

  5. Factors Affecting Growth of Pinus radiata in Chile

    Science.gov (United States)

    Alvarez-Munoz, Jose Santos

    The Chilean forestry industry is based on hundreds of thousands of hectares of Pinus radiata plantations that have been established in a variety of soil and climate conditions. This approach has resulted in highly variable plantation productivity even when the best available technology was used. Little information is known about the ecophysiology basis for this variability. We explored the spatial and temporal variation of stand growth in Chile using a network of permanent sample plots from Modelo Nacional de Simulacion de Pino radiata. We hypothesized that the climate would play an important role in the annual variations in productivity. To answer these questions we developed the following projects: (1) Determination of site resource availability from historical data from automatic weather stations (rainfall, temperatures) and a geophysical model for solar irradiation, (2) Determination of peak annual leaf area index (LAI) for selected permanent sample plots using remote sensing technologies, (3) Analysis of soil, climate, canopy and stand factors affecting the Pinus radiata plantation growth and the use efficiency of site resources. For project 1, we estimated solar irradiation using the r.sun , Hargreaves-Samani (HS), and Bristow-Campbell (BC) models and validated model estimates with observations from weather stations. Estimations from a calibrated r.sun model accounted for 94% of the variance (r2=0.94) in monthly mean measured values. The r.sun model performed quite well for a wide range of Chilean conditions when compared with the HS and BC models. Our estimates of global irradiation may be improved with better estimates of cloudiness as they become available. Our model was able to provide spatial estimates of daily, weekly, monthly and yearly solar irradiation. For project 2, we estimated the inter-annual variation of LAI (Leaf Area Index), using remote sensing technologies. We determined LAI using Landsat Thematic Mapper (TM) data covering a 5 year period

  6. Hacia un planteamiento de arquitectura docente, en Chile

    Directory of Open Access Journals (Sweden)

    Mac Clure Alamos, Oscar

    1986-12-01

    Full Text Available On this pages the author expound the different architectural Solutions adopted for school projects from his professional experience: 22 years (1959-1981 in the Construction Society of Educational Establishments in Santiago de Chile, as well as the execution -four years at the Santiago University (late State Technical University- of the modified project for the Planetarium which had been projected by the Construction Society. He also expound briefly a number of constructions of educational character carried out through the practicing of his profession. Taking as a base these experiences, he offers some suggestions and conclusions that will be useful for future programmes intended to solve the problems of the school buildings. From a critical and objective position he tries to show the actual situation on the educational architecture in this country.En estas páginas se pretende dar a conocer diferentes soluciones arquitectónicas adoptadas en los proyectos escolares, a través de mi experiencia profesional, durante 22 años (1959 - 1981 en la Sociedad Constructora de Establecimientos Educacionales en Santiago de Chile. También la ejecución, durante 4 años (1981 - 1985, en la Universidad de Santiago (ex Universidad Técnica del Estado del proyecto modificado y la construcción del edificio para el Planetario, que había realizado en la Sociedad Constructora. En forma breve expondré, además, algunas obras de carácter educacional, realizadas en el ejercicio privado de mi profesión. En base a estas experiencias procuraré entregar algunas sugerencias y conclusiones que podrían ser útiles en futuros programas destinados a resolver los problemas de las construcciones docentes. Desde una posición crítica y objetiva intentaré también dar a conocer la situación actual de la arquitectura educacional en el país.

  7. Waiting list in a public health facility in Santiago, Chile

    Directory of Open Access Journals (Sweden)

    Alejandro Letelier

    2014-07-01

    Full Text Available Introduction Waiting lists are a well-known problem in public healthcare systems worldwide. For instance, England had over one million people in waiting lists for elective surgical procedures in 2000. Spain had over 360 000 patients in surgical waiting lists in 2007. Chile has been trying to manage waiting times through the GES (Explicit Guarantees in Healthcare plan, which was established by the Chilean government in 2005. Waiting lists for the guaranteed-care diseases in the GES plan had 380 000 patients at the beginning of 2010, and that number was reduced to zero in 2011. Internationally, there are some descriptive studies about waiting lists that focus on variables such as waiting times and number of patients in the list. In Chile, however, this type of study is lacking. Purpose This study aims to describe the characteristics of waiting lists for medical specialties between April and October 2011. It also aims to identify the components of management models in public healthcare centers, and to identify and analyze waiting-time frames of patients referred to a secondary or tertiary healthcare public center from a public primary healthcare center. Methods A descriptive cross-sectional study of the waiting list for first-time consultations for medical specialties was carried out. Referred patients were described and grouped using indicators of access to healthcare and waiting time between April and October 2011. Each consultation request or referral of a new patient was included in the waiting list and analyzed. Results There were 15 935 requests for consultations; 5 717 requests were resolved, and 8 544 were not (54% of the total requests for consultation. There was a mean waiting time of 498 days for non-resolved requests for consultation, and a mean of 141 days for resolved requests. The specialties in highest demand were orthopedic surgery and ophthalmology. The main waiting-list management processes were referral and reception of requests

  8. Reiterative AP2a activity controls sequential steps in the neural crest gene regulatory network.

    Science.gov (United States)

    de Crozé, Noémie; Maczkowiak, Frédérique; Monsoro-Burq, Anne H

    2011-01-04

    The neural crest (NC) emerges from combinatorial inductive events occurring within its progenitor domain, the neural border (NB). Several transcription factors act early at the NB, but the initiating molecular events remain elusive. Recent data from basal vertebrates suggest that ap2 might have been critical for NC emergence; however, the role of AP2 factors at the NB remains unclear. We show here that AP2a initiates NB patterning and is sufficient to elicit a NB-like pattern in neuralized ectoderm. In contrast, the other early regulators do not participate in ap2a initiation at the NB, but cooperate to further establish a robust NB pattern. The NC regulatory network uses a multistep cascade of secreted inducers and transcription factors, first at the NB and then within the NC progenitors. Here we report that AP2a acts at two distinct steps of this cascade. As the earliest known NB specifier, AP2a mediates Wnt signals to initiate the NB and activate pax3; as a NC specifier, AP2a regulates further NC development independent of and downstream of NB patterning. Our findings reconcile conflicting observations from various vertebrate organisms. AP2a provides a paradigm for the reiterated use of multifunctional molecules, thereby facilitating emergence of the NC in vertebrates.

  9. The History of the APS Shock Compression of Condensed Matter Topical Group

    Energy Technology Data Exchange (ETDEWEB)

    Forbes, J W

    2001-05-02

    In order to provide broader scientific recognition and to advance the science of shock compressed condensed matter, a group of American Physical Society (APS) members worked within the Society to make this field an active part of the APS. Individual papers were presented at APS meetings starting in the 1940's and shock wave sessions were organized starting with the 1967 Pasadena meeting. Shock wave topical conferences began in 1979 in Pullman, WA. Signatures were obtained on a petition in 1984 from a balanced cross-section of the shock wave community to form an APS Topical Group (TG). The APS Council officially accepted the formation of the Shock Compression of Condensed Matter (SCCM) TG at its October 1984 meeting. This action firmly aligned the shock wave field with a major physical science organization. Most early topical conferences were sanctioned by the APS while those held after 1992 were official APS meetings. The topical group organizes a shock wave topical conference in odd numbered years while participating in shock wave/high pressure sessions at APS general meetings in even numbered years.

  10. History of the APS Topical Group on Shock Compression of Condensed Matter

    Energy Technology Data Exchange (ETDEWEB)

    Forbes, J W

    2001-10-19

    In order to provide broader scientific recognition and to advance the science of shock compressed condensed matter, a group of American Physical Society (APS) members worked within the Society to make this field an active part of the APS. Individual papers were presented at APS meetings starting in the 1940's and shock wave sessions were organized starting with the 1967 Pasadena meeting. Shock wave topical conferences began in 1979 in Pullman, WA. Signatures were obtained on a petition in 1984 from a balanced cross-section of the shock wave community to form an APS Topical Group (TG). The APS Council officially accepted the formation of the Shock Compression of Condensed Matter (SCCM) TG at its October 1984 meeting. This action firmly aligned the shock wave field with a major physical science organization. Most early topical conferences were sanctioned by the APS while those held after 1992 were official APS meetings. The topical group organizes a shock wave topical conference in odd numbered years while participating in shock wavehigh pressure sessions at APS general meetings in even numbered years.

  11. The interaction between the adaptor protein APS and Enigma is involved in actin organisation

    DEFF Research Database (Denmark)

    Barres, Romain; Gonzalez, Teresa; Le Marchand-Brustel, Yannick

    2005-01-01

    APS (adaptor protein with PH and SH2 domains) is an adaptor protein phosphorylated by several tyrosine kinase receptors including the insulin receptor. To identify novel binding partners of APS, we performed yeast two-hybrid screening. We identified Enigma, a PDZ and LIM domain-containing protein...... that was previously shown to be associated with the actin cytoskeleton. In HEK 293 cells, Enigma interacted specifically with APS, but not with the APS-related protein SH2-B. This interaction required the NPTY motif of APS and the LIM domains of Enigma. In NIH-3T3 cells that express the insulin receptor, Enigma...... and APS were partially co-localised with F-actin in small ruffling structures. Insulin increased the complex formation between APS and Enigma and their co-localisation in large F-actin containing ruffles. While in NIH-3T3 and HeLa cells the co-expression of both Enigma and APS did not modify the actin...

  12. 75 FR 20774 - Establishment of Class E Airspace; Fort A.P. Hill, VA

    Science.gov (United States)

    2010-04-21

    ... Federal Aviation Administration 14 CFR Part 71 Establishment of Class E Airspace; Fort A.P. Hill, VA... Register December 7, 2009 that establishes Class E airspace at Fort A.P. Hill, VA. DATES: Effective Date..., Eastern Service Center, Federal Aviation Administration, P.O. Box 20636, Atlanta, Georgia 30320;...

  13. Coming Soon: CADRE (Career Advancement and Development Resources and Education) website for all APS members

    Science.gov (United States)

    The Council of the American Phytopathological Society (APS) approved an initiative in February 2013 to create a web resource called CADRE (Career Advancement and Development Resources and Education). CADRE is to provide APS members an archive of articles, videos, and webinars about a variety of prof...

  14. Amphioxus and lamprey AP-2 genes: implications for neural crest evolution and migration patterns

    Science.gov (United States)

    Meulemans, Daniel; Bronner-Fraser, Marianne

    2002-01-01

    The neural crest is a uniquely vertebrate cell type present in the most basal vertebrates, but not in cephalochordates. We have studied differences in regulation of the neural crest marker AP-2 across two evolutionary transitions: invertebrate to vertebrate, and agnathan to gnathostome. Isolation and comparison of amphioxus, lamprey and axolotl AP-2 reveals its extensive expansion in the vertebrate dorsal neural tube and pharyngeal arches, implying co-option of AP-2 genes by neural crest cells early in vertebrate evolution. Expression in non-neural ectoderm is a conserved feature in amphioxus and vertebrates, suggesting an ancient role for AP-2 genes in this tissue. There is also common expression in subsets of ventrolateral neurons in the anterior neural tube, consistent with a primitive role in brain development. Comparison of AP-2 expression in axolotl and lamprey suggests an elaboration of cranial neural crest patterning in gnathostomes. However, migration of AP-2-expressing neural crest cells medial to the pharyngeal arch mesoderm appears to be a primitive feature retained in all vertebrates. Because AP-2 has essential roles in cranial neural crest differentiation and proliferation, the co-option of AP-2 by neural crest cells in the vertebrate lineage was a potentially crucial event in vertebrate evolution.

  15. Foundations for College and Beyond: Looking Back on AP Art History

    Science.gov (United States)

    Schoenbohm, Laurel

    2013-01-01

    It was years after this author's AP Art History course in high school, and two years after college. She and some friends decided to fill a day during the Thanksgiving visits appreciating fine art. Prior to that AP course her senior year of high school, touring an art museum had seemed like the equivalent of going to the dentist. But after…

  16. Understanding and Using the New Guided-Inquiry AP Chemistry Laboratory Manual

    Science.gov (United States)

    Cacciatore, Kristen L.

    2014-01-01

    To support teaching and learning in the advanced placement (AP) chemistry laboratory, the College Board published a laboratory manual, "AP Chemistry Guided-Inquiry Experiments: Applying the Science Practices," in 2013 as part of the redesigned course. This article provides a discussion of the rationale for the existence of the manual as…

  17. NACS: non-overlapping AP's caching scheme to reduce handoff in 802.11 wireless LAN

    CERN Document Server

    Tariq, Usman; Hong, Man-Pyo

    2011-01-01

    With the escalation of the IEEE 802.11 based wireless networks, voice over IP and analogous applications are also used over wireless networks. Recently, the wireless LAN systems are spaciously deployed for public Internet services. In public wireless LAN systems, reliable user authentication and mobility support are indispensable issues. When a mobile device budges out the range of one access point (AP) and endeavor to connect to new AP, it performs handoff. Contemporarily, PNC and SNC were proposed to propagate the MN context to the entire neighboring AP's on the wireless network with the help of neighbor graph. In this paper, we proposed a non-overlapping AP's caching scheme (NACS), which propagates the mobile node context to those AP's which do not overlap with the current AP. To capture the topology of non-overlapping AP's in the wireless network, non-overlapping graph (NOG) is generated at each AP. Simulation results shows that NACS reduces the signaling cost of propagating the MN context to the neighbor...

  18. Citizenship ‘from Above’? The Case of Chile, 1964-2010

    Directory of Open Access Journals (Sweden)

    Gerard van der Ree

    2011-04-01

    Full Text Available During the last fifty years, citizenship in Chile has been re-interpreted and reformulated in different ways. By combining top-down and bottom-up approaches towards citizenship, this article argues that the reformulation of citizenship in Chile has been brought about through both state-initiated projects and civil society responses, which have interacted over time. State projects have been based on ideological doctrines in order to resolve problems emanating from ‘below’, while civil society responses have come from the ways in which the state have sought to implement its projects. Even though this historical process has produced both periods of rapid expansion and radical restriction of citizenship, in the end it produced a stable but asymmetric model of citizenship in Chile.Resumen: ¿Ciudadanía ‘desde arriba’? El caso de Chile, 1964-2010Durante los últimos cincuenta años, la ciudadanía en Chile ha sido re-interpretada y reformulada de diferentes modos. Combinando las aproximaciones descendentes y ascendentes, en este artículo se defiende que la reformulación de la ciudadanía en Chile fue provocada tanto por proyectos iniciados por el estado como por respuestas de la sociedad civil, que, con el tiempo, han llegado a interactuar. Los proyectos estatales se han basado en doctrinas ideológicas para resolver problemas que emanaban desde ‘abajo’, mientras que las respuestas de la sociedad civil han sido provocadas por las maneras en que el estado ha intentado implementar sus proyectos. Aunque el proceso histórico ha producido tanto periodos de rápida extensión como de radicales restricciones de la ciudadanía, al final resultó en Chile un modelo estable, aunque asimétrico.

  19. Carbon dioxide, hydrographic, and chemical data obtained in the South Pacific Ocean (WOCE Sections P16A/P17A, P17E/P19S, and P19C, R/V Knorr, October 1992--April 1993)

    Energy Technology Data Exchange (ETDEWEB)

    Rubin, S.; Goddard, J.G.; Chipman, D.W.; Takahashi, Taro; Sutherland, S.C. [Columbia Univ., Palisades, NY (United States). Lamont-Doherty Earth Observatory; Reid, J.L.; Swift, J.H.; Talley, L.D. [Univ. of California, San Diego, La Jolla, CA (United States). Scripps Institution of Oceanography

    1998-06-01

    This data documentation discusses the procedures and methods used to measure total carbon dioxide concentration (TCO{sub 2}) and partial pressure of CO{sub 2} (pCO{sub 2}) in discrete water samples collected during three expeditions of the Research Vessel (R/V) Knorr in the South Pacific Ocean. Conducted as part of the World Ocean Circulation Experiment (WOCE), the first cruise (WOCE Section P16A/P17A) began in Papeete, Tahiti, French Polynesia, on October 6, 1992, and returned to Papeete on November 25, 1992. The second cruise (WOCE Section P17E/P19S) began in Papeete on December 4, 1992, and finished in Punta Arenas, Chile, on January 22, 1993. The third expedition (WOCE Section P19C) started in Punta Arenas, on February 22 and finished in Panama City, Panama, on April 13, 1993. During the three expeditions, 422 hydrographic stations were occupied. Hydrographic and chemical measurements made along WOCE Sections P16A/P17A, P17E/P19S, and P19C included pressure, temperature, salinity, and oxygen [measured by conductivity, temperature, and depth (CTD) sensor], as well as discrete measurements of salinity, oxygen, phosphate, nitrate, nitrite, silicate, chlorofluorocarbons (CFC-11, CFC-12), TCO{sub 2}, and pCO{sub 2} measured at 4 and 20 C. In addition, potential temperatures were calculated from the measured variables.

  20. Ortografía y fonética en la Aurora de Chile Orthography and phonetics in the Aurora de Chile

    Directory of Open Access Journals (Sweden)

    Sonia Almau Almau

    2010-01-01

    Full Text Available En este trabajo se analizan los aspectos ortográficos y fonéticos más significativos del periódico “ministerial y político” la Aurora de Chile, dirigido por Camilo Henríquez y redactado por numerosos colaboradores, que apareció semanalmente en 1812 y 1813. Dicho periódico posee un indudable valor documental no solo por ser el primer impreso relevante de Chile, sino por tratarse de un corpus amplio, compuesto por noticias nacionales e internacionales de diversa índole, que refleja perfectamente las preocupaciones ideológicas del movimiento independentista.This paper analyses the most significant orthographic and phonetic aspects of Aurora de Chile, a ministerial and political newspaper published weekly during 1812-1813, which was directed by Camilo Henríquez and written by many contributors. This newspaper has an enormous documentary value, not only because it is the first relevant newspaper in Chile, but also because it constitutes a large corpus, which is made up of national and international news of various kinds, and which clearly reflects the independence movement ideological concerns.

  1. Manuel de Espanol para Profesores del Cuerpo de Paz--Chile (Peace Corps Teacher's Manual for Spanish--Chile). Second Edition.

    Science.gov (United States)

    Polanco, Patricia

    This teaching manual is designed for the Spanish language training of Peace Corps volunteers serving in Chile, and focuses on daily communication skills needed in that context. It contains 12 topical lessons outlining targeted language and communication competencies, suggested classroom activities, phrase and vocabulary lists, grammar and usage…

  2. Evaluacion de la Interaccion Adulto-Nino en Aulas Pre-escolares de Concepcion, Chile. [Evaluation Adult-Child Interaction in Preschool Classrooms of Concepcion, Chile.

    Science.gov (United States)

    Mathiesen De G., Maria Elena; Herrera G., Maria Olivia; Villalon B., Malva; Suzuky S., Emy

    2000-01-01

    Presents findings from investigation of the validity of the Arnett Caregiver Interaction Scale, CIS (1989), in preschools in Concepcion, Chile. Demonstrates the reliability and validity of the scale to evaluate the interaction of the childhood educator with young children, suggesting changes to the scale. Notes differences found for school type.…

  3. Radiation doses in neuroangiography for a clinical hospital in Chile; Dosis de radiacion en neuroangiografia para un hospital clinico de Chile

    Energy Technology Data Exchange (ETDEWEB)

    Vergara, F.; Valenzuela, E., E-mail: franciscovergara@hotmail.com [Pontificia Universidad Catolica de Chile, Santiago (Chile). Facultad de Medicina. Centro de Terapia Endovascular; Ubeda, C.A.; Nocetti, D., E-mail: carlos.ubeda.uta@gmail.com [Universidade de Tarapaca (Chile). Centro de Estudos en Ciencias Radiologicas (CECRad). Dept. de Tecnologic Medica. Facultad de Ciencias de la Salud (FACSAL)

    2013-11-01

    The objective of this study is to estimate the levels of radiation to the patient in neuroangiography procedures diagnostic and therapy in a Chile's Hospital, using a biplane angiographic system Siemens model ArtisZee. This research was conducted under the auspices of the International Atomic Energy Agency and the support of their radiation protection programs for patients.

  4. The Westinghouse AP1000 plant design: a generation III+ reactor with unique proven passive safety technology

    Energy Technology Data Exchange (ETDEWEB)

    Demetri, K. J.; Leipner, C. I.; Marshall, M. L., E-mail: demetrkj@westinghouse.com [Westinghouse Electric Company, 1000 Westinghouse Drive, Cranberry Township, PA 16066 (United States)

    2015-09-15

    The AP1000 plant is an 1100-M We pressurized water reactor with passive safety features and extensive plant simplifications and standardization that simplify construction, operation, maintenance, safety, and cost. The AP1000 plant is based on proven pressurized water reactor (PWR) technology, with an emphasis on safety features that rely solely on natural forces. These passive safety features are combined with simple, active, defense-in-depth systems used during normal plant operations which also provide the first level of defense against more probable events. This paper focuses on specific safety and licensing topics: the AP1000 plant robustness to be prepared for extreme events that may lead to catastrophic loss of infrastructure, such as the Fukushima Dai-ichi event, and the AP1000 plant compliance with the safety objectives for new plants. The first deployment of the AP1000 plant formally began in July 2007 when Westinghouse Electric Company and its consortium partner, the Shaw Group, signed contracts for four AP1000 units on coastal sites of Sanmen and Haiyang, China. Both sites have the planned ability to accommodate at least six AP1000 units; construction is largely concurrent for all four units. Additionally, the United States (U.S.) Nuclear Regulatory Commission (NRC) issued combined licenses (COLs) to allow Southern Nuclear Operating Company (SNC) and South Carolina Electric and Gas Company (SCE and G) to construct and operate AP1000 plants. Within this paper, the various factors that contribute to an unparalleled level of design, construction, delivery, and licensing certainty for any new AP1000 plant projects are described. These include: 1) How the AP1000 plant design development and reviews undertaken in the United States, China and Europe increase licensing certainty. 2) How the AP1000 passive plant robustness against extreme events that result in large loss of infrastructure further contributes to the licensing certainty in a post

  5. Glossary for the implementation of Health in All Policies (HiAP).

    Science.gov (United States)

    Freiler, Alix; Muntaner, Carles; Shankardass, Ketan; Mah, Catherine L; Molnar, Agnes; Renahy, Emilie; O'Campo, Patricia

    2013-12-01

    Health in All Policies (HiAP) is becoming increasingly popular as a governmental strategy to improve population health by coordinating action across health and non-health sectors. A variety of intersectoral initiatives may be used in HiAP that frame health determinants as the bridge between policies and health outcomes. The purpose of this glossary is to present concepts and terms useful in understanding the implementation of HiAP as a cross-sectoral policy. The concepts presented here were applied and elaborated over the course of case studies of HiAP in multiple jurisdictions, which used key informant interviews and the systematic review of literature to study the implementation of specific HiAP initiatives.

  6. New Protein Vector ApE1 for Targeted Delivery of Anticancer Drugs

    Directory of Open Access Journals (Sweden)

    N. V. Pozdniakova

    2012-01-01

    Full Text Available A new chimeric gene ApE1 encoding the receptor-binding domain of the human alpha-fetoprotein fused to a sequence of 22 glutamic acid residues was constructed. A new bacterial producer strain E. coli SHExT7 ApE1 was selected for ApE1 production in a soluble state. A simplified method was developed to purify ApE1 from bacterial biomass. It was shown that the new vector protein selectively interacts with AFP receptors on the tumor cell surface and can be efficiently accumulated in tumor cells. In addition, ApE1 was shown to be stable in storage and during its chemical modification. An increased number of carboxyl groups in the molecule allows the production of cytotoxic compound conjugates with higher drug-loading capacity and enhanced tumor targeting potential.

  7. Seed-specific aspartic proteinase FeAP12 from buckwheat (Fagopyrum esculentum Moench

    Directory of Open Access Journals (Sweden)

    Timotijević Gordana S.

    2010-01-01

    Full Text Available Aspartic proteinase gene (FeAP12 has been isolated from the cDNA library of developing buckwheat seeds. Analysis of its deduced amino acid sequence showed that it resembled the structure and shared high homology with typical plant aspartic proteinases (AP characterized by the presence of a plant-specific insert (PSI, unique among APs. It was shown that FeAP12 mRNA was not present in the leaves, roots, steam and flowers, but was seed-specifically expressed. Moreover, the highest levels of FeAP12 expression were observed in the early stages of seed development, therefore suggesting its potential role in nucellar degradation.

  8. Authenticated, private, and secured smart cards (APS-SC)

    Science.gov (United States)

    Szu, Harold; Mehmood, Amir

    2006-04-01

    From historical perspective, the recent advancements in better antenna designs, low power circuitry integrations and inexpensive fabrication materials have made possible a miniature counter-measure against Radar, a clutter behaving like a fake target return called Digital Reflection Frequency Modulation (DRFM). Such a military counter-measure have found its way in the commerce as a near field communication known as Radio Frequency Identification (RFID), a passive or active item tag T attached to every readable-writable Smart Card (SC): Passports ID, medical patient ID, biometric ID, driver licenses, book ID, library ID, etc. These avalanche phenomena may be due to the 3 rd Gen phones seeking much more versatile & inexpensive interfaces, than the line-of-sight bar-code optical scan. Despite of the popularity of RFID, the lacking of Authenticity, Privacy and Security (APS) protection restricted somewhat the wide spread commercial, financial, medical, legal, and militarily applications. Conventional APS approach can obfuscate a private passkey K of SC with the tag number T or the reader number R, or both, i.e. only T*K or R*K or both will appear on them, where * denotes an invertible operation, e.g. EXOR, but not limited to it. Then, only the authentic owner, knowing all, can inverse the operation, e.g. EXOR*EXOR= I to find K. However, such an encryption could be easily compromised by a hacker seeking exhaustively by comparison based on those frequently used words. Nevertheless, knowing biological wetware lesson for power of pairs sensors and Radar hardware counter-measure history, we can counter the counter-measure DRFM, instead using one RFID tag per SD, we follow the Nature adopting two ears/tags, e.g. each one holding portions of the ID or simply two different ID's readable only by different modes of the interrogating reader, followed by brain central processor in terms of nonlinear invertible shufflers mixing two ID bits. We prefer to adopt such a hardware

  9. Foreword: 18th Aps-Sccm and 24th Airapt

    Science.gov (United States)

    Collins, Gilbert; Moore, David S.; Yoo, Choong-Shik

    2014-05-01

    This second joint conference between the APS Topical Group on Shock Compression of Condensed Matter and the International Association for the Advancement of High Pressure Science and Technology (AIRAPT) demonstrates that static and dynamic compression of condensed matter continues to be a vibrant field of science and engineering. It is also by its nature an interdisciplinary field, incorporating chemistry, materials science, solid mechanics, plasma physics, and condensed matter physics, and utilizes theoretical, computational, and experimental tools. Recent years have brought about many advances in loading platforms, diagnostics, and computations that are leading to the emergence of many new avenues of research. These advances are also breathing new life into traditional topics such as equations of state, phase transformations, and chemistry at extreme conditions. The plenary lectures by Gennady Kanel, Karl Syassen, David Ceperley, Jon Eggert, Duck Young Kim, and Richard Kraus spanned the disciplines of static and dynamic high pressure physics and illustrated the breadth of the field. They also showed that interesting and important problems remain for researchers of the future to solve. The main guiding principal in the organization of this conference was to intertwine static and dynamical experimental alongside computational and theoretical studies of similar materials. To achieve this goal, we arranged the conference to include static, dynamic, and computational components in the same sessions, quite often taking presenters out of their comfort zone. The three special sessions on Deep Carbon Budget (organized by Giulia Galli and Rus Hemley), High Energy Density Materials (organized by Raymond Jeanloz and Jon Eggert), and Dynamic Response of Materials (organized by Yogendra Gupta and John Sarrao) furthered this guiding principal. We also endeavored to represent the breadth of static and dynamic high pressure science and technology, notably beyond that done at

  10. Analysis of contaminating elements in tree rings in Santiago, Chile

    Energy Technology Data Exchange (ETDEWEB)

    Romo-Kroeger, C.M.; Avila, M.J.; Eaton, L.C.; Lopez, L.A. [Faculty of Sciences. Univ. of Chile, Santiago (Chile)

    1996-12-31

    Using the 22`` isochronous cyclotron at the University of Chile, we have performed PIXE analyses on a group of samples collected from trees of metropolitan parks in Santiago. Dendrochronology was performed on each sample, which was then sectioned for the PIXE and other analyses, neutron activation and electro-chemistry. Available samples are trunk sections or cores obtained by the use of a 4.0 mm stainless steel incremental corer. We took three cores from each tree with permission of the municipalities. For the PIXE we use infinitely thick targets, as wood slabs taken along the trunk radius, and thin targets obtained by acid digestion of wood pieces and deposition on Kapton foils. Self supporting thick targets were placed directly in the PIXE chamber in a position so as to allow the irradiation of a specific annual ring. Potassium and Calcium appear as the most abundant elements in wood. Other elements such as S, Cu, Zn, As, Br and Pb were detected in amounts above the natural background in wood, and can be attributed to environmental contamination. The K/Ca ratios appear to be different for each species of tree, and seem to be related to the physico-chemical properties of wood. Preliminary results show important amounts of As and Cu (supposedly from mining origin) with increasing presence in the recent years. Pb and Zn (supposedly from vehicle origin) are also higher in recent years. (author)

  11. Self-generated Literacy Practices in Disadvantaged Environments in Chile

    Directory of Open Access Journals (Sweden)

    Margarita Calderón López

    2017-01-01

    Full Text Available This study explores the role of literacy in disadvantaged environments and the interplay between self-generated literacy practices and their conceptualization of literacy in 7 to 10-year-old Chilean pupils from two different schools located in Santiago, Chile. The study was framed within a participatory approach focused on promoting the children’s agency and voice in the research. A range of second-level data materials were collected through interviews with parents, photographs and existing documents. Although at a resources-associated level the sociocultural context did not inhibit the emergence of literacy practices, the context did contribute to the children’s understanding of literacy. This study raises the need for considering how children’s understanding of literacy influence their involvement and learning about reading and writing as their experiences and perceptions have an important role in their learning process, particularly on how they develop their reading and writing practices. The findings implied that by raising the participants’ awareness of the relevance of everyday practices in relation with reading and writing, they are likelier to feel more comfortable and empowered towards their own literacy practices. Particularly, the empowerment of children coming from a disadvantaged background would give them more opportunities to support their learning. By making the children aware of the relevance of their own perceptions and practices, the pupils could gain in confidence, be agents of their learning processes, and have more resources to succeed on the demanding school environment.

  12. Healthcare Accessibility Shortfalls and Hospital Infrastructures in Chile

    Directory of Open Access Journals (Sweden)

    Stefano Mainardi

    2009-03-01

    Full Text Available To measure healthcare accessibility, a previous study formulated a stochastic cost frontier model, and applied it to distances of communal centres from nearest emergency hospitals in Chile. Based on a larger set of variables, this study re-estimates the distance threshold, and tests alternative specifications and distribution assumptions over the period 2000-05. Complementing the analysis, ordered probit regressions help examine the cross-commune allocation of hospitals with varying complexity of medical services. Thirdly, excess distance estimates are used with other covariates in tobit models of health sector infrastructure investments. Socio-economic, demographic and geophysical conditions, along with non-hospital healthcare facilities, explain spatial inequality of hospitals. Excess distances are robust to different model specifications and distribution assumptions, and do not appear to be compensated by standards of services of the nearest hospitals or new healthcare infrastructure and upgrading investments in support to the communes concerned. Communes with perceived inadequacy in timing of medical attention turn out to often register large location inefficiency too. For the most critical communal cases, the excess distance burden amounts.

  13. Policies of Maternal Love, Chile 1927-1937

    Directory of Open Access Journals (Sweden)

    Javiera Poblete Vargas

    2015-11-01

    Full Text Available This article has proposed to identify the political and economic usefulness that doctors and the "social visitors" (social worker conferred to a maternal love in Chile, in the treatment of binomial problem of Mother and Child, to the inside of their articles written in four scientific magazines, between 1927 and 1937: Social Service, Charitable, Social Assistance and Social Action. With the theoretical tools that it has provided to the historiography of cultural studies, gender studies, critical discourse analysis and the political philosophy, we will analyze the historical sources available and we will seek to demonstrate that in the political and ideological project of the health professionals and social service, this affective dimension will have a political and economic usefulness, to the extent that achieves naturalize and reinforce, in the women of the people, its maternal social/sexual role for training and caring of the life of future mothers and citizens of the country, in the midst of a crisis scenario

  14. The debate in Chile on organ donation revisited

    Directory of Open Access Journals (Sweden)

    Miguel Hugo Kottow Lang

    2016-08-01

    Full Text Available Resumen Aumenta la escasez de órganos para trasplantes de cadáver a vivo, en tanto la lista de receptores crece por extensión de las indicaciones médicas para trasplantar y la longevidad de enfermos crónicos con disfunciones orgánicas. Chile tiene una tasa bajísima de 6,7 donantes por millón, pese a una ley de consentimiento presunto enmendada para acoger un “principio de reciprocidad”. Casi cuatro millones de personas documentan su rechazo a donar, y el 53% de familias niegan la donación en los presuntamente disponibles. Es urgente repensar y flexibilizar ciertos aspectos hasta ahora rechazados como algún incentivo no material, la donación parcial de órganos, la posibilidad de aceptar vínculos personales entre donantes y receptores, e incrementar la transparencia de los procedimientos para fomentar la confianza en ellos.

  15. Traumatic effects of political repression in Chile: a clinical experience.

    Science.gov (United States)

    Cordal, Margarita Díaz

    2005-10-01

    The author examines psychic trauma resulting from human rights violations in Chile. Starting from trauma theories developed by authors such as Ferenczi, Winnicott and Stolorow, she posits the relevance of the subject's emotionally significant environment in the production of the traumatic experience. She describes the characteristics of the therapeutic process on the basis of a clinical case. She emphasizes the need to recognize the damage that may be produced within the reliable link between patient and analyst, pointing out the risk of retraumatization if analysts distance themselves and apply 'technique' rigorously, leaving out their own subjective assessments. Therapists must maintain their focus on the conjunction of the patient's intersubjective context and inner psychic world both when exploring the origin of the trauma and when insight is produced. The author posits repetition in the transference as an attempt at reparation, at finding the expected response from the analyst that will help patients assemble the fragments of their history and achieve, as Winnicott would put it, a feeling of continuity in the experience of being.

  16. [The Universidad Austral de Chile Medical School: a regional commitment].

    Science.gov (United States)

    Grob, C

    1997-07-01

    The Universidad Austral de Chile Medical School was created in 1966. Its general goal was to train a general physician with capacities to integrate biological, psychological and social issues, to deal with prevalent diseases as well as with the non referable casualties, to analyze health situations and to manage health teams. From its beginning, it incorporated anthropological and the public health contents to medical curriculum. Moreover, the formal teaching formation was reduced to 5 years, increasing the internship cycle to 2 years, with an important practice on primary health care in regional hospitals, that included a research project on health administration. A revision of the School curriculum showed the need of a better horizontal and vertical integration of medical education. Consequently, global courses were organized to gather knowledge that, until now, was delivered in a fragmented form. Our Medical School has a major impact in the southern region of the country and over 60% of its graduates have settled in this zone, improving its physician/inhabitant relationship and the number of specialists.

  17. Health informatics in Chile: responding to health reforms.

    Science.gov (United States)

    Capurro, Daniel

    2007-12-01

    Chile is in the throes of health reforms aimed at ensuring that every person with specified chronic diseases receives timely and high quality care. CITs are crucial to the achievement of this vision because they make it possible to manage information and knowledge in a more efficient way. Until a few years ago, the incorporation of CITs was limited to individual initiatives, but since 2004 there has been a master plan to coordinate this task in the public sector. Some projects are now operative but there is still a long road to travel before getting to our destination. One of the most underdeveloped areas is the clinical applications of health CITs, especially the incorporation of biomedical knowledge to clinical practice. The two biggest challenges facing the Digital Agenda for the health care system are (i) to develop a critical mass of clinicians and health related professionals with expertise in Health Informatics; and (ii) to foster technical integration of the private and public sectors of the health care market.

  18. VOTO ECONÓMICO CON INCERTIDUMBRE. El caso de Chile

    Directory of Open Access Journals (Sweden)

    José Luis Sáez-Lozano

    2014-01-01

    Full Text Available Desde que en 1931 Tibbits publicó un estudio sobre la relación entre el ciclo económico y los resultados electorales, el análisis del voto económico ha ido perfilando una teoría que explica la decisión de los electores. A diferencia de otras investigaciones, en este artículo se plantea un modelo de voto económico en el que suponemos que los electores son racionales, neutrales ante el riesgo y poseen incertidumbre ante la situación económica prospectiva del país. El objetivo último del elector es votar por el candidato que le permita maximizar la utilidad esperada de su decisión. De las estimaciones realizadas a partir de la matriz de microdatos agrupados de las elecciones presidenciales celebradas en Chile en 1993, 1999-2000 y 2005-2006, se concluye que el liderazgo y el contexto electoral son los factores que más condicionan el comportamiento de los electores. También comprobamos que el voto económico de los chilenos es sofisticado, racional y heterogéneo.

  19. Catastrophic debris avalanche deposit of Socompa volcano, northern Chile

    Science.gov (United States)

    Francis, P. W.; Gardeweg, M.; Ramirez, C. F.; Rothery, D. A.

    1985-01-01

    Between 10,000 and 500 yr ago the Socompa volcano in northern Chile experienced a catastrophic collapse of a 70 deg sector of the original cone, causing a debris avalanche that descended nearly 3000 m vertically and traveled more than 35 km from the volcano. The deposits cover some 490 sq km and have a minimum volume of 15 cu km. Parts of the original cone slumped in a nearly coherent form and are now preserved as large blocks more than 400 m high. The primary avalanche traveled northwestward over sloping ground before coming to rest transiently, forming a prominent marginal ridge, and then slid away northeastward to form a secondary flow, overriding much of the primary avalanche deposit. Abundant, prismatic, jointed dacite blocks within the debris avalanche deposit and a thin, fine-grained pumiceous deposit beneath it suggest that the collapse was triggered by magmatic activity and may have been accompanied by a violent lateral blast. Collapse was followed by eruption of pumiceous pyroclastic flows and extrusion of voluminous dacite domes.

  20. El valle de Azapa en el norte de Chile

    Directory of Open Access Journals (Sweden)

    Cocilovo, José Alberto

    1996-01-01

    Full Text Available En el presente trabajo se analiza el proceso microevolutivo de la población prehistórica del Valle de Azapa (Norte de Chile, mediante un nuevo estudio de la información preparada con motivo de experiencias anteriores, relacionada con la obtención de una explicación genético-poblacional sobre la diferenciación biológica observada en el área. Hemos empleado matrices de distancias D2 de Mahalanobis calculadas entre cinco grupos de distintas fases cronológicas para la muestra total y para cada uno de los sexos. Hemos utilizado una adaptación de un modelo que preve el incremento exponencial del parentesco a medida que aumenta la distancia cronológica entre las muestras. Los resultados obtenidos confirman una alta correlación entre distancias morfológicas y cronológicas. De acuerdo con lo esperado, casi un 80% de la variación métrica puede ser explicada por una función de las diferencias cronológicas (en número de generaciones basada en el desarrollo de un proceso dispersivo regulado por la acción de la migración.

  1. Dutch Minister of Science Visits ESO Facilities in Chile

    Science.gov (United States)

    2005-05-01

    Mrs. Maria van der Hoeven, the Dutch Minister of Education, Culture and Science, who travelled to the Republic of Chile, arrived at the ESO Paranal Observatory on Friday afternoon, May 13, 2005. The Minister was accompanied, among others, by the Dutch Ambassador to Chile, Mr. Hinkinus Nijenhuis, and Mr. Cornelis van Bochove, the Dutch Director of Science. The distinguished visitors were able to acquaint themselves with one of the foremost European research facilities, the ESO Very Large Telescope (VLT), during an overnight stay at this remote site, and later, with the next major world facility in sub-millimetre and millimetre astronomy, the Atacama Large Millimeter Array (ALMA). At Paranal, the guests were welcomed by the ESO Director General, Dr. Catherine Cesarsky; the ESO Council President, Prof. Piet van der Kruit; the ESO Representative in Chile, Prof. Felix Mirabel; the Director of the La Silla Paranal Observatory, Dr. Jason Spyromilio; by one of the Dutch members of the ESO Council, Prof. Tim de Zeeuw; by the renowned astrophysicist from Leiden, Prof. Ewine van Dishoek, as well as by ESO staff members. The visitors were shown the various high-tech installations at the observatory, including many of the large, front-line VLT astronomical instruments that have been built in collaboration between ESO and European research institutes. Explanations were given by ESO astronomers and engineers and the Minister gained a good impression of the wide range of exciting research programmes that are carried out with the VLT. Having enjoyed the spectacular sunset over the Pacific Ocean from the Paranal deck, the Minister visited the VLT Control Room from where the four 8.2-m Unit Telescopes and the VLT Interferometer (VLTI) are operated. Here, the Minister was invited to follow an observing sequence at the console of the Kueyen (UT2) and Melipal (UT3) telescopes. "I was very impressed, not just by the technology and the science, but most of all by all the people involved

  2. militar en la frontera de chile en el siglo XIX

    Directory of Open Access Journals (Sweden)

    Wilma Vilaboa Blome

    2007-01-01

    Full Text Available The historic origin of the habitat in the Bio-Bio Region was singular and repeated nowhere else in Chile. The uncivilized and fragmented geography, with no communication routes to the south of the Bio-Bio River towards the end of the nineteenth century, together with the resistance of the indigenous people and the perception of having a country divided in two parts by an inexpugnably frontier by means of civil colonisation, provoked the political decision of settling these territories by the action of military force. Thus, in the geographical area that appears as an interstice and is known as “The Frontier”, the territorial occupation followed defensive lines along the fluvial routes in the form of a series of military forts that developed to become cities such as Collipulli, Mulchen, Negrete and Temuco. This chronic situation of instability could neither allow the consolidation of foundation cities, nor the development of an agricultural economy or a commercial trade economy, which explains the late incorporation of this area to the nation. A country within a country; it neither assumes its rules nor submits to its jurisdiction; it does not even follow the economic model of its time.

  3. [Compliance with tuberculosis treatment in adults in Santiago, Chile].

    Science.gov (United States)

    Ferrer, X; Kirschbaum, A; Toro, J; Jadue, J; Muñoz, M; Espinoza, A

    1991-11-01

    A prospective study was conducted to estimate the current magnitude of adherence to short-course tuberculosis treatment, the degree of abandonment, the characteristics of treatment dropouts, and the causes of this abandonment. The study group was made up of tuberculosis patients over the age of 15 who received care at the Western and Southern Health Services of the Metropolitan Region of Santiago, Chile, between 1 October 1987 and 31 January 1988. The percentage abandoning treatment, calculated by the life table method, was 11.5. The profile of patients who dropped out of treatment was as follows: male, under 45 years of age, single, low level of education, no steady work, homeless, and alcoholic. In addition, an opinion survey on the variables associated with abandonment was conducted and it was concluded that the main ones were alcoholism and intolerance to tuberculosis drugs. Awareness of this profile makes it possible to take measures to prevent patients from abandoning treatment, as well as to educate and even hospitalize at the start of treatment those tuberculous patients exhibiting such a profile.

  4. Metagenomes of the picoalga Bathycoccus from the Chile coastal upwelling.

    Directory of Open Access Journals (Sweden)

    Daniel Vaulot

    Full Text Available Among small photosynthetic eukaryotes that play a key role in oceanic food webs, picoplanktonic Mamiellophyceae such as Bathycoccus, Micromonas, and Ostreococcus are particularly important in coastal regions. By using a combination of cell sorting by flow cytometry, whole genome amplification (WGA, and 454 pyrosequencing, we obtained metagenomic data for two natural picophytoplankton populations from the coastal upwelling waters off central Chile. About 60% of the reads of each sample could be mapped to the genome of Bathycoccus strain from the Mediterranean Sea (RCC1105, representing a total of 9 Mbp (sample T142 and 13 Mbp (sample T149 of non-redundant Bathycoccus genome sequences. WGA did not amplify all regions uniformly, resulting in unequal coverage along a given chromosome and between chromosomes. The identity at the DNA level between the metagenomes and the cultured genome was very high (96.3% identical bases for the three larger chromosomes over a 360 kbp alignment. At least two to three different genotypes seemed to be present in each natural sample based on read mapping to Bathycoccus RCC1105 genome.

  5. Cultural experiences of immigrant nurses at two hospitals in Chile

    Directory of Open Access Journals (Sweden)

    Gabriel Rodríguez

    2014-04-01

    Full Text Available OBJECTIVE: to explore the cultural experiences of nurses who immigrated to Chile. The study´s theoretical framework was the Purnell Model for Cultural Competence.METHOD: Leininger's Observation-Participation-Reflection method was developed at two hospitals in the city of Santiago, and ethnographic interviews were held with 15 immigrant nurses.RESULTS: among Purnell's 12 domains, the following were identified: Overview/heritage, Communication, Workforce issues, Family roles and organization, Biocultural ecology and Health-care practices. The difficulties were related to the language and its semantic meaning, the new responsibilities and the difficult relationship with colleagues. "In search of better horizons - the decision to immigrate", "Gaining confidence and establishing a support network - employability and professional performance" and "Seeking for people´s acceptance - professional adaptation in a new cultural scenario" are cultural themes that represent their experiences.CONCLUSIONS: the competence to offer cultural care demands the development of public policies and continuing education programs at health institutions, specifically focused on immigrant nurses.

  6. Sustainable energy system. A case study from Chile

    Energy Technology Data Exchange (ETDEWEB)

    Gebremedhin, A.; Karlsson, B. [Department of Management and Engineering, Division of Energy Systems, Linkoeping University, SE-581 83 Linkoeping (Sweden); Bjoernfot, K. [Shell Raffinaderi AB, Torslandavaegen, Box 8889, SE-402 72 (Sweden)

    2009-05-15

    This paper presents some of the results of a power system analysis for Chile. The two major Chilean electric systems are roughly modelled and optimized using a linear programming method with the option to integrate renewable energy sources like wind power, solar power, mini-hydropower and biomass-fired power and also 'municipal waste'. A total of four different scenarios are outlined: reference system, new production units, gas and coal price variations and a policy measure to encourage power production based on renewable energy. The objective of the scenarios was to illustrate under what conditions integration of the different energy sources in the existing production system is possible. The study shows that even under current conditions, mini-hydro and waste to energy plants are economically viable. Wind power might be interesting alternatives if policy instrument measures are applied. On the other hand, it is hard for the other energy sources to enter the system even when higher price levels of gas and coal are applied. The system is more sensitive to coal price increases than to gas price increases and this mainly encourages CO{sub 2} emission reduction. (author)

  7. Gas geochemistry of the Cordon Caulle geothermal system, Southern Chile

    Energy Technology Data Exchange (ETDEWEB)

    Sepulveda, Fabian [SGGES, University of Auckland, Private Bag 92019, Auckland (New Zealand); Lahsen, Alfredo [Department of Geology, University of Chile, P.O. Box 13518 (21), Santiago (Chile); Powell, Thomas [Mighty River Power, P.O. Box 445, Hamilton (New Zealand)

    2007-10-15

    The Cordon Caulle geothermal system is located in a NW-trending volcano-tectonic depression of the Southern Andean Volcanic Zone of Chile. Outflows of low chloride water were previously interpreted as the surface expression of a shallow steam-heated aquifer, with subsurface temperatures of 150-170 C. Gas data from fumaroles and hot springs have been used to assess the nature and temperature of the deeper, underlying geothermal reservoir. Fumaroles at the northeastern border of Cordon Caulle have {sup 3}He/{sup 4}He ratios typical of subduction margins (6-7 R{sub A}) and N{sub 2}/Ar ratios of about 40, indicating deep convection of air-saturated groundwater. Fumaroles at the southwestern border have N{sub 2}/Ar ratios >300, suggesting the presence of a deep volcanic component. Gas ratios of fumarole discharges yield equilibration temperatures >300 C, whereas those of hot spring waters suggest temperatures of about 160 C. Based on these data, and comparisons with well documented liquid and vapor-dominated geothermal systems, a model is proposed of a boiling liquid-dominated geothermal system overlain by a secondary steam-heated aquifer. (author)

  8. Apuntes sobre el renacer de la huelga obrera en Chile

    Directory of Open Access Journals (Sweden)

    Daniel Núñez Arancibia

    2012-01-01

    Full Text Available En este artículo se analiza un conjunto de manifestaciones indicativas del resurgimiento de la huelga obrera en Chile, con especial atención en el marco de las condiciones políticas en que evolucionaron las organizaciones obreras, desde finales de la dictadura hasta la reciente era neoliberal. Además se examina la reaparición de expresiones reivindicativas de los trabajadores, que se han dado a pesar de algunas medidas dirigidas a despolitizar las luchas laborales y de varias reformas legales que redujeron el espacio de actuación de las organizaciones obreras. Estos variados esfuerzos organizativos han tenido lugar en sectores primarios, en donde se confrontan las nuevas condiciones de flexibilización y precariedad que el empresariado chileno ha impulsado. En contra de las perspectivas estructuralistas, en este análisis se sustenta la importancia que los subcontratistas y los trabajadores tercerizados han tenido en dichos procesos, y la apelación a huelgas extralegales en tanto hechos significativos en relación con la actual crisis de las clásicas identidades ligadas a la vida fabril y al trabajo normal

  9. Interbasin underflow between closed Altiplano basins in Chile.

    Science.gov (United States)

    Montgomery, Errol L; Rosko, Michael J; Castro, Santiago O; Keller, Barry R; Bevacqua, Paolo S

    2003-01-01

    Interbasin ground water movement of 200 to 240 L/sec occurs as underflow beneath a mountainous surface water divide separating the topographically higher Salar de Michincha from the topographically lower Salar de Coposa internally drained basins in the Altiplano of northern Chile. Salt-encrusted flats (salars) and saline lakes occur on the lowest parts of the basin floors and comprise the principal evaporative discharge areas for the basins. Because a surface water divide separates the basins, surface water drainage boundaries do not coincide with ground water drainage boundaries. In the region, interbasin ground water movement is usually not recognized, but occurs for selected basins, and at places is an important component of ground water budgets. With increasing development of water for mining industry and potential exportation of ground water from the Altiplano for use at coastal cities, demonstration and quantification of interbasin movement is important for assessment of sustainable ground water development in a region of extreme aridity. Recognition and quantification of interbasin ground water underflow will assist in management of ground water resources in the arid Chilean Altiplano environment.

  10. Caregiver perceptions of child nutritional status in Magallanes, Chile

    Science.gov (United States)

    Heitzinger, Kristen; Vélez, Juan Carlos; Parra, Sonia G.; Barbosa, Clarita; Fitzpatrick, Annette L.

    2012-01-01

    Background We aimed to identify risk factors for childhood overweight and obesity and the accuracy of caregivers’ perceptions of their child’s nutritional status in the Magallanes region, Patagonia, Chile. Methods Heights and weights of children attending day care centers and elementary schools were collected and caregivers completed questionnaires regarding their child’s health and behavior. The child’s nutritional status was diagnosed using the 2006 WHO Child Growth Standards (for children under age 6) and the CDC 2000 Growth Charts (for children age 6 and older). Logistic regression was used to evaluate factors related to childhood overweight/obesity and weight underestimation by caregivers of overweight or obese children. Results Of the 795 children included in the study, 247 (31.1%) were overweight and 223 (28.1%) were obese. Risk factors for overweight/obesity included younger age and being perceived to eat more than normal by the caregiver. Caregivers were less likely to underestimate their child’s weight if the child was older or if the caregiver believed the child ate more than a normal amount. Conclusions There is a high prevalence of overweight and obesity among children in Magallanes and the majority of caregivers underestimate the extent of the problem in their children. PMID:24548582

  11. National and international astronomical activities in Chile 1849--2002

    Science.gov (United States)

    Duerbeck, H. W.

    2003-03-01

    At all times and in many ways, Chilean astronomy has been influenced externally, either by astronomical expeditions from other parts of the world, or by astronomers that immigrated from other countries. We outline the history of the Chilean National Observatory, beginning with its origins out of Gilliss' US Naval Expedition to the Southern Hemisphere, over its directors Moesta, Vergara, Obrecht, Ristenpart to the middle of the 20th century, as well as the astronomical development at the Universidad Católica. In addition, various international expeditions, which aimed at observations of solar eclipses, the Venus transit of 1882, and the Mars opposition of 1907, were carried out. While a major photometric project of Harvard Observatory was active for only six weeks in the north of Chile, the spectroscopic Mills expedition of Lick Observatory in Santiago lasted several decades, and the solar observatory of the Smithsonian Astrophysical Observatory near Calama even longer. Finally we give a brief overview of the evolution and the actual state of the international observatories Cerro Tololo, La Silla, Paranal, and Las Campanas.

  12. Apacheta, a new geothermal prospect in Northern Chile

    Energy Technology Data Exchange (ETDEWEB)

    Urzua, Luis; Powell, Tom; Cumming, William B.; Dobson, Patrick

    2002-05-24

    The discovery of two high-temperature fumaroles, with gas geochemistry compatible with an economic geothermal system, established Apacheta as one of the most attractive geothermal exploration prospects in northern Chile. These remote fumaroles at 5,150 m elevation were first sampled in 1999 by ENAP and its partners, following up on the reports of a CODELCO water exploration well that flowed small amounts of dry steam at 4,540 m elevation in the valley 4.5 km east of the fumaroles. The prospect is associated with a Plio-Pleistocene volcanic complex located within a NW-trending graben along the axis of the high Andes. The regional water table is 4,200 masl. There are no hot springs, just the 88 degrees C steam well and the 109 degrees and 118 degrees C fumaroles with gas compositions that indicate reservoir temperatures of greater than or equal to 250 degrees C, using a variety of gas geothermometers. An MT-TDEM survey was completed in 2001-2002 by Geotermica del Norte (SDN), an ENAP-C ODELCO partnership, to explore the Apacheta geothermal concession. The survey results indicated that base of the low resistivity clay cap has a structural apex just west of the fumaroles, a pattern typically associated with shallow permeability within a high temperature geothermal resource. SGN plans to drill at least one exploration well in 2002-03 to characterize a possible economic resource at Apacheta.

  13. CONSORCIOS TECNOLÓGICOS EN ARGENTINA, CHILE, COLOMBIA Y URUGUAY

    Directory of Open Access Journals (Sweden)

    Roberto Álvarez E.

    2012-01-01

    Full Text Available Este artículo analiza un conjunto de consorcios tecnológicos apoyados con recursos públicos en Argentina, Chile, Colombia y Uruguay. Estos programas buscan facilitar la interacción entre empresas e instituciones dedicadas a la producción de ciencia y tecnología. Los resultados, basados en datos recabados para un subconjunto de los grupos apoyados, ponen en relieve las dificultades y los largos tiempos que se re-quieren para lograr resultados concretos, en particular, en innovación tecnológica. El trabajo cuantitativo muestra una evaluación relativamente baja de las empresas res-pecto al efecto de estos instrumentos en la generación de innovaciones de productos y procesos y la obtención de patentes, aunque existen aspectos relativamente mejor evaluados, como el mejoramiento del acceso a conocimiento tecnológico, en ámbitos como el mercadeo y los recursos humanos. Esto puede deberse a que varios de los consorcios llevan poco tiempo en funcionamiento y necesitan un plazo más largo para ser evaluados.

  14. Image of the seismogenic coupling zone in Central Chile: The amphibious experiment SPOC (Subduction Processes Off Chile)

    Science.gov (United States)

    Krawczyk, C. M.; Stiller, M.; Lüth, S.; Mechie, J.; Spoc Research Group

    2003-04-01

    Nearly all interplate megathrust earthquakes occur in the seismogenic coupling zone between converging plates. In the area of the 1960 Chile earthquake (Mw = 9.5), we aim at a quantitative understanding of the seismicity and its relation to processes operating at depth and at the surface. As a first step, the offshore experiment SPOC with RV SONNE was combined with an onshore-offshore, active-passive seismic experiment between 36° and 39° S, crossing the rupture area of the 1960 Chile earthquake. The campaign comprised: (1) a 2-D wide-angle component recording chemical shots and airgun pulses along three consecutive E-W onshore profiles; (2) a seismic reflection experiment in the onshore-offshore transition; and (3) a 3-D component which recorded both active and passive sources. Offshore, the upper plate is split into many segments with pronounced forearc basins and narrow accretionary wedges. A thick subduction channel seems to cause a non-accretionary subduction mode. Covering onshore the westernmost part of a long E-W refraction seismic line (one amongst three), the profile spread of the reflection seismic survey at 38° 15`S was 54 km long, with three set-ups of 18 km length each, and extended from the coast to the east. Furthermore, the offshore-onshore transition zone is imaged by a wide-angle section resulting from the registration of the airgun shots of the marine profile with the first 18 km of the spread of the NVR survey. Different mainly eastward dipping reflection bands are observed between 5-25 km depth. These bands are interpreted to describe the internal structure of the Palaeozoic accretionary wedge in the region. The reflections between 25-45 km depth correlate with Wadati-Benioff seismicity and are suggested to image the top of the downgoing plate. Below the coast, the plate dips with c. 15° below the continent. In the central part of the profile, a break in reflectivity located below the axis of the coastal cordillera more or less coincides

  15. La democracia incompleta en Chile: La realidad tras los rankings internacionales Incomplete Democracy in Chile: Reality Behind International Rankings

    Directory of Open Access Journals (Sweden)

    MANUEL ANTONIO GARRETÓN M

    2010-01-01

    Full Text Available A pesar de la imagen generalizada del caso chileno en los rankings internacionales como un proceso ejemplar de transición hacia la democracia y de la vida política democrática, Chile es una "democracia incompleta" debido a los enclaves autoritarios heredados de la dictadura y no superados en su totalidad. La democracia chilena, analizada a través de las dimensiones constitucional, electoral y ciudadana, presenta la contradicción entre los grandes avances conseguidos bajo los gobiernos de la Concertación y las debilidades en las tres dimensiones. Estas debilidades se explican por los limites fundantes en la soberanía popular observados a partir de la Constitución, que consagró la exclusión política a través del sistema binominal, de lo que se derivan los limites de la democracia electoral sujeta a restricciones fácticas y normativas en un diseño institucional deficiente. Asimismo, la dimensión ciudadana de la democracia se enfrenta a problemas de derechos civiles específicos de las minorías, desigualdades socioeconómicas, participación electoral y ausencia de instituciones de participación.Chile has a very good image on international rankings about its transition to democracy and democratic performance. Despite it, the Chilean case is still a case of incomplete democracy, due to the authoritarian enclaves inherited from the military dictatorship and not yet totally overcome. Analyzed through constitutional, electoral and citizen dimensions of democracy, the Chilean one shows a contradiction between the significant achievements under Concertación government in almost twenty years and the weaknesses of this three dimensions. These weaknesses originated in the limits to popular sovereignty grounded on the Constitution where it was consecrated political exclusions through the electoral bi-nominal system. This generated an institutional design, which leads to severe restrictions both factual and normative in political

  16. Renal effects of atriopeptin (AP) II in conscious SHR

    Energy Technology Data Exchange (ETDEWEB)

    Smits, J.F.; Debets, J.M.; Struyker-Boudier, H.A.; Daemen, M.J.

    1986-03-05

    Diuresis and natriuresis following APs has been suggested to depend upon increased renal blood flow (RBF). In a previous study, they found that APII infusions in conscious SHR decrease RBF. In this study, they report effects of APII on glomerular filtration rate (GFR) and renal excretory function in conscious SHR. Male SHR were equipped with arterial and venous catheters. Furthermore, a special catheter was implanted into the bladder to allow continuous urine sampling from conscious, freely moving rats. Animals were allowed at least 4 days to recover. In one group of SHR, APII (N=7) or saline (N=7) was infused to quantitate excretion of water, Na/sup +/, and K/sup +/. Two other groups of SHR (N=8 each) were infused with /sup 51/Cr-EDTA and /sup 125/I-PAH. GFR and renal plasma flow (ERPF) were calculated from urine and a mid-time plasma sample during APII or saline infusion. Following changes in infusion rates, urine from the first 5 min was discarded, after which a 10-min collection was made. APII (0.5-4 ..mu..g/kg/min) increased water, Na/sup +/ and K/sup +/ output maximally during 2 ..mu..g/kg/min. ERPF decreased from 10.7 +/- 1.1 ml/min to 7.9 +/- 0.5 ml/min. GFR did not change significantly. Filtration fraction increased from 24 +/- 1% to 33 +/- 2%. Fractional water excretion increased from 0.8 +/- 0.2% to 2.5 +/- 0.7%. Saline infusions did not affect renal function. The results indicate that in conscious SHR, APII causes diuresis and natriuresis which does not depend upon increased GFR, but, rather, upon a primary tubular effect.

  17. Hidrocefalia após meningite - relato de caso

    Directory of Open Access Journals (Sweden)

    Tássia Sabbadin Mancilha

    2015-10-01

    Full Text Available A malformação do sistema nervoso central é um dos fatores de risco para meningite no período neonatal, a qual se caracteriza pela ocorrência de um processo infeccioso nas meninges, ocorrendo entre o nascimento e o 28º dia de vida. As complicações mais frequentemente associadas á meningite neonatal são a ventriculite, síndrome convulsiva, síndrome da secreção impropria do hormônio antidiurético, hidrocefalia, abcesso cerebral, hemorragia intracraniana, leucomalácia e coleção subdural. O objetivo do presente relato é descrever um caso de um paciente portador de uma má formação do sistema nervoso central, que apresentou aos 28 dias de vida quadro de meningite bacteriana que evoluiu para uma hidrocefalia. Após abordagem cirúrgica para colocação de DVE, seguida de complicações e troca de DVP, paciente apresenta suspeita de hipertensão intracraniana, quadro de crises convulsivas e atraso no desenvolvimento neuropsicomotor. A meningite no período neonatal é considerada uma patologia grave, cuja mortalidade varia de 15 a 50%. Sua incidência varia de 0,3 a 1 caso por 1000 nascidos vivos. Dentre os sobreviventes cerca de 50 a 75% evoluem com deficiência auditiva, deficiência visual, atraso no desenvolvimento neuropsicomotor, retardo mental, convulsões e hidrocefalia. Desta forma fica evidente, devido ao diagnóstico clinico ser difícil, a necessidade de manejo e tratamento precoce a fim de minimizar o prognóstico e as dificuldades que poderá apresentar o paciente no futuro.

  18. Psicología comunitaria y políticas sociales en Chile Psicologia comunitaria e políticas sociais no Chile Community psychology and social policies in Chile

    Directory of Open Access Journals (Sweden)

    Jaime Alfaro Inzunza

    2009-08-01

    Full Text Available En este artículo analizamos la relación entre Psicología Comunitaria y políticas sociales, estableciendo la influencia de las políticas sociales sobre el desarrollo contemporáneo de la Psicología Comunitaria en Chile. Sostenemos que su consolidación como profesión se asocia estrechamente a la implementación de políticas sociales a partir de la década de los noventa y su conformación actual está condicionada y tensionada por las orientaciones de estas políticas. Se examina la evolución tanto de las políticas sociales como de la Psicología Comunitaria en Chile, los puntos de encuentro y las tensiones, de las que derivamos una serie de desafíos y proyecciones que examinamos en el presente artículo, con el objetivo de avanzar en la comprensión de esta relación.Este artigo investigou a relação entre a Psicologia Comunitária e as políticas sociais, estabelecendo a influência das políticas sociais sobre o desenvolvimento contemporâneo da Psicologia Comunitária no Chile. Afirmamos que a sua consolidação como profissão está intimamente associada à implementação de políticas sociais desde a década de noventa e sua formação atual está condicionada e tensionada pelas diretrizes dessas políticas. O estudo analisa a evolução das políticas sociais e da psicologia comunitária no Chile, os pontos de encontro e de tensão, dos quais se deriva uma série de desafios e projeções discutidos neste artigo com o objetivo de fazer avançar a compreensão desta relação.In this article we analyze the evolution of community psychology in Chile, and the influences of social policies in its development. We hold that its consolidation as a profession is closely associated to the implementation of social policies since the nineties, and its present conformation is determined and tightened by the orientation of these policies. From the evolution of social policies and Community Psychology in Chile we have come up with a series

  19. AP-2α Inhibits c-MYC Induced Oxidative Stress and Apoptosis in HaCaT Human Keratinocytes

    Directory of Open Access Journals (Sweden)

    Lei Yu

    2009-01-01

    AP-2 may have a direct effect on the c-myc gene. Chromatin immunoprecipitation assays demonstrated that AP-2 proteins bound to a cluster of AP-2 binding sites located within a 2 kb upstream regulatory region of c-myc These results suggest that the negative regulation of AP-2 on c-MYC activity was achieved through binding of AP-2 protein to the c-myc gene. The effects of AP-2 on c-MYC induced ROS accumulation and apoptosis in epidermal keratinocytes are likely to play an important role in cell growth, differentiation and carcinogenesis of the skin.

  20. Algunas precisiones sobre la enseñanza de la arquitectura y el urbanismo en la Universidad de Chile /Some clarification on the architecture and urbanism teaching in the Universidad de Chile

    Directory of Open Access Journals (Sweden)

    David Maulén de los Reyes

    2010-12-01

    Full Text Available El ex Decano de la Facultad de Arquitectura y Urbanismo de la Universidad de Chile entrevistado, entrega antecedentes sobre el proceso de reforma de la enseñanza producida a mediados del siglo XX./ The ex-Dean of Architecture of the Universidad de Chile (FAU presents a background for the curricular reform occurred in the mid-20th century.