WorldWideScience

Sample records for chi1-3510 mesons

  1. Measurement of the $\\chi_b(3P)$ mass and of the relative rate of $\\chi_{b1}(1P)$ and $\\chi_{b2}(1P)$ production

    CERN Document Server

    Aaij, Roel; Adinolfi, Marco; Affolder, Anthony; Ajaltouni, Ziad; Akar, Simon; Albrecht, Johannes; Alessio, Federico; Alexander, Michael; Ali, Suvayu; Alkhazov, Georgy; Alvarez Cartelle, Paula; Alves Jr, Antonio Augusto; Amato, Sandra; Amerio, Silvia; Amhis, Yasmine; An, Liupan; Anderlini, Lucio; Anderson, Jonathan; Andreassen, Rolf; Andreotti, Mirco; Andrews, Jason; Appleby, Robert; Aquines Gutierrez, Osvaldo; Archilli, Flavio; Artamonov, Alexander; Artuso, Marina; Aslanides, Elie; Auriemma, Giulio; Baalouch, Marouen; Bachmann, Sebastian; Back, John; Badalov, Alexey; Baesso, Clarissa; Baldini, Wander; Barlow, Roger; Barschel, Colin; Barsuk, Sergey; Barter, William; Batozskaya, Varvara; Battista, Vincenzo; Bay, Aurelio; Beaucourt, Leo; Beddow, John; Bedeschi, Franco; Bediaga, Ignacio; Belogurov, Sergey; Belous, Konstantin; Belyaev, Ivan; Ben-Haim, Eli; Bencivenni, Giovanni; Benson, Sean; Benton, Jack; Berezhnoy, Alexander; Bernet, Roland; Bettler, Marc-Olivier; van Beuzekom, Martinus; Bien, Alexander; Bifani, Simone; Bird, Thomas; Bizzeti, Andrea; Bjørnstad, Pål Marius; Blake, Thomas; Blanc, Frédéric; Blouw, Johan; Blusk, Steven; Bocci, Valerio; Bondar, Alexander; Bondar, Nikolay; Bonivento, Walter; Borghi, Silvia; Borgia, Alessandra; Borsato, Martino; Bowcock, Themistocles; Bowen, Espen Eie; Bozzi, Concezio; Brambach, Tobias; van den Brand, Johannes; Bressieux, Joël; Brett, David; Britsch, Markward; Britton, Thomas; Brodzicka, Jolanta; Brook, Nicholas; Brown, Henry; Bursche, Albert; Busetto, Giovanni; Buytaert, Jan; Cadeddu, Sandro; Calabrese, Roberto; Calvi, Marta; Calvo Gomez, Miriam; Campana, Pierluigi; Campora Perez, Daniel; Carbone, Angelo; Carboni, Giovanni; Cardinale, Roberta; Cardini, Alessandro; Carson, Laurence; Carvalho Akiba, Kazuyoshi; Casse, Gianluigi; Cassina, Lorenzo; Castillo Garcia, Lucia; Cattaneo, Marco; Cauet, Christophe; Cenci, Riccardo; Charles, Matthew; Charpentier, Philippe; Chefdeville, Maximilien; Chen, Shanzhen; Cheung, Shu-Faye; Chiapolini, Nicola; Chrzaszcz, Marcin; Ciba, Krzystof; Cid Vidal, Xabier; Ciezarek, Gregory; Clarke, Peter; Clemencic, Marco; Cliff, Harry; Closier, Joel; Coco, Victor; Cogan, Julien; Cogneras, Eric; Cojocariu, Lucian; Collins, Paula; Comerma-Montells, Albert; Contu, Andrea; Cook, Andrew; Coombes, Matthew; Coquereau, Samuel; Corti, Gloria; Corvo, Marco; Counts, Ian; Couturier, Benjamin; Cowan, Greig; Craik, Daniel Charles; Cruz Torres, Melissa Maria; Cunliffe, Samuel; Currie, Robert; D'Ambrosio, Carmelo; Dalseno, Jeremy; David, Pascal; David, Pieter; Davis, Adam; De Bruyn, Kristof; De Capua, Stefano; De Cian, Michel; De Miranda, Jussara; De Paula, Leandro; De Silva, Weeraddana; De Simone, Patrizia; Decamp, Daniel; Deckenhoff, Mirko; Del Buono, Luigi; Déléage, Nicolas; Derkach, Denis; Deschamps, Olivier; Dettori, Francesco; Di Canto, Angelo; Dijkstra, Hans; Donleavy, Stephanie; Dordei, Francesca; Dorigo, Mirco; Dosil Suárez, Alvaro; Dossett, David; Dovbnya, Anatoliy; Dreimanis, Karlis; Dujany, Giulio; Dupertuis, Frederic; Durante, Paolo; Dzhelyadin, Rustem; Dziurda, Agnieszka; Dzyuba, Alexey; Easo, Sajan; Egede, Ulrik; Egorychev, Victor; Eidelman, Semen; Eisenhardt, Stephan; Eitschberger, Ulrich; Ekelhof, Robert; Eklund, Lars; El Rifai, Ibrahim; Elsasser, Christian; Ely, Scott; Esen, Sevda; Evans, Hannah Mary; Evans, Timothy; Falabella, Antonio; Färber, Christian; Farinelli, Chiara; Farley, Nathanael; Farry, Stephen; Fay, Robert; Ferguson, Dianne; Fernandez Albor, Victor; Ferreira Rodrigues, Fernando; Ferro-Luzzi, Massimiliano; Filippov, Sergey; Fiore, Marco; Fiorini, Massimiliano; Firlej, Miroslaw; Fitzpatrick, Conor; Fiutowski, Tomasz; Fontana, Marianna; Fontanelli, Flavio; Forty, Roger; Francisco, Oscar; Frank, Markus; Frei, Christoph; Frosini, Maddalena; Fu, Jinlin; Furfaro, Emiliano; Gallas Torreira, Abraham; Galli, Domenico; Gallorini, Stefano; Gambetta, Silvia; Gandelman, Miriam; Gandini, Paolo; Gao, Yuanning; García Pardiñas, Julián; Garofoli, Justin; Garra Tico, Jordi; Garrido, Lluis; Gaspar, Clara; Gauld, Rhorry; Gavardi, Laura; Gavrilov, Gennadii; Geraci, Angelo; Gersabeck, Evelina; Gersabeck, Marco; Gershon, Timothy; Ghez, Philippe; Gianelle, Alessio; Gianì, Sebastiana; Gibson, Valerie; Giubega, Lavinia-Helena; Gligorov, V.V.; Göbel, Carla; Golubkov, Dmitry; Golutvin, Andrey; Gomes, Alvaro; Gotti, Claudio; Grabalosa Gándara, Marc; Graciani Diaz, Ricardo; Granado Cardoso, Luis Alberto; Graugés, Eugeni; Graziani, Giacomo; Grecu, Alexandru; Greening, Edward; Gregson, Sam; Griffith, Peter; Grillo, Lucia; Grünberg, Oliver; Gui, Bin; Gushchin, Evgeny; Guz, Yury; Gys, Thierry; Hadjivasiliou, Christos; Haefeli, Guido; Haen, Christophe; Haines, Susan; Hall, Samuel; Hamilton, Brian; Hampson, Thomas; Han, Xiaoxue; Hansmann-Menzemer, Stephanie; Harnew, Neville; Harnew, Samuel; Harrison, Jonathan; He, Jibo; Head, Timothy; Heijne, Veerle; Hennessy, Karol; Henrard, Pierre; Henry, Louis; Hernando Morata, Jose Angel; van Herwijnen, Eric; Heß, Miriam; Hicheur, Adlène; Hill, Donal; Hoballah, Mostafa; Hombach, Christoph; Hulsbergen, Wouter; Hunt, Philip; Hussain, Nazim; Hutchcroft, David; Hynds, Daniel; Idzik, Marek; Ilten, Philip; Jacobsson, Richard; Jaeger, Andreas; Jalocha, Pawel; Jans, Eddy; Jaton, Pierre; Jawahery, Abolhassan; Jing, Fanfan; John, Malcolm; Johnson, Daniel; Jones, Christopher; Joram, Christian; Jost, Beat; Jurik, Nathan; Kandybei, Sergii; Kanso, Walaa; Karacson, Matthias; Karbach, Moritz; Karodia, Sarah; Kelsey, Matthew; Kenyon, Ian; Ketel, Tjeerd; Khanji, Basem; Khurewathanakul, Chitsanu; Klaver, Suzanne; Klimaszewski, Konrad; Kochebina, Olga; Kolpin, Michael; Komarov, Ilya; Koopman, Rose; Koppenburg, Patrick; Korolev, Mikhail; Kozlinskiy, Alexandr; Kravchuk, Leonid; Kreplin, Katharina; Kreps, Michal; Krocker, Georg; Krokovny, Pavel; Kruse, Florian; Kucewicz, Wojciech; Kucharczyk, Marcin; Kudryavtsev, Vasily; Kurek, Krzysztof; Kvaratskheliya, Tengiz; La Thi, Viet Nga; Lacarrere, Daniel; Lafferty, George; Lai, Adriano; Lambert, Dean; Lambert, Robert W; Lanfranchi, Gaia; Langenbruch, Christoph; Langhans, Benedikt; Latham, Thomas; Lazzeroni, Cristina; Le Gac, Renaud; van Leerdam, Jeroen; Lees, Jean-Pierre; Lefèvre, Regis; Leflat, Alexander; Lefrançois, Jacques; Leo, Sabato; Leroy, Olivier; Lesiak, Tadeusz; Lespinasse, Mickael; Leverington, Blake; Li, Yiming; Likhomanenko, Tatiana; Liles, Myfanwy; Lindner, Rolf; Linn, Christian; Lionetto, Federica; Liu, Bo; Lohn, Stefan; Longstaff, Iain; Lopes, Jose; Lopez-March, Neus; Lowdon, Peter; Lu, Haiting; Lucchesi, Donatella; Luo, Haofei; Lupato, Anna; Luppi, Eleonora; Lupton, Oliver; Machefert, Frederic; Machikhiliyan, Irina V; Maciuc, Florin; Maev, Oleg; Malde, Sneha; Malinin, Alexander; Manca, Giulia; Mancinelli, Giampiero; Mapelli, Alessandro; Maratas, Jan; Marchand, Jean François; Marconi, Umberto; Marin Benito, Carla; Marino, Pietro; Märki, Raphael; Marks, Jörg; Martellotti, Giuseppe; Martens, Aurelien; Martín Sánchez, Alexandra; Martinelli, Maurizio; Martinez Santos, Diego; Martinez Vidal, Fernando; Martins Tostes, Danielle; Massafferri, André; Matev, Rosen; Mathe, Zoltan; Matteuzzi, Clara; Mazurov, Alexander; McCann, Michael; McCarthy, James; McNab, Andrew; McNulty, Ronan; McSkelly, Ben; Meadows, Brian; Meier, Frank; Meissner, Marco; Merk, Marcel; Milanes, Diego Alejandro; Minard, Marie-Noelle; Moggi, Niccolò; Molina Rodriguez, Josue; Monteil, Stephane; Morandin, Mauro; Morawski, Piotr; Mordà, Alessandro; Morello, Michael Joseph; Moron, Jakub; Morris, Adam Benjamin; Mountain, Raymond; Muheim, Franz; Müller, Katharina; Mussini, Manuel; Muster, Bastien; Naik, Paras; Nakada, Tatsuya; Nandakumar, Raja; Nasteva, Irina; Needham, Matthew; Neri, Nicola; Neubert, Sebastian; Neufeld, Niko; Neuner, Max; Nguyen, Anh Duc; Nguyen, Thi-Dung; Nguyen-Mau, Chung; Nicol, Michelle; Niess, Valentin; Niet, Ramon; Nikitin, Nikolay; Nikodem, Thomas; Novoselov, Alexey; O'Hanlon, Daniel Patrick; Oblakowska-Mucha, Agnieszka; Obraztsov, Vladimir; Oggero, Serena; Ogilvy, Stephen; Okhrimenko, Oleksandr; Oldeman, Rudolf; Onderwater, Gerco; Orlandea, Marius; Otalora Goicochea, Juan Martin; Owen, Patrick; Oyanguren, Maria Arantza; Pal, Bilas Kanti; Palano, Antimo; Palombo, Fernando; Palutan, Matteo; Panman, Jacob; Papanestis, Antonios; Pappagallo, Marco; Pappalardo, Luciano; Parkes, Christopher; Parkinson, Christopher John; Passaleva, Giovanni; Patel, Girish; Patel, Mitesh; Patrignani, Claudia; Pearce, Alex; Pellegrino, Antonio; Pepe Altarelli, Monica; Perazzini, Stefano; Perret, Pascal; Perrin-Terrin, Mathieu; Pescatore, Luca; Pesen, Erhan; Petridis, Konstantin; Petrolini, Alessandro; Picatoste Olloqui, Eduardo; Pietrzyk, Boleslaw; Pilař, Tomas; Pinci, Davide; Pistone, Alessandro; Playfer, Stephen; Plo Casasus, Maximo; Polci, Francesco; Poluektov, Anton; Polycarpo, Erica; Popov, Alexander; Popov, Dmitry; Popovici, Bogdan; Potterat, Cédric; Price, Eugenia; Prisciandaro, Jessica; Pritchard, Adrian; Prouve, Claire; Pugatch, Valery; Puig Navarro, Albert; Punzi, Giovanni; Qian, Wenbin; Rachwal, Bartolomiej; Rademacker, Jonas; Rakotomiaramanana, Barinjaka; Rama, Matteo; Rangel, Murilo; Raniuk, Iurii; Rauschmayr, Nathalie; Raven, Gerhard; Reichert, Stefanie; Reid, Matthew; dos Reis, Alberto; Ricciardi, Stefania; Richards, Sophie; Rihl, Mariana; Rinnert, Kurt; Rives Molina, Vincente; Roa Romero, Diego; Robbe, Patrick; Rodrigues, Ana Barbara; Rodrigues, Eduardo; Rodriguez Perez, Pablo; Roiser, Stefan; Romanovsky, Vladimir; Romero Vidal, Antonio; Rotondo, Marcello; Rouvinet, Julien; Ruf, Thomas; Ruiz, Hugo; Ruiz Valls, Pablo; Saborido Silva, Juan Jose; Sagidova, Naylya; Sail, Paul; Saitta, Biagio; Salustino Guimaraes, Valdir; Sanchez Mayordomo, Carlos; Sanmartin Sedes, Brais; Santacesaria, Roberta; Santamarina Rios, Cibran; Santovetti, Emanuele; Sarti, Alessio; Satriano, Celestina; Satta, Alessia; Saunders, Daniel Martin; Savrina, Darya; Schiller, Manuel; Schindler, Heinrich; Schlupp, Maximilian; Schmelling, Michael; Schmidt, Burkhard; Schneider, Olivier; Schopper, Andreas; Schune, Marie Helene; Schwemmer, Rainer; Sciascia, Barbara; Sciubba, Adalberto; Semennikov, Alexander; Sepp, Indrek; Serra, Nicola; Serrano, Justine; Sestini, Lorenzo; Seyfert, Paul; Shapkin, Mikhail; Shapoval, Illya; Shcheglov, Yury; Shears, Tara; Shekhtman, Lev; Shevchenko, Vladimir; Shires, Alexander; Silva Coutinho, Rafael; Simi, Gabriele; Sirendi, Marek; Skidmore, Nicola; Skwarnicki, Tomasz; Smith, Anthony; Smith, Edmund; Smith, Eluned; Smith, Jackson; Smith, Mark; Snoek, Hella; Sokoloff, Michael; Soler, Paul; Soomro, Fatima; Souza, Daniel; Souza De Paula, Bruno; Spaan, Bernhard; Sparkes, Ailsa; Spradlin, Patrick; Sridharan, Srikanth; Stagni, Federico; Stahl, Marian; Stahl, Sascha; Steinkamp, Olaf; Stenyakin, Oleg; Stevenson, Scott; Stoica, Sabin; Stone, Sheldon; Storaci, Barbara; Stracka, Simone; Straticiuc, Mihai; Straumann, Ulrich; Stroili, Roberto; Subbiah, Vijay Kartik; Sun, Liang; Sutcliffe, William; Swientek, Krzysztof; Swientek, Stefan; Syropoulos, Vasileios; Szczekowski, Marek; Szczypka, Paul; Szumlak, Tomasz; T'Jampens, Stephane; Teklishyn, Maksym; Tellarini, Giulia; Teubert, Frederic; Thomas, Christopher; Thomas, Eric; van Tilburg, Jeroen; Tisserand, Vincent; Tobin, Mark; Tolk, Siim; Tomassetti, Luca; Tonelli, Diego; Topp-Joergensen, Stig; Torr, Nicholas; Tournefier, Edwige; Tourneur, Stephane; Tran, Minh Tâm; Tresch, Marco; Trisovic, Ana; Tsaregorodtsev, Andrei; Tsopelas, Panagiotis; Tuning, Niels; Ubeda Garcia, Mario; Ukleja, Artur; Ustyuzhanin, Andrey; Uwer, Ulrich; Vagnoni, Vincenzo; Valenti, Giovanni; Vallier, Alexis; Vazquez Gomez, Ricardo; Vazquez Regueiro, Pablo; Vázquez Sierra, Carlos; Vecchi, Stefania; Velthuis, Jaap; Veltri, Michele; Veneziano, Giovanni; Vesterinen, Mika; Viaud, Benoit; Vieira, Daniel; Vieites Diaz, Maria; Vilasis-Cardona, Xavier; Vollhardt, Achim; Volyanskyy, Dmytro; Voong, David; Vorobyev, Alexey; Vorobyev, Vitaly; Voß, Christian; de Vries, Jacco; Waldi, Roland; Wallace, Charlotte; Wallace, Ronan; Walsh, John; Wandernoth, Sebastian; Wang, Jianchun; Ward, David; Watson, Nigel; Websdale, David; Whitehead, Mark; Wicht, Jean; Wiedner, Dirk; Wilkinson, Guy; Williams, Matthew; Williams, Mike; Wilson, Fergus; Wimberley, Jack; Wishahi, Julian; Wislicki, Wojciech; Witek, Mariusz; Wormser, Guy; Wotton, Stephen; Wright, Simon; Wu, Suzhi; Wyllie, Kenneth; Xie, Yuehong; Xing, Zhou; Xu, Zhirui; Yang, Zhenwei; Yuan, Xuhao; Yushchenko, Oleg; Zangoli, Maria; Zavertyaev, Mikhail; Zhang, Liming; Zhang, Wen Chao; Zhang, Yanxi; Zhelezov, Alexey; Zhokhov, Anatoly; Zhong, Liang; Zvyagin, Alexander

    2014-10-14

    The production of $\\chi_b$ mesons in proton-proton collisions is studied using a data sample collected by the LHCb detector, at centre-of-mass energies of $\\sqrt{s}=7$ and $8$ TeV and corresponding to an integrated luminosity of 3.0 fb$^{-1}$. The $\\chi_b$ mesons are identified through their decays to $\\Upsilon(1S)\\gamma$ and $\\Upsilon(2S)\\gamma$ using photons that converted to $e^+e^-$ pairs in the detector. The $\\chi_b(3P)$ meson mass, and the relative prompt production rate of $\\chi_{b1}(1P)$ and $\\chi_{b2}(1P)$ mesons as a function of the $\\Upsilon(1S)$ transverse momentum in the $\\chi_b$ rapidity range 2.0< $y$<4.5, are measured. Assuming a mass splitting between the $\\chi_{b1}(3P)$ and the $\\chi_{b2}(3P)$ states of 10.5 MeV/$c^2$, the mass of the $\\chi_{b1}(3P)$ meson is \\begin{equation*} m(\\chi_{b1}(3P))= 10515.7^{+2.2}_{-3.9}(stat) ^{+1.5}_{-2.1}(syst) MeV/c^2. \\end{equation*}

  2. Production of $\\chi_{c2}$ Mesons in Photon-Photon Collisions at LEP

    CERN Document Server

    Ackerstaff, K.; Allison, John; Altekamp, N.; Anderson, K.J.; Anderson, S.; Arcelli, S.; Asai, S.; Ashby, S.F.; Axen, D.; Azuelos, G.; Ball, A.H.; Barberio, E.; Barlow, Roger J.; Bartoldus, R.; Batley, J.R.; Baumann, S.; Bechtluft, J.; Behnke, T.; Bell, Kenneth Watson; Bella, G.; Bellerive, A.; Bentvelsen, S.; Bethke, S.; Betts, S.; Biebel, O.; Biguzzi, A.; Bird, S.D.; Blobel, V.; Bloodworth, I.J.; Bobinski, M.; Bock, P.; Bohme, J.; Boutemeur, M.; Braibant, S.; Bright-Thomas, P.; Brown, Robert M.; Burckhart, H.J.; Burgard, C.; Burgin, R.; Capiluppi, P.; Carnegie, R.K.; Carter, A.A.; Carter, J.R.; Chang, C.Y.; Charlton, David G.; Chrisman, D.; Ciocca, C.; Clarke, P.E.L.; Clay, E.; Cohen, I.; Conboy, J.E.; Cooke, O.C.; Couyoumtzelis, C.; Coxe, R.L.; Cuffiani, M.; Dado, S.; Dallavalle, G.Marco; Davis, R.; De Jong, S.; del Pozo, L.A.; De Roeck, A.; Desch, K.; Dienes, B.; Dixit, M.S.; Dubbert, J.; Duchovni, E.; Duckeck, G.; Duerdoth, I.P.; Eatough, D.; Estabrooks, P.G.; Etzion, E.; Evans, H.G.; Fabbri, F.; Fanfani, A.; Fanti, M.; Faust, A.A.; Fiedler, F.; Fierro, M.; Fleck, I.; Folman, R.; Furtjes, A.; Futyan, D.I.; Gagnon, P.; Gary, J.W.; Gascon, J.; Gascon-Shotkin, S.M.; Gaycken, G.; Geich-Gimbel, C.; Giacomelli, G.; Giacomelli, P.; Gibson, V.; Gibson, W.R.; Gingrich, D.M.; Glenzinski, D.; Goldberg, J.; Gorn, W.; Grandi, C.; Gross, E.; Grunhaus, J.; Gruwe, M.; Hanson, G.G.; Hansroul, M.; Hapke, M.; Harder, K.; Hargrove, C.K.; Hartmann, C.; Hauschild, M.; Hawkes, C.M.; Hawkings, R.; Hemingway, R.J.; Herndon, M.; Herten, G.; Heuer, R.D.; Hildreth, M.D.; Hill, J.C.; Hillier, S.J.; Hobson, P.R.; Hocker, James Andrew; Homer, R.J.; Honma, A.K.; Horvath, D.; Hossain, K.R.; Howard, R.; Huntemeyer, P.; Igo-Kemenes, P.; Imrie, D.C.; Ishii, K.; Jacob, F.R.; Jawahery, A.; Jeremie, H.; Jimack, M.; Jones, C.R.; Jovanovic, P.; Junk, T.R.; Karlen, D.; Kartvelishvili, V.; Kawagoe, K.; Kawamoto, T.; Kayal, P.I.; Keeler, R.K.; Kellogg, R.G.; Kennedy, B.W.; Klier, A.; Kluth, S.; Kobayashi, T.; Kobel, M.; Koetke, D.S.; Kokott, T.P.; Kolrep, M.; Komamiya, S.; Kowalewski, Robert V.; Kress, T.; Krieger, P.; von Krogh, J.; Kuhl, T.; Kyberd, P.; Lafferty, G.D.; Lanske, D.; Lauber, J.; Lautenschlager, S.R.; Lawson, I.; Layter, J.G.; Lazic, D.; Lee, A.M.; Lellouch, D.; Letts, J.; Levinson, L.; Liebisch, R.; List, B.; Littlewood, C.; Lloyd, A.W.; Lloyd, S.L.; Loebinger, F.K.; Long, G.D.; Losty, M.J.; Ludwig, J.; Lui, D.; Macchiolo, A.; Macpherson, A.; Mader, W.; Mannelli, M.; Marcellini, S.; Markopoulos, C.; Martin, A.J.; Martin, J.P.; Martinez, G.; Mashimo, T.; Mattig, Peter; McDonald, W.John; McKenna, J.; Mckigney, E.A.; McMahon, T.J.; McPherson, R.A.; Meijers, F.; Menke, S.; Merritt, F.S.; Mes, H.; Meyer, J.; Michelini, A.; Mihara, S.; Mikenberg, G.; Miller, D.J.; Mir, R.; Mohr, W.; Montanari, A.; Mori, T.; Nagai, K.; Nakamura, I.; Neal, H.A.; Nellen, B.; Nisius, R.; O'Neale, S.W.; Oakham, F.G.; Odorici, F.; Ogren, H.O.; Oreglia, M.J.; Orito, S.; Palinkas, J.; Pasztor, G.; Pater, J.R.; Patrick, G.N.; Patt, J.; Perez-Ochoa, R.; Petzold, S.; Pfeifenschneider, P.; Pilcher, J.E.; Pinfold, J.; Plane, David E.; Poffenberger, P.; Poli, B.; Polok, J.; Przybycien, M.; Rembser, C.; Rick, H.; Robertson, S.; Robins, S.A.; Rodning, N.; Roney, J.M.; Roscoe, K.; Rossi, A.M.; Rozen, Y.; Runge, K.; Runolfsson, O.; Rust, D.R.; Sachs, K.; Saeki, T.; Sahr, O.; Sang, W.M.; Sarkisian, E.K.G.; Sbarra, C.; Schaile, A.D.; Schaile, O.; Scharf, F.; Scharff-Hansen, P.; Schieck, J.; Schmitt, B.; Schmitt, S.; Schoning, A.; Schroder, Matthias; Schumacher, M.; Schwick, C.; Scott, W.G.; Seuster, R.; Shears, T.G.; Shen, B.C.; Shepherd-Themistocleous, C.H.; Sherwood, P.; Siroli, G.P.; Sittler, A.; Skuja, A.; Smith, A.M.; Snow, G.A.; Sobie, R.; Soldner-Rembold, S.; Sproston, M.; Stahl, A.; Stephens, K.; Steuerer, J.; Stoll, K.; Strom, David M.; Strohmer, R.; Surrow, B.; Talbot, S.D.; Tanaka, S.; Taras, P.; Tarem, S.; Teuscher, R.; Thiergen, M.; Thomson, M.A.; von Torne, E.; Torrence, E.; Towers, S.; Trigger, I.; Trocsanyi, Z.; Tsur, E.; Turcot, A.S.; Turner-Watson, M.F.; Van Kooten, Rick J.; Vannerem, P.; Verzocchi, M.; Voss, H.; Wackerle, F.; Wagner, A.; Ward, C.P.; Ward, D.R.; Watkins, P.M.; Watson, A.T.; Watson, N.K.; Wells, P.S.; Wermes, N.; White, J.S.; Wilson, G.W.; Wilson, J.A.; Wyatt, T.R.; Yamashita, S.; Yekutieli, G.; Zacek, V.; Zer-Zion, D.

    1998-01-01

    We present an observation at LEP of the production of chi_c2 mesons in the collisions of two quasi-real photons using the OPAL detector. The chi_c2 mesons are reconstructed in the decay channel Chi_c2 to J/psi gamma to l+l- gamma (with l= e,mu) using all data taken at e+e- centre-of-mass energies of 91 and 183 GeV, corresponding to integrated luminosities of 167 and 55 pb-1 respectively. The two-photon width of the Chi_2 is determined to be 1.76 +- 0.47 +- 0.37 +- 0.15 keV where the first error is statistical, the second is systematic and the third comes from branching ratio uncertainties.

  3. Measurement of the relative rate of prompt $\\chi_{c0}$, $\\chi_{c1}$ and $\\chi_{c2}$ production at $\\sqrt{s}=7$TeV

    CERN Document Server

    Aaij, R; Adinolfi, M; Adrover, C; Affolder, A; Ajaltouni, Z; Albrecht, J; Alessio, F; Alexander, M; Ali, S; Alkhazov, G; Alvarez Cartelle, P; Alves Jr, A A; Amato, S; Amerio, S; Amhis, Y; Anderlini, L; Anderson, J; Andreassen, R; Andrews, J E; Appleby, R B; Aquines Gutierrez, O; Archilli, F; Artamonov, A; Artuso, M; Aslanides, E; Auriemma, G; Baalouch, M; Bachmann, S; Back, J J; Baesso, C; Balagura, V; Baldini, W; Barlow, R J; Barschel, C; Barsuk, S; Barter, W; Bauer, Th; Bay, A; Beddow, J; Bedeschi, F; Bediaga, I; Belogurov, S; Belous, K; Belyaev, I; Ben-Haim, E; Bencivenni, G; Benson, S; Benton, J; Berezhnoy, A; Bernet, R; Bettler, M -O; van Beuzekom, M; Bien, A; Bifani, S; Bird, T; Bizzeti, A; Bjørnstad, P M; Blake, T; Blanc, F; Blouw, J; Blusk, S; Bocci, V; Bondar, A; Bondar, N; Bonivento, W; Borghi, S; Borgia, A; Bowcock, T J V; Bowen, E; Bozzi, C; Brambach, T; van den Brand, J; Bressieux, J; Brett, D; Britsch, M; Britton, T; Brook, N H; Brown, H; Burducea, I; Bursche, A; Busetto, G; Buytaert, J; Cadeddu, S; Callot, O; Calvi, M; Calvo Gomez, M; Camboni, A; Campana, P; Campora Perez, D; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carranza-Mejia, H; Carson, L; Carvalho Akiba, K; Casse, G; Castillo Garcia, L; Cattaneo, M; Cauet, Ch; Cenci, R; Charles, M; Charpentier, Ph; Chen, P; Chiapolini, N; Chrzaszcz, M; Ciba, K; Cid Vidal, X; Ciezarek, G; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Coca, C; Coco, V; Cogan, J; Cogneras, E; Collins, P; Comerma-Montells, A; Contu, A; Cook, A; Coombes, M; Coquereau, S; Corti, G; Couturier, B; Cowan, G A; Craik, D C; Cunliffe, S; Currie, R; D'Ambrosio, C; David, P; David, P N Y; Davis, A; De Bonis, I; De Bruyn, K; De Capua, S; De Cian, M; De Miranda, J M; De Paula, L; De Silva, W; De Simone, P; Decamp, D; Deckenhoff, M; Del Buono, L; Déléage, N; Derkach, D; Deschamps, O; Dettori, F; Di Canto, A; Dijkstra, H; Dogaru, M; Donleavy, S; Dordei, F; Dosil Suárez, A; Dossett, D; Dovbnya, A; Dupertuis, F; Durante, P; Dzhelyadin, R; Dziurda, A; Dzyuba, A; Easo, S; Egede, U; Egorychev, V; Eidelman, S; van Eijk, D; Eisenhardt, S; Eitschberger, U; Ekelhof, R; Eklund, L; El Rifai, I; Elsasser, Ch; Falabella, A; Färber, C; Fardell, G; Farinelli, C; Farry, S; Fave, V; Ferguson, D; Fernandez Albor, V; Ferreira Rodrigues, F; Ferro-Luzzi, M; Filippov, S; Fiore, M; Fitzpatrick, C; Fontana, M; Fontanelli, F; Forty, R; Francisco, O; Frank, M; Frei, C; Frosini, M; Furcas, S; Furfaro, E; Gallas Torreira, A; Galli, D; Gandelman, M; Gandini, P; Gao, Y; Garofoli, J; Garosi, P; Garra Tico, J; Garrido, L; Gaspar, C; Gauld, R; Gersabeck, E; Gersabeck, M; Gershon, T; Ghez, Ph; Gibson, V; Giubega, L; Gligorov, V V; Göbel, C; Golubkov, D; Golutvin, A; Gomes, A; Gordon, H; Grabalosa Gándara, M; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graziani, G; Grecu, A; Greening, E; Gregson, S; Griffith, P; Grünberg, O; Gui, B; Gushchin, E; Guz, Yu; Gys, T; Hadjivasiliou, C; Haefeli, G; Haen, C; Haines, S C; Hall, S; Hamilton, B; Hampson, T; Hansmann-Menzemer, S; Harnew, N; Harnew, S T; Harrison, J; Hartmann, T; He, J; Head, T; Heijne, V; Hennessy, K; Henrard, P; Hernando Morata, J A; van Herwijnen, E; Hicheur, A; Hicks, E; Hill, D; Hoballah, M; Hombach, C; Hopchev, P; Hulsbergen, W; Hunt, P; Huse, T; Hussain, N; Hutchcroft, D; Hynds, D; Iakovenko, V; Idzik, M; Ilten, P; Jacobsson, R; Jaeger, A; Jans, E; Jaton, P; Jawahery, A; Jing, F; John, M; Johnson, D; Jones, C R; Joram, C; Jost, B; Kaballo, M; Kandybei, S; Kanso, W; Karacson, M; Karbach, T M; Kenyon, I R; Ketel, T; Keune, A; Khanji, B; Kochebina, O; Komarov, I; Koopman, R F; Koppenburg, P; Korolev, M; Kozlinskiy, A; Kravchuk, L; Kreplin, K; Kreps, M; Krocker, G; Krokovny, P; Kruse, F; Kucharczyk, M; Kudryavtsev, V; Kvaratskheliya, T; La Thi, V N; Lacarrere, D; Lafferty, G; Lai, A; Lambert, D; Lambert, R W; Lanciotti, E; Lanfranchi, G; Langenbruch, C; Latham, T; Lazzeroni, C; Le Gac, R; van Leerdam, J; Lees, J -P; Lefèvre, R; Leflat, A; Lefrançois, J; Leo, S; Leroy, O; Lesiak, T; Leverington, B; Li, Y; Li Gioi, L; Liles, M; Lindner, R; Linn, C; Liu, B; Liu, G; Lohn, S; Longstaff, I; Lopes, J H; Lopez-March, N; Lu, H; Lucchesi, D; Luisier, J; Luo, H; Machefert, F; Machikhiliyan, I V; Maciuc, F; Maev, O; Malde, S; Manca, G; Mancinelli, G; Maratas, J; Marconi, U; Märki, R; Marks, J; Martellotti, G; Martens, A; Martín Sánchez, A; Martinelli, M; Martinez Santos, D; Martins Tostes, D; Massafferri, A; Matev, R; Mathe, Z; Matteuzzi, C; Maurice, E; Mazurov, A; Mc Skelly, B; McCarthy, J; McNab, A; McNulty, R; Meadows, B; Meier, F; Meissner, M; Merk, M; Milanes, D A; Minard, M -N; Molina Rodriguez, J; Monteil, S; Moran, D; Morawski, P; Mordà, A; Morello, M J; Mountain, R; Mous, I; Muheim, F; Müller, K; Muresan, R; Muryn, B; Muster, B; Naik, P; Nakada, T; Nandakumar, R; Nasteva, I; Needham, M; Neubert, S; Neufeld, N; Nguyen, A D; Nguyen, T D; Nguyen-Mau, C; Nicol, M; Niess, V; Niet, R; Nikitin, N; Nikodem, T; Nomerotski, A; Novoselov, A; Oblakowska-Mucha, A; Obraztsov, V; Oggero, S; Ogilvy, S; Okhrimenko, O; Oldeman, R; Orlandea, M; Otalora Goicochea, J M; Owen, P; Oyanguren, A; Pal, B K; Palano, A; Palutan, M; Panman, J; Papanestis, A; Pappagallo, M; Parkes, C; Parkinson, C J; Passaleva, G; Patel, G D; Patel, M; Patrick, G N; Patrignani, C; Pavel-Nicorescu, C; Pazos Alvarez, A; Pellegrino, A; Penso, G; Pepe Altarelli, M; Perazzini, S; Perez Trigo, E; Pérez-Calero Yzquierdo, A; Perret, P; Perrin-Terrin, M; Pessina, G; Petridis, K; Petrolini, A; Phan, A; Picatoste Olloqui, E; Pietrzyk, B; Pilař, T; Pinci, D; Playfer, S; Plo Casasus, M; Polci, F; Polok, G; Poluektov, A; Polycarpo, E; Popov, A; Popov, D; Popovici, B; Potterat, C; Powell, A; Prisciandaro, J; Pritchard, A; Prouve, C; Pugatch, V; Puig Navarro, A; Punzi, G; Qian, W; Rademacker, J H; Rakotomiaramanana, B; Rangel, M S; Raniuk, I; Rauschmayr, N; Raven, G; Redford, S; Reid, M M; dos Reis, A C; Ricciardi, S; Richards, A; Rinnert, K; Rives Molina, V; Roa Romero, D A; Robbe, P; Roberts, D A; Rodrigues, E; Rodriguez Perez, P; Roiser, S; Romanovsky, V; Romero Vidal, A; Rouvinet, J; Ruf, T; Ruffini, F; Ruiz, H; Ruiz Valls, P; Sabatino, G; Saborido Silva, J J; Sagidova, N; Sail, P; Saitta, B; Salustino Guimaraes, V; Salzmann, C; Sanmartin Sedes, B; Sannino, M; Santacesaria, R; Santamarina Rios, C; Santovetti, E; Sapunov, M; Sarti, A; Satriano, C; Satta, A; Savrie, M; Savrina, D; Schaack, P; Schiller, M; Schindler, H; Schlupp, M; Schmelling, M; Schmidt, B; Schneider, O; Schopper, A; Schune, M -H; Schwemmer, R; Sciascia, B; Sciubba, A; Seco, M; Semennikov, A; Senderowska, K; Sepp, I; Serra, N; Serrano, J; Seyfert, P; Shapkin, M; Shapoval, I; Shatalov, P; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, O; Shevchenko, V; Shires, A; Silva Coutinho, R; Sirendi, M; Skwarnicki, T; Smith, N A; Smith, E; Smith, J; Smith, M; Sokoloff, M D; Soler, F J P; Soomro, F; Souza, D; Souza De Paula, B; Spaan, B; Sparkes, A; Spradlin, P; Stagni, F; Stahl, S; Steinkamp, O; Stevenson, S; Stoica, S; Stone, S; Storaci, B; Straticiuc, M; Straumann, U; Subbiah, V K; Sun, L; Swientek, S; Syropoulos, V; Szczekowski, M; Szczypka, P; Szumlak, T; T'Jampens, S; Teklishyn, M; Teodorescu, E; Teubert, F; Thomas, C; Thomas, E; van Tilburg, J; Tisserand, V; Tobin, M; Tolk, S; Tonelli, D; Topp-Joergensen, S; Torr, N; Tournefier, E; Tourneur, S; Tran, M T; Tresch, M; Tsaregorodtsev, A; Tsopelas, P; Tuning, N; Ubeda Garcia, M; Ukleja, A; Urner, D; Ustyuzhanin, A; Uwer, U; Vagnoni, V; Valenti, G; Vallier, A; Van Dijk, M; Vazquez Gomez, R; Vazquez Regueiro, P; Vázquez Sierra, C; Vecchi, S; Velthuis, J J; Veltri, M; Veneziano, G; Vesterinen, M; Viaud, B; Vieira, D; Vilasis-Cardona, X; Vollhardt, A; Volyanskyy, D; Voong, D; Vorobyev, A; Vorobyev, V; Voß, C; Voss, H; Waldi, R; Wallace, C; Wallace, R; Wandernoth, S; Wang, J; Ward, D R; Watson, N K; Webber, A D; Websdale, D; Whitehead, M; Wicht, J; Wiechczynski, J; Wiedner, D; Wiggers, L; Wilkinson, G; Williams, M P; Williams, M; Wilson, F F; Wimberley, J; Wishahi, J; Witek, M; Wotton, S A; Wright, S; Wu, S; Wyllie, K; Xie, Y; Xing, Z; Yang, Z; Young, R; Yuan, X; Yushchenko, O; Zangoli, M; Zavertyaev, M; Zhang, F; Zhang, L; Zhang, W C; Zhang, Y; Zhelezov, A; Zhokhov, A; Zhong, L; Zvyagin, A

    2013-01-01

    Prompt production of charmonium $\\chi_{c0}$, $\\chi_{c1}$ and $\\chi_{c2}$ mesons is studied using proton-proton collisions at the LHC at a centre-of-mass energy of $\\sqrt{s}=7$TeV. The $\\chi_{c}$ mesons are identified through their decay to $J/\\psi\\gamma$, with $J/\\psi\\rightarrow\\mu^+mu^-$ using photons that converted in the detector. A data sample, corresponding to an integrated luminosity of $1.0\\mathrm{fb}^{-1}$ collected by the LHCb detector, is used to measure the relative prompt production rate of $\\chi_{c1}$ and $\\chi_{c2}$ in the rapidity range $2.0chi_{c0}$ meson production at a hadron collider is also presented.

  4. Observation of chi(c1) Decays into Vector Meson Pairs phi phi, omega omega, and omega phi

    NARCIS (Netherlands)

    Ablikim, M.; Achasov, M. N.; An, L.; An, Q.; An, Z. H.; Bai, J. Z.; Baldini, R.; Ban, Y.; Becker, J.; Berger, N.; Bertani, M.; Bian, J. M.; Bondarenko, O.; Boyko, I.; Briere, R. A.; Bytev, V.; Cai, X.; Cao, G. F.; Cao, X. X.; Chang, J. F.; Chelkov, G.; Chen, G.; Chen, H. S.; Chen, J. C.; Chen, M. L.; Chen, S. J.; Chen, Y.; Chen, Y. B.; Cheng, H. P.; Chu, Y. P.; Cronin-Hennessy, D.; Dai, H. L.; Dai, J. P.; Dedovich, D.; Deng, Z. Y.; Denysenko, I.; Destefanis, M.; Ding, Y.; Dong, L. Y.; Dong, M. Y.; Du, S. X.; Duan, M. Y.; Fan, R. R.; Fang, J.; Fang, S. S.; Feng, C. Q.; Fu, C. D.; Fu, J. L.; Gao, Y.; Geng, C.; Goetzen, K.; Gong, W. X.; Greco, M.; Grishin, S.; Gu, M. H.; Gu, Y. T.; Guan, Y. H.; Guo, A. Q.; Guo, L. B.; Guo, Y. P.; Hao, X. Q.; Harris, F. A.; He, K. L.; He, M.; He, Z. Y.; Heng, Y. K.; Hou, Z. L.; Hu, H. M.; Hu, J. F.; Hu, T.; Huang, B.; Huang, G. M.; Huang, J. S.; Huang, X. T.; Huang, Y. P.; Hussain, T.; Ji, C. S.; Ji, Q.; Ji, X. B.; Ji, X. L.; Jia, L. K.; Jiang, L. L.; Jiang, X. S.; Jiao, J. B.; Jiao, Z.; Jin, D. P.; Jin, S.; Jing, F. F.; Kavatsyuk, M.; Komamiya, S.; Kuehn, W.; Lange, J. S.; Leung, J. K. C.; Li, Cheng; Li, Cui; Li, D. M.; Li, F.; Li, G.; Li, H. B.; Li, J. C.; Li, Lei; Li, N. B.; Li, Q. J.; Li, W. D.; Li, W. G.; Li, X. L.; Li, X. N.; Li, X. Q.; Li, X. R.; Li, Z. B.; Liang, H.; Liang, Y. F.; Liang, Y. T.; Liao, G. R.; Liao, X. T.; Liu, B. J.; Liu, B. J.; Liu, C. L.; Liu, C. X.; Liu, C. Y.; Liu, F. H.; Liu, Fang; Liu, Feng; Liu, G. C.; Liu, H.; Liu, H. B.; Liu, H. M.; Liu, H. W.; Liu, J. P.; Liu, K.; Liu, K. Y.; Liu, Q.; Liu, S. B.; Liu, X.; Liu, X. H.; Liu, Y. B.; Liu, Y. W.; Liu, Yong; Liu, Z. A.; Liu, Z. Q.; Loehner, H.; Lu, G. R.; Lu, H. J.; Lu, J. G.; Lu, Q. W.; Lu, X. R.; Lu, Y. P.; Luo, C. L.; Luo, M. X.; Luo, T.; Luo, X. L.; Ma, C. L.; Ma, F. C.; Ma, H. L.; Ma, Q. M.; Ma, T.; Ma, X.; Ma, X. Y.; Maggiora, M.; Malik, Q. A.; Mao, H.; Mao, Y. J.; Mao, Z. P.; Messchendorp, J. G.; Min, J.; Mitchell, R. E.; Mo, X. H.; Muchnoi, N. Yu.; Nefedov, Y.; Ning, Z.; Olsen, S. L.; Ouyang, Q.; Pacetti, S.; Pelizaeus, M.; Peters, K.; Ping, J. L.; Ping, R. G.; Poling, R.; Pun, C. S. J.; Qi, M.; Qian, S.; Qiao, C. F.; Qin, X. S.; Qiu, J. F.; Rashid, K. H.; Rong, G.; Ruan, X. D.; Sarantsev, A.; Schulze, J.; Shao, M.; Shen, C. P.; Shen, X. Y.; Sheng, H. Y.; Shepherd, M. R.; Song, X. Y.; Sonoda, S.; Spataro, S.; Spruck, B.; Sun, D. H.; Sun, G. X.; Sun, J. F.; Sun, S. S.; Sun, X. D.; Sun, Y. J.; Sun, Y. Z.; Sun, Z. J.; Sun, Z. T.; Tang, C. J.; Tang, X.; Tang, X. F.; Tian, H. L.; Toth, D.; Varner, G. S.; Wan, X.; Wang, B. Q.; Wang, K.; Wang, L. L.; Wang, L. S.; Wang, M.; Wang, P.; Wang, P. L.; Wang, Q.; Wang, S. G.; Wang, X. L.; Wang, Y. D.; Wang, Y. F.; Wang, Y. Q.; Wang, Z.; Wang, Z. G.; Wang, Z. Y.; Wei, D. H.; Wen, Q. G.; Wen, S. P.; Wiedner, U.; Wu, L. H.; Wu, N.; Wu, W.; Wu, Z.; Xiao, Z. J.; Xie, Y. G.; Xu, G. F.; Xu, G. M.; Xu, H.; Xu, Y.; Xu, Z. R.; Xu, Z. Z.; Xue, Z.; Yan, L.; Yan, W. B.; Yan, Y. H.; Yang, H. X.; Yang, M.; Yang, T.; Yang, Y.; Yang, Y. X.; Ye, M.; Ye, M. H.; Yu, B. X.; Yu, C. X.; Yu, L.; Yuan, C. Z.; Yuan, W. L.; Yuan, Y.; Zafar, A. A.; Zallo, A.; Zeng, Y.; Zhang, B. X.; Zhang, B. Y.; Zhang, C. C.; Zhang, D. H.; Zhang, H. H.; Zhang, H. Y.; Zhang, J.; Zhang, J. W.; Zhang, J. Y.; Zhang, J. Z.; Zhang, L.; Zhang, S. H.; Zhang, T. R.; Zhang, X. J.; Zhang, X. Y.; Zhang, Y.; Zhang, Y. H.; Zhang, Z. P.; Zhang, Z. Y.; Zhao, G.; Zhao, H. S.; Zhao, Jiawei; Zhao, Jingwei; Zhao, Lei; Zhao, Ling; Zhao, M. G.; Zhao, Q.; Zhao, S. J.; Zhao, T. C.; Zhao, X. H.; Zhao, Y. B.; Zhao, Z. G.; Zhao, Z. L.; Zhemchugov, A.; Zheng, B.; Zheng, J. P.; Zheng, Y. H.; Zheng, Z. P.; Zhong, B.; Zhong, J.; Zhong, L.; Zhou, L.; Zhou, X. K.; Zhou, X. R.; Zhu, C.; Zhu, K.; Zhu, K. J.; Zhu, S. H.; Zhu, X. L.; Zhu, X. W.; Zhu, Y. S.; Zhu, Z. A.; Zhuang, J.; Zou, B. S.; Zou, J. H.; Zuo, J. X.; Zweber, P.

    2011-01-01

    Using (106 +/- 4) x 10(6) psi(3686) events accumulated with the BESIII detector at the BEPCII e(+) e(-) collider, we present the first measurement of decays of chi(c1) to vector meson pairs phi phi, omega omega, and omega phi. The branching fractions are measured to be (4.4 +/- 0.3 +/- 0.5) x

  5. Measurement of the cross-section ratio $\\sigma(\\chi_{c2})/\\sigma(\\chi_{c1})$ for prompt $\\chi_c$ production at $\\sqrt{s}=7$ TeV

    CERN Document Server

    INSPIRE-00258707; Abellan Beteta, C.; Adeva, B.; Adinolfi, M.; Adrover, C.; Affolder, A.; Ajaltouni, Z.; Albrecht, J.; Alessio, F.; Alexander, M.; Alkhazov, G.; Alvarez Cartelle, P.; Alves Jr, A.A.; Amato, S.; Amhis, Y.; Anderson, J.; Appleby, R.B.; Aquines Gutierrez, O.; Archilli, F.; Arrabito, L.; Artamonov, A.; Artuso, M.; Aslanides, E.; Auriemma, G.; Bachmann, S.; Back, J.J.; Bailey, D.S.; Balagura, V.; Baldini, W.; Barlow, R.J.; Barschel, C.; Barsuk, S.; Barter, W.; Bates, A.; Bauer, C.; Bauer, Th.; Bay, A.; Bediaga, I.; Belogurov, S.; Belous, K.; Belyaev, I.; Ben-Haim, E.; Benayoun, M.; Bencivenni, G.; Benson, S.; Benton, J.; Bernet, R.; Bettler, M.O.; van Beuzekom, M.; Bien, A.; Bifani, S.; Bird, T.; Bizzeti, A.; Bjornstad, P.M.; Blake, T.; Blanc, F.; Blanks, C.; Blouw, J.; Blusk, S.; Bobrov, A.; Bocci, V.; Bondar, A.; Bondar, N.; Bonivento, W.; Borghi, S.; Borgia, A.; Bowcock, T.J.V.; Bozzi, C.; Brambach, T.; van den Brand, J.; Bressieux, J.; Brett, D.; Britsch, M.; Britton, T.; Brook, N.H.; Brown, H.; Buchler-Germann, A.; Burducea, I.; Bursche, A.; Buytaert, J.; Cadeddu, S.; Callot, O.; Calvi, M.; Calvo Gomez, M.; Camboni, A.; Campana, P.; Carbone, A.; Carboni, G.; Cardinale, R.; Cardini, A.; Carson, L.; Carvalho Akiba, K.; Casse, G.; Cattaneo, M.; Cauet, Ch.; Charles, M.; Charpentier, Ph.; Chiapolini, N.; Ciba, K.; Cid Vidal, X.; Ciezarek, G.; Clarke, P.E.L.; Clemencic, M.; Cliff, H.V.; Closier, J.; Coca, C.; Coco, V.; Cogan, J.; Collins, P.; Comerma-Montells, A.; Constantin, F.; Conti, G.; Contu, A.; Cook, A.; Coombes, M.; Corti, G.; Cowan, G.A.; Currie, R.; D'Almagne, B.; D'Ambrosio, C.; David, P.; David, P.N.Y.; De Bonis, I.; De Capua, S.; De Cian, M.; De Lorenzi, F.; de Miranda, J.M.; De Paula, L.; De Simone, P.; Decamp, D.; Deckenhoff, M.; Degaudenzi, H.; Deissenroth, M.; Del Buono, L.; Deplano, C.; Derkach, D.; Deschamps, O.; Dettori, F.; Dickens, J.; Dijkstra, H.; Diniz Batista, P.; Bonal, F.Domingo; Donleavy, S.; Dordei, F.; Dosil Suarez, A.; Dossett, D.; Dovbnya, A.; Dupertuis, F.; Dzhelyadin, R.; Dziurda, A.; Easo, S.; Egede, U.; Egorychev, V.; Eidelman, S.; van Eijk, D.; Eisele, F.; Eisenhardt, S.; Ekelhof, R.; Eklund, L.; Elsasser, Ch.; Elsby, D.; Esperante Pereira, D.; Esteve, L.; Falabella, A.; Fanchini, E.; Farber, C.; Fardell, G.; Farinelli, C.; Farry, S.; Fave, V.; Fernandez Albor, V.; Ferro-Luzzi, M.; Filippov, S.; Fitzpatrick, C.; Fontana, M.; Fontanelli, F.; Forty, R.; Frank, M.; Frei, C.; Frosini, M.; Furcas, S.; Gallas Torreira, A.; Galli, D.; Gandelman, M.; Gandini, P.; Gao, Y.; Garnier, J-C.; Garofoli, J.; Garra Tico, J.; Garrido, L.; Gascon, D.; Gaspar, C.; Gauvin, N.; Gersabeck, M.; Gershon, T.; Ghez, Ph.; Gibson, V.; Gligorov, V.V.; Gobel, C.; Golubkov, D.; Golutvin, A.; Gomes, A.; Gordon, H.; Grabalosa Gandara, M.; Graciani Diaz, R.; Granado Cardoso, L.A.; Grauges, E.; Graziani, G.; Grecu, A.; Greening, E.; Gregson, S.; Gui, B.; Gushchin, E.; Guz, Yu.; Gys, T.; Haefeli, G.; Haen, C.; Haines, S.C.; Hampson, T.; Hansmann-Menzemer, S.; Harji, R.; Harnew, N.; Harrison, J.; Harrison, P.F.; He, J.; Heijne, V.; Hennessy, K.; Henrard, P.; Hernando Morata, J.A.; van Herwijnen, E.; Hicks, E.; Holubyev, K.; Hopchev, P.; Hulsbergen, W.; Hunt, P.; Huse, T.; Huston, R.S.; Hutchcroft, D.; Hynds, D.; Iakovenko, V.; Ilten, P.; Imong, J.; Jacobsson, R.; Jaeger, A.; Jahjah Hussein, M.; Jans, E.; Jansen, F.; Jaton, P.; Jean-Marie, B.; Jing, F.; John, M.; Johnson, D.; Jones, C.R.; Jost, B.; Kaballo, M.; Kandybei, S.; Karacson, M.; Karbach, T.M.; Keaveney, J.; Kenyon, I.R.; Kerzel, U.; Ketel, T.; Keune, A.; Khanji, B.; Kim, Y.M.; Knecht, M.; Koppenburg, P.; Kozlinskiy, A.; Kravchuk, L.; Kreplin, K.; Kreps, M.; Krocker, G.; Krokovny, P.; Kruse, F.; Kruzelecki, K.; Kucharczyk, M.; Kvaratskheliya, T.; La Thi, V.N.; Lacarrere, D.; Lafferty, G.; Lai, A.; Lambert, D.; Lambert, R.W.; Lanciotti, E.; Lanfranchi, G.; Langenbruch, C.; Latham, T.; Lazzeroni, C.; Le Gac, R.; van Leerdam, J.; Lees, J.P.; Lefevre, R.; Leflat, A.; Lefrancois, J.; Leroy, O.; Lesiak, T.; Li, L.; Li Gioi, L.; Lieng, M.; Liles, M.; Lindner, R.; Linn, C.; Liu, B.; Liu, G.; Lopes, J.H.; Lopez Asamar, E.; Lopez-March, N.; Lu, H.; Luisier, J.; Raighne, A.Mac; Machefert, F.; Machikhiliyan, I.V.; Maciuc, F.; Maev, O.; Magnin, J.; Malde, S.; Mamunur, R.M.D.; Manca, G.; Mancinelli, G.; Mangiafave, N.; Marconi, U.; Marki, R.; Marks, J.; Martellotti, G.; Martens, A.; Martin, L.; Martin Sanchez, A.; Martinez Santos, D.; Massafferri, A.; Mathe, Z.; Matteuzzi, C.; Matveev, M.; Maurice, E.; Maynard, B.; Mazurov, A.; McGregor, G.; McNulty, R.; Mclean, C.; Meissner, M.; Merk, M.; Merkel, J.; Messi, R.; Miglioranzi, S.; Milanes, D.A.; Minard, M.N.; Molina Rodriguez, J.; Monteil, S.; Moran, D.; Morawski, P.; Mountain, R.; Mous, I.; Muheim, F.; Muller, K.; Muresan, R.; Muryn, B.; Muster, B.; Musy, M.; Mylroie-Smith, J.; Naik, P.; Nakada, T.; Nandakumar, R.; Nasteva, I.; Nedos, M.; Needham, M.; Neufeld, N.; Nguyen-Mau, C.; Nicol, M.; Niess, V.; Nikitin, N.; Nomerotski, A.; Novoselov, A.; Oblakowska-Mucha, A.; Obraztsov, V.; Oggero, S.; Ogilvy, S.; Okhrimenko, O.; Oldeman, R.; Orlandea, M.; Otalora Goicochea, J.M.; Owen, P.; Pal, K.; Palacios, J.; Palano, A.; Palutan, M.; Panman, J.; Papanestis, A.; Pappagallo, M.; Parkes, C.; Parkinson, C.J.; Passaleva, G.; Patel, G.D.; Patel, M.; Paterson, S.K.; Patrick, G.N.; Patrignani, C.; Pavel-Nicorescu, C.; Pazos Alvarez, A.; Pellegrino, A.; Penso, G.; Pepe Altarelli, M.; Perazzini, S.; Perego, D.L.; Perez Trigo, E.; Perez-Calero Yzquierdo, A.; Perret, P.; Perrin-Terrin, M.; Pessina, G.; Petrella, A.; Petrolini, A.; Phan, A.; Picatoste Olloqui, E.; Pie Valls, B.; Pietrzyk, B.; Pilar, T.; Pinci, D.; Plackett, R.; Playfer, S.; Plo Casasus, M.; Polok, G.; Poluektov, A.; Polycarpo, E.; Popov, D.; Popovici, B.; Potterat, C.; Powell, A.; du Pree, T.; Prisciandaro, J.; Pugatch, V.; Puig Navarro, A.; Qian, W.; Rademacker, J.H.; Rakotomiaramanana, B.; Rangel, M.S.; Raniuk, I.; Raven, G.; Redford, S.; Reid, M.M.; dos Reis, A.C.; Ricciardi, S.; Rinnert, K.; Roa Romero, D.A.; Robbe, P.; Rodrigues, E.; Rodrigues, F.; Rodriguez Perez, P.; Rogers, G.J.; Roiser, S.; Romanovsky, V.; Rosello, M.; Rouvinet, J.; Ruf, T.; Ruiz, H.; Sabatino, G.; Saborido Silva, J.J.; Sagidova, N.; Sail, P.; Saitta, B.; Salzmann, C.; Sannino, M.; Santacesaria, R.; Santamarina Rios, C.; Santinelli, R.; Santovetti, E.; Sapunov, M.; Sarti, A.; Satriano, C.; Satta, A.; Savrie, M.; Savrina, D.; Schaack, P.; Schiller, M.; Schleich, S.; Schlupp, M.; Schmelling, M.; Schmidt, B.; Schneider, O.; Schopper, A.; Schune, M.H.; Schwemmer, R.; Sciascia, B.; Sciubba, A.; Seco, M.; Semennikov, A.; Senderowska, K.; Sepp, I.; Serra, N.; Serrano, J.; Seyfert, P.; Shao, B.; Shapkin, M.; Shapoval, I.; Shatalov, P.; Shcheglov, Y.; Shears, T.; Shekhtman, L.; Shevchenko, O.; Shevchenko, V.; Shires, A.; Coutinho, R.Silva; Skwarnicki, T.; Smith, A.C.; Smith, N.A.; Smith, E.; Sobczak, K.; Soler, F.J.P.; Solomin, A.; Soomro, F.; Souza De Paula, B.; Spaan, B.; Sparkes, A.; Spradlin, P.; Stagni, F.; Stahl, S.; Steinkamp, O.; Stoica, S.; Stone, S.; Storaci, B.; Straticiuc, M.; Straumann, U.; Subbiah, V.K.; Swientek, S.; Szczekowski, M.; Szczypka, P.; Szumlak, T.; T'Jampens, S.; Teodorescu, E.; Teubert, F.; Thomas, C.; Thomas, E.; van Tilburg, J.; Tisserand, V.; Tobin, M.; Topp-Joergensen, S.; Torr, N.; Tournefier, E.; Tran, M.T.; Tsaregorodtsev, A.; Tuning, N.; Garcia, M.Ubeda; Ukleja, A.; Urquijo, P.; Uwer, U.; Vagnoni, V.; Valenti, G.; Vazquez Gomez, R.; Vazquez Regueiro, P.; Vecchi, S.; Velthuis, J.J.; Veltri, M.; Viaud, B.; Videau, I.; Vilasis-Cardona, X.; Visniakov, J.; Vollhardt, A.; Volyanskyy, D.; Voong, D.; Vorobyev, A.; Voss, H.; Wandernoth, S.; Wang, J.; Ward, D.R.; Watson, N.K.; Webber, A.D.; Websdale, D.; Whitehead, M.; Wiedner, D.; Wiggers, L.; Wilkinson, G.; Williams, M.P.; Williams, M.; Wilson, F.F.; Wishahi, J.; Witek, M.; Witzeling, W.; Wotton, S.A.; Wyllie, K.; Xie, Y.; Xing, F.; Xing, Z.; Yang, Z.; Young, R.; Yushchenko, O.; Zavertyaev, M.; Zhang, F.; Zhang, L.; Zhang, W.C.; Zhang, Y.; Zhelezov, A.; Zhong, L.; Zverev, E.; Zvyagin, A.

    2013-07-16

    The prompt production of the charmonium $\\chi_{c1}$ and $\\chi_{c2}$ mesons has been studied in proton-proton collisions at the Large Hadron Collider at a centre-of-mass energy of $\\sqrt{s}=7$~TeV. The $\\chi_c$ mesons are identified through their decays $\\chi_c\\,\\rightarrow\\,J/\\psi\\,\\gamma$ with $J/\\psi\\,\\rightarrow\\,\\mu^+\\,\\mu^-$ using 36~$\\mathrm{pb^{-1}}$ of data collected by the LHCb detector in 2010. The ratio of the prompt production cross-sections for the two $\\chi_c$ spin states, $\\sigma(\\chi_{c2})\\,/\\,\\sigma(\\chi_{c1})$, has been determined as a function of the $J/\\psi$ transverse momentum, $p_{\\mathrm{T}}^{J/\\psi}$, in the range from 2 to 15~GeV/$c$. The results are in agreement with the next-to-leading order non-relativistic QCD model at high $p_{\\mathrm{T}}^{J/\\psi}$ and lie consistently above the pure leading-order colour singlet prediction.

  6. Measurement of the cross-section ratio {sigma}({chi}{sub c2})/{sigma}({chi}{sub c1}) for prompt {chi}{sub c} production at {radical}(s)=7 TeV

    Energy Technology Data Exchange (ETDEWEB)

    Aaij, R. [Nikhef National Institute for Subatomic Physics, Amsterdam (Netherlands); Abellan Beteta, C. [Universitat de Barcelona, Barcelona (Spain); Adeva, B. [Universidad de Santiago de Compostela, Santiago de Compostela (Spain); Adinolfi, M. [H.H. Wills Physics Laboratory, University of Bristol, Bristol (United Kingdom); Adrover, C. [CPPM, Aix-Marseille Universite, CNRS/IN2P3, Marseille (France); Affolder, A. [Oliver Lodge Laboratory, University of Liverpool, Liverpool (United Kingdom); Ajaltouni, Z. [Clermont Universite, Universite Blaise Pascal, CNRS/IN2P3, LPC, Clermont-Ferrand (France); Albrecht, J.; Alessio, F. [European Organization for Nuclear Research (CERN), Geneva (Switzerland); Alexander, M. [School of Physics and Astronomy, University of Glasgow, Glasgow (United Kingdom); Alkhazov, G. [Petersburg Nuclear Physics Institute (PNPI), Gatchina (Russian Federation); Alvarez Cartelle, P. [Universidad de Santiago de Compostela, Santiago de Compostela (Spain); Alves, A.A. [Sezione INFN di Roma La Sapienza, Roma (Italy); Amato, S. [Universidade Federal do Rio de Janeiro (UFRJ), Rio de Janeiro (Brazil); Amhis, Y. [Ecole Polytechnique Federale de Lausanne (EPFL), Lausanne (Switzerland); Anderson, J. [Physik-Institut, Universitaet Zuerich, Zuerich (Switzerland); Appleby, R.B. [School of Physics and Astronomy, University of Manchester, Manchester (United Kingdom); Aquines Gutierrez, O. [Max-Planck-Institut fuer Kernphysik (MPIK), Heidelberg (Germany); Archilli, F. [Laboratori Nazionali dell' INFN di Frascati, Frascati (Italy); European Organization for Nuclear Research (CERN), Geneva (Switzerland); Arrabito, L. [CC-IN2P3, CNRS/IN2P3, Lyon-Villeurbanne (France); and others

    2012-08-14

    The prompt production of the charmonium {chi}{sub c1} and {chi}{sub c2} mesons has been studied in proton-proton collisions at the Large Hadron Collider at a centre-of-mass energy of {radical}(s)=7 TeV. The {chi}{sub c} mesons are identified through their decays {chi}{sub c}{yields}J/{psi}{gamma} with J/{psi}{yields}{mu}{sup +}{mu}{sup -} using 36 pb{sup -1} of data collected by the LHCb detector in 2010. The ratio of the prompt production cross-sections for the two {chi}{sub c} spin states, {sigma}({chi}{sub c2})/{sigma}({chi}{sub c1}), has been determined as a function of the J/{psi} transverse momentum, p{sub T}{sup J/{psi}}, in the range from 2 to 15 GeV/c. The results are in agreement with the next-to-leading order non-relativistic QCD model at high p{sub T}{sup J/{psi}} and lie consistently above the pure leading-order colour-singlet prediction.

  7. 24 CFR 3.510 - Recruitment.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Recruitment. 3.510 Section 3.510... Recruitment. (a) Nondiscriminatory recruitment and hiring. A recipient shall not discriminate on the basis of sex in the recruitment and hiring of employees. Where a recipient has been found to be presently...

  8. 7 CFR 29.3510 - Color symbols.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 2 2010-01-01 2010-01-01 false Color symbols. 29.3510 Section 29.3510 Agriculture Regulations of the Department of Agriculture AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing... Type 95) § 29.3510 Color symbols. As applied to Dark Air-cured tobacco, color symbols are L—light brown...

  9. Understanding the branching ratios of \\chi_{c1}\\to\\phi\\phi, \\omega\\omega, \\omega\\phi observed at BES-III

    OpenAIRE

    Chen, Dian-Yong; He, Jun; Li, Xue-Qian; Liu, Xiang

    2009-01-01

    In this work, we discuss the contribution of the mesonic loops to the decay rates of $\\chi_{c1}\\to \\phi\\phi,\\,\\omega\\omega$ which are suppressed by the helicity selection rules and $\\chi_{c1}\\to \\phi\\omega$ which is a double-OZI forbidden process. We find that the mesonic loop effects naturally explain the clear signals of $\\chi_{c1}\\to \\phi\\phi,\\,\\omega\\omega$ decay modes observed by the BES collaboration. Moreover, we investigate the effects of the $\\omega-\\phi$ mixing which may result in t...

  10. Measurement of the fraction of $\\Upsilon(1S)$ originating from $\\chi_b(1P)$ decays in $pp$ collisions at $\\sqrt{s}$ = 7 TeV

    CERN Document Server

    Aaij, R; Adametz, A; Adeva, B; Adinolfi, M; Adrover, C; Affolder, A; Ajaltouni, Z; Albrecht, J; Alessio, F; Alexander, M; Ali, S; Alkhazov, G; Alvarez Cartelle, P; Alves Jr, A A; Amato, S; Amhis, Y; Anderson, J; Appleby, R B; Aquines Gutierrez, O; Archilli, F; Artamonov, A; Artuso, M; Aslanides, E; Auriemma, G; Bachmann, S; Back, J J; Balagura, V; Baldini, W; Barlow, R J; Barschel, C; Barsuk, S; Barter, W; Bates, A; Bauer, C; Bauer, Th; Bay, A; Beddow, J; Bediaga, I; Belogurov, S; Belous, K; Belyaev, I; Ben-Haim, E; Benayoun, M; Bencivenni, G; Benson, S; Benton, J; Bernet, R; Bettler, M -O; van Beuzekom, M; Bien, A; Bifani, S; Bird, T; Bizzeti, A; Bjørnstad, P M; Blake, T; Blanc, F; Blanks, C; Blouw, J; Blusk, S; Bobrov, A; Bocci, V; Bondar, A; Bondar, N; Bonivento, W; Borghi, S; Borgia, A; Bowcock, T J V; Bozzi, C; Brambach, T; van den Brand, J; Bressieux, J; Brett, D; Britsch, M; Britton, T; Brook, N H; Brown, H; Büchler-Germann, A; Burducea, I; Bursche, A; Buytaert, J; Cadeddu, S; Callot, O; Calvi, M; Calvo Gomez, M; Camboni, A; Campana, P; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carson, L; Carvalho Akiba, K; Casse, G; Cattaneo, M; Cauet, Ch; Charles, M; Charpentier, Ph; Chen, P; Chiapolini, N; Chrzaszcz, M; Ciba, K; Cid Vidal, X; Ciezarek, G; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Coca, C; Coco, V; Cogan, J; Cogneras, E; Collins, P; Comerma-Montells, A; Contu, A; Cook, A; Coombes, M; Corti, G; Couturier, B; Cowan, G A; Craik, D; Currie, R; D'Ambrosio, C; David, P; David, P N Y; De Bonis, I; De Bruyn, K; De Capua, S; De Cian, M; De Miranda, J M; De Paula, L; De Simone, P; Decamp, D; Deckenhoff, M; Degaudenzi, H; Del Buono, L; Deplano, C; Derkach, D; Deschamps, O; Dettori, F; Dickens, J; Dijkstra, H; Diniz Batista, P; Domingo Bonal, F; Donleavy, S; Dordei, F; Dosil Suárez, A; Dossett, D; Dovbnya, A; Dupertuis, F; Dzhelyadin, R; Dziurda, A; Dzyuba, A; Easo, S; Egede, U; Egorychev, V; Eidelman, S; van Eijk, D; Eisele, F; Eisenhardt, S; Ekelhof, R; Eklund, L; El Rifai, I; Elsasser, Ch; Elsby, D; Esperante Pereira, D; Falabella, A; Färber, C; Fardell, G; Farinelli, C; Farry, S; Fave, V; Fernandez Albor, V; Ferreira Rodrigues, F; Ferro-Luzzi, M; Filippov, S; Fitzpatrick, C; Fontana, M; Fontanelli, F; Forty, R; Francisco, O; Frank, M; Frei, C; Frosini, M; Furcas, S; Gallas Torreira, A; Galli, D; Gandelman, M; Gandini, P; Gao, Y; Garnier, J-C; Garofoli, J; Garra Tico, J; Garrido, L; Gascon, D; Gaspar, C; Gauld, R; Gauvin, N; Gersabeck, E; Gersabeck, M; Gershon, T; Ghez, Ph; Gibson, V; Gligorov, V V; Göbel, C; Golubkov, D; Golutvin, A; Gomes, A; Gordon, H; Grabalosa Gándara, M; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graziani, G; Grecu, A; Greening, E; Gregson, S; Grünberg, O; Gui, B; Gushchin, E; Guz, Yu; Gys, T; Hadjivasiliou, C; Haefeli, G; Haen, C; Haines, S C; Hampson, T; Hansmann-Menzemer, S; Harnew, N; Harnew, S T; Harrison, J; Harrison, P F; Hartmann, T; He, J; Heijne, V; Hennessy, K; Henrard, P; Hernando Morata, J A; van Herwijnen, E; Hicks, E; Hoballah, M; Hopchev, P; Hulsbergen, W; Hunt, P; Huse, T; Huston, R S; Hutchcroft, D; Hynds, D; Iakovenko, V; Ilten, P; Imong, J; Jacobsson, R; Jaeger, A; Jahjah Hussein, M; Jans, E; Jansen, F; Jaton, P; Jean-Marie, B; Jing, F; John, M; Johnson, D; Jones, C R; Jost, B; Kaballo, M; Kandybei, S; Karacson, M; Karbach, T M; Keaveney, J; Kenyon, I R; Kerzel, U; Ketel, T; Keune, A; Khanji, B; Kim, Y M; Knecht, M; Kochebina, O; Komarov, I; Koopman, R F; Koppenburg, P; Korolev, M; Kozlinskiy, A; Kravchuk, L; Kreplin, K; Kreps, M; Krocker, G; Krokovny, P; Kruse, F; Kucharczyk, M; Kudryavtsev, V; Kvaratskheliya, T; La Thi, V N; Lacarrere, D; Lafferty, G; Lai, A; Lambert, D; Lambert, R W; Lanciotti, E; Lanfranchi, G; Langenbruch, C; Latham, T; Lazzeroni, C; Le Gac, R; van Leerdam, J; Lees, J -P; Lefèvre, R; Leflat, A; Lefrançois, J; Leroy, O; Lesiak, T; Li, L; Li, Y; Li Gioi, L; Lieng, M; Liles, M; Lindner, R; Linn, C; Liu, B; Liu, G; von Loeben, J; Lopes, J H; Lopez Asamar, E; Lopez-March, N; Lu, H; Luisier, J; Mac Raighne, A; Machefert, F; Machikhiliyan, I V; Maciuc, F; Maev, O; Magnin, J; Malde, S; Mamunur, R M D; Manca, G; Mancinelli, G; Mangiafave, N; Marconi, U; Märki, R; Marks, J; Martellotti, G; Martens, A; Martin, L; Martín Sánchez, A; Martinelli, M; Martinez Santos, D; Massafferri, A; Mathe, Z; Matteuzzi, C; Matveev, M; Maurice, E; Mazurov, A; McCarthy, J; McGregor, G; McNulty, R; Meissner, M; Merk, M; Merkel, J; Milanes, D A; Minard, M -N; Molina Rodriguez, J; Monteil, S; Moran, D; Morawski, P; Mountain, R; Mous, I; Muheim, F; Müller, K; Muresan, R; Muryn, B; Muster, B; Mylroie-Smith, J; Naik, P; Nakada, T; Nandakumar, R; Nasteva, I; Needham, M; Neufeld, N; Nguyen, A D; Nguyen-Mau, C; Nicol, M; Niess, V; Nikitin, N; Nikodem, T; Nomerotski, A; Novoselov, A; Oblakowska-Mucha, A; Obraztsov, V; Oggero, S; Ogilvy, S; Okhrimenko, O; Oldeman, R; Orlandea, M; Otalora Goicochea, J M; Owen, P; Pal, B K; Palano, A; Palutan, M; Panman, J; Papanestis, A; Pappagallo, M; Parkes, C; Parkinson, C J; Passaleva, G; Patel, G D; Patel, M; Patrick, G N; Patrignani, C; Pavel-Nicorescu, C; Pazos Alvarez, A; Pellegrino, A; Penso, G; Pepe Altarelli, M; Perazzini, S; Perego, D L; Perez Trigo, E; Pérez-Calero Yzquierdo, A; Perret, P; Perrin-Terrin, M; Pessina, G; Petrolini, A; Phan, A; Picatoste Olloqui, E; Pie Valls, B; Pietrzyk, B; Pilař, T; Pinci, D; Playfer, S; Plo Casasus, M; Polci, F; Polok, G; Poluektov, A; Polycarpo, E; Popov, D; Popovici, B; Potterat, C; Powell, A; Prisciandaro, J; Pugatch, V; Puig Navarro, A; Qian, W; Rademacker, J H; Rakotomiaramanana, B; Rangel, M S; Raniuk, I; Rauschmayr, N; Raven, G; Redford, S; Reid, M M; dos Reis, A C; Ricciardi, S; Richards, A; Rinnert, K; Roa Romero, D A; Robbe, P; Rodrigues, E; Rodrigues, F; Rodriguez Perez, P; Rogers, G J; Roiser, S; Romanovsky, V; Romero Vidal, A; Rosello, M; Rouvinet, J; Ruf, T; Ruiz, H; Sabatino, G; Saborido Silva, J J; Sagidova, N; Sail, P; Saitta, B; Salzmann, C; Sanmartin Sedes, B; Sannino, M; Santacesaria, R; Santamarina Rios, C; Santinelli, R; Santovetti, E; Sapunov, M; Sarti, A; Satriano, C; Satta, A; Savrie, M; Savrina, D; Schaack, P; Schiller, M; Schindler, H; Schleich, S; Schlupp, M; Schmelling, M; Schmidt, B; Schneider, O; Schopper, A; Schune, M -H; Schwemmer, R; Sciascia, B; Sciubba, A; Seco, M; Semennikov, A; Senderowska, K; Sepp, I; Serra, N; Serrano, J; Seyfert, P; Shapkin, M; Shapoval, I; Shatalov, P; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, O; Shevchenko, V; Shires, A; Silva Coutinho, R; Skwarnicki, T; Smith, N A; Smith, E; Smith, M; Sobczak, K; Soler, F J P; Solomin, A; Soomro, F; Souza, D; Souza De Paula, B; Spaan, B; Sparkes, A; Spradlin, P; Stagni, F; Stahl, S; Steinkamp, O; Stoica, S; Stone, S; Storaci, B; Straticiuc, M; Straumann, U; Subbiah, V K; Swientek, S; Szczekowski, M; Szczypka, P; Szumlak, T; T'Jampens, S; Teklishyn, M; Teodorescu, E; Teubert, F; Thomas, C; Thomas, E; van Tilburg, J; Tisserand, V; Tobin, M; Tolk, S; Topp-Joergensen, S; Torr, N; Tournefier, E; Tourneur, S; Tran, M T; Tsaregorodtsev, A; Tuning, N; Ubeda Garcia, M; Ukleja, A; Uwer, U; Vagnoni, V; Valenti, G; Vazquez Gomez, R; Vazquez Regueiro, P; Vecchi, S; Velthuis, J J; Veltri, M; Veneziano, G; Vesterinen, M; Viaud, B; Videau, I; Vieira, D; Vilasis-Cardona, X; Visniakov, J; Vollhardt, A; Volyanskyy, D; Voong, D; Vorobyev, A; Vorobyev, V; Voß, C; Voss, H; Waldi, R; Wallace, R; Wandernoth, S; Wang, J; Ward, D R; Watson, N K; Webber, A D; Websdale, D; Whitehead, M; Wicht, J; Wiedner, D; Wiggers, L; Wilkinson, G; Williams, M P; Williams, M; Wilson, F F; Wishahi, J; Witek, M; Witzeling, W; Wotton, S A; Wright, S; Wu, S; Wyllie, K; Xie, Y; Xing, F; Xing, Z; Yang, Z; Young, R; Yuan, X; Yushchenko, O; Zangoli, M; Zavertyaev, M; Zhang, F; Zhang, L; Zhang, W C; Zhang, Y; Zhelezov, A; Zhong, L; Zvyagin, A

    2012-01-01

    The production of $\\chi_b(1P)$ mesons in $pp$ collisions at a centre-of-mass energy of 7 TeV is studied using 32 pb$^{-1}$ of data collected with the LHCb detector. The $\\chi_b(1P)$ mesons are reconstructed in the decay mode $\\chi_b(1P) \\to \\Upsilon(1S)\\gamma \\to \\mu^+\\mu^-\\gamma$. The fraction of $\\Upsilon(1S)$ originating from $\\chi_b(1P)$ decays in the $\\Upsilon(1S)$ transverse momentum range $6 < p_{\\rm T}^{\\Upsilon(1S)} < 15$ Gev/$c$ and rapidity range $2.0 < y^{\\Upsilon(1S)} < 4.5$ is measured to be $(20.7\\pm 5.7\\pm 2.1^{+2.7}_{-5.4})\\%$, where the first uncertainty is statistical, the second is systematic and the last gives the range of the result due to the unknown $\\Upsilon(1S)$ and $\\chi_b(1P)$ polarizations.

  11. 18 CFR 35.10a - Forms of service agreements.

    Science.gov (United States)

    2010-04-01

    ... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Forms of service agreements. 35.10a Section 35.10a Conservation of Power and Water Resources FEDERAL ENERGY REGULATORY... service agreement for a service other than market-based power sales, the public utility shall include as...

  12. Tensor meson dominance and e+e--physics

    International Nuclear Information System (INIS)

    Genz, H.; Karlsruhe Univ.; Mallik, S.

    1983-01-01

    The phenomenological status of tensor meson dominance is reported. Some new results concerning hadronic decays of the 2 ++ -meson chi 2 (3.55) and the heavy lepton tau are also included. Considering experimental errors, tensor meson dominance is in agreement with experiment. (author)

  13. 21 CFR 866.3510 - Rubella virus serological reagents.

    Science.gov (United States)

    2010-04-01

    ... (CONTINUED) MEDICAL DEVICES IMMUNOLOGY AND MICROBIOLOGY DEVICES Serological Reagents § 866.3510 Rubella virus... Clinical Laboratory Standards': (i) 1/LA6 “Detection and Quantitation of Rubella IgG Antibody: Evaluation... Products in the Clinical Laboratory, October 1997,” (ii) 1/LA18 “Specifications for Immunological Testing...

  14. Observation of the $ \\chi_{\\mathrm{b}1}(\\text{3P}) $ and $ \\chi_{\\mathrm{b}2}(\\text{3P}) $ and measurement of their masses

    CERN Document Server

    Sirunyan, Albert M; CMS Collaboration; Adam, Wolfgang; Ambrogi, Federico; Asilar, Ece; Bergauer, Thomas; Brandstetter, Johannes; Dragicevic, Marko; Erö, Janos; Escalante Del Valle, Alberto; Flechl, Martin; Fruehwirth, Rudolf; Ghete, Vasile Mihai; Hrubec, Josef; Jeitler, Manfred; Krammer, Natascha; Krätschmer, Ilse; Liko, Dietrich; Madlener, Thomas; Mikulec, Ivan; Rad, Navid; Rohringer, Herbert; Schieck, Jochen; Schöfbeck, Robert; Spanring, Markus; Spitzbart, Daniel; Taurok, Anton; Waltenberger, Wolfgang; Wittmann, Johannes; Wulz, Claudia-Elisabeth; Zarucki, Mateusz; Chekhovsky, Vladimir; Mossolov, Vladimir; Suarez Gonzalez, Juan; De Wolf, Eddi A; Di Croce, Davide; Janssen, Xavier; Lauwers, Jasper; Pieters, Maxim; Van De Klundert, Merijn; Van Haevermaet, Hans; Van Mechelen, Pierre; Van Remortel, Nick; Abu Zeid, Shimaa; Blekman, Freya; D'Hondt, Jorgen; De Bruyn, Isabelle; De Clercq, Jarne; Deroover, Kevin; Flouris, Giannis; Lontkovskyi, Denys; Lowette, Steven; Marchesini, Ivan; Moortgat, Seth; Moreels, Lieselotte; Python, Quentin; Skovpen, Kirill; Tavernier, Stefaan; Van Doninck, Walter; Van Mulders, Petra; Van Parijs, Isis; Beghin, Diego; Bilin, Bugra; Brun, Hugues; Clerbaux, Barbara; De Lentdecker, Gilles; Delannoy, Hugo; Dorney, Brian; Fasanella, Giuseppe; Favart, Laurent; Goldouzian, Reza; Grebenyuk, Anastasia; Kalsi, Amandeep Kaur; Lenzi, Thomas; Luetic, Jelena; Postiau, Nicolas; Starling, Elizabeth; Thomas, Laurent; Vander Velde, Catherine; Vanlaer, Pascal; Vannerom, David; Wang, Qun; Cornelis, Tom; Dobur, Didar; Fagot, Alexis; Gul, Muhammad; Khvastunov, Illia; Poyraz, Deniz; Roskas, Christos; Trocino, Daniele; Tytgat, Michael; Verbeke, Willem; Vermassen, Basile; Vit, Martina; Zaganidis, Nicolas; Bakhshiansohi, Hamed; Bondu, Olivier; Brochet, Sébastien; Bruno, Giacomo; Caputo, Claudio; David, Pieter; Delaere, Christophe; Delcourt, Martin; Francois, Brieuc; Giammanco, Andrea; Krintiras, Georgios; Lemaitre, Vincent; Magitteri, Alessio; Mertens, Alexandre; Musich, Marco; Piotrzkowski, Krzysztof; Saggio, Alessia; Vidal Marono, Miguel; Wertz, Sébastien; Zobec, Joze; Alves, Fábio Lúcio; Alves, Gilvan; Correa Martins Junior, Marcos; Correia Silva, Gilson; Hensel, Carsten; Moraes, Arthur; Pol, Maria Elena; Rebello Teles, Patricia; Belchior Batista Das Chagas, Ewerton; Carvalho, Wagner; Chinellato, Jose; Coelho, Eduardo; Melo Da Costa, Eliza; Da Silveira, Gustavo Gil; De Jesus Damiao, Dilson; De Oliveira Martins, Carley; Fonseca De Souza, Sandro; Malbouisson, Helena; Matos Figueiredo, Diego; Melo De Almeida, Miqueias; Mora Herrera, Clemencia; Mundim, Luiz; Nogima, Helio; Prado Da Silva, Wanda Lucia; Sanchez Rosas, Luis Junior; Santoro, Alberto; Sznajder, Andre; Thiel, Mauricio; Tonelli Manganote, Edmilson José; Torres Da Silva De Araujo, Felipe; Vilela Pereira, Antonio; Ahuja, Sudha; Bernardes, Cesar Augusto; Calligaris, Luigi; Tomei, Thiago; De Moraes Gregores, Eduardo; Mercadante, Pedro G; Novaes, Sergio F; Padula, Sandra; Aleksandrov, Aleksandar; Hadjiiska, Roumyana; Iaydjiev, Plamen; Marinov, Andrey; Misheva, Milena; Rodozov, Mircho; Shopova, Mariana; Sultanov, Georgi; Dimitrov, Anton; Litov, Leander; Pavlov, Borislav; Petkov, Peicho; Fang, Wenxing; Gao, Xuyang; Yuan, Li; Ahmad, Muhammad; Bian, Jian-Guo; Chen, Guo-Ming; Chen, He-Sheng; Chen, Mingshui; Chen, Ye; Jiang, Chun-Hua; Leggat, Duncan; Liao, Hongbo; Liu, Zhenan; Romeo, Francesco; Shaheen, Sarmad Masood; Spiezia, Aniello; Tao, Junquan; Wang, Chunjie; Wang, Zheng; Yazgan, Efe; Zhang, Huaqiao; Zhang, Sijing; Zhao, Jingzhou; Ban, Yong; Chen, Geng; Levin, Andrew; Li, Jing; Li, Linwei; Li, Qiang; Mao, Yajun; Qian, Si-Jin; Wang, Dayong; Xu, Zijun; Wang, Yi; Avila, Carlos; Cabrera, Andrés; Carrillo Montoya, Camilo Andres; Chaparro Sierra, Luisa Fernanda; Florez, Carlos; González Hernández, Carlos Felipe; Segura Delgado, Manuel Alejandro; Courbon, Benoit; Godinovic, Nikola; Lelas, Damir; Puljak, Ivica; Sculac, Toni; Antunovic, Zeljko; Kovac, Marko; Brigljevic, Vuko; Ferencek, Dinko; Kadija, Kreso; Mesic, Benjamin; Starodumov, Andrei; Susa, Tatjana; Ather, Mohsan Waseem; Attikis, Alexandros; Kolosova, Marina; Mavromanolakis, Georgios; Mousa, Jehad; Nicolaou, Charalambos; Ptochos, Fotios; Razis, Panos A; Rykaczewski, Hans; Finger, Miroslav; Finger Jr, Michael; Ayala, Edy; Carrera Jarrin, Edgar; Abdalla, Hassan; Abdelalim, Ahmed Ali; Mahmoud, Mohammed; Bhowmik, Sandeep; Carvalho Antunes De Oliveira, Alexandra; Dewanjee, Ram Krishna; Ehataht, Karl; Kadastik, Mario; Raidal, Martti; Veelken, Christian; Eerola, Paula; Kirschenmann, Henning; Pekkanen, Juska; Voutilainen, Mikko; Havukainen, Joona; Heikkilä, Jaana Kristiina; Jarvinen, Terhi; Karimäki, Veikko; Kinnunen, Ritva; Lampén, Tapio; Lassila-Perini, Kati; Laurila, Santeri; Lehti, Sami; Lindén, Tomas; Luukka, Panja-Riina; Mäenpää, Teppo; Siikonen, Hannu; Tuominen, Eija; Tuominiemi, Jorma; Tuuva, Tuure; Besancon, Marc; Couderc, Fabrice; Dejardin, Marc; Denegri, Daniel; Faure, Jean-Louis; Ferri, Federico; Ganjour, Serguei; Givernaud, Alain; Gras, Philippe; Hamel de Monchenault, Gautier; Jarry, Patrick; Leloup, Clément; Locci, Elizabeth; Malcles, Julie; Negro, Giulia; Rander, John; Rosowsky, André; Sahin, Mehmet Özgür; Titov, Maksym; Abdulsalam, Abdulla; Amendola, Chiara; Antropov, Iurii; Beaudette, Florian; Busson, Philippe; Charlot, Claude; Granier de Cassagnac, Raphael; Kucher, Inna; Lobanov, Artur; Martin Blanco, Javier; Nguyen, Matthew; Ochando, Christophe; Ortona, Giacomo; Pigard, Philipp; Salerno, Roberto; Sauvan, Jean-Baptiste; Sirois, Yves; Stahl Leiton, Andre Govinda; Zabi, Alexandre; Zghiche, Amina; Agram, Jean-Laurent; Andrea, Jeremy; Bloch, Daniel; Brom, Jean-Marie; Chabert, Eric Christian; Cherepanov, Vladimir; Collard, Caroline; Conte, Eric; Fontaine, Jean-Charles; Gelé, Denis; Goerlach, Ulrich; Jansová, Markéta; Le Bihan, Anne-Catherine; Tonon, Nicolas; Van Hove, Pierre; Gadrat, Sébastien; Beauceron, Stephanie; Bernet, Colin; Boudoul, Gaelle; Chanon, Nicolas; Chierici, Roberto; Contardo, Didier; Depasse, Pierre; El Mamouni, Houmani; Fay, Jean; Finco, Linda; Gascon, Susan; Gouzevitch, Maxime; Grenier, Gérald; Ille, Bernard; Lagarde, Francois; Laktineh, Imad Baptiste; Lattaud, Hugues; Lethuillier, Morgan; Mirabito, Laurent; Pequegnot, Anne-Laure; Perries, Stephane; Popov, Andrey; Sordini, Viola; Vander Donckt, Muriel; Viret, Sébastien; Toriashvili, Tengizi; Tsamalaidze, Zviad; Autermann, Christian; Feld, Lutz; Kiesel, Maximilian Knut; Klein, Katja; Lipinski, Martin; Preuten, Marius; Rauch, Max Philip; Schomakers, Christian; Schulz, Johannes; Teroerde, Marius; Wittmer, Bruno; Zhukov, Valery; Albert, Andreas; Duchardt, Deborah; Endres, Matthias; Erdmann, Martin; Esch, Thomas; Ghosh, Saranya; Güth, Andreas; Hebbeker, Thomas; Heidemann, Carsten; Hoepfner, Kerstin; Keller, Henning; Knutzen, Simon; Mastrolorenzo, Luca; Merschmeyer, Markus; Meyer, Arnd; Millet, Philipp; Mukherjee, Swagata; Pook, Tobias; Radziej, Markus; Reithler, Hans; Rieger, Marcel; Schmidt, Alexander; Teyssier, Daniel; Flügge, Günter; Hlushchenko, Olena; Kress, Thomas; Künsken, Andreas; Müller, Thomas; Nehrkorn, Alexander; Nowack, Andreas; Pistone, Claudia; Pooth, Oliver; Roy, Dennis; Sert, Hale; Stahl, Achim; Aldaya Martin, Maria; Arndt, Till; Asawatangtrakuldee, Chayanit; Babounikau, Illia; Beernaert, Kelly; Behnke, Olaf; Behrens, Ulf; Bermúdez Martínez, Armando; Bertsche, David; Bin Anuar, Afiq Aizuddin; Borras, Kerstin; Botta, Valeria; Campbell, Alan; Connor, Patrick; Contreras-Campana, Christian; Costanza, Francesco; Danilov, Vladyslav; De Wit, Adinda; Defranchis, Matteo Maria; Diez Pardos, Carmen; Domínguez Damiani, Daniela; Eckerlin, Guenter; Eichhorn, Thomas; Elwood, Adam; Eren, Engin; Gallo, Elisabetta; Geiser, Achim; Grados Luyando, Juan Manuel; Grohsjean, Alexander; Gunnellini, Paolo; Guthoff, Moritz; Haranko, Mykyta; Harb, Ali; Hauk, Johannes; Jung, Hannes; Kasemann, Matthias; Keaveney, James; Kleinwort, Claus; Knolle, Joscha; Krücker, Dirk; Lange, Wolfgang; Lelek, Aleksandra; Lenz, Teresa; Lipka, Katerina; Lohmann, Wolfgang; Mankel, Rainer; Melzer-Pellmann, Isabell-Alissandra; Meyer, Andreas Bernhard; Meyer, Mareike; Missiroli, Marino; Mittag, Gregor; Mnich, Joachim; Myronenko, Volodymyr; Pflitsch, Svenja Karen; Pitzl, Daniel; Raspereza, Alexei; Savitskyi, Mykola; Saxena, Pooja; Schütze, Paul; Schwanenberger, Christian; Shevchenko, Rostyslav; Singh, Akshansh; Tholen, Heiner; Turkot, Oleksii; Vagnerini, Antonio; Van Onsem, Gerrit Patrick; Walsh, Roberval; Wen, Yiwen; Wichmann, Katarzyna; Wissing, Christoph; Zenaiev, Oleksandr; Aggleton, Robin; Bein, Samuel; Benato, Lisa; Benecke, Anna; Blobel, Volker; Centis Vignali, Matteo; Dreyer, Torben; Garutti, Erika; Gonzalez, Daniel; Haller, Johannes; Hinzmann, Andreas; Karavdina, Anastasia; Kasieczka, Gregor; Klanner, Robert; Kogler, Roman; Kovalchuk, Nataliia; Kurz, Simon; Kutzner, Viktor; Lange, Johannes; Marconi, Daniele; Multhaup, Jens; Niedziela, Marek; Nowatschin, Dominik; Perieanu, Adrian; Reimers, Arne; Rieger, Oliver; Scharf, Christian; Schleper, Peter; Schumann, Svenja; Schwandt, Joern; Sonneveld, Jory; Stadie, Hartmut; Steinbrück, Georg; Stober, Fred-Markus Helmut; Stöver, Marc; Troendle, Daniel; Vanhoefer, Annika; Vormwald, Benedikt; Akbiyik, Melike; Barth, Christian; Baselga, Marta; Baur, Sebastian; Butz, Erik; Caspart, René; Chwalek, Thorsten; Colombo, Fabio; De Boer, Wim; Dierlamm, Alexander; El Morabit, Karim; Faltermann, Nils; Freund, Benedikt; Giffels, Manuel; Harrendorf, Marco Alexander; Hartmann, Frank; Heindl, Stefan Michael; Husemann, Ulrich; Kassel, Florian; Katkov, Igor; Kudella, Simon; Mildner, Hannes; Mitra, Soureek; Mozer, Matthias Ulrich; Müller, Thomas; Plagge, Michael; Quast, Gunter; Rabbertz, Klaus; Schröder, Matthias; Shvetsov, Ivan; Sieber, Georg; Simonis, Hans-Jürgen; Ulrich, Ralf; Wayand, Stefan; Weber, Marc; Weiler, Thomas; Williamson, Shawn; Wöhrmann, Clemens; Wolf, Roger; Anagnostou, Georgios; Daskalakis, Georgios; Geralis, Theodoros; Kyriakis, Aristotelis; Loukas, Demetrios; Paspalaki, Garyfallia; Topsis-Giotis, Iasonas; Karathanasis, George; Kesisoglou, Stilianos; Kontaxakis, Pantelis; Panagiotou, Apostolos; Papavergou, Ioanna; Saoulidou, Niki; Tziaferi, Eirini; Vellidis, Konstantinos; Kousouris, Konstantinos; Papakrivopoulos, Ioannis; Tsipolitis, Georgios; Evangelou, Ioannis; Foudas, Costas; Gianneios, Paraskevas; Katsoulis, Panagiotis; Kokkas, Panagiotis; Mallios, Stavros; Manthos, Nikolaos; Papadopoulos, Ioannis; Paradas, Evangelos; Strologas, John; Triantis, Frixos A; Tsitsonis, Dimitrios; Bartók, Márton; Csanad, Mate; Filipovic, Nicolas; Major, Péter; Nagy, Marton Imre; Pasztor, Gabriella; Surányi, Olivér; Veres, Gabor Istvan; Bencze, Gyorgy; Hajdu, Csaba; Horvath, Dezso; Hunyadi, Ádám; Sikler, Ferenc; Vámi, Tamás Álmos; Veszpremi, Viktor; Vesztergombi, Gyorgy; Beni, Noemi; Czellar, Sandor; Karancsi, János; Makovec, Alajos; Molnar, Jozsef; Szillasi, Zoltan; Raics, Peter; Trocsanyi, Zoltan Laszlo; Ujvari, Balazs; Choudhury, Somnath; Komaragiri, Jyothsna Rani; Tiwari, Praveen Chandra; Bahinipati, Seema; Kar, Chandiprasad; Mal, Prolay; Mandal, Koushik; Nayak, Aruna; Sahoo, Deepak Kumar; Swain, Sanjay Kumar; Bansal, Sunil; Beri, Suman Bala; Bhatnagar, Vipin; Chauhan, Sushil; Chawla, Ridhi; Dhingra, Nitish; Gupta, Rajat; Kaur, Anterpreet; Kaur, Amandeep; Kaur, Manjit; Kaur, Sandeep; Kumar, Ramandeep; Kumari, Priyanka; Lohan, Manisha; Mehta, Ankita; Sandeep, Kaur; Sharma, Sandeep; Singh, Jasbir; Walia, Genius; Bhardwaj, Ashutosh; Choudhary, Brajesh C; Garg, Rocky Bala; Gola, Mohit; Keshri, Sumit; Kumar, Ashok; Malhotra, Shivali; Naimuddin, Md; Priyanka, Priyanka; Ranjan, Kirti; Shah, Aashaq; Sharma, Ramkrishna; Bhardwaj, Rishika; Bharti, Monika; Bhattacharya, Rajarshi; Bhattacharya, Satyaki; Bhawandeep, Bhawandeep; Bhowmik, Debabrata; Dey, Sourav; Dutt, Suneel; Dutta, Suchandra; Ghosh, Shamik; Mondal, Kuntal; Nandan, Saswati; Purohit, Arnab; Rout, Prasant Kumar; Roy, Ashim; Roy Chowdhury, Suvankar; Saha, Gourab; Sarkar, Subir; Sharan, Manoj; Singh, Bipen; Thakur, Shalini; Behera, Prafulla Kumar; Chudasama, Ruchi; Dutta, Dipanwita; Jha, Vishwajeet; Kumar, Vineet; Netrakanti, Pawan Kumar; Pant, Lalit Mohan; Shukla, Prashant; Aziz, Tariq; Bhat, Muzamil Ahmad; Dugad, Shashikant; Mohanty, Gagan Bihari; Sur, Nairit; Sutar, Bajrang; Ravindra Kumar Verma, Ravindra; Banerjee, Sudeshna; Bhattacharya, Soham; Chatterjee, Suman; Das, Pallabi; Guchait, Monoranjan; Jain, Sandhya; Karmakar, Saikat; Kumar, Sanjeev; Maity, Manas; Majumder, Gobinda; Mazumdar, Kajari; Sahoo, Niladribihari; Sarkar, Tanmay; Chauhan, Shubhanshu; Dube, Sourabh; Hegde, Vinay; Kapoor, Anshul; Kothekar, Kunal; Pandey, Shubham; Rane, Aditee; Sharma, Seema; Chenarani, Shirin; Eskandari Tadavani, Esmaeel; Etesami, Seyed Mohsen; Khakzad, Mohsen; Mohammadi Najafabadi, Mojtaba; Naseri, Mohsen; Rezaei Hosseinabadi, Ferdos; Safarzadeh, Batool; Zeinali, Maryam; Felcini, Marta; Grunewald, Martin; Abbrescia, Marcello; Calabria, Cesare; Colaleo, Anna; Creanza, Donato; Cristella, Leonardo; De Filippis, Nicola; De Palma, Mauro; Di Florio, Adriano; Errico, Filippo; Fiore, Luigi; Gelmi, Andrea; Iaselli, Giuseppe; Ince, Merve; Lezki, Samet; Maggi, Giorgio; Maggi, Marcello; Miniello, Giorgia; My, Salvatore; Nuzzo, Salvatore; Pompili, Alexis; Pugliese, Gabriella; Radogna, Raffaella; Ranieri, Antonio; Selvaggi, Giovanna; Sharma, Archana; Silvestris, Lucia; Venditti, Rosamaria; Verwilligen, Piet; Zito, Giuseppe; Abbiendi, Giovanni; Battilana, Carlo; Bonacorsi, Daniele; Borgonovi, Lisa; Braibant-Giacomelli, Sylvie; Campanini, Renato; Capiluppi, Paolo; Castro, Andrea; Cavallo, Francesca Romana; Chhibra, Simranjit Singh; Ciocca, Claudia; Codispoti, Giuseppe; Cuffiani, Marco; Dallavalle, Gaetano-Marco; Fabbri, Fabrizio; Fanfani, Alessandra; Giacomelli, Paolo; Grandi, Claudio; Guiducci, Luigi; Iemmi, Fabio; Marcellini, Stefano; Masetti, Gianni; Montanari, Alessandro; Navarria, Francesco; Perrotta, Andrea; Primavera, Federica; Rossi, Antonio; Rovelli, Tiziano; Siroli, Gian Piero; Tosi, Nicolò; Albergo, Sebastiano; Di Mattia, Alessandro; Potenza, Renato; Tricomi, Alessia; Tuve, Cristina; Barbagli, Giuseppe; Chatterjee, Kalyanmoy; Ciulli, Vitaliano; Civinini, Carlo; D'Alessandro, Raffaello; Focardi, Ettore; Latino, Giuseppe; Lenzi, Piergiulio; Meschini, Marco; Paoletti, Simone; Russo, Lorenzo; Sguazzoni, Giacomo; Strom, Derek; Viliani, Lorenzo; Benussi, Luigi; Bianco, Stefano; Fabbri, Franco; Piccolo, Davide; Ferro, Fabrizio; Ravera, Fabio; Robutti, Enrico; Tosi, Silvano; Benaglia, Andrea; Beschi, Andrea; Brianza, Luca; Brivio, Francesco; Ciriolo, Vincenzo; Di Guida, Salvatore; Dinardo, Mauro Emanuele; Fiorendi, Sara; Gennai, Simone; Ghezzi, Alessio; Govoni, Pietro; Malberti, Martina; Malvezzi, Sandra; Massironi, Andrea; Menasce, Dario; Moroni, Luigi; Paganoni, Marco; Pedrini, Daniele; Ragazzi, Stefano; Tabarelli de Fatis, Tommaso; Zuolo, Davide; Buontempo, Salvatore; Cavallo, Nicola; Di Crescenzo, Antonia; Fabozzi, Francesco; Fienga, Francesco; Galati, Giuliana; Iorio, Alberto Orso Maria; Khan, Wajid Ali; Lista, Luca; Meola, Sabino; Paolucci, Pierluigi; Sciacca, Crisostomo; Voevodina, Elena; Azzi, Patrizia; Bacchetta, Nicola; Bisello, Dario; Boletti, Alessio; Bragagnolo, Alberto; Carlin, Roberto; Checchia, Paolo; Dall'Osso, Martino; De Castro Manzano, Pablo; Dorigo, Tommaso; Dosselli, Umberto; Gasparini, Fabrizio; Gasparini, Ugo; Gozzelino, Andrea; Hoh, Siew Yan; Lacaprara, Stefano; Lujan, Paul; Margoni, Martino; Meneguzzo, Anna Teresa; Pazzini, Jacopo; Ronchese, Paolo; Rossin, Roberto; Simonetto, Franco; Tiko, Andres; Torassa, Ezio; Zanetti, Marco; Zotto, Pierluigi; Zumerle, Gianni; Braghieri, Alessandro; Magnani, Alice; Montagna, Paolo; Ratti, Sergio P; Re, Valerio; Ressegotti, Martina; Riccardi, Cristina; Salvini, Paola; Vai, Ilaria; Vitulo, Paolo; Biasini, Maurizio; Bilei, Gian Mario; Cecchi, Claudia; Ciangottini, Diego; Fanò, Livio; Lariccia, Paolo; Leonardi, Roberto; Manoni, Elisa; Mantovani, Giancarlo; Mariani, Valentina; Menichelli, Mauro; Rossi, Alessandro; Santocchia, Attilio; Spiga, Daniele; Androsov, Konstantin; Azzurri, Paolo; Bagliesi, Giuseppe; Bianchini, Lorenzo; Boccali, Tommaso; Borrello, Laura; Castaldi, Rino; Ciocci, Maria Agnese; Dell'Orso, Roberto; Fedi, Giacomo; Fiori, Francesco; Giannini, Leonardo; Giassi, Alessandro; Grippo, Maria Teresa; Ligabue, Franco; Manca, Elisabetta; Mandorli, Giulio; Messineo, Alberto; Palla, Fabrizio; Rizzi, Andrea; Spagnolo, Paolo; Tenchini, Roberto; Tonelli, Guido; Venturi, Andrea; Verdini, Piero Giorgio; Barone, Luciano; Cavallari, Francesca; Cipriani, Marco; Daci, Nadir; Del Re, Daniele; Di Marco, Emanuele; Diemoz, Marcella; Gelli, Simone; Longo, Egidio; Marzocchi, Badder; Meridiani, Paolo; Organtini, Giovanni; Pandolfi, Francesco; Paramatti, Riccardo; Preiato, Federico; Rahatlou, Shahram; Rovelli, Chiara; Santanastasio, Francesco; Amapane, Nicola; Arcidiacono, Roberta; Argiro, Stefano; Arneodo, Michele; Bartosik, Nazar; Bellan, Riccardo; Biino, Cristina; Cartiglia, Nicolo; Cenna, Francesca; Cometti, Simona; Costa, Marco; Covarelli, Roberto; Demaria, Natale; Kiani, Bilal; Mariotti, Chiara; Maselli, Silvia; Migliore, Ernesto; Monaco, Vincenzo; Monteil, Ennio; Monteno, Marco; Obertino, Maria Margherita; Pacher, Luca; Pastrone, Nadia; Pelliccioni, Mario; Pinna Angioni, Gian Luca; Romero, Alessandra; Ruspa, Marta; Sacchi, Roberto; Shchelina, Ksenia; Sola, Valentina; Solano, Ada; Soldi, Dario; Staiano, Amedeo; Belforte, Stefano; Candelise, Vieri; Casarsa, Massimo; Cossutti, Fabio; Da Rold, Alessandro; Della Ricca, Giuseppe; Vazzoler, Federico; Zanetti, Anna; Kim, Dong Hee; Kim, Gui Nyun; Kim, Min Suk; Lee, Jeongeun; Lee, Sangeun; Lee, Seh Wook; Moon, Chang-Seong; Oh, Young Do; Sekmen, Sezen; Son, Dong-Chul; Yang, Yu Chul; Kim, Hyunchul; Moon, Dong Ho; Oh, Geonhee; Goh, Junghwan; Kim, Tae Jeong; Cho, Sungwoong; Choi, Suyong; Go, Yeonju; Gyun, Dooyeon; Ha, Seungkyu; Hong, Byung-Sik; Jo, Youngkwon; Lee, Kisoo; Lee, Kyong Sei; Lee, Songkyo; Lim, Jaehoon; Park, Sung Keun; Roh, Youn; Kim, Hyunsoo; Almond, John; Kim, Junho; Kim, Jae Sung; Lee, Haneol; Lee, Kyeongpil; Nam, Kyungwook; Oh, Sung Bin; Radburn-Smith, Benjamin Charles; Seo, Seon-hee; Yang, Unki; Yoo, Hwi Dong; Yu, Geum Bong; Jeon, Dajeong; Kim, Hyunyong; Kim, Ji Hyun; Lee, Jason Sang Hun; Park, Inkyu; Choi, Young-Il; Hwang, Chanwook; Lee, Jongseok; Yu, Intae; Dudenas, Vytautas; Juodagalvis, Andrius; Vaitkus, Juozas; Ahmed, Ijaz; Ibrahim, Zainol Abidin; Md Ali, Mohd Adli Bin; Mohamad Idris, Faridah; Wan Abdullah, Wan Ahmad Tajuddin; Yusli, Mohd Nizam; Zolkapli, Zukhaimira; Benitez, Jose F; Castaneda Hernandez, Alfredo; Murillo Quijada, Javier Alberto; Duran-Osuna, Cecilia; Castilla-Valdez, Heriberto; De La Cruz-Burelo, Eduard; Ramirez-Sanchez, Gabriel; Heredia-De La Cruz, Ivan; Rabadán-Trejo, Raúl Iraq; Lopez-Fernandez, Ricardo; Mejia Guisao, Jhovanny; Reyes-Almanza, Rogelio; Ramírez García, Mateo; Sánchez Hernández, Alberto; Carrillo Moreno, Salvador; Oropeza Barrera, Cristina; Vazquez Valencia, Fabiola; Eysermans, Jan; Pedraza, Isabel; Salazar Ibarguen, Humberto Antonio; Uribe Estrada, Cecilia; Morelos Pineda, Antonio; Krofcheck, David; Bheesette, Srinidhi; Butler, Philip H; Ahmad, Ashfaq; Ahmad, Muhammad; Asghar, Muhammad Irfan; Hassan, Qamar; Hoorani, Hafeez R; Saddique, Asif; Shah, Mehar Ali; Shoaib, Muhammad; Waqas, Muhammad; Bialkowska, Helena; Bluj, Michal; Boimska, Bozena; Frueboes, Tomasz; Górski, Maciej; Kazana, Malgorzata; Nawrocki, Krzysztof; Szleper, Michal; Traczyk, Piotr; Zalewski, Piotr; Bunkowski, Karol; Byszuk, Adrian; Doroba, Krzysztof; Kalinowski, Artur; Konecki, Marcin; Krolikowski, Jan; Misiura, Maciej; Olszewski, Michal; Pyskir, Andrzej; Walczak, Marek; Araujo, Mariana; Bargassa, Pedrame; Beirão Da Cruz E Silva, Cristóvão; Di Francesco, Agostino; Faccioli, Pietro; Galinhas, Bruno; Gallinaro, Michele; Hollar, Jonathan; Leonardo, Nuno; Nemallapudi, Mythra Varun; Seixas, Joao; Strong, Giles; Toldaiev, Oleksii; Vadruccio, Daniele; Varela, Joao; Afanasiev, Serguei; Bunin, Pavel; Gavrilenko, Mikhail; Golutvin, Igor; Gorbunov, Ilya; Kamenev, Alexey; Karjavine, Vladimir; Lanev, Alexander; Malakhov, Alexander; Matveev, Viktor; Moisenz, Petr; Palichik, Vladimir; Perelygin, Victor; Shmatov, Sergey; Shulha, Siarhei; Skatchkov, Nikolai; Smirnov, Vitaly; Voytishin, Nikolay; Zarubin, Anatoli; Golovtsov, Victor; Ivanov, Yury; Kim, Victor; Kuznetsova, Ekaterina; Levchenko, Petr; Murzin, Victor; Oreshkin, Vadim; Smirnov, Igor; Sosnov, Dmitry; Sulimov, Valentin; Uvarov, Lev; Vavilov, Sergey; Vorobyev, Alexey; Andreev, Yuri; Dermenev, Alexander; Gninenko, Sergei; Golubev, Nikolai; Karneyeu, Anton; Kirsanov, Mikhail; Krasnikov, Nikolai; Pashenkov, Anatoli; Tlisov, Danila; Toropin, Alexander; Epshteyn, Vladimir; Gavrilov, Vladimir; Lychkovskaya, Natalia; Popov, Vladimir; Pozdnyakov, Ivan; Safronov, Grigory; Spiridonov, Alexander; Stepennov, Anton; Stolin, Viatcheslav; Toms, Maria; Vlasov, Evgueni; Zhokin, Alexander; Aushev, Tagir; Chistov, Ruslan; Danilov, Mikhail; Parygin, Pavel; Philippov, Dmitry; Polikarpov, Sergey; Tarkovskii, Evgenii; Andreev, Vladimir; Azarkin, Maksim; Dremin, Igor; Kirakosyan, Martin; Rusakov, Sergey V; Terkulov, Adel; Baskakov, Alexey; Belyaev, Andrey; Boos, Edouard; Dubinin, Mikhail; Dudko, Lev; Ershov, Alexander; Gribushin, Andrey; Klyukhin, Vyacheslav; Kodolova, Olga; Lokhtin, Igor; Miagkov, Igor; Obraztsov, Stepan; Petrushanko, Sergey; Savrin, Viktor; Snigirev, Alexander; Barnyakov, Alexander; Blinov, Vladimir; Dimova, Tatyana; Kardapoltsev, Leonid; Skovpen, Yuri; Azhgirey, Igor; Bayshev, Igor; Bitioukov, Sergei; Elumakhov, Dmitry; Godizov, Anton; Kachanov, Vassili; Kalinin, Alexey; Konstantinov, Dmitri; Mandrik, Petr; Petrov, Vladimir; Ryutin, Roman; Slabospitskii, Sergei; Sobol, Andrei; Troshin, Sergey; Tyurin, Nikolay; Uzunian, Andrey; Volkov, Alexey; Babaev, Anton; Baidali, Sergei; Okhotnikov, Vitalii; Adzic, Petar; Cirkovic, Predrag; Devetak, Damir; Dordevic, Milos; Milosevic, Jovan; Alcaraz Maestre, Juan; Álvarez Fernández, Adrian; Bachiller, Irene; Barrio Luna, Mar; Brochero Cifuentes, Javier Andres; Cerrada, Marcos; Colino, Nicanor; De La Cruz, Begona; Delgado Peris, Antonio; Fernandez Bedoya, Cristina; Fernández Ramos, Juan Pablo; Flix, Jose; Fouz, Maria Cruz; Gonzalez Lopez, Oscar; Goy Lopez, Silvia; Hernandez, Jose M; Josa, Maria Isabel; Moran, Dermot; Pérez-Calero Yzquierdo, Antonio María; Puerta Pelayo, Jesus; Redondo, Ignacio; Romero, Luciano; Senghi Soares, Mara; Triossi, Andrea; Albajar, Carmen; de Trocóniz, Jorge F; Cuevas, Javier; Erice, Carlos; Fernandez Menendez, Javier; Folgueras, Santiago; Gonzalez Caballero, Isidro; González Fernández, Juan Rodrigo; Palencia Cortezon, Enrique; Rodríguez Bouza, Víctor; Sanchez Cruz, Sergio; Vischia, Pietro; Vizan Garcia, Jesus Manuel; Cabrillo, Iban Jose; Calderon, Alicia; Chazin Quero, Barbara; Duarte Campderros, Jordi; Fernandez, Marcos; Fernández Manteca, Pedro José; García Alonso, Andrea; Garcia-Ferrero, Juan; Gomez, Gervasio; Lopez Virto, Amparo; Marco, Jesus; Martinez Rivero, Celso; Martinez Ruiz del Arbol, Pablo; Matorras, Francisco; Piedra Gomez, Jonatan; Prieels, Cédric; Rodrigo, Teresa; Ruiz-Jimeno, Alberto; Scodellaro, Luca; Trevisani, Nicolò; Vila, Ivan; Vilar Cortabitarte, Rocio; Wickramage, Nadeesha; Abbaneo, Duccio; Akgun, Bora; Auffray, Etiennette; Auzinger, Georg; Baillon, Paul; Ball, Austin; Barney, David; Bendavid, Joshua; Bianco, Michele; Bocci, Andrea; Botta, Cristina; Brondolin, Erica; Camporesi, Tiziano; Cepeda, Maria; Cerminara, Gianluca; Chapon, Emilien; Chen, Yi; Cucciati, Giacomo; D'Enterria, David; Dabrowski, Anne; Daponte, Vincenzo; David Tinoco Mendes, Andre; De Roeck, Albert; Deelen, Nikkie; Dobson, Marc; Dünser, Marc; Dupont, Niels; Elliott-Peisert, Anna; Everaerts, Pieter; Fallavollita, Francesco; Fasanella, Daniele; Franzoni, Giovanni; Fulcher, Jonathan; Funk, Wolfgang; Gigi, Dominique; Gilbert, Andrew; Gill, Karl; Glege, Frank; Guilbaud, Maxime; Gulhan, Doga; Hegeman, Jeroen; Innocente, Vincenzo; Jafari, Abideh; Janot, Patrick; Karacheban, Olena; Kieseler, Jan; Kornmayer, Andreas; Krammer, Manfred; Lange, Clemens; Lecoq, Paul; Lourenco, Carlos; Malgeri, Luca; Mannelli, Marcello; Meijers, Frans; Merlin, Jeremie Alexandre; Mersi, Stefano; Meschi, Emilio; Milenovic, Predrag; Moortgat, Filip; Mulders, Martijn; Ngadiuba, Jennifer; Nourbakhsh, Shervin; Orfanelli, Styliani; Orsini, Luciano; Pantaleo, Felice; Pape, Luc; Perez, Emmanuel; Peruzzi, Marco; Petrilli, Achille; Petrucciani, Giovanni; Pfeiffer, Andreas; Pierini, Maurizio; Pitters, Florian Michael; Rabady, Dinyar; Racz, Attila; Reis, Thomas; Rolandi, Gigi; Rovere, Marco; Sakulin, Hannes; Schäfer, Christoph; Schwick, Christoph; Seidel, Markus; Selvaggi, Michele; Sharma, Archana; Silva, Pedro; Sphicas, Paraskevas; Stakia, Anna; Steggemann, Jan; Tosi, Mia; Treille, Daniel; Tsirou, Andromachi; Veckalns, Viesturs; Zeuner, Wolfram Dietrich; Caminada, Lea; Deiters, Konrad; Erdmann, Wolfram; Horisberger, Roland; Ingram, Quentin; Kaestli, Hans-Christian; Kotlinski, Danek; Langenegger, Urs; Rohe, Tilman; Wiederkehr, Stephan Albert; Backhaus, Malte; Bäni, Lukas; Berger, Pirmin; Chernyavskaya, Nadezda; Dissertori, Günther; Dittmar, Michael; Donegà, Mauro; Dorfer, Christian; Grab, Christoph; Heidegger, Constantin; Hits, Dmitry; Hoss, Jan; Klijnsma, Thomas; Lustermann, Werner; Manzoni, Riccardo Andrea; Marionneau, Matthieu; Meinhard, Maren Tabea; Micheli, Francesco; Musella, Pasquale; Nessi-Tedaldi, Francesca; Pata, Joosep; Pauss, Felicitas; Perrin, Gaël; Perrozzi, Luca; Pigazzini, Simone; Quittnat, Milena; Ruini, Daniele; Sanz Becerra, Diego Alejandro; Schönenberger, Myriam; Shchutska, Lesya; Tavolaro, Vittorio Raoul; Theofilatos, Konstantinos; Vesterbacka Olsson, Minna Leonora; Wallny, Rainer; Zhu, De Hua; Aarrestad, Thea Klaeboe; Amsler, Claude; Brzhechko, Danyyl; Canelli, Maria Florencia; De Cosa, Annapaola; Del Burgo, Riccardo; Donato, Silvio; Galloni, Camilla; Hreus, Tomas; Kilminster, Benjamin; Leontsinis, Stefanos; Neutelings, Izaak; Pinna, Deborah; Rauco, Giorgia; Robmann, Peter; Salerno, Daniel; Schweiger, Korbinian; Seitz, Claudia; Takahashi, Yuta; Zucchetta, Alberto; Chang, Yu-Hsiang; Cheng, Kai-yu; Doan, Thi Hien; Jain, Shilpi; Khurana, Raman; Kuo, Chia-Ming; Lin, Willis; Pozdnyakov, Andrey; Yu, Shin-Shan; Chang, Paoti; Chao, Yuan; Chen, Kai-Feng; Chen, Po-Hsun; Hou, George Wei-Shu; Kumar, Arun; Li, You-ying; Liu, Yueh-Feng; Lu, Rong-Shyang; Paganis, Efstathios; Psallidas, Andreas; Steen, Arnaud; Asavapibhop, Burin; Srimanobhas, Norraphat; Suwonjandee, Narumon; Bat, Ayse; Boran, Fatma; Cerci, Salim; Damarseckin, Serdal; Demiroglu, Zuhal Seyma; Dolek, Furkan; Dozen, Candan; Dumanoglu, Isa; Girgis, Semiray; Gokbulut, Gul; Guler, Yalcin; Gurpinar, Emine; Hos, Ilknur; Isik, Candan; Kangal, Evrim Ersin; Kara, Ozgun; Kayis Topaksu, Aysel; Kiminsu, Ugur; Oglakci, Mehmet; Onengut, Gulsen; Ozdemir, Kadri; Ozturk, Sertac; Sunar Cerci, Deniz; Tali, Bayram; Tok, Ufuk Guney; Turkcapar, Semra; Zorbakir, Ibrahim Soner; Zorbilmez, Caglar; Isildak, Bora; Karapinar, Guler; Yalvac, Metin; Zeyrek, Mehmet; Atakisi, Ismail Okan; Gülmez, Erhan; Kaya, Mithat; Kaya, Ozlem; Tekten, Sevgi; Yetkin, Elif Asli; Agaras, Merve Nazlim; Atay, Serhat; Cakir, Altan; Cankocak, Kerem; Komurcu, Yildiray; Sen, Sercan; Grynyov, Boris; Levchuk, Leonid; Ball, Fionn; Beck, Lana; Brooke, James John; Burns, Douglas; Clement, Emyr; Cussans, David; Davignon, Olivier; Flacher, Henning; Goldstein, Joel; Heath, Greg P; Heath, Helen F; Kreczko, Lukasz; Newbold, Dave M; Paramesvaran, Sudarshan; Penning, Bjoern; Sakuma, Tai; Smith, Dominic; Smith, Vincent J; Taylor, Joseph; Titterton, Alexander; Bell, Ken W; Belyaev, Alexander; Brew, Christopher; Brown, Robert M; Cieri, Davide; Cockerill, David JA; Coughlan, John A; Harder, Kristian; Harper, Sam; Linacre, Jacob; Olaiya, Emmanuel; Petyt, David; Shepherd-Themistocleous, Claire; Thea, Alessandro; Tomalin, Ian R; Williams, Thomas; Womersley, William John; Bainbridge, Robert; Bloch, Philippe; Borg, Johan; Breeze, Shane; Buchmuller, Oliver; Bundock, Aaron; Casasso, Stefano; Colling, David; Corpe, Louie; Dauncey, Paul; Davies, Gavin; Della Negra, Michel; Di Maria, Riccardo; Haddad, Yacine; Hall, Geoffrey; Iles, Gregory; James, Thomas; Komm, Matthias; Laner, Christian; Lyons, Louis; Magnan, Anne-Marie; Malik, Sarah; Martelli, Arabella; Nash, Jordan; Nikitenko, Alexander; Palladino, Vito; Pesaresi, Mark; Richards, Alexander; Rose, Andrew; Scott, Edward; Seez, Christopher; Shtipliyski, Antoni; Singh, Gurpreet; Stoye, Markus; Strebler, Thomas; Summers, Sioni; Tapper, Alexander; Uchida, Kirika; Virdee, Tejinder; Wardle, Nicholas; Winterbottom, Daniel; Wright, Jack; Zenz, Seth Conrad; Cole, Joanne; Hobson, Peter R; Khan, Akram; Kyberd, Paul; Mackay, Catherine Kirsty; Morton, Alexander; Reid, Ivan; Teodorescu, Liliana; Zahid, Sema; Call, Kenneth; Dittmann, Jay; Hatakeyama, Kenichi; Liu, Hongxuan; Madrid, Christopher; Mcmaster, Brooks; Pastika, Nathaniel; Smith, Caleb; Bartek, Rachel; Dominguez, Aaron; Buccilli, Andrew; Cooper, Seth; Henderson, Conor; Rumerio, Paolo; West, Christopher; Arcaro, Daniel; Bose, Tulika; Gastler, Daniel; Rankin, Dylan; Richardson, Clint; Rohlf, James; Sulak, Lawrence; Zou, David; Benelli, Gabriele; Coubez, Xavier; Cutts, David; Hadley, Mary; Hakala, John; Heintz, Ulrich; Hogan, Julie Managan; Kwok, Ka Hei Martin; Laird, Edward; Landsberg, Greg; Lee, Jangbae; Mao, Zaixing; Narain, Meenakshi; Piperov, Stefan; Sagir, Sinan; Syarif, Rizki; Usai, Emanuele; Yu, David; Band, Reyer; Brainerd, Christopher; Breedon, Richard; Burns, Dustin; Calderon De La Barca Sanchez, Manuel; Chertok, Maxwell; Conway, John; Conway, Rylan; Cox, Peter Timothy; Erbacher, Robin; Flores, Chad; Funk, Garrett; Ko, Winston; Kukral, Ota; Lander, Richard; Mulhearn, Michael; Pellett, Dave; Pilot, Justin; Shalhout, Shalhout; Shi, Mengyao; Stolp, Dustin; Taylor, Devin; Tos, Kyle; Tripathi, Mani; Wang, Zhangqier; Zhang, Fengwangdong; Bachtis, Michail; Bravo, Cameron; Cousins, Robert; Dasgupta, Abhigyan; Florent, Alice; Hauser, Jay; Ignatenko, Mikhail; Mccoll, Nickolas; Regnard, Simon; Saltzberg, David; Schnaible, Christian; Valuev, Vyacheslav; Bouvier, Elvire; Burt, Kira; Clare, Robert; Gary, J William; Ghiasi Shirazi, Seyyed Mohammad Amin; Hanson, Gail; Karapostoli, Georgia; Kennedy, Elizabeth; Lacroix, Florent; Long, Owen Rosser; Olmedo Negrete, Manuel; Paneva, Mirena Ivova; Si, Weinan; Wang, Long; Wei, Hua; Wimpenny, Stephen; Yates, Brent; Branson, James G; Cittolin, Sergio; Derdzinski, Mark; Gerosa, Raffaele; Gilbert, Dylan; Hashemi, Bobak; Holzner, André; Klein, Daniel; Kole, Gouranga; Krutelyov, Vyacheslav; Letts, James; Masciovecchio, Mario; Olivito, Dominick; Padhi, Sanjay; Pieri, Marco; Sani, Matteo; Sharma, Vivek; Simon, Sean; Tadel, Matevz; Vartak, Adish; Wasserbaech, Steven; Wood, John; Würthwein, Frank; Yagil, Avraham; Zevi Della Porta, Giovanni; Amin, Nick; Bhandari, Rohan; Bradmiller-Feld, John; Campagnari, Claudio; Citron, Matthew; Dishaw, Adam; Dutta, Valentina; Franco Sevilla, Manuel; Gouskos, Loukas; Heller, Ryan; Incandela, Joe; Ovcharova, Ana; Qu, Huilin; Richman, Jeffrey; Stuart, David; Suarez, Indara; Wang, Sicheng; Yoo, Jaehyeok; Anderson, Dustin; Bornheim, Adolf; Lawhorn, Jay Mathew; Newman, Harvey B; Nguyen, Thong; Spiropulu, Maria; Vlimant, Jean-Roch; Wilkinson, Richard; Xie, Si; Zhang, Zhicai; Zhu, Ren-Yuan; Andrews, Michael Benjamin; Ferguson, Thomas; Mudholkar, Tanmay; Paulini, Manfred; Sun, Menglei; Vorobiev, Igor; Weinberg, Marc; Cumalat, John Perry; Ford, William T; Jensen, Frank; Johnson, Andrew; Krohn, Michael; MacDonald, Emily; Mulholland, Troy; Stenson, Kevin; Ulmer, Keith; Wagner, Stephen Robert; Alexander, James; Chaves, Jorge; Cheng, Yangyang; Chu, Jennifer; Datta, Abhisek; Mcdermott, Kevin; Mirman, Nathan; Patterson, Juliet Ritchie; Quach, Dan; Rinkevicius, Aurelijus; Ryd, Anders; Skinnari, Louise; Soffi, Livia; Tan, Shao Min; Tao, Zhengcheng; Thom, Julia; Tucker, Jordan; Wittich, Peter; Zientek, Margaret; Abdullin, Salavat; Albrow, Michael; Alyari, Maral; Apollinari, Giorgio; Apresyan, Artur; Apyan, Aram; Banerjee, Sunanda; Bauerdick, Lothar AT; Beretvas, Andrew; Berryhill, Jeffrey; Bhat, Pushpalatha C; Bolla, Gino; Burkett, Kevin; Butler, Joel Nathan; Canepa, Anadi; Cerati, Giuseppe Benedetto; Cheung, Harry; Chlebana, Frank; Cremonesi, Matteo; Duarte, Javier; Elvira, Victor Daniel; Freeman, Jim; Gecse, Zoltan; Gottschalk, Erik; Gray, Lindsey; Green, Dan; Grünendahl, Stefan; Gutsche, Oliver; Hanlon, Jim; Harris, Robert M; Hasegawa, Satoshi; Hirschauer, James; Hu, Zhen; Jayatilaka, Bodhitha; Jindariani, Sergo; Johnson, Marvin; Joshi, Umesh; Klima, Boaz; Kortelainen, Matti J; Kreis, Benjamin; Lammel, Stephan; Lincoln, Don; Lipton, Ron; Liu, Miaoyuan; Liu, Tiehui; Lykken, Joseph; Maeshima, Kaori; Marraffino, John Michael; Mason, David; McBride, Patricia; Merkel, Petra; Mrenna, Stephen; Nahn, Steve; O'Dell, Vivian; Pedro, Kevin; Pena, Cristian; Prokofyev, Oleg; Rakness, Gregory; Ristori, Luciano; Savoy-Navarro, Aurore; Schneider, Basil; Sexton-Kennedy, Elizabeth; Soha, Aron; Spalding, William J; Spiegel, Leonard; Stoynev, Stoyan; Strait, James; Strobbe, Nadja; Taylor, Lucas; Tkaczyk, Slawek; Tran, Nhan Viet; Uplegger, Lorenzo; Vaandering, Eric Wayne; Vernieri, Caterina; Verzocchi, Marco; Vidal, Richard; Wang, Michael; Weber, Hannsjoerg Artur; Whitbeck, Andrew; Acosta, Darin; Avery, Paul; Bortignon, Pierluigi; Bourilkov, Dimitri; Brinkerhoff, Andrew; Cadamuro, Luca; Carnes, Andrew; Carver, Matthew; Curry, David; Field, Richard D; Gleyzer, Sergei V; Joshi, Bhargav Madhusudan; Konigsberg, Jacobo; Korytov, Andrey; Ma, Peisen; Matchev, Konstantin; Mei, Hualin; Mitselmakher, Guenakh; Shi, Kun; Sperka, David; Wang, Jian; Wang, Sean-Jiun; Joshi, Yagya Raj; Linn, Stephan; Ackert, Andrew; Adams, Todd; Askew, Andrew; Hagopian, Sharon; Hagopian, Vasken; Johnson, Kurtis F; Kolberg, Ted; Martinez, German; Perry, Thomas; Prosper, Harrison; Saha, Anirban; Schiber, Catherine; Sharma, Varun; Yohay, Rachel; Baarmand, Marc M; Bhopatkar, Vallary; Colafranceschi, Stefano; Hohlmann, Marcus; Noonan, Daniel; Rahmani, Mehdi; Roy, Titas; Yumiceva, Francisco; Adams, Mark Raymond; Apanasevich, Leonard; Berry, Douglas; Betts, Russell Richard; Cavanaugh, Richard; Chen, Xuan; Dittmer, Susan; Evdokimov, Olga; Gerber, Cecilia Elena; Hangal, Dhanush Anil; Hofman, David Jonathan; Jung, Kurt; Kamin, Jason; Mills, Corrinne; Sandoval Gonzalez, Irving Daniel; Tonjes, Marguerite; Varelas, Nikos; Wang, Hui; Wang, Xiao; Wu, Zhenbin; Zhang, Jingyu; Alhusseini, Mohammad; Bilki, Burak; Clarida, Warren; Dilsiz, Kamuran; Durgut, Süleyman; Gandrajula, Reddy Pratap; Haytmyradov, Maksat; Khristenko, Viktor; Merlo, Jean-Pierre; Mestvirishvili, Alexi; Moeller, Anthony; Nachtman, Jane; Ogul, Hasan; Onel, Yasar; Ozok, Ferhat; Penzo, Aldo; Snyder, Christina; Tiras, Emrah; Wetzel, James; Blumenfeld, Barry; Cocoros, Alice; Eminizer, Nicholas; Fehling, David; Feng, Lei; Gritsan, Andrei; Hung, Wai Ting; Maksimovic, Petar; Roskes, Jeffrey; Sarica, Ulascan; Swartz, Morris; Xiao, Meng; You, Can; Al-bataineh, Ayman; Baringer, Philip; Bean, Alice; Boren, Samuel; Bowen, James; Bylinkin, Alexander; Castle, James; Khalil, Sadia; Kropivnitskaya, Anna; Majumder, Devdatta; Mcbrayer, William; Murray, Michael; Rogan, Christopher; Sanders, Stephen; Schmitz, Erich; Tapia Takaki, Daniel; Wang, Quan; Duric, Senka; Ivanov, Andrew; Kaadze, Ketino; Kim, Doyeong; Maravin, Yurii; Mendis, Dalath Rachitha; Mitchell, Tyler; Modak, Atanu; Mohammadi, Abdollah; Saini, Lovedeep Kaur; Skhirtladze, Nikoloz; Rebassoo, Finn; Wright, Douglas; Baden, Drew; Baron, Owen; Belloni, Alberto; Eno, Sarah Catherine; Feng, Yongbin; Ferraioli, Charles; Hadley, Nicholas John; Jabeen, Shabnam; Jeng, Geng-Yuan; Kellogg, Richard G; Kunkle, Joshua; Mignerey, Alice; Ricci-Tam, Francesca; Shin, Young Ho; Skuja, Andris; Tonwar, Suresh C; Wong, Kak; Abercrombie, Daniel; Allen, Brandon; Azzolini, Virginia; Baty, Austin; Bauer, Gerry; Bi, Ran; Brandt, Stephanie; Busza, Wit; Cali, Ivan Amos; D'Alfonso, Mariarosaria; Demiragli, Zeynep; Gomez Ceballos, Guillelmo; Goncharov, Maxim; Harris, Philip; Hsu, Dylan; Hu, Miao; Iiyama, Yutaro; Innocenti, Gian Michele; Klute, Markus; Kovalskyi, Dmytro; Lee, Yen-Jie; Luckey, Paul David; Maier, Benedikt; Marini, Andrea Carlo; Mcginn, Christopher; Mironov, Camelia; Narayanan, Siddharth; Niu, Xinmei; Paus, Christoph; Roland, Christof; Roland, Gunther; Stephans, George; Sumorok, Konstanty; Tatar, Kaya; Velicanu, Dragos; Wang, Jing; Wang, Ta-Wei; Wyslouch, Bolek; Zhaozhong, Shi; Benvenuti, Alberto; Chatterjee, Rajdeep Mohan; Evans, Andrew; Hansen, Peter; Kalafut, Sean; Kubota, Yuichi; Lesko, Zachary; Mans, Jeremy; Ruckstuhl, Nicole; Rusack, Roger; Turkewitz, Jared; Wadud, Mohammad Abrar; Acosta, John Gabriel; Oliveros, Sandra; Avdeeva, Ekaterina; Bloom, Kenneth; Claes, Daniel R; Fangmeier, Caleb; Golf, Frank; Gonzalez Suarez, Rebeca; Kamalieddin, Rami; Kravchenko, Ilya; Monroy, Jose; Siado, Joaquin Emilo; Snow, Gregory R; Stieger, Benjamin; Godshalk, Andrew; Harrington, Charles; Iashvili, Ia; Kharchilava, Avto; Mclean, Christine; Nguyen, Duong; Parker, Ashley; Rappoccio, Salvatore; Roozbahani, Bahareh; Alverson, George; Barberis, Emanuela; Freer, Chad; Hortiangtham, Apichart; Morse, David Michael; Orimoto, Toyoko; Teixeira De Lima, Rafael; Wamorkar, Tanvi; Wang, Bingran; Wisecarver, Andrew; Wood, Darien; Bhattacharya, Saptaparna; Charaf, Otman; Hahn, Kristan Allan; Mucia, Nicholas; Odell, Nathaniel; Schmitt, Michael Henry; Sung, Kevin; Trovato, Marco; Velasco, Mayda; Bucci, Rachael; Dev, Nabarun; Hildreth, Michael; Hurtado Anampa, Kenyi; Jessop, Colin; Karmgard, Daniel John; Kellams, Nathan; Lannon, Kevin; Li, Wenzhao; Loukas, Nikitas; Marinelli, Nancy; Meng, Fanbo; Mueller, Charles; Musienko, Yuri; Planer, Michael; Reinsvold, Allison; Ruchti, Randy; Siddireddy, Prasanna; Smith, Geoffrey; Taroni, Silvia; Wayne, Mitchell; Wightman, Andrew; Wolf, Matthias; Woodard, Anna; Alimena, Juliette; Antonelli, Louis; Bylsma, Ben; Durkin, Lloyd Stanley; Flowers, Sean; Francis, Brian; Hart, Andrew; Hill, Christopher; Ji, Weifeng; Ling, Ta-Yung; Luo, Wuming; Winer, Brian L; Wulsin, Howard Wells; Cooperstein, Stephane; Elmer, Peter; Hardenbrook, Joshua; Higginbotham, Samuel; Kalogeropoulos, Alexis; Lange, David; Lucchini, Marco Toliman; Luo, Jingyu; Marlow, Daniel; Mei, Kelvin; Ojalvo, Isabel; Olsen, James; Palmer, Christopher; Piroué, Pierre; Salfeld-Nebgen, Jakob; Stickland, David; Tully, Christopher; Malik, Sudhir; Norberg, Scarlet; Barker, Anthony; Barnes, Virgil E; Das, Souvik; Gutay, Laszlo; Jones, Matthew; Jung, Andreas Werner; Khatiwada, Ajeeta; Mahakud, Bibhuprasad; Miller, David Harry; Neumeister, Norbert; Peng, Cheng-Chieh; Qiu, Hao; Schulte, Jan-Frederik; Sun, Jian; Wang, Fuqiang; Xiao, Rui; Xie, Wei; Cheng, Tongguang; Dolen, James; Parashar, Neeti; Chen, Zhenyu; Ecklund, Karl Matthew; Freed, Sarah; Geurts, Frank JM; Kilpatrick, Matthew; Li, Wei; Michlin, Benjamin; Padley, Brian Paul; Roberts, Jay; Rorie, Jamal; Shi, Wei; Tu, Zhoudunming; Zabel, James; Zhang, Aobo; Bodek, Arie; de Barbaro, Pawel; Demina, Regina; Duh, Yi-ting; Dulemba, Joseph Lynn; Fallon, Colin; Ferbel, Thomas; Galanti, Mario; Garcia-Bellido, Aran; Han, Jiyeon; Hindrichs, Otto; Khukhunaishvili, Aleko; Lo, Kin Ho; Tan, Ping; Taus, Rhys; Verzetti, Mauro; Agapitos, Antonis; Chou, John Paul; Gershtein, Yuri; Gómez Espinosa, Tirso Alejandro; Halkiadakis, Eva; Heindl, Maximilian; Hughes, Elliot; Kaplan, Steven; Kunnawalkam Elayavalli, Raghav; Kyriacou, Savvas; Lath, Amitabh; Montalvo, Roy; Nash, Kevin; Osherson, Marc; Saka, Halil; Salur, Sevil; Schnetzer, Steve; Sheffield, David; Somalwar, Sunil; Stone, Robert; Thomas, Scott; Thomassen, Peter; Walker, Matthew; Delannoy, Andrés G; Heideman, Joseph; Riley, Grant; Spanier, Stefan; Thapa, Krishna; Bouhali, Othmane; Celik, Ali; Dalchenko, Mykhailo; De Mattia, Marco; Delgado, Andrea; Dildick, Sven; Eusebi, Ricardo; Gilmore, Jason; Huang, Tao; Kamon, Teruki; Luo, Sifu; Mueller, Ryan; Patel, Rishi; Perloff, Alexx; Perniè, Luca; Rathjens, Denis; Safonov, Alexei; Akchurin, Nural; Damgov, Jordan; De Guio, Federico; Dudero, Phillip Russell; Kunori, Shuichi; Lamichhane, Kamal; Lee, Sung Won; Mengke, Tielige; Muthumuni, Samila; Peltola, Timo; Undleeb, Sonaina; Volobouev, Igor; Wang, Zhixing; Greene, Senta; Gurrola, Alfredo; Janjam, Ravi; Johns, Willard; Maguire, Charles; Melo, Andrew; Ni, Hong; Padeken, Klaas; Ruiz Alvarez, José David; Sheldon, Paul; Tuo, Shengquan; Velkovska, Julia; Verweij, Marta; Xu, Qiao; Arenton, Michael Wayne; Barria, Patrizia; Cox, Bradley; Hirosky, Robert; Joyce, Matthew; Ledovskoy, Alexander; Li, Hengne; Neu, Christopher; Sinthuprasith, Tutanon; Wang, Yanchu; Wolfe, Evan; Xia, Fan; Harr, Robert; Karchin, Paul Edmund; Poudyal, Nabin; Sturdy, Jared; Thapa, Prakash; Zaleski, Shawn; Brodski, Michael; Buchanan, James; Caillol, Cécile; Carlsmith, Duncan; Dasu, Sridhara; Dodd, Laura; Gomber, Bhawna; Grothe, Monika; Herndon, Matthew; Hervé, Alain; Hussain, Usama; Klabbers, Pamela; Lanaro, Armando; Long, Kenneth; Loveless, Richard; Ruggles, Tyler; Savin, Alexander; Smith, Nicholas; Smith, Wesley H; Woods, Nathaniel

    2018-01-01

    The $ \\chi_{\\mathrm{b}1}(\\text{3P}) $ and $ \\chi_{\\mathrm{b}2}(\\text{3P}) $ states are observed through their $ \\Upsilon(\\text{3S}) \\gamma$ decays, using an event sample of proton-proton collisions collected by the CMS experiment at the CERN LHC. The data were collected at a center-of-mass energy of 13 TeV and correspond to an integrated luminosity of 80.0 fb$^{-1}$. The $ \\Upsilon(\\text{3S}) $ mesons are identified through their dimuon decay channel, while the low-energy photons are detected after converting to $ \\mathrm{ e^{+}e^{-} } $ pairs in the silicon tracker, leading to a $ \\chi_{\\mathrm{b}}(\\text{3P}) $ mass resolution of 2.2 MeV. This is the first time that the $J = $ 1 and 2 states are well resolved and their masses individually measured: 10 513.42 $\\pm$ 0.41 (stat) $\\pm$ 0.18 (syst) MeV and 10 524.02 $\\pm$ 0.57 (stat) $\\pm$ 0.18 (syst) MeV; they are determined with respect to the world-average value of the $ \\Upsilon(\\text{3S}) $ mass, which has an uncertainty of 0.5 MeV. The mass splitting is me...

  15. Observation of B0 -> chi_c0 K*0 and Evidence of B+ -> chi_c0 K*+

    Energy Technology Data Exchange (ETDEWEB)

    Aubert, : B.

    2008-08-13

    The authors present the observation of the decay B{sup 0} {yields} {chi}{sub c0}K*{sup 0} as well as evidence of B{sup +} {yields} {chi}{sub c0}K*{sup +}, with an 8.9 and a 3.6 standard deviation significance, respectively, using a data sample of 454 million {Upsilon}(4S) {yields} B{bar B} decays collected with the BABAR detector at the PEP-II B meson factory located at the Standard Linear Accelerator Center (SLAC). The measured branching fractions are: {Beta}(B{sup 0} {yields} {chi}{sub c0}K*{sup 0}) = (1.7 {+-} 0.3 {+-} 0.2) x 10{sup -4} and {Beta}(B{sup +} {yields} {chi}{sub c0}K*{sup +}) = (1.4 {+-} 0.5 {+-} 0.2) x 10{sup -4}, where the first quoted errors are statistical and the second are systematic. They obtain a branching fraction upper limit of {Beta}(B{sup +} {yields} {chi}{sub c0}K*{sup +}) < 2.1 x 10{sup -4} at the 90% confidence level.

  16. Tensor meson dominance and e/sup +/e/sup -/-physics

    Energy Technology Data Exchange (ETDEWEB)

    Genz, H [Miami Univ., Coral Gables, FL (USA). Center for Theoretical Studies; Karlsruhe Univ. (T.H.) (Germany, F.R.). Inst. fuer Theoretische Kernphysik); Mallik, S [Karlsruhe Univ. (T.H.) (Germany, F.R.). Inst. fuer Theoretische Kernphysik

    1983-01-01

    The phenomenological status of tensor meson dominance is reported. Some new results concerning hadronic decays of the 2/sup + +/-meson chi/sub 2/(3.55) and the heavy lepton tau are also included. Considering experimental errors, tensor meson dominance is in agreement with experiment.

  17. Tetraquarks in the 1/N expansion and meson-meson resonances

    Energy Technology Data Exchange (ETDEWEB)

    Maiani, L. [Dipartimento di Fisica and INFN, ‘Sapienza’ Università di Roma, P.le Aldo Moro 5, I-00185 Roma (Italy); Polosa, A.D. [Dipartimento di Fisica and INFN, ‘Sapienza’ Università di Roma, P.le Aldo Moro 5, I-00185 Roma (Italy); CERN Theory Department, CH-1211 Geneva 23 (Switzerland); Riquer, V. [Dipartimento di Fisica and INFN, ‘Sapienza’ Università di Roma, P.le Aldo Moro 5, I-00185 Roma (Italy)

    2016-06-27

    Diquarks are found to have the right degrees of freedom to describe the tetraquark poles in hidden-charm to open-charm meson-meson amplitudes. Compact tetraquarks result as intermediate states in non-planar diagrams of the 1/N expansion and the corresponding resonances are narrower than what estimated before. The proximity of tetraquarks to meson-thresholds has an apparent role in this analysis and, in the language of meson molecules, an halving rule in the counting of states is obtained.

  18. Tetraquarks in the 1/N expansion and meson-meson resonances

    International Nuclear Information System (INIS)

    Maiani, L.; Polosa, A.D.; Riquer, V.

    2016-01-01

    Diquarks are found to have the right degrees of freedom to describe the tetraquark poles in hidden-charm to open-charm meson-meson amplitudes. Compact tetraquarks result as intermediate states in non-planar diagrams of the 1/N expansion and the corresponding resonances are narrower than what estimated before. The proximity of tetraquarks to meson-thresholds has an apparent role in this analysis and, in the language of meson molecules, an halving rule in the counting of states is obtained.

  19. Central exclusive $J/\\psi$ and $\\chi_c$ production at LHCb

    CERN Document Server

    Stevenson, S

    2013-01-01

    Central exclusive $J/\\psi$ and $\\chi_c$ meson production has been measured in decays to dimuons with the LHCb detector, in data corresponding to 36 pb$^{-1}$ of integrated luminosity from $\\sqrt{s}$= 7 TeV proton-proton collisions. Cross-section measurements for $J/\\psi$, $\\psi$ (2S) and $\\chi_{c0,c1,c2}$ production are presented, and the $J/\\psi$ photoproduction cross-section is measured as a function of the photon-proton centre-of-mass energy and compared to measurements made at HERA.

  20. 20 CFR 418.3510 - When would an increase, reduction or termination start?

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false When would an increase, reduction or termination start? 418.3510 Section 418.3510 Employees' Benefits SOCIAL SECURITY ADMINISTRATION MEDICARE..., reduction or termination start? We are required to give you a written notice of our proposed action before...

  1. Radiative transitions of new particles and the puzzle of cc-bar pseudoscalar mesons

    International Nuclear Information System (INIS)

    Arafune, J.; Fukugita, M.; Oyanagi, Y.

    1977-01-01

    Radiative transitions between psi's and chi's are investigated in terms of a nonrelativistic quark model. When the level mixing is taken into account, no difficulties are met in M1 transitions, if the newly discovered chi (3454) is assigned to the ground state of the pseudoscalar meson

  2. Meson-meson scattering in lattice QED2+1

    International Nuclear Information System (INIS)

    Fiebig, H.R.; Woloshyn, R.M.

    1993-01-01

    Scattering phase shifts of a meson-meson system in staggered 3-dimensional lattice QED are computed. The main task of the simulation is to obtain a discrete set of two-body energy levels. These are extracted from a 4-point time correlation matrix and then used to obtain scattering phase shifts. The results for the l = 0 and l = 2 partial waves are consistent with short-range repulsion and intermediate-range attraction of the residual meson-meson interaction. (orig.)

  3. Measurements of psi ' -> (p)over-barK(+)Sigma(0) and chi(cJ) -> (p)over-barK(+) Lambda

    NARCIS (Netherlands)

    Ablikim, M.; Achasov, M. N.; Albayrak, O.; Ambrose, D. J.; An, F. F.; An, Q.; Bai, J. Z.; Ban, Y.; Becker, J.; Bennett, J. V.; Bertani, M.; Bian, J. M.; Boger, E.; Bondarenko, O.; Boyko, I.; Briere, R. A.; Bytev, V.; Cai, X.; Cakir, O.; Calcaterra, A.; Cao, G. F.; Cetin, S. A.; Chang, J. F.; Chelkov, G.; Chen, G.; Chen, H. S.; Chen, J.C.; Chen, M.L.; Chen, S. J.; Chen, X.; Chen, Y.B.; Cheng, H. P.; Chu, Y. P.; Cronin-Hennessy, D.; Dai, H. L.; Dai, J.P.; Dedovich, D.; Deng, Z. Y.; Denig, A.; Denysenko, I.; Destefanis, M.; Ding, W. M.; Ding, Y.; Dong, L. Y.; Dong, M. Y.; Du, S. X.; Fang, J.; Fang, S. S.; Fava, L.; Feng, C. Q.; Ferroli, R. B.; Friedel, P.; Fu, C. D.; Gao, Y.; Geng, C.; Goetzen, K.; Gong, W. X.; Gradl, W.; Greco, M.; Gu, M. H.; Gu, Y. T.; Guan, Y. H.; Guo, Q.; Guo, L. B.; Guo, T.; Guo, Y. P.; Han, Y. L.; Harris, F. A.; He, K. L.; He, M.; He, Z. Y.; Held, T.; Heng, Y. K.; Hou, Z. L.; Hu, C.; Hu, H. M.; Hu, J. F.; Hu, T.; Huang, G. M.; Huang, G. S.; Huang, J.S.; Huang, L.; Huang, X.T.; Huang, Y.; Huang, Y.P.; Hussain, T.; Ji, C. S.; Ji, Q.; Ji, Q. P.; Ji, X. B.; Ji, X. L.; Jiang, L.L.; Jiang, X. S.; Jiao, J. B.; Jiao, Z.; Jin, D. P.; Jin, S.; Jing, F. F.; Kalantar-Nayestanaki, N.; Kavatsyuk, M.; Kopf, B.; Kornicer, M.; Kuehn, W.; Lai, W.; Lange, J.S.; Leyhe, M.; Li, C. H.; Li, Cheng; Li, Cui; Li, D. M.; Li, F.; Li, G.; Li, H.B.; Li, J. C.; Li, K.; Li, Lei; Li, Q. J.; Li, S.L.; Li, W. D.; Li, W. G.; Li, X. L.; Li, X. N.; Li, X. Q.; Li, X. R.; Li, Z. B.; Liang, H.; Liang, Y. F.; Liang, Y.T.; Liao, G.R.; Liao, X. T.; Lin, D.; Liu, B. J.; Liu, Cheng; Liu, C.X.; Liu, F.H.; Liu, Fang; Liu, Feng; Liu, H.; Liu, H. B.; Liu, H. H.; Liu, H. M.; Liu, H. W.; Liu, J. P.; Liu, K.; Liu, K.Y.; Liu, Kai; Liu, P. L.; Liu, Q.; Liu, S. B.; Liu, X.; Liu, Y. B.; Liu, Z. A.; Liu, Zhiqiang; Liu, Zhiqing; Loehner, H.; Lu, G. R.; Lu, H. J.; Lu, J.G.; Lu, Q. W.; Lu, X. R.; Lu, Y. P.; Luo, C. L.; Luo, M. X.; Luo, T.; Luo, X.L.; Lv, M.; Ma, C.L.; Ma, F. C.; Ma, H. L.; Ma, Q. M.; Ma, S.; Ma, T.; Ma, X. Y.; Maas, F.E.; Maggiora, M.; Malik, Q. A.; Mao, Y. J.; Mao, Z. P.; Messchendorp, J. G.; Min, J.; Min, T. J.; Mitchell, R. E.; Mo, X. H.; Morales, C. Morales; Moriya, K.; Muchnoi, N. Yu.; Muramatsu, H.; Nefedov, Y.; Nicholson, C.; Nikolaev, I. B.; Ning, Z.; Olsen, S. L.; Ouyang, Q.; Pacetti, S.; Park, J.W.; Pelizaeus, M.; Peng, H. P.; Peters, K.; Ping, J. L.; Ping, R. G.; Poling, R.; Prencipe, E.; Qi, M.; Qian, S.; Qiao, C. F.; Qin, L. Q.; Qin, X. S.; Qin, Y.; Qin, Z. H.; Qiu, J. F.; Rashid, K. H.; Rong, G.; Ruan, X. D.; Sarantsev, A.; Schaefer, B. D.; Shao, M.; Shen, C. P.; Shen, X. Y.; Sheng, H. Y.; Shepherd, M. R.; Song, X. Y.; Spataro, S.; Spruck, B.; Sun, D. H.; Sun, G. X.; Sun, J.F.; Sun, S. S.; Sun, Y.J.; Sun, Y.Z.; Sun, Z.J.; Sun, Z.T.; Tang, C.J.; Tang, X.; Tapan, I.; Thorndike, E. H.; Toth, D.; Ullrich, M.; Varner, G. S.; Wang, B.Q.; Wang, D.; Wang, D.Y.; Wang, K.; Wang, L. L.; Wang, L. S.; Wang, M.; Wang, P.; Wang, P. L.; Wang, Q. J.; Wang, S. G.; Wang, X. F.; Wang, X. L.; Wang, Y. F.; Wang, Z.; Wang, Z. G.; Wang, Z.Y.; Wei, D. H.; Wei, J.B.; Weidenkaff, P.; Wen, Q. G.; Wen, S. P.; Wiedner, U.; Wu, L.H.; Wu, N.; Wu, S.X.; Wu, W.; Wu, Z.; Xia, L. G.; Xia, Y. X.; Xiao, Z. J.; Xie, Y. G.; Xiu, Q. L.; Xu, G. F.; Xu, G. M.; Xu, Q.J.; Xu, Q.N.; Xu, X. P.; Xu, Z. R.; Xue, F.; Xue, Z.; Yan, L.; Yan, W. B.; Yan, Y. H.; Yang, H. X.; Yang, Y.; Yang, Y. X.; Ye, H.; Ye, M.; Ye, M. H.; Yu, B. X.; Yu, C. X.; Yu, H. W.; Yu, J. S.; Yu, S. P.; Yuan, C. Z.; Yuan, Y.; Zafar, A. A.; Zallo, A.; Zeng, Y.; Zhang, B. X.; Zhang, B. Y.; Zhang, C.; Zhang, C. C.; Zhang, D. H.; Zhang, H. H.; Zhang, H. Y.; Zhang, J. Q.; Zhang, J. W.; Zhang, J. Y.; Zhang, J. Z.; Zhang, LiLi; Zhang, R.; Zhang, S. H.; Zhang, X. J.; Zhang, X. Y.; Zhang, Y.; Zhang, Y. H.; Zhang, Z. P.; Zhang, Z. Y.; Zhang, Zhenghao; Zhao, G.; Zhao, H. S.; Zhao, J.W.; Zhao, K. X.; Zhao, Lei; Zhao, Ling; Zhao, M. G.; Zhao, Q.; Zhao, Q. Z.; Zhao, S.J.; Zhao, T.C.; Zhao, Y. B.; Zhao, Z. G.; Zhemchugov, A.; Zheng, B.; Zheng, Y. H.; Zhong, B.; Zhong, Z.; Zhou, L.; Zhou, X. K.; Zhou, X.R.; Zhu, C.; Zhu, K.; Zhu, K. J.; Zhu, S.H.; Zhu, Stuart; Zhu, Y.C.; Zhu, Y.M.; Zhu, Y.S.; Zhu, Z. A.; Zhuang, J.; Zou, B. S.; Zou, J. H.; Werner, M.J.; Zheng, J.P.

    2013-01-01

    Using a sample of 1.06 x 10(8) psi' mesons collectedwith the BESIII detector at the BEPCII e(+)e(-) collider and chi(cJ) mesons produced via radiative transitions from the psi', we report the first observation for psi' -> (p) over barK(+)Sigma(0) + c.c. (charge conjugate), as well as improved

  4. Measurement of sigma chi c2 B(chi c2-->J/psi gamma)/sigma chi c1 B(chi c1 -->J/psi gamma) in pp collisions at square root s=1.96 TeV.

    Science.gov (United States)

    Abulencia, A; Adelman, J; Affolder, T; Akimoto, T; Albrow, M G; Ambrose, D; Amerio, S; Amidei, D; Anastassov, A; Anikeev, K; Annovi, A; Antos, J; Aoki, M; Apollinari, G; Arguin, J-F; Arisawa, T; Artikov, A; Ashmanskas, W; Attal, A; Azfar, F; Azzi-Bacchetta, P; Azzurri, P; Bacchetta, N; Badgett, W; Barbaro-Galtieri, A; Barnes, V E; Barnett, B A; Baroiant, S; Bartsch, V; Bauer, G; Bedeschi, F; Behari, S; Belforte, S; Bellettini, G; Bellinger, J; Belloni, A; Benjamin, D; Beretvas, A; Beringer, J; Berry, T; Bhatti, A; Binkley, M; Bisello, D; Blair, R E; Blocker, C; Blumenfeld, B; Bocci, A; Bodek, A; Boisvert, V; Bolla, G; Bolshov, A; Bortoletto, D; Boudreau, J; Boveia, A; Brau, B; Brigliadori, L; Bromberg, C; Brubaker, E; Budagov, J; Budd, H S; Budd, S; Budroni, S; Burkett, K; Busetto, G; Bussey, P; Byrum, K L; Cabrera, S; Campanelli, M; Campbell, M; Canelli, F; Canepa, A; Carillo, S; Carlsmith, D; Carosi, R; Carron, S; Casarsa, M; Castro, A; Catastini, P; Cauz, D; Cavalli-Sforza, M; Cerri, A; Cerrito, L; Chang, S H; Chen, Y C; Chertok, M; Chiarelli, G; Chlachidze, G; Chlebana, F; Cho, I; Cho, K; Chokheli, D; Chou, J P; Choudalakis, G; Chuang, S H; Chung, K; Chung, W H; Chung, Y S; Ciljak, M; Ciobanu, C I; Ciocci, M A; Clark, A; Clark, D; Coca, M; Compostella, G; Convery, M E; Conway, J; Cooper, B; Copic, K; Cordelli, M; Cortiana, G; Crescioli, F; Cuenca Almenar, C; Cuevas, J; Culbertson, R; Cully, J C; Cyr, D; DaRonco, S; Datta, M; D'Auria, S; Davies, T; D'Onofrio, M; Dagenhart, D; de Barbaro, P; De Cecco, S; Deisher, A; De Lentdecker, G; Dell'Orso, M; Delli Paoli, F; Demortier, L; Deng, J; Deninno, M; De Pedis, D; Derwent, P F; Di Giovanni, G P; Dionisi, C; Di Ruzza, B; Dittmann, J R; DiTuro, P; Dörr, C; Donati, S; Donega, M; Dong, P; Donini, J; Dorigo, T; Dube, S; Efron, J; Erbacher, R; Errede, D; Errede, S; Eusebi, R; Fang, H C; Farrington, S; Fedorko, I; Fedorko, W T; Feild, R G; Feindt, M; Fernandez, J P; Field, R; Flanagan, G; Foland, A; Forrester, S; Foster, G W; Franklin, M; Freeman, J C; Furic, I; Gallinaro, M; Galyardt, J; Garcia, J E; Garberson, F; Garfinkel, A F; Gay, C; Gerberich, H; Gerdes, D; Giagu, S; Giannetti, P; Gibson, A; Gibson, K; Gimmell, J L; Ginsburg, C; Giokaris, N; Giordani, M; Giromini, P; Giunta, M; Giurgiu, G; Glagolev, V; Glenzinski, D; Gold, M; Goldschmidt, N; Goldstein, J; Golossanov, A; Gomez, G; Gomez-Ceballos, G; Goncharov, M; González, O; Gorelov, I; Goshaw, A T; Goulianos, K; Gresele, A; Griffiths, M; Grinstein, S; Grosso-Pilcher, C; Group, R C; Grundler, U; Guimaraes da Costa, J; Gunay-Unalan, Z; Haber, C; Hahn, K; Hahn, S R; Halkiadakis, E; Hamilton, A; Han, B-Y; Han, J Y; Handler, R; Happacher, F; Hara, K; Hare, M; Harper, S; Harr, R F; Harris, R M; Hartz, M; Hatakeyama, K; Hauser, J; Heijboer, A; Heinemann, B; Heinrich, J; Henderson, C; Herndon, M; Heuser, J; Hidas, D; Hill, C S; Hirschbuehl, D; Hocker, A; Holloway, A; Hou, S; Houlden, M; Hsu, S-C; Huffman, B T; Hughes, R E; Husemann, U; Huston, J; Incandela, J; Introzzi, G; Iori, M; Ishizawa, Y; Ivanov, A; Iyutin, B; James, E; Jang, D; Jayatilaka, B; Jeans, D; Jensen, H; Jeon, E J; Jindariani, S; Jones, M; Joo, K K; Jun, S Y; Jung, J E; Junk, T R; Kamon, T; Karchin, P E; Kato, Y; Kemp, Y; Kephart, R; Kerzel, U; Khotilovich, V; Kilminster, B; Kim, D H; Kim, H S; Kim, J E; Kim, M J; Kim, S B; Kim, S H; Kim, Y K; Kimura, N; Kirsch, L; Klimenko, S; Klute, M; Knuteson, B; Ko, B R; Kondo, K; Kong, D J; Konigsberg, J; Korytov, A; Kotwal, A V; Kovalev, A; Kraan, A C; Kraus, J; Kravchenko, I; Kreps, M; Kroll, J; Krumnack, N; Kruse, M; Krutelyov, V; Kubo, T; Kuhlmann, S E; Kuhr, T; Kusakabe, Y; Kwang, S; Laasanen, A T; Lai, S; Lami, S; Lammel, S; Lancaster, M; Lander, R L; Lannon, K; Lath, A; Latino, G; Lazzizzera, I; LeCompte, T; Lee, J; Lee, J; Lee, Y J; Lee, S W; Lefèvre, R; Leonardo, N; Leone, S; Levy, S; Lewis, J D; Lin, C; Lin, C S; Lindgren, M; Lipeles, E; Lister, A; Litvintsev, D O; Liu, T; Lockyer, N S; Loginov, A; Loreti, M; Loverre, P; Lu, R-S; Lucchesi, D; Lujan, P; Lukens, P; Lungu, G; Lyons, L; Lys, J; Lysak, R; Lytken, E; Mack, P; MacQueen, D; Madrak, R; Maeshima, K; Makhoul, K; Maki, T; Maksimovic, P; Malde, S; Manca, G; Margaroli, F; Marginean, R; Marino, C; Marino, C P; Martin, A; Martin, M; Martin, V; Martínez, M; Maruyama, T; Mastrandrea, P; Masubuchi, T; Matsunaga, H; Mattson, M E; Mazini, R; Mazzanti, P; McFarland, K S; McIntyre, P; McNulty, R; Mehta, A; Mehtala, P; Menzemer, S; Menzione, A; Merkel, P; Mesropian, C; Messina, A; Miao, T; Miladinovic, N; Miles, J; Miller, R; Mills, C; Milnik, M; Mitra, A; Mitselmakher, G; Miyamoto, A; Moed, S; Moggi, N; Mohr, B; Moore, R; Morello, M; Movilla Fernandez, P; Mülmenstädt, J; Mukherjee, A; Muller, Th; Mumford, R; Murat, P; Nachtman, J; Nagano, A; Naganoma, J; Nakano, I; Napier, A; Necula, V; Neu, C; Neubauer, M S; Nielsen, J; Nigmanov, T; Nodulman, L; Norniella, O; Nurse, E; Oh, S H; Oh, Y D; Oksuzian, I; Okusawa, T; Oldeman, R; Orava, R; Osterberg, K; Pagliarone, C; Palencia, E; Papadimitriou, V; Paramonov, A A; Parks, B; Pashapour, S; Patrick, J; Pauletta, G; Paulini, M; Paus, C; Pellett, D E; Penzo, A; Phillips, T J; Piacentino, G; Piedra, J; Pinera, L; Pitts, K; Plager, C; Pondrom, L; Portell, X; Poukhov, O; Pounder, N; Prakoshyn, F; Pronko, A; Proudfoot, J; Ptohos, F; Punzi, G; Pursley, J; Rademacker, J; Rahaman, A; Ranjan, N; Rappoccio, S; Reisert, B; Rekovic, V; Renton, P; Rescigno, M; Richter, S; Rimondi, F; Ristori, L; Robson, A; Rodrigo, T; Rogers, E; Rolli, S; Roser, R; Rossi, M; Rossin, R; Ruiz, A; Russ, J; Rusu, V; Saarikko, H; Sabik, S; Safonov, A; Sakumoto, W K; Salamanna, G; Saltó, O; Saltzberg, D; Sánchez, C; Santi, L; Sarkar, S; Sartori, L; Sato, K; Savard, P; Savoy-Navarro, A; Scheidle, T; Schlabach, P; Schmidt, E E; Schmidt, M P; Schmitt, M; Schwarz, T; Scodellaro, L; Scott, A L; Scribano, A; Scuri, F; Sedov, A; Seidel, S; Seiya, Y; Semenov, A; Sexton-Kennedy, L; Sfyrla, A; Shapiro, M D; Shears, T; Shepard, P F; Sherman, D; Shimojima, M; Shochet, M; Shon, Y; Shreyber, I; Sidoti, A; Sinervo, P; Sisakyan, A; Sjolin, J; Slaughter, A J; Slaunwhite, J; Sliwa, K; Smith, J R; Snider, F D; Snihur, R; Soderberg, M; Soha, A; Somalwar, S; Sorin, V; Spalding, J; Spinella, F; Spreitzer, T; Squillacioti, P; Stanitzki, M; Staveris-Polykalas, A; St Denis, R; Stelzer, B; Stelzer-Chilton, O; Stentz, D; Strologas, J; Stuart, D; Suh, J S; Sukhanov, A; Sun, H; Suzuki, T; Taffard, A; Takashima, R; Takeuchi, Y; Takikawa, K; Tanaka, M; Tanaka, R; Tecchio, M; Teng, P K; Terashi, K; Thom, J; Thompson, A S; Thomson, E; Tipton, P; Tiwari, V; Tkaczyk, S; Toback, D; Tokar, S; Tollefson, K; Tomura, T; Tonelli, D; Torre, S; Torretta, D; Tourneur, S; Trischuk, W; Tsuchiya, R; Tsuno, S; Turini, N; Ukegawa, F; Unverhau, T; Uozumi, S; Usynin, D; Vallecorsa, S; van Remortel, N; Varganov, A; Vataga, E; Vázquez, F; Velev, G; Veramendi, G; Veszpremi, V; Vidal, R; Vila, I; Vilar, R; Vine, T; Vollrath, I; Volobouev, I; Volpi, G; Würthwein, F; Wagner, P; Wagner, R G; Wagner, R L; Wagner, J; Wagner, W; Wallny, R; Wang, S M; Warburton, A; Waschke, S; Waters, D; Weinberger, M; Wester, W C; Whitehouse, B; Whiteson, D; Wicklund, A B; Wicklund, E; Williams, G; Williams, H H; Wilson, P; Winer, B L; Wittich, P; Wolbers, S; Wolfe, C; Wright, T; Wu, X; Wynne, S M; Yagil, A; Yamamoto, K; Yamaoka, J; Yamashita, T; Yang, C; Yang, U K; Yang, Y C; Yao, W M; Yeh, G P; Yoh, J; Yorita, K; Yoshida, T; Yu, G B; Yu, I; Yu, S S; Yun, J C; Zanello, L; Zanetti, A; Zaw, I; Zhang, X; Zhou, J; Zucchelli, S

    2007-06-08

    We measure the ratio of cross section times branching fraction, Rp=sigma chi c2 B(chi c2-->J/psi gamma)/sigma chi c1 B(chi c1-->J/psi gamma), in 1.1 fb(-1) of pp collisions at square root s=1.96 TeV. This measurement covers the kinematic range pT(J/psi)>4.0 GeV/c, |eta(J/psi)1.0 GeV/c. For events due to prompt processes, we find Rp=0.395+/-0.016(stat)+/-0.015(syst). This result represents a significant improvement in precision over previous measurements of prompt chi c1,2 hadro production.

  5. Workshop on mesons and mesonic states up to slightly above 1 GeV/c2

    International Nuclear Information System (INIS)

    Oelert, W.; Sefzick, T.

    1991-04-01

    The new accelerator COSY-Juelich will provide protons with momenta up to 3.3 GeV/c. Thus an effective mass slightly above 1 GeV/c 2 can be produced in the pp-interaction. Employing higher mass targets also heavier mesons can be observed. The production of single mesons and of mesonic states with and without strangeness can be investgated at COSY. The structure of some mesons in the mass range of 950 McV/c 2 to 1020 MeV/c 2 is still not well understood. While the Φ(1020) at the upper limit of this range is believed to be of rahter pure santi s nature the content of the η'(958) meson at the lower limit of this range is still under discussion. New results suggest that what is called the f o meson (former notation S*) consists in reality of two close and narrow states; one of them being a santi s - quarks configuration while the other should be a flavour singlet which couples to ππ and Kanti K with similar strengths. Also the discussion on possible gluonium candidates is still alive. It is speculated that some of these mesons - till now supposed to have widths of 30 to 50 MeV/c 2 - could rather be an overlay of structures with much smaller widths. Another features of resonances in this region is their partial decay into the Kanti K channel if their actual mass is large enough. Strong decays in Kanti K could be a signal of a Kanti K 'molecular' nature of the resonance. In particular the atomic K + K - structure should exist. In order to have review of the physics related to these problems there was a workshop held on: MESONS and MESONIC STATES up to slightly above 1 GeV/c 2 at the ZEL - Forschungszentrum - Juelich February 19 to 20, 1990. The following contains copies of the shown transparencies and short write-ups as far as available. (orig.)

  6. Measurement of inclusive production of charmonium states in B meson decays

    Energy Technology Data Exchange (ETDEWEB)

    Barrera, Barbara

    2000-10-13

    The authors reconstruct the charmonium mesons J/{psi}, {psi}(2S) and {chi}{sub c} using a sample of 8.46 x 10{sup 6} B{bar B} events collected by the BABAR detector operating at e{sup +}e{sup -} center of mass energies near the {Lambda}(4S) resonance. by measuring rates relative to the branching fraction of the J/{psi}, they obtain preliminary inclusive B branching fractions of (0.25 {+-} 0.02 {+-} 0.02)% to the {psi}(2S) and (0.39 {+-} 0.04 {+-} 0.04)% to the {chi}{sub c1}, and set a 90% confidence level limit of 0.24% on decays through the {chi}{sub c2}.

  7. Semileptonic decays of B mesons into excited charm mesons: leading order and 1/mc contributions

    International Nuclear Information System (INIS)

    Mannel, T.

    1994-01-01

    We use the heavy quark effective theory to investigate the form factors that describe the semileptonic decays of a B meson into excited daughter mesons. For an excited daughter meson with charm, a single form factor is needed at leading order, while five form factors and two dimensionful constants are needed to order 1/m c in the heavy quark expansion. For non-charmed final states, a total of four form factors are needed at leading order. For the process B→D(*)Xlν, four form factors are also needed at leading order. (orig.)

  8. Meson production in two-photon interactions at LHC energies

    Energy Technology Data Exchange (ETDEWEB)

    Da Silva, D. T.; Goncalves, V. P.; Sauter, W. K. [Instituto de Fisica e Matematica, Universidade Federal de Pelotas, Campus Universitario UFPel, CP 354, 96010-900, Capao do Leao-RS (Brazil)

    2013-03-25

    The LHC opens a new kinematical regime at high energy, where several questions related to the description of the high-energy regime of the Quantum Chromodynamics (QCD) remain without satisfactory answers. Some open questions are the search for non-q-bar q resonances, the determination of the spectrum of q-bar q states and the identification of states with anomalous {gamma}{gamma} couplings. A possible way to study these problems is the study of meson production in two-photon interactions. In this contribution we calculate the meson production in two-photon interactions at LHC energies considering proton - proton collisions and estimate the total cross section for the production of the mesons {pi}, a, f, {eta} and {chi}.

  9. Inclusive decays of {ital B} mesons to charmonium

    Energy Technology Data Exchange (ETDEWEB)

    Balest, R.; Cho, K.; Ford, W.T.; Johnson, D.R.; Lingel, K.; Lohner, M.; Rankin, P.; Smith, J.G.; Alexander, J.P.; Bebek, C.; Berkelman, K.; Bloom, K.; Browder, T.E.; Cassel, D.G.; Cho, H.A.; Coffman, D.M.; Crowcroft, D.S.; Drell, P.S.; Dumas, D.J.; Ehrlich, R.; Gaidarev, P.; Garcia-Sciveres, M.; Geiser, B.; Gittelman, B.; Gray, S.W.; Hartill, D.L.; Heltsley, B.K.; Henderson, S.; Jones, C.D.; Jones, S.L.; Kandaswamy, J.; Katayama, N.; Kim, P.C.; Kreinick, D.L.; Ludwig, G.S.; Masui, J.; Mevissen, J.; Mistry, N.B.; Ng, C.R.; Nordberg, E.; Patterson, J.R.; Peterson, D.; Riley, D.; Salman, S.; Sapper, M.; Wuerthwein, F.; Avery, P.; Freyberger, A.; Rodriguez, J.; Yang, S.; Yelton, J.; Cinabro, D.; Liu, T.; Saulnier, M.; Wilson, R.; Yamamoto, H.; Bergfeld, T.; Eisenstein, B.I.; Gollin, G.; Ong, B.; Palmer, M.; Selen, M.; Thaler, J.J.; Edwards, K.W.; Ogg, M.; Bellerive, A.; Britton, D.I.; Hyatt, E.R.F.; MacFarlane, D.B.; Patel, P.M.; Spaan, B.; Sadoff, A.J.; Ammar, R.; Baringer, P.; Bean, A.; Besson, D.; Coppage, D.; Copty, N.; Davis, R.; Hancock, N.; Kelly, M.; Kotov, S.; Kravchenko, I.; Kwak, N.; Lam, H.; Kubota, Y.; Lattery, M.; Momayezi, M.; Nelson, J.K.; Patton, S.; Poling, R.; Savinov, V.; Schrenk, S.; Wang, R.; Alam, M.S.; Kim, I.J.; Ling, Z.; Mahmood, A.H.; O`Neill, J.J.; Severini, H.; Sun, C.R.; Wappler, F.; Crawford, G.; Daubenmier, C.M.; Fulton, R.; Fujino, D.; Gan, K.K.; Honscheid, K.; Kagan, H.; Kass, R.; Lee, J.; Sung, M.; White, C.; Wolf, A.; Zoeller, M.M.; Butler, F.; Fu, X.; Nemati, B.; Ross, W.R.; Skubic, P.; Wood, M.; Bishai, M.; Fast, J.; Gerndt, E.; Hinson, J.W.; McIlwain, R.L.; Miao, T.; Miller, D.H.; Modesitt, M.; Payne, D.; Shibata, E.I.; Shipsey, I.P.J.; Wang, P.N.; Battle, M.; Ernst, J.; Gibbons, L.; Kwon, Y.; Roberts, S.; Thorndike, E.H.; Wang, C.H.; Dominick, J.; Lambrecht, M.; Sanghera, S.; Shelkov, V.; Skwarnicki, T.; Stroynowski, R.; Volobouev, I.; Wei, G.; Artuso, M.; Gao, M.; Goldberg, M.; He, D.; Horwitz, N.; Moneti, G.C.; (CLEO Collabor...

    1995-09-01

    We have used the CLEO-II detector at the Cornell Electron Storage Ringe (CESR) to study the inclusive production of charmonium mesons in a sample of 2.15 million {ital B{bar B}} events. We find inclusive branching fractions of (1.12{plus_minus}0.04{plus_minus}0.06)% for {ital B}{r_arrow}{ital J}/{psi}{ital X}, (0.34{plus_minus}0.04{plus_minus}0.03)% for {ital B}{r_arrow}{psi}{prime}{ital X}, and (0.40{plus_minus}0.06{plus_minus}0.04)% for {ital B}{r_arrow}{chi}{sub {ital c}1}{ital X}. We also find some evidence for the inclusive production of {chi}{sub {ital c}2}, and set an upper limit for the branching fraction of the inclusive decay {ital B}{r_arrow}{eta}{sub {ital c}}{ital X} of 0.9% at 90% confidence level. Momentum spectra for inclusive {ital J}/{psi}, {psi}{prime}, and {chi}{sub {ital c}1} production are presented. These measurements are compared to theoretical calculations.

  10. Measurement of B(psi -> gamma chi(c1)) and search for psi -> gamma chi(c2)

    NARCIS (Netherlands)

    Ablikim, M.; Achasov, M. N.; Ai, X. C.; Albayrak, O.; Albrecht, M.; Ambrose, D. J.; Amoroso, A.; An, F. F.; An, Q.; Bai, J. Z.; Ferroli, R. Baldini; Ban, Y.; Bennett, D. W.; Bennett, J. V.; Bertani, M.; Bettoni, D.; Bian, J. M.; Bianchi, F.; Boger, E.; Bondarenko, O.; Boyko, I.; Briere, R. A.; Cai, H.; Cai, X.; Cakir, O.; Calcaterra, A.; Cao, G. F.; Cetin, S. A.; Chang, J. F.; Chelkov, G.; Chen, G.; Chen, H. S.; Chen, H. Y.; Chen, J. C.; Chen, M. L.; Chen, S. J.; Chen, X.; Chen, X. R.; Chen, Y. B.; Cheng, H. P.; Chu, X. K.; Cibinetto, G.; Cronin-Hennessy, D.; Dai, H. L.; Dai, J. P.; Dbeyssi, A.; Dedovich, D.; Deng, Z. Y.; Denig, A.; Denysenko, I.; Destefanis, M.; De Mori, F.; Ding, Y.; Dong, C.; Dong, J.; Dong, L. Y.; Dong, M. Y.; Du, S. X.; Duan, P. F.; Fan, J. Z.; Fang, J.; Fang, S. S.; Fang, X.; Fang, Y.; Fava, L.; Feldbauer, F.; Felici, G.; Feng, C. Q.; Fioravanti, E.; Fritsch, M.; Fu, C. D.; Gao, Q.; Gao, X. Y.; Gao, Y.; Gao, Z.; Garzia, I.; Geng, C.; Goetzen, K.; Gong, W. X.; Gradl, W.; Greco, M.; Gu, M. H.; Gu, Y. T.; Guan, Y. H.; Guo, A. Q.; Guo, L. B.; Guo, Y.; Guo, Y. P.; Haddadi, Z.; Hafner, A.; Han, S.; Han, Y. L.; Hao, X. Q.; Harris, F. A.; He, K. L.; He, Z. Y.; Held, T.; Heng, Y. K.; Hou, Z. L.; Hu, C.; Hu, H. M.; Hu, J. F.; Hu, T.; Hu, Y.; Huang, G. M.; Huang, G. S.; Huang, H. P.; Huang, J. S.; Huang, X. T.; Huang, Y.; Hussain, T.; Ji, Q.; Ji, Q. P.; Ji, X. B.; Ji, X. L.; Jiang, L. L.; Jiang, L. W.; Jiang, X. S.; Liao, J. B.; Liao, Z.; Jin, D. P.; Jin, S.; Johansson, T.; Julin, A.; Kalantar-Nayestanaki, N.; Kang, X. L.; Kang, X. S.; Kavatsyuk, M.; Ke, B. C.; Kliemt, R.; Kloss, B.; Kolcu, O. B.; Kopf, B.; Komicer, M.; Kuehn, W.; Kupsc, A.; Lai, W.; Lange, J. S.; Lara, M.; Larin, P.; Leng, C.; Li, C. H.; Li, Cheng; Li, D. M.; Li, F.; Li, G.; Li, H. B.; Li, J. C.; Li, Jin; Li, K.; Li, K.; Li, Lei; Li, P. R.; Li, T.; Li, W. D.; Li, W. G.; Li, X. L.; Li, X. M.; Li, X. N.; Li, X. Q.; Li, Z. B.; Liang, H.; Liang, Y. F.; Liang, Y. T.; Liao, G. R.; Lin, D. X.; Liu, B. J.; Liu, C. X.; Liu, F. H.; Liu, Fang; Liu, Feng; Liu, H. B.; Liu, H. H.; Liu, H. H.; Liu, H. M.; Liu, J.; Liu, J. P.; Liu, J. Y.; Liu, K.; Liu, K. Y.; Liu, L. D.; Liu, P. L.; Liu, Q.; Liu, S. B.; Liu, X.; Liu, X. X.; Liu, Y. B.; Liu, Z. A.; Liu, Zhiqiang; Liu, Zhiging; Loehner, H.; Lou, X. C.; Lu, H. J.; Lu, J. G.; Lu, R. Q.; Lu, Y.; Lu, Y. P.; Luo, C. L.; Luo, M. X.; Luo, T.; Luo, X. L.; Lv, M.; Lyu, X. R.; Ma, F. C.; Ma, H. L.; Ma, L. L.; Ma, Q. M.; Ma, S.; Ma, T.; Ma, X. N.; Ma, X. Y.; Maas, F. E.; Maggiora, M.; Malik, Q. A.; Mao, Y. J.; Mao, Z. P.; Marcello, S.; Messchendorp, J. G.; Min, J.; Min, T. J.; Mitchell, R. E.; Mo, X. H.; Mo, Y. J.; Morales, C. Morales; Moriya, K.; Muchnoi, N. Yu.; Muramatsu, H.; Nefedov, Y.; Nerling, F.; Nikolaev, I. B.; Ning, Z.; Nisar, S.; Niu, S. L.; Niu, X. Y.; Olsen, S. L.; Ouyang, Q.; Pacetti, S.; Patteri, P.; Pelizaeus, M.; Peng, H. P.; Peters, K.; Pettersson, J.; Ping, J. L.; Ping, R. G.; Poling, R.; Pu, Y. N.; Qi, M.; Qian, S.; Qiao, C. F.; Qin, L. Q.; Qin, N.; Qin, X. S.; Qin, Y.; Qin, Z. H.; Qiu, J. F.; Rashid, K. H.; Redmer, C. F.; Ren, H. L.; Ripka, M.; Rong, G.; Ruan, X. D.; Santoro, V.; Sarantsev, A.; Savrie, M.; Schoenning, K.; Schumann, S.; Shan, W.; Shao, M.; Shen, C. P.; Shen, P. X.; Shen, X. Y.; Sheng, H. Y.; Song, W. M.; Song, X. Y.; Sosio, S.; Spataro, S.; Sun, G. X.; Sun, J. F.; Sun, S. S.; Sun, Y. J.; Sun, Y. Z.; Sun, Z. J.; Sun, Z. T.; Tang, C. J.; Tang, X.; Tapan, I.; Thomdike, E. H.; Tiemens, M.; Toth, D.; Ullrich, M.; Uman, I.; Varner, G. S.; Wang, B.; Wang, B. L.; Wang, D.; Wang, D. Y.; Wang, K.; Wang, L. L.; Wang, L. S.; Wang, M.; Wang, P.; Wang, P. L.; Wang, Q. J.; Wang, S. G.; Wang, W.; Wang, X. F.; Wang, Y. D.; Wang, Y. F.; Wang, Y. Q.; Wang, Z.; Wang, Z. G.; Wang, Z. H.; Wang, Z. Y.; Weber, T.; Wei, D. H.; Wei, J. B.; Weidenkaff, P.; Wen, S. P.; Wiedner, U.; Wolke, M.; Wu, L. H.; Wu, Z.; Xia, L. G.; Xia, Y.; Xiao, D.; Xiao, Z. J.; Xie, Y. G.; Xiu, Q. L.; Xu, G. F.; Xu, L.; Xu, Q. J.; Xu, Q. N.; Xu, X. P.; Yan, L.; Yan, W. B.; Yan, W. C.; Yan, Y. H.; Yang, H. X.; Yang, L.; Yang, Y.; Yang, Y. X.; Ye, H.; Ye, M.; Ye, M. H.; Yin, J. H.; Yu, B. X.; Yu, C. X.; Yu, H. W.; Yu, J. S.; Yuan, C. Z.; Yuan, W. L.; Yuan, Y.; Yuncu, A.; Zafar, A. A.; Zallo, A.; Zeng, Y.; Zhang, B. X.; Zhang, B. Y.; Zhang, C.; Zhang, C. C.; Zhang, D. H.; Zhang, H. H.; Zhang, H. Y.; Zhang, J. J.; Zhang, J. L.; Zhang, J. Q.; Zhang, J. W.; Zhang, J. Y.; Zhang, J. Z.; Zhang, K.; Zhang, L.; Zhang, S. H.; Zhang, X. Y.; Zhang, Y.; Zhang, Y. H.; Zhang, Y. T.; Zhang, Z. H.; Zhang, Z. P.; Zhang, Z. Y.; Zhao, G.; Zhao, J. W.; Zhao, J. Y.; Zhao, J. Z.; Zhao, Lei; Zhao, Ling; Zhao, M. G.; Zhao, Q.; Zhao, Q. W.; Zhao, S. J.; Zhao, T. C.; Zhao, Y. B.; Zhao, Z. G.; Zheruchugov, A.; Zheng, B.; Zheng, J. P.; Zheng, W. J.; Zheng, Y. H.; Zhong, B.; Zhou, L.; Zhou, Li; Zhou, X.; Zhou, X. K.; Zhou, X. R.; Zhou, X. Y.; Zhu, K.; Zhu, K. J.; Zhu, S.; Zhu, X. L.; Zhu, Y. C.; Zhu, Y. S.; Zhu, Z. A.; Zhuang, J.; Zotti, L.; Zou, B. S.; Zou, J. H.

    2015-01-01

    We report a measurement of the branching fraction for psi(3770) -> gamma chi(c1) and search for the transition psi(3770) -> gamma chi(c2) based on 2.92 fb(-1) of e(+)e(-) data accumulated at root s = 3.773 GeV with the BESIII detector at the BEPCII collider. We measure B(psi(3770) -> gamma chi(c1))

  11. Meson-meson bound state in a 2+1 lattice QCD model with two flavors and strong coupling

    International Nuclear Information System (INIS)

    Faria da Veiga, Paulo A.; O'Carroll, Michael; Neto, Antonio Francisco

    2005-01-01

    We consider the existence of bound states of two mesons in an imaginary-time formulation of lattice QCD. We analyze an SU(3) theory with two flavors in 2+1 dimensions and two-dimensional spin matrices. For a small hopping parameter and a sufficiently large glueball mass, as a preliminary, we show the existence of isoscalar and isovector mesonlike particles that have isolated dispersion curves (upper gap up to near the two-particle threshold ∼-4lnκ). The corresponding meson masses are equal up to and including O(κ 3 ) and are asymptotically of order -2lnκ-κ 2 . Considering the zero total isospin sector, we show that there is a meson-meson bound state solution to the Bethe-Salpeter equation in a ladder approximation, below the two-meson threshold, and with binding energy of order bκ 2 ≅0.02359κ 2 . In the context of the strong coupling expansion in κ, we show that there are two sources of meson-meson attraction. One comes from a quark-antiquark exchange. This is not a meson exchange, as the spin indices are not those of the meson particle, and we refer to this as a quasimeson exchange. The other arises from gauge field correlations of four overlapping bonds, two positively oriented and two of opposite orientation. Although the exchange part gives rise to a space range-one attractive potential, the main mechanism for the formation of the bound state comes from the gauge contribution. In our lattice Bethe-Salpeter equation approach, this mechanism is manifested by an attractive distance-zero energy-dependent potential. We recall that no bound state appeared in the one-flavor case, where the repulsive effect of Pauli exclusion is stronger

  12. Measurement of $\\chi_{c1}$ and $\\chi_{c2}$ production with $\\sqrt{s}=7$ TeV $pp$ collisions at ATLAS

    CERN Document Server

    Aad, Georges; Abbott, Brad; Abdallah, Jalal; Abdel Khalek, Samah; Abdinov, Ovsat; Aben, Rosemarie; Abi, Babak; Abolins, Maris; AbouZeid, Ossama; Abramowicz, Halina; Abreu, Henso; Abulaiti, Yiming; Acharya, Bobby Samir; Adamczyk, Leszek; Adams, David; Addy, Tetteh; Adelman, Jahred; Adomeit, Stefanie; Adye, Tim; Aefsky, Scott; Agatonovic-Jovin, Tatjana; Aguilar-Saavedra, Juan Antonio; Agustoni, Marco; Ahlen, Steven; Ahmad, Ashfaq; Ahmadov, Faig; Aielli, Giulio; {\\AA}kesson, Torsten Paul Ake; Akimoto, Ginga; Akimov, Andrei; Alam, Muhammad Aftab; Albert, Justin; Albrand, Solveig; Alconada Verzini, Maria Josefina; Aleksa, Martin; Aleksandrov, Igor; Alessandria, Franco; Alexa, Calin; Alexander, Gideon; Alexandre, Gauthier; Alexopoulos, Theodoros; Alhroob, Muhammad; Aliev, Malik; Alimonti, Gianluca; Alio, Lion; Alison, John; Allbrooke, Benedict; Allison, Lee John; Allport, Phillip; Allwood-Spiers, Sarah; Almond, John; Aloisio, Alberto; Alon, Raz; Alonso, Alejandro; Alonso, Francisco; Altheimer, Andrew David; Alvarez Gonzalez, Barbara; Alviggi, Mariagrazia; Amako, Katsuya; Amaral Coutinho, Yara; Amelung, Christoph; Ammosov, Vladimir; Amor Dos Santos, Susana Patricia; Amorim, Antonio; Amoroso, Simone; Amram, Nir; Amundsen, Glenn; Anastopoulos, Christos; Ancu, Lucian Stefan; Andari, Nansi; Andeen, Timothy; Anders, Christoph Falk; Anders, Gabriel; Anderson, Kelby; Andreazza, Attilio; Andrei, George Victor; Anduaga, Xabier; Angelidakis, Stylianos; Anger, Philipp; Angerami, Aaron; Anghinolfi, Francis; Anisenkov, Alexey; Anjos, Nuno; Annovi, Alberto; Antonaki, Ariadni; Antonelli, Mario; Antonov, Alexey; Antos, Jaroslav; Anulli, Fabio; Aoki, Masato; Aperio Bella, Ludovica; Apolle, Rudi; Arabidze, Giorgi; Aracena, Ignacio; Arai, Yasuo; Arce, Ayana; Arfaoui, Samir; Arguin, Jean-Francois; Argyropoulos, Spyridon; Arik, Engin; Arik, Metin; Armbruster, Aaron James; Arnaez, Olivier; Arnal, Vanessa; Arslan, Ozan; Artamonov, Andrei; Artoni, Giacomo; Asai, Shoji; Asbah, Nedaa; Ask, Stefan; {\\AA}sman, Barbro; Asquith, Lily; Assamagan, Ketevi; Astalos, Robert; Astbury, Alan; Atkinson, Markus; Atlay, Naim Bora; Auerbach, Benjamin; Auge, Etienne; Augsten, Kamil; Aurousseau, Mathieu; Avolio, Giuseppe; Azuelos, Georges; Azuma, Yuya; Baak, Max; Bacci, Cesare; Bach, Andre; Bachacou, Henri; Bachas, Konstantinos; Backes, Moritz; Backhaus, Malte; Backus Mayes, John; Badescu, Elisabeta; Bagiacchi, Paolo; Bagnaia, Paolo; Bai, Yu; Bailey, David; Bain, Travis; Baines, John; Baker, Oliver Keith; Baker, Sarah; Balek, Petr; Balli, Fabrice; Banas, Elzbieta; Banerjee, Swagato; Banfi, Danilo; Bangert, Andrea Michelle; Bansal, Vikas; Bansil, Hardeep Singh; Barak, Liron; Baranov, Sergei; Barber, Tom; Barberio, Elisabetta Luigia; Barberis, Dario; Barbero, Marlon; Barillari, Teresa; Barisonzi, Marcello; Barklow, Timothy; Barlow, Nick; Barnett, Bruce; Barnett, Michael; Baroncelli, Antonio; Barone, Gaetano; Barr, Alan; Barreiro, Fernando; Barreiro Guimaraes da Costa, Joao; Bartoldus, Rainer; Barton, Adam Edward; Bartos, Pavol; Bartsch, Valeria; Bassalat, Ahmed; Basye, Austin; Bates, Richard; Batkova, Lucia; Batley, Richard; Battistin, Michele; Bauer, Florian; Bawa, Harinder Singh; Beau, Tristan; Beauchemin, Pierre-Hugues; Beccherle, Roberto; Bechtle, Philip; Beck, Hans Peter; Becker, Anne Kathrin; Becker, Sebastian; Beckingham, Matthew; Beddall, Andrew; Beddall, Ayda; Bedikian, Sourpouhi; Bednyakov, Vadim; Bee, Christopher; Beemster, Lars; Beermann, Thomas; Begel, Michael; Behr, Katharina; Belanger-Champagne, Camille; Bell, Paul; Bell, William; Bella, Gideon; Bellagamba, Lorenzo; Bellerive, Alain; Bellomo, Massimiliano; Belloni, Alberto; Beloborodova, Olga; Belotskiy, Konstantin; Beltramello, Olga; Benary, Odette; Benchekroun, Driss; Bendtz, Katarina; Benekos, Nektarios; Benhammou, Yan; Benhar Noccioli, Eleonora; Benitez Garcia, Jorge-Armando; Benjamin, Douglas; Bensinger, James; Benslama, Kamal; Bentvelsen, Stan; Berge, David; Bergeaas Kuutmann, Elin; Berger, Nicolas; Berghaus, Frank; Berglund, Elina; Beringer, Jurg; Bernard, Clare; Bernat, Pauline; Bernhard, Ralf; Bernius, Catrin; Bernlochner, Florian Urs; Berry, Tracey; Berta, Peter; Bertella, Claudia; Bertolucci, Federico; Besana, Maria Ilaria; Besjes, Geert-Jan; Bessidskaia, Olga; Besson, Nathalie; Bethke, Siegfried; Bhimji, Wahid; Bianchi, Riccardo-Maria; Bianchini, Louis; Bianco, Michele; Biebel, Otmar; Bieniek, Stephen Paul; Bierwagen, Katharina; Biesiada, Jed; Biglietti, Michela; Bilbao De Mendizabal, Javier; Bilokon, Halina; Bindi, Marcello; Binet, Sebastien; Bingul, Ahmet; Bini, Cesare; Bittner, Bernhard; Black, Curtis; Black, James; Black, Kevin; Blackburn, Daniel; Blair, Robert; Blanchard, Jean-Baptiste; Blazek, Tomas; Bloch, Ingo; Blocker, Craig; Blum, Walter; Blumenschein, Ulrike; Bobbink, Gerjan; Bobrovnikov, Victor; Bocchetta, Simona Serena; Bocci, Andrea; Boddy, Christopher Richard; Boehler, Michael; Boek, Jennifer; Boek, Thorsten Tobias; Boelaert, Nele; Bogaerts, Joannes Andreas; Bogdanchikov, Alexander; Bogouch, Andrei; Bohm, Christian; Bohm, Jan; Boisvert, Veronique; Bold, Tomasz; Boldea, Venera; Boldyrev, Alexey; Bolnet, Nayanka Myriam; Bomben, Marco; Bona, Marcella; Boonekamp, Maarten; Bordoni, Stefania; Borer, Claudia; Borisov, Anatoly; Borissov, Guennadi; Borri, Marcello; Borroni, Sara; Bortfeldt, Jonathan; Bortolotto, Valerio; Bos, Kors; Boscherini, Davide; Bosman, Martine; Boterenbrood, Hendrik; Bouchami, Jihene; Boudreau, Joseph; Bouhova-Thacker, Evelina Vassileva; Boumediene, Djamel Eddine; Bourdarios, Claire; Bousson, Nicolas; Boutouil, Sara; Boveia, Antonio; Boyd, James; Boyko, Igor; Bozovic-Jelisavcic, Ivanka; Bracinik, Juraj; Branchini, Paolo; Brandt, Andrew; Brandt, Gerhard; Brandt, Oleg; Bratzler, Uwe; Brau, Benjamin; Brau, James; Braun, Helmut; Brazzale, Simone Federico; Brelier, Bertrand; Brendlinger, Kurt; Brenner, Richard; Bressler, Shikma; Bristow, Timothy Michael; Britton, Dave; Brochu, Frederic; Brock, Ian; Brock, Raymond; Broggi, Francesco; Bromberg, Carl; Bronner, Johanna; Brooijmans, Gustaaf; Brooks, Timothy; Brooks, William; Brosamer, Jacquelyn; Brost, Elizabeth; Brown, Gareth; Brown, Jonathan; Bruckman de Renstrom, Pawel; Bruncko, Dusan; Bruneliere, Renaud; Brunet, Sylvie; Bruni, Alessia; Bruni, Graziano; Bruschi, Marco; Bryngemark, Lene; Buanes, Trygve; Buat, Quentin; Bucci, Francesca; Buchholz, Peter; Buckingham, Ryan; Buckley, Andrew; Buda, Stelian Ioan; Budagov, Ioulian; Budick, Burton; Buehrer, Felix; Bugge, Lars; Bugge, Magnar Kopangen; Bulekov, Oleg; Bundock, Aaron Colin; Bunse, Moritz; Burckhart, Helfried; Burdin, Sergey; Burgess, Thomas; Burghgrave, Blake; Burke, Stephen; Burmeister, Ingo; Busato, Emmanuel; Buscher, Volker; Bussey, Peter; Buszello, Claus-Peter; Butler, Bart; Butler, John; Butt, Aatif Imtiaz; Buttar, Craig; Butterworth, Jonathan; Buttinger, William; Buzatu, Adrian; Byszewski, Marcin; Cabrera Urb\\'an, Susana; Caforio, Davide; Cakir, Orhan; Calafiura, Paolo; Calderini, Giovanni; Calfayan, Philippe; Calkins, Robert; Caloba, Luiz; Caloi, Rita; Calvet, David; Calvet, Samuel; Camacho Toro, Reina; Camarri, Paolo; Cameron, David; Caminada, Lea Michaela; Caminal Armadans, Roger; Campana, Simone; Campanelli, Mario; Canale, Vincenzo; Canelli, Florencia; Canepa, Anadi; Cantero, Josu; Cantrill, Robert; Cao, Tingting; Capeans Garrido, Maria Del Mar; Caprini, Irinel; Caprini, Mihai; Capua, Marcella; Caputo, Regina; Cardarelli, Roberto; Carli, Tancredi; Carlino, Gianpaolo; Carminati, Leonardo; Caron, Sascha; Carquin, Edson; Carrillo-Montoya, German D; Carter, Antony; Carter, Janet; Carvalho, Joao; Casadei, Diego; Casado, Maria Pilar; Caso, Carlo; Castaneda-Miranda, Elizabeth; Castelli, Angelantonio; Castillo Gimenez, Victoria; Castro, Nuno Filipe; Catastini, Pierluigi; Catinaccio, Andrea; Catmore, James; Cattai, Ariella; Cattani, Giordano; Caughron, Seth; Cavaliere, Viviana; Cavalli, Donatella; Cavalli-Sforza, Matteo; Cavasinni, Vincenzo; Ceradini, Filippo; Cerio, Benjamin; Cerny, Karel; Santiago Cerqueira, Augusto; Cerri, Alessandro; Cerrito, Lucio; Cerutti, Fabio; Cervelli, Alberto; Cetin, Serkant Ali; Chafaq, Aziz; Chakraborty, Dhiman; Chalupkova, Ina; Chan, Kevin; Chang, Philip; Chapleau, Bertrand; Chapman, John Derek; Charfeddine, Driss; Charlton, Dave; Chavda, Vikash; Chavez Barajas, Carlos Alberto; Cheatham, Susan; Chekanov, Sergei; Chekulaev, Sergey; Chelkov, Gueorgui; Chelstowska, Magda Anna; Chen, Chunhui; Chen, Hucheng; Chen, Karen; Chen, Liming; Chen, Shenjian; Chen, Xin; Chen, Yujiao; Cheng, Yangyang; Cheplakov, Alexander; Cherkaoui El Moursli, Rajaa; Chernyatin, Valeriy; Cheu, Elliott; Chevalier, Laurent; Chiarella, Vitaliano; Chiefari, Giovanni; Childers, John Taylor; Chilingarov, Alexandre; Chiodini, Gabriele; Chisholm, Andrew; Chislett, Rebecca Thalatta; Chitan, Adrian; Chizhov, Mihail; Chouridou, Sofia; Chow, Bonnie Kar Bo; Christidi, Ilektra-Athanasia; Chromek-Burckhart, Doris; Chu, Ming-Lee; Chudoba, Jiri; Ciapetti, Guido; Ciftci, Abbas Kenan; Ciftci, Rena; Cinca, Diane; Cindro, Vladimir; Ciocio, Alessandra; Cirilli, Manuela; Cirkovic, Predrag; Citron, Zvi Hirsh; Citterio, Mauro; Ciubancan, Mihai; Clark, Allan G; Clark, Philip James; Clarke, Robert; Cleland, Bill; Clemens, Jean-Claude; Clement, Benoit; Clement, Christophe; Coadou, Yann; Cobal, Marina; Coccaro, Andrea; Cochran, James H; Coelli, Simone; Coffey, Laurel; Cogan, Joshua Godfrey; Coggeshall, James; Colas, Jacques; Cole, Brian; Cole, Stephen; Colijn, Auke-Pieter; Collins-Tooth, Christopher; Collot, Johann; Colombo, Tommaso; Colon, German; Compostella, Gabriele; Conde Muino, Patricia; Coniavitis, Elias; Conidi, Maria Chiara; Connelly, Ian; Consonni, Sofia Maria; Consorti, Valerio; Constantinescu, Serban; Conta, Claudio; Conti, Geraldine; Conventi, Francesco; Cooke, Mark; Cooper, Ben; Cooper-Sarkar, Amanda; Cooper-Smith, Neil; Copic, Katherine; Cornelissen, Thijs; Corradi, Massimo; Corriveau, Francois; Corso-Radu, Alina; Cortes-Gonzalez, Arely; Cortiana, Giorgio; Costa, Giuseppe; Costa, Mar\\'ia Jos\\'e; Costanzo, Davide; C\\^ot\\'e, David; Cottin, Giovanna; Courneyea, Lorraine; Cowan, Glen; Cox, Brian; Cranmer, Kyle; Cree, Graham; Cr\\'ep\\'e-Renaudin, Sabine; Crescioli, Francesco; Crispin Ortuzar, Mireia; Cristinziani, Markus; Crosetti, Giovanni; Cuciuc, Constantin-Mihai; Cuenca Almenar, Crist\\'obal; Cuhadar Donszelmann, Tulay; Cummings, Jane; Curatolo, Maria; Cuthbert, Cameron; Czirr, Hendrik; Czodrowski, Patrick; Czyczula, Zofia; D'Auria, Saverio; D'Onofrio, Monica; D'Orazio, Alessia; Da Cunha Sargedas De Sousa, Mario Jose; Da Via, Cinzia; Dabrowski, Wladyslaw; Dafinca, Alexandru; Dai, Tiesheng; Dallaire, Frederick; Dallapiccola, Carlo; Dam, Mogens; Daniells, Andrew Christopher; Dano Hoffmann, Maria; Dao, Valerio; Darbo, Giovanni; Darlea, Georgiana Lavinia; Darmora, Smita; Dassoulas, James; Davey, Will; David, Claire; Davidek, Tomas; Davies, Eleanor; Davies, Merlin; Davignon, Olivier; Davison, Adam; Davygora, Yuriy; Dawe, Edmund; Dawson, Ian; Daya-Ishmukhametova, Rozmin; De, Kaushik; de Asmundis, Riccardo; De Castro, Stefano; De Cecco, Sandro; de Graat, Julien; De Groot, Nicolo; de Jong, Paul; De La Taille, Christophe; De la Torre, Hector; De Lorenzi, Francesco; De Nooij, Lucie; De Pedis, Daniele; De Salvo, Alessandro; De Sanctis, Umberto; De Santo, Antonella; De Vivie De Regie, Jean-Baptiste; De Zorzi, Guido; Dearnaley, William James; Debbe, Ramiro; Debenedetti, Chiara; Dechenaux, Benjamin; Dedovich, Dmitri; Degenhardt, James; Del Peso, Jose; Del Prete, Tarcisio; Delemontex, Thomas; Deliot, Frederic; Deliyergiyev, Maksym; Dell'Acqua, Andrea; Dell'Asta, Lidia; Della Pietra, Massimo; della Volpe, Domenico; Delmastro, Marco; Delsart, Pierre-Antoine; Deluca, Carolina; Demers, Sarah; Demichev, Mikhail; Demilly, Aurelien; Demirkoz, Bilge; Denisov, Sergey; Derendarz, Dominik; Derkaoui, Jamal Eddine; Derue, Frederic; Dervan, Paul; Desch, Klaus Kurt; Deviveiros, Pier-Olivier; Dewhurst, Alastair; DeWilde, Burton; Dhaliwal, Saminder; Dhullipudi, Ramasudhakar; Di Ciaccio, Anna; Di Ciaccio, Lucia; Di Domenico, Antonio; Di Donato, Camilla; Di Girolamo, Alessandro; Di Girolamo, Beniamino; Di Mattia, Alessandro; Di Micco, Biagio; Di Nardo, Roberto; Di Simone, Andrea; Di Sipio, Riccardo; Di Valentino, David; Diaz, Marco Aurelio; Diehl, Edward; Dietrich, Janet; Dietzsch, Thorsten; Diglio, Sara; Dindar Yagci, Kamile; Dingfelder, Jochen; Dionisi, Carlo; Dita, Petre; Dita, Sanda; Dittus, Fridolin; Djama, Fares; Djobava, Tamar; Barros do Vale, Maria Aline; Do Valle Wemans, Andr\\'e; Doan, Thi Kieu Oanh; Dobos, Daniel; Dobson, Ellie; Dodd, Jeremy; Doglioni, Caterina; Doherty, Tom; Dohmae, Takeshi; Dolejsi, Jiri; Dolezal, Zdenek; Dolgoshein, Boris; Donadelli, Marisilvia; Donati, Simone; Dondero, Paolo; Donini, Julien; Dopke, Jens; Doria, Alessandra; Dos Anjos, Andre; Dotti, Andrea; Dova, Maria-Teresa; Doyle, Tony; Dris, Manolis; Dubbert, Jorg; Dube, Sourabh; Dubreuil, Emmanuelle; Duchovni, Ehud; Duckeck, Guenter; Ducu, Otilia Anamaria; Duda, Dominik; Dudarev, Alexey; Dudziak, Fanny; Duflot, Laurent; Duguid, Liam; Duhrssen, Michael; Dunford, Monica; Duran Yildiz, Hatice; Duren, Michael; Dwuznik, Michal; Ebke, Johannes; Edson, William; Edwards, Clive; Edwards, Nicholas Charles; Ehrenfeld, Wolfgang; Eifert, Till; Eigen, Gerald; Einsweiler, Kevin; Eisenhandler, Eric; Ekelof, Tord; El Kacimi, Mohamed; Ellert, Mattias; Elles, Sabine; Ellinghaus, Frank; Ellis, Katherine; Ellis, Nicolas; Elmsheuser, Johannes; Elsing, Markus; Emeliyanov, Dmitry; Enari, Yuji; Endner, Oliver Chris; Endo, Masaki; Engelmann, Roderich; Erdmann, Johannes; Ereditato, Antonio; Eriksson, Daniel; Ernis, Gunar; Ernst, Jesse; Ernst, Michael; Ernwein, Jean; Errede, Deborah; Errede, Steven; Ertel, Eugen; Escalier, Marc; Esch, Hendrik; Escobar, Carlos; Espinal Curull, Xavier; Esposito, Bellisario; Etienne, Francois; Etienvre, Anne-Isabelle; Etzion, Erez; Evangelakou, Despoina; Evans, Hal; Fabbri, Laura; Facini, Gabriel; Fakhrutdinov, Rinat; Falciano, Speranza; Fang, Yaquan; Fanti, Marcello; Farbin, Amir; Farilla, Addolorata; Farooque, Trisha; Farrell, Steven; Farrington, Sinead; Farthouat, Philippe; Fassi, Farida; Fassnacht, Patrick; Fassouliotis, Dimitrios; Fatholahzadeh, Baharak; Favareto, Andrea; Fayard, Louis; Federic, Pavol; Fedin, Oleg; Fedorko, Wojciech; Fehling-Kaschek, Mirjam; Feligioni, Lorenzo; Feng, Cunfeng; Feng, Eric; Feng, Haolu; Fenyuk, Alexander; Fernando, Waruna; Ferrag, Samir; Ferrando, James; Ferrara, Valentina; Ferrari, Arnaud; Ferrari, Pamela; Ferrari, Roberto; Ferreira de Lima, Danilo Enoque; Ferrer, Antonio; Ferrere, Didier; Ferretti, Claudio; Ferretto Parodi, Andrea; Fiascaris, Maria; Fiedler, Frank; Filip\\v{c}i\\v{c}, Andrej; Filipuzzi, Marco; Filthaut, Frank; Fincke-Keeler, Margret; Finelli, Kevin Daniel; Fiolhais, Miguel; Fiorini, Luca; Firan, Ana; Fischer, Julia; Fisher, Matthew; Fitzgerald, Eric Andrew; Flechl, Martin; Fleck, Ivor; Fleischmann, Philipp; Fleischmann, Sebastian; Fletcher, Gareth Thomas; Fletcher, Gregory; Flick, Tobias; Floderus, Anders; Flores Castillo, Luis; Florez Bustos, Andres Carlos; Flowerdew, Michael; Fonseca Martin, Teresa; Formica, Andrea; Forti, Alessandra; Fortin, Dominique; Fournier, Daniel; Fox, Harald; Francavilla, Paolo; Franchini, Matteo; Franchino, Silvia; Francis, David; Franklin, Melissa; Franz, Sebastien; Fraternali, Marco; Fratina, Sasa; French, Sky; Friedrich, Conrad; Friedrich, Felix; Froidevaux, Daniel; Frost, James; Fukunaga, Chikara; Fullana Torregrosa, Esteban; Fulsom, Bryan Gregory; Fuster, Juan; Gabaldon, Carolina; Gabizon, Ofir; Gabrielli, Alessandro; Gabrielli, Andrea; Gadatsch, Stefan; Gadfort, Thomas; Gadomski, Szymon; Gagliardi, Guido; Gagnon, Pauline; Galea, Cristina; Galhardo, Bruno; Gallas, Elizabeth; Gallo, Valentina Santina; Gallop, Bruce; Gallus, Petr; Galster, Gorm Aske Gram Krohn; Gan, KK; Gandrajula, Reddy Pratap; Gao, Jun; Gao, Yongsheng; Garay Walls, Francisca; Garberson, Ford; Garc\\'ia, Carmen; Garc\\'ia Navarro, Jos\\'e Enrique; Garcia-Sciveres, Maurice; Gardner, Robert; Garelli, Nicoletta; Garonne, Vincent; Gatti, Claudio; Gaudio, Gabriella; Gaur, Bakul; Gauthier, Lea; Gauzzi, Paolo; Gavrilenko, Igor; Gay, Colin; Gaycken, Goetz; Gazis, Evangelos; Ge, Peng; Gecse, Zoltan; Gee, Norman; Geerts, Daniel Alphonsus Adrianus; Geich-Gimbel, Christoph; Gellerstedt, Karl; Gemme, Claudia; Gemmell, Alistair; Genest, Marie-H\\'el\\`ene; Gentile, Simonetta; George, Matthias; George, Simon; Gerbaudo, Davide; Gershon, Avi; Ghazlane, Hamid; Ghodbane, Nabil; Giacobbe, Benedetto; Giagu, Stefano; Giangiobbe, Vincent; Giannetti, Paola; Gianotti, Fabiola; Gibbard, Bruce; Gibson, Stephen; Gilchriese, Murdock; Gillam, Thomas; Gillberg, Dag; Gillman, Tony; Gingrich, Douglas; Giokaris, Nikos; Giordani, MarioPaolo; Giordano, Raffaele; Giorgi, Francesco Michelangelo; Giovannini, Paola; Giraud, Pierre-Francois; Giugni, Danilo; Giuliani, Claudia; Giunta, Michele; Gjelsten, B{\\o}rge Kile; Gkialas, Ioannis; Gladilin, Leonid; Glasman, Claudia; Glatzer, Julian; Glazov, Alexandre; Glonti, George; Goblirsch-Kolb, Maximilian; Goddard, Jack Robert; Godfrey, Jennifer; Godlewski, Jan; Goeringer, Christian; Goldfarb, Steven; Golling, Tobias; Golubkov, Dmitry; Gomes, Agostinho; Gomez Fajardo, Luz Stella; Gon\\c calo, Ricardo; Goncalves Pinto Firmino Da Costa, Joao; Gonella, Laura; Gonz\\'alez de la Hoz, Santiago; Gonzalez Parra, Garoe; Gonzalez Silva, Laura; Gonzalez-Sevilla, Sergio; Goodson, Jeremiah Jet; Goossens, Luc; Gorbounov, Petr Andreevich; Gordon, Howard; Gorelov, Igor; Gorfine, Grant; Gorini, Benedetto; Gorini, Edoardo; Gori\\v{s}ek, Andrej; Gornicki, Edward; Goshaw, Alfred; Gossling, Claus; Gostkin, Mikhail Ivanovitch; Gouighri, Mohamed; Goujdami, Driss; Goulette, Marc Phillippe; Goussiou, Anna; Goy, Corinne; Gozpinar, Serdar; Grabas, Herve Marie Xavier; Graber, Lars; Grabowska-Bold, Iwona; Grafstrom, Per; Grahn, Karl-Johan; Gramling, Johanna; Gramstad, Eirik; Grancagnolo, Francesco; Grancagnolo, Sergio; Grassi, Valerio; Gratchev, Vadim; Gray, Heather; Gray, Julia Ann; Graziani, Enrico; Grebenyuk, Oleg; Greenwood, Zeno Dixon; Gregersen, Kristian; Gregor, Ingrid-Maria; Grenier, Philippe; Griffiths, Justin; Grigalashvili, Nugzar; Grillo, Alexander; Grimm, Kathryn; Grinstein, Sebastian; Gris, Philippe Luc Yves; Grishkevich, Yaroslav; Grivaz, Jean-Francois; Grohs, Johannes Philipp; Grohsjean, Alexander; Gross, Eilam; Grosse-Knetter, Joern; Grossi, Giulio Cornelio; Groth-Jensen, Jacob; Grout, Zara Jane; Grybel, Kai; Guescini, Francesco; Guest, Daniel; Gueta, Orel; Guicheney, Christophe; Guido, Elisa; Guillemin, Thibault; Guindon, Stefan; Gul, Umar; Gumpert, Christian; Gunther, Jaroslav; Guo, Jun; Gupta, Shaun; Gutierrez, Phillip; Gutierrez Ortiz, Nicolas Gilberto; Gutschow, Christian; Guttman, Nir; Guyot, Claude; Gwenlan, Claire; Gwilliam, Carl; Haas, Andy; Haber, Carl; Hadavand, Haleh Khani; Haefner, Petra; Hageboeck, Stephan; Hajduk, Zbigniew; Hakobyan, Hrachya; Haleem, Mahsana; Hall, David; Halladjian, Garabed; Hamacher, Klaus; Hamal, Petr; Hamano, Kenji; Hamer, Matthias; Hamilton, Andrew; Hamilton, Samuel; Han, Liang; Hanagaki, Kazunori; Hanawa, Keita; Hance, Michael; Hanke, Paul; Hansen, John Renner; Hansen, J{\\o}rgen Beck; Hansen, Jorn Dines; Hansen, Peter Henrik; Hansson, Per; Hara, Kazuhiko; Hard, Andrew; Harenberg, Torsten; Harkusha, Siarhei; Harper, Devin; Harrington, Robert; Harris, Orin; Harrison, Paul Fraser; Hartjes, Fred; Harvey, Alex; Hasegawa, Satoshi; Hasegawa, Yoji; Hassani, Samira; Haug, Sigve; Hauschild, Michael; Hauser, Reiner; Havranek, Miroslav; Hawkes, Christopher; Hawkings, Richard John; Hawkins, Anthony David; Hayashi, Takayasu; Hayden, Daniel; Hays, Chris; Hayward, Helen; Haywood, Stephen; Head, Simon; Heck, Tobias; Hedberg, Vincent; Heelan, Louise; Heim, Sarah; Heinemann, Beate; Heisterkamp, Simon; Hejbal, Jiri; Helary, Louis; Heller, Claudio; Heller, Matthieu; Hellman, Sten; Hellmich, Dennis; Helsens, Clement; Henderson, James; Henderson, Robert; Henrichs, Anna; Henriques Correia, Ana Maria; Henrot-Versille, Sophie; Hensel, Carsten; Herbert, Geoffrey Henry; Medina Hernandez, Carlos; Hern\\'andez Jim\\'enez, Yesenia; Herrberg-Schubert, Ruth; Herten, Gregor; Hertenberger, Ralf; Hervas, Luis; Hesketh, Gavin Grant; Hessey, Nigel; Hickling, Robert; Hig\\'on-Rodriguez, Emilio; Hill, John; Hiller, Karl Heinz; Hillert, Sonja; Hillier, Stephen; Hinchliffe, Ian; Hines, Elizabeth; Hirose, Minoru; Hirschbuehl, Dominic; Hobbs, John; Hod, Noam; Hodgkinson, Mark; Hodgson, Paul; Hoecker, Andreas; Hoeferkamp, Martin; Hoffman, Julia; Hoffmann, Dirk; Hofmann, Julia Isabell; Hohlfeld, Marc; Holmes, Tova Ray; Hong, Tae Min; Hooft van Huysduynen, Loek; Hostachy, Jean-Yves; Hou, Suen; Hoummada, Abdeslam; Howard, Jacob; Howarth, James; Hrabovsky, Miroslav; Hristova, Ivana; Hrivnac, Julius; Hryn'ova, Tetiana; Hsu, Pai-hsien Jennifer; Hsu, Shih-Chieh; Hu, Diedi; Hu, Xueye; Huang, Yanping; Hubacek, Zdenek; Hubaut, Fabrice; Huegging, Fabian; Huettmann, Antje; Huffman, Todd Brian; Hughes, Emlyn; Hughes, Gareth; Huhtinen, Mika; Hulsing, Tobias Alexander; Hurwitz, Martina; Huseynov, Nazim; Huston, Joey; Huth, John; Iacobucci, Giuseppe; Iakovidis, Georgios; Ibragimov, Iskander; Iconomidou-Fayard, Lydia; Idarraga, John; Ideal, Emma; Iengo, Paolo; Igonkina, Olga; Iizawa, Tomoya; Ikegami, Yoichi; Ikematsu, Katsumasa; Ikeno, Masahiro; Iliadis, Dimitrios; Ilic, Nikolina; Inamaru, Yuki; Ince, Tayfun; Ioannou, Pavlos; Iodice, Mauro; Iordanidou, Kalliopi; Ippolito, Valerio; Irles Quiles, Adrian; Isaksson, Charlie; Ishino, Masaya; Ishitsuka, Masaki; Ishmukhametov, Renat; Issever, Cigdem; Istin, Serhat; Ivashin, Anton; Iwanski, Wieslaw; Iwasaki, Hiroyuki; Izen, Joseph; Izzo, Vincenzo; Jackson, Brett; Jackson, John; Jackson, Matthew; Jackson, Paul; Jaekel, Martin; Jain, Vivek; Jakobs, Karl; Jakobsen, Sune; Jakoubek, Tomas; Jakubek, Jan; Jamin, David Olivier; Jana, Dilip; Jansen, Eric; Jansen, Hendrik; Janssen, Jens; Janus, Michel; Jared, Richard; Jarlskog, Goran; Jeanty, Laura; Jeng, Geng-yuan; Jen-La Plante, Imai; Jennens, David; Jenni, Peter; Jentzsch, Jennifer; Jeske, Carl; J\\'ez\\'equel, St\\'ephane; Jha, Manoj Kumar; Ji, Haoshuang; Ji, Weina; Jia, Jiangyong; Jiang, Yi; Jimenez Belenguer, Marcos; Jin, Shan; Jinaru, Adam; Jinnouchi, Osamu; Joergensen, Morten Dam; Joffe, David; Johansson, Erik; Johansson, Per; Johns, Kenneth; Jon-And, Kerstin; Jones, Graham; Jones, Roger; Jones, Tim; Jorge, Pedro; Joshi, Kiran Daniel; Jovicevic, Jelena; Ju, Xiangyang; Jung, Christian; Jungst, Ralph Markus; Jussel, Patrick; Juste Rozas, Aurelio; Kaci, Mohammed; Kaczmarska, Anna; Kadlecik, Peter; Kado, Marumi; Kagan, Harris; Kagan, Michael; Kajomovitz, Enrique; Kalinin, Sergey; Kama, Sami; Kanaya, Naoko; Kaneda, Michiru; Kaneti, Steven; Kanno, Takayuki; Kantserov, Vadim; Kanzaki, Junichi; Kaplan, Benjamin; Kapliy, Anton; Kar, Deepak; Karakostas, Konstantinos; Karastathis, Nikolaos; Karnevskiy, Mikhail; Karpov, Sergey; Karthik, Krishnaiyengar; Kartvelishvili, Vakhtang; Karyukhin, Andrey; Kashif, Lashkar; Kasieczka, Gregor; Kass, Richard; Kastanas, Alex; Kataoka, Yousuke; Katre, Akshay; Katzy, Judith; Kaushik, Venkatesh; Kawagoe, Kiyotomo; Kawamoto, Tatsuo; Kawamura, Gen; Kazama, Shingo; Kazanin, Vassili; Kazarinov, Makhail; Keeler, Richard; Keener, Paul; Kehoe, Robert; Keil, Markus; Keller, John; Keoshkerian, Houry; Kepka, Oldrich; Ker\\v{s}evan, Borut Paul; Kersten, Susanne; Kessoku, Kohei; Keung, Justin; Khalil-zada, Farkhad; Khandanyan, Hovhannes; Khanov, Alexander; Kharchenko, Dmitri; Khodinov, Alexander; Khomich, Andrei; Khoo, Teng Jian; Khoriauli, Gia; Khoroshilov, Andrey; Khovanskiy, Valery; Khramov, Evgeniy; Khubua, Jemal; Kim, Hyeon Jin; Kim, Shinhong; Kimura, Naoki; Kind, Oliver; King, Barry; King, Matthew; King, Robert Steven Beaufoy; King, Samuel Burton; Kirk, Julie; Kiryunin, Andrey; Kishimoto, Tomoe; Kisielewska, Danuta; Kitamura, Takumi; Kittelmann, Thomas; Kiuchi, Kenji; Kladiva, Eduard; Klein, Max; Klein, Uta; Kleinknecht, Konrad; Klimek, Pawel; Klimentov, Alexei; Klingenberg, Reiner; Klinger, Joel Alexander; Klinkby, Esben; Klioutchnikova, Tatiana; Klok, Peter; Kluge, Eike-Erik; Kluit, Peter; Kluth, Stefan; Kneringer, Emmerich; Knoops, Edith; Knue, Andrea; Kobayashi, Tomio; Kobel, Michael; Kocian, Martin; Kodys, Peter; Koenig, Sebastian; Koevesarki, Peter; Koffas, Thomas; Koffeman, Els; Kogan, Lucy Anne; Kohlmann, Simon; Kohout, Zdenek; Kohriki, Takashi; Koi, Tatsumi; Kolanoski, Hermann; Koletsou, Iro; Koll, James; Komar, Aston; Komori, Yuto; Kondo, Takahiko; Koneke, Karsten; Konig, Adriaan; Kono, Takanori; Konoplich, Rostislav; Konstantinidis, Nikolaos; Kopeliansky, Revital; Koperny, Stefan; Kopke, Lutz; Kopp, Anna Katharina; Korcyl, Krzysztof; Kordas, Kostantinos; Korn, Andreas; Korol, Aleksandr; Korolkov, Ilya; Korolkova, Elena; Korotkov, Vladislav; Kortner, Oliver; Kortner, Sandra; Kostyukhin, Vadim; Kotov, Sergey; Kotov, Vladislav; Kotwal, Ashutosh; Kourkoumelis, Christine; Kouskoura, Vasiliki; Koutsman, Alex; Kowalewski, Robert Victor; Kowalski, Tadeusz; Kozanecki, Witold; Kozhin, Anatoly; Kral, Vlastimil; Kramarenko, Viktor; Kramberger, Gregor; Krasny, Mieczyslaw Witold; Krasznahorkay, Attila; Kraus, Jana; Kravchenko, Anton; Kreiss, Sven; Kretzschmar, Jan; Kreutzfeldt, Kristof; Krieger, Nina; Krieger, Peter; Kroeninger, Kevin; Kroha, Hubert; Kroll, Joe; Kroseberg, Juergen; Krstic, Jelena; Kruchonak, Uladzimir; Kruger, Hans; Kruker, Tobias; Krumnack, Nils; Krumshteyn, Zinovii; Kruse, Amanda; Kruse, Mark; Kruskal, Michael; Kubota, Takashi; Kuday, Sinan; Kuehn, Susanne; Kugel, Andreas; Kuhl, Thorsten; Kukhtin, Victor; Kulchitsky, Yuri; Kuleshov, Sergey; Kuna, Marine; Kunkle, Joshua; Kupco, Alexander; Kurashige, Hisaya; Kurata, Masakazu; Kurochkin, Yurii; Kurumida, Rie; Kus, Vlastimil; Kuwertz, Emma Sian; Kuze, Masahiro; Kvita, Jiri; Kwee, Regina; La Rosa, Alessandro; La Rotonda, Laura; Labarga, Luis; Lablak, Said; Lacasta, Carlos; Lacava, Francesco; Lacey, James; Lacker, Heiko; Lacour, Didier; Lacuesta, Vicente Ram\\'on; Ladygin, Evgueni; Lafaye, Remi; Laforge, Bertrand; Lagouri, Theodota; Lai, Stanley; Laier, Heiko; Laisne, Emmanuel; Lambourne, Luke; Lampen, Caleb; Lampl, Walter; Lan\\c con, Eric; Landgraf, Ulrich; Landon, Murrough; Lang, Valerie Susanne; Lange, Clemens; Lankford, Andrew; Lanni, Francesco; Lantzsch, Kerstin; Lanza, Agostino; Laplace, Sandrine; Lapoire, Cecile; Laporte, Jean-Francois; Lari, Tommaso; Larner, Aimee; Lassnig, Mario; Laurelli, Paolo; Lavorini, Vincenzo; Lavrijsen, Wim; Laycock, Paul; Le, Bao Tran; Le Dortz, Olivier; Le Guirriec, Emmanuel; Le Menedeu, Eve; LeCompte, Thomas; Ledroit-Guillon, Fabienne Agnes Marie; Lee, Claire Alexandra; Lee, Hurng-Chun; Lee, Jason; Lee, Shih-Chang; Lee, Lawrence; Lefebvre, Guillaume; Lefebvre, Michel; Legger, Federica; Leggett, Charles; Lehan, Allan; Lehmacher, Marc; Lehmann Miotto, Giovanna; Lei, Xiaowen; Leister, Andrew Gerard; Leite, Marco Aurelio Lisboa; Leitner, Rupert; Lellouch, Daniel; Lemmer, Boris; Lendermann, Victor; Leney, Katharine; Lenz, Tatjana; Lenzen, Georg; Lenzi, Bruno; Leone, Robert; Leonhardt, Kathrin; Leontsinis, Stefanos; Leroy, Claude; Lessard, Jean-Raphael; Lester, Christopher; Lester, Christopher Michael; Lev\\^eque, Jessica; Levin, Daniel; Levinson, Lorne; Lewis, Adrian; Lewis, George; Leyko, Agnieszka; Leyton, Michael; Li, Bing; Li, Bo; Li, Haifeng; Li, Ho Ling; Li, Shu; Li, Xuefei; Liang, Zhijun; Liao, Hongbo; Liberti, Barbara; Lichard, Peter; Lie, Ki; Liebal, Jessica; Liebig, Wolfgang; Limbach, Christian; Limosani, Antonio; Limper, Maaike; Lin, Simon; Linde, Frank; Lindquist, Brian Edward; Linnemann, James; Lipeles, Elliot; Lipniacka, Anna; Lisovyi, Mykhailo; Liss, Tony; Lissauer, David; Lister, Alison; Litke, Alan; Liu, Bo; Liu, Dong; Liu, Jianbei; Liu, Kun; Liu, Lulu; Liu, Miaoyuan; Liu, Minghui; Liu, Yanwen; Livan, Michele; Livermore, Sarah; Lleres, Annick; Llorente Merino, Javier; Lloyd, Stephen; Lo Sterzo, Francesco; Lobodzinska, Ewelina; Loch, Peter; Lockman, William; Loddenkoetter, Thomas; Loebinger, Fred; Loevschall-Jensen, Ask Emil; Loginov, Andrey; Loh, Chang Wei; Lohse, Thomas; Lohwasser, Kristin; Lokajicek, Milos; Lombardo, Vincenzo Paolo; Long, Jonathan; Long, Robin Eamonn; Lopes, Lourenco; Lopez Mateos, David; Lopez Paredes, Brais; Lorenz, Jeanette; Lorenzo Martinez, Narei; Losada, Marta; Loscutoff, Peter; Losty, Michael; Lou, XinChou; Lounis, Abdenour; Love, Jeremy; Love, Peter; Lowe, Andrew; Lu, Feng; Lubatti, Henry; Luci, Claudio; Lucotte, Arnaud; Ludwig, Dorthe; Ludwig, Inga; Luehring, Frederick; Lukas, Wolfgang; Luminari, Lamberto; Lund, Esben; Lundberg, Johan; Lundberg, Olof; Lund-Jensen, Bengt; Lungwitz, Matthias; Lynn, David; Lysak, Roman; Lytken, Else; Ma, Hong; Ma, Lian Liang; Maccarrone, Giovanni; Macchiolo, Anna; Ma\\v{c}ek, Bo\\v{s}tjan; Machado Miguens, Joana; Macina, Daniela; Mackeprang, Rasmus; Madar, Romain; Madaras, Ronald; Maddocks, Harvey Jonathan; Mader, Wolfgang; Madsen, Alexander; Maeno, Mayuko; Maeno, Tadashi; Magnoni, Luca; Magradze, Erekle; Mahboubi, Kambiz; Mahlstedt, Joern; Mahmoud, Sara; Mahout, Gilles; Maiani, Camilla; Maidantchik, Carmen; Maio, Am\\'elia; Majewski, Stephanie; Makida, Yasuhiro; Makovec, Nikola; Mal, Prolay; Malaescu, Bogdan; Malecki, Pawel; Maleev, Victor; Malek, Fairouz; Mallik, Usha; Malon, David; Malone, Caitlin; Maltezos, Stavros; Malyshev, Vladimir; Malyukov, Sergei; Mamuzic, Judita; Mandelli, Luciano; Mandi\\'{c}, Igor; Mandrysch, Rocco; Maneira, Jos\\'e; Manfredini, Alessandro; Manhaes de Andrade Filho, Luciano; Manjarres Ramos, Joany Andreina; Mann, Alexander; Manning, Peter; Manousakis-Katsikakis, Arkadios; Mansoulie, Bruno; Mantifel, Rodger; Mapelli, Livio; March, Luis; Marchand, Jean-Francois; Marchese, Fabrizio; Marchiori, Giovanni; Marcisovsky, Michal; Marino, Christopher; Marques, Carlos; Marroquim, Fernando; Marshall, Zach; Marti, Lukas Fritz; Marti-Garcia, Salvador; Martin, Brian; Martin, Brian Thomas; Martin, Jean-Pierre; Martin, Tim; Martin, Victoria Jane; Martin dit Latour, Bertrand; Martinez, Homero; Martinez, Mario; Martin-Haugh, Stewart; Martyniuk, Alex; Marx, Marilyn; Marzano, Francesco; Marzin, Antoine; Masetti, Lucia; Mashimo, Tetsuro; Mashinistov, Ruslan; Masik, Jiri; Maslennikov, Alexey; Massa, Ignazio; Massol, Nicolas; Mastrandrea, Paolo; Mastroberardino, Anna; Masubuchi, Tatsuya; Matsunaga, Hiroyuki; Matsushita, Takashi; Mattig, Peter; Mattig, Stefan; Mattmann, Johannes; Mattravers, Carly; Maurer, Julien; Maxfield, Stephen; Maximov, Dmitriy; Mazini, Rachid; Mazzaferro, Luca; Mazzanti, Marcello; Mc Goldrick, Garrin; Mc Kee, Shawn Patrick; McCarn, Allison; McCarthy, Robert; McCarthy, Tom; McCubbin, Norman; McFarlane, Kenneth; Mcfayden, Josh; Mchedlidze, Gvantsa; Mclaughlan, Tom; McMahon, Steve; McPherson, Robert; Meade, Andrew; Mechnich, Joerg; Mechtel, Markus; Medinnis, Mike; Meehan, Samuel; Meera-Lebbai, Razzak; Mehlhase, Sascha; Mehta, Andrew; Meier, Karlheinz; Meineck, Christian; Meirose, Bernhard; Melachrinos, Constantinos; Mellado Garcia, Bruce Rafael; Meloni, Federico; Mendoza Navas, Luis; Mengarelli, Alberto; Menke, Sven; Meoni, Evelin; Mercurio, Kevin Michael; Mergelmeyer, Sebastian; Meric, Nicolas; Mermod, Philippe; Merola, Leonardo; Meroni, Chiara; Merritt, Frank; Merritt, Hayes; Messina, Andrea; Metcalfe, Jessica; Mete, Alaettin Serhan; Meyer, Carsten; Meyer, Christopher; Meyer, Jean-Pierre; Meyer, Jochen; Meyer, Joerg; Michal, Sebastien; Middleton, Robin; Migas, Sylwia; Mijovi\\'{c}, Liza; Mikenberg, Giora; Mikestikova, Marcela; Miku\\v{z}, Marko; Miller, David; Mills, Corrinne; Milov, Alexander; Milstead, David; Milstein, Dmitry; Minaenko, Andrey; Minano Moya, Mercedes; Minashvili, Irakli; Mincer, Allen; Mindur, Bartosz; Mineev, Mikhail; Ming, Yao; Mir, Lluisa-Maria; Mirabelli, Giovanni; Mitani, Takashi; Mitrevski, Jovan; Mitsou, Vasiliki A; Mitsui, Shingo; Miyagawa, Paul; Mjornmark, Jan-Ulf; Moa, Torbjoern; Moeller, Victoria; Mohapatra, Soumya; Mohr, Wolfgang; Molander, Simon; Moles-Valls, Regina; Molfetas, Angelos; Monig, Klaus; Monini, Caterina; Monk, James; Monnier, Emmanuel; Montejo Berlingen, Javier; Monticelli, Fernando; Monzani, Simone; Moore, Roger; Mora Herrera, Clemencia; Moraes, Arthur; Morange, Nicolas; Morel, Julien; Moreno, Deywis; Moreno Ll\\'acer, Mar\\'ia; Morettini, Paolo; Morgenstern, Marcus; Morii, Masahiro; Moritz, Sebastian; Morley, Anthony Keith; Mornacchi, Giuseppe; Morris, John; Morvaj, Ljiljana; Moser, Hans-Guenther; Mosidze, Maia; Moss, Josh; Mount, Richard; Mountricha, Eleni; Mouraviev, Sergei; Moyse, Edward; Mudd, Richard; Mueller, Felix; Mueller, James; Mueller, Klemens; Mueller, Thibaut; Mueller, Timo; Muenstermann, Daniel; Munwes, Yonathan; Murillo Quijada, Javier Alberto; Murray, Bill; Mussche, Ido; Musto, Elisa; Myagkov, Alexey; Myska, Miroslav; Nackenhorst, Olaf; Nadal, Jordi; Nagai, Koichi; Nagai, Ryo; Nagai, Yoshikazu; Nagano, Kunihiro; Nagarkar, Advait; Nagasaka, Yasushi; Nagel, Martin; Nairz, Armin Michael; Nakahama, Yu; Nakamura, Koji; Nakamura, Tomoaki; Nakano, Itsuo; Namasivayam, Harisankar; Nanava, Gizo; Napier, Austin; Narayan, Rohin; Nash, Michael; Nattermann, Till; Naumann, Thomas; Navarro, Gabriela; Neal, Homer; Nechaeva, Polina; Neep, Thomas James; Negri, Andrea; Negri, Guido; Negrini, Matteo; Nektarijevic, Snezana; Nelson, Andrew; Nelson, Timothy Knight; Nemecek, Stanislav; Nemethy, Peter; Nepomuceno, Andre Asevedo; Nessi, Marzio; Neubauer, Mark; Neumann, Manuel; Neusiedl, Andrea; Neves, Ricardo; Nevski, Pavel; Newcomer, Mitchel; Newman, Paul; Nguyen, Duong Hai; Nguyen Thi Hong, Van; Nickerson, Richard; Nicolaidou, Rosy; Nicquevert, Bertrand; Nielsen, Jason; Nikiforou, Nikiforos; Nikiforov, Andriy; Nikolaenko, Vladimir; Nikolic-Audit, Irena; Nikolics, Katalin; Nikolopoulos, Konstantinos; Nilsson, Paul; Ninomiya, Yoichi; Nisati, Aleandro; Nisius, Richard; Nobe, Takuya; Nodulman, Lawrence; Nomachi, Masaharu; Nomidis, Ioannis; Norberg, Scarlet; Nordberg, Markus; Novakova, Jana; Nozaki, Mitsuaki; Nozka, Libor; Ntekas, Konstantinos; Nuncio-Quiroz, Adriana-Elizabeth; Nunes Hanninger, Guilherme; Nunnemann, Thomas; Nurse, Emily; O'Brien, Brendan Joseph; O'grady, Fionnbarr; O'Neil, Dugan; O'Shea, Val; Oakes, Louise Beth; Oakham, Gerald; Oberlack, Horst; Ocariz, Jose; Ochi, Atsuhiko; Ochoa, Ines; Oda, Susumu; Odaka, Shigeru; Ogren, Harold; Oh, Alexander; Oh, Seog; Ohm, Christian; Ohshima, Takayoshi; Okamura, Wataru; Okawa, Hideki; Okumura, Yasuyuki; Okuyama, Toyonobu; Olariu, Albert; Olchevski, Alexander; Olivares Pino, Sebastian Andres; Oliveira, Miguel Alfonso; Oliveira Damazio, Denis; Oliver Garcia, Elena; Olivito, Dominick; Olszewski, Andrzej; Olszowska, Jolanta; Onofre, Ant\\'onio; Onyisi, Peter; Oram, Christopher; Oreglia, Mark; Oren, Yona; Orestano, Domizia; Orlando, Nicola; Oropeza Barrera, Cristina; Orr, Robert; Osculati, Bianca; Ospanov, Rustem; Otero y Garzon, Gustavo; Otono, Hidetoshi; Ouchrif, Mohamed; Ouellette, Eric; Ould-Saada, Farid; Ouraou, Ahmimed; Oussoren, Koen Pieter; Ouyang, Qun; Ovcharova, Ana; Owen, Mark; Owen, Simon; Ozcan, Veysi Erkcan; Ozturk, Nurcan; Pachal, Katherine; Pacheco Pages, Andres; Padilla Aranda, Cristobal; Pagan Griso, Simone; Paganis, Efstathios; Pahl, Christoph; Paige, Frank; Pais, Preema; Pajchel, Katarina; Palacino, Gabriel; Palestini, Sandro; Pallin, Dominique; Palma, Alberto; Palmer, Jody; Pan, Yibin; Panagiotopoulou, Evgenia; Panduro Vazquez, William; Pani, Priscilla; Panikashvili, Natalia; Panitkin, Sergey; Pantea, Dan; Papadopoulou, Theodora; Papageorgiou, Konstantinos; Paramonov, Alexander; Paredes Hernandez, Daniela; Parker, Michael Andrew; Parodi, Fabrizio; Parsons, John; Parzefall, Ulrich; Pashapour, Shabnaz; Pasqualucci, Enrico; Passaggio, Stefano; Passeri, Antonio; Pastore, Fernanda; Pastore, Francesca; P\\'asztor, Gabriella; Pataraia, Sophio; Patel, Nikhul; Pater, Joleen; Patricelli, Sergio; Pauly, Thilo; Pearce, James; Pedersen, Maiken; Pedraza Lopez, Sebastian; Pedro, Rute; Peleganchuk, Sergey; Pelikan, Daniel; Peng, Haiping; Penning, Bjoern; Penwell, John; Perepelitsa, Dennis; Perez Cavalcanti, Tiago; Perez Codina, Estel; Perez Garcia-Estan, Maria Teresa; Perez Reale, Valeria; Perini, Laura; Pernegger, Heinz; Perrino, Roberto; Peschke, Richard; Peshekhonov, Vladimir; Peters, Krisztian; Peters, Yvonne; Petersen, Brian; Petersen, Jorgen; Petersen, Troels; Petit, Elisabeth; Petridis, Andreas; Petridou, Chariclia; Petrolo, Emilio; Petrucci, Fabrizio; Petteni, Michele; Pezoa, Raquel; Phillips, Peter William; Piacquadio, Giacinto; Pianori, Elisabetta; Picazio, Attilio; Piccaro, Elisa; Piccinini, Maurizio; Piec, Sebastian Marcin; Piegaia, Ricardo; Pignotti, David; Pilcher, James; Pilkington, Andrew; Pina, Joao Antonio; Pinamonti, Michele; Pinder, Alex; Pinfold, James; Pingel, Almut; Pinto, Belmiro; Pizio, Caterina; Pleier, Marc-Andre; Pleskot, Vojtech; Plotnikova, Elena; Plucinski, Pawel; Poddar, Sahill; Podlyski, Fabrice; Poettgen, Ruth; Poggioli, Luc; Pohl, David-leon; Pohl, Martin; Polesello, Giacomo; Policicchio, Antonio; Polifka, Richard; Polini, Alessandro; Pollard, Christopher Samuel; Polychronakos, Venetios; Pomeroy, Daniel; Pomm\\`es, Kathy; Pontecorvo, Ludovico; Pope, Bernard; Popeneciu, Gabriel Alexandru; Popovic, Dragan; Poppleton, Alan; Portell Bueso, Xavier; Pospelov, Guennady; Pospisil, Stanislav; Potamianos, Karolos; Potrap, Igor; Potter, Christina; Potter, Christopher; Poulard, Gilbert; Poveda, Joaquin; Pozdnyakov, Valery; Prabhu, Robindra; Pralavorio, Pascal; Pranko, Aliaksandr; Prasad, Srivas; Pravahan, Rishiraj; Prell, Soeren; Price, Darren; Price, Joe; Price, Lawrence; Prieur, Damien; Primavera, Margherita; Proissl, Manuel; Prokofiev, Kirill; Prokoshin, Fedor; Protopapadaki, Eftychia-sofia; Protopopescu, Serban; Proudfoot, James; Prudent, Xavier; Przybycien, Mariusz; Przysiezniak, Helenka; Psoroulas, Serena; Ptacek, Elizabeth; Pueschel, Elisa; Puldon, David; Purohit, Milind; Puzo, Patrick; Pylypchenko, Yuriy; Qian, Jianming; Quadt, Arnulf; Quarrie, David; Quayle, William; Quilty, Donnchadha; Radeka, Veljko; Radescu, Voica; Radhakrishnan, Sooraj Krishnan; Radloff, Peter; Ragusa, Francesco; Rahal, Ghita; Rajagopalan, Srinivasan; Rammensee, Michael; Rammes, Marcus; Randle-Conde, Aidan Sean; Rangel-Smith, Camila; Rao, Kanury; Rauscher, Felix; Rave, Tobias Christian; Ravenscroft, Thomas; Raymond, Michel; Read, Alexander Lincoln; Rebuzzi, Daniela; Redelbach, Andreas; Redlinger, George; Reece, Ryan; Reeves, Kendall; Reinsch, Andreas; Reisin, Hernan; Reisinger, Ingo; Relich, Matthew; Rembser, Christoph; Ren, Zhongliang; Renaud, Adrien; Rescigno, Marco; Resconi, Silvia; Resende, Bernardo; Reznicek, Pavel; Rezvani, Reyhaneh; Richter, Robert; Ridel, Melissa; Rieck, Patrick; Rijssenbeek, Michael; Rimoldi, Adele; Rinaldi, Lorenzo; Ritsch, Elmar; Riu, Imma; Rivoltella, Giancesare; Rizatdinova, Flera; Rizvi, Eram; Robertson, Steven; Robichaud-Veronneau, Andree; Robinson, Dave; Robinson, James; Robson, Aidan; Rocha de Lima, Jose Guilherme; Roda, Chiara; Roda Dos Santos, Denis; Rodrigues, Luis; Roe, Shaun; R{\\o}hne, Ole; Rolli, Simona; Romaniouk, Anatoli; Romano, Marino; Romeo, Gaston; Romero Adam, Elena; Rompotis, Nikolaos; Roos, Lydia; Ros, Eduardo; Rosati, Stefano; Rosbach, Kilian; Rose, Anthony; Rose, Matthew; Rosendahl, Peter Lundgaard; Rosenthal, Oliver; Rossetti, Valerio; Rossi, Elvira; Rossi, Leonardo Paolo; Rosten, Rachel; Rotaru, Marina; Roth, Itamar; Rothberg, Joseph; Rousseau, David; Royon, Christophe; Rozanov, Alexandre; Rozen, Yoram; Ruan, Xifeng; Rubbo, Francesco; Rubinskiy, Igor; Rud, Viacheslav; Rudolph, Christian; Rudolph, Matthew Scott; Ruhr, Frederik; Ruiz-Martinez, Aranzazu; Rumyantsev, Leonid; Rurikova, Zuzana; Rusakovich, Nikolai; Ruschke, Alexander; Rutherfoord, John; Ruthmann, Nils; Ruzicka, Pavel; Ryabov, Yury; Rybar, Martin; Rybkin, Grigori; Ryder, Nick; Saavedra, Aldo; Sacerdoti, Sabrina; Saddique, Asif; Sadeh, Iftach; Sadrozinski, Hartmut; Sadykov, Renat; Safai Tehrani, Francesco; Sakamoto, Hiroshi; Sakurai, Yuki; Salamanna, Giuseppe; Salamon, Andrea; Saleem, Muhammad; Salek, David; Sales De Bruin, Pedro Henrique; Salihagic, Denis; Salnikov, Andrei; Salt, Jos\\'e; Salvachua Ferrando, Bel\\'en; Salvatore, Daniela; Salvatore, Pasquale Fabrizio; Salvucci, Antonio; Salzburger, Andreas; Sampsonidis, Dimitrios; Sanchez, Arturo; S\\'anchez, Javier; Sanchez Martinez, Victoria; Sandaker, Heidi; Sander, Heinz Georg; Sanders, Michiel; Sandhoff, Marisa; Sandoval, Tanya; Sandoval, Carlos; Sandstroem, Rikard; Sankey, Dave; Sansoni, Andrea; Santoni, Claudio; Santonico, Rinaldo; Santos, Helena; Santoyo Castillo, Itzebelt; Sapp, Kevin; Sapronov, Andrey; Saraiva, Joao; Sarkisyan-Grinbaum, Edward; Sarrazin, Bjorn; Sartisohn, Georg; Sasaki, Osamu; Sasaki, Yuichi; Sasao, Noboru; Satsounkevitch, Igor; Sauvage, Gilles; Sauvan, Emmanuel; Sauvan, Jean-Baptiste; Savard, Pierre; Savinov, Vladimir; Savu, Dan Octavian; Sawyer, Craig; Sawyer, Lee; Saxon, David; Saxon, James; Sbarra, Carla; Sbrizzi, Antonio; Scanlon, Tim; Scannicchio, Diana; Scarcella, Mark; Schaarschmidt, Jana; Schacht, Peter; Schaefer, Douglas; Schaelicke, Andreas; Schaepe, Steffen; Schaetzel, Sebastian; Schafer, Uli; Schaffer, Arthur; Schaile, Dorothee; Schamberger, R. Dean; Scharf, Veit; Schegelsky, Valery; Scheirich, Daniel; Schernau, Michael; Scherzer, Max; Schiavi, Carlo; Schieck, Jochen; Schillo, Christian; Schioppa, Marco; Schlenker, Stefan; Schmidt, Evelyn; Schmieden, Kristof; Schmitt, Christian; Schmitt, Christopher; Schmitt, Sebastian; Schneider, Basil; Schnellbach, Yan Jie; Schnoor, Ulrike; Schoeffel, Laurent; Schoening, Andre; Schoenrock, Bradley Daniel; Schorlemmer, Andre Lukas; Schott, Matthias; Schouten, Doug; Schovancova, Jaroslava; Schram, Malachi; Schramm, Steven; Schreyer, Manuel; Schroeder, Christian; Schroer, Nicolai; Schuh, Natascha; Schultens, Martin Johannes; Schultz-Coulon, Hans-Christian; Schulz, Holger; Schumacher, Markus; Schumm, Bruce; Schune, Philippe; Schwartzman, Ariel; Schwegler, Philipp; Schwemling, Philippe; Schwienhorst, Reinhard; Schwindling, Jerome; Schwindt, Thomas; Schwoerer, Maud; Sciacca, Gianfranco; Scifo, Estelle; Sciolla, Gabriella; Scott, Bill; Scutti, Federico; Searcy, Jacob; Sedov, George; Sedykh, Evgeny; Seidel, Sally; Seiden, Abraham; Seifert, Frank; Seixas, Jos\\'e; Sekhniaidze, Givi; Sekula, Stephen; Selbach, Karoline Elfriede; Seliverstov, Dmitry; Sellers, Graham; Seman, Michal; Semprini-Cesari, Nicola; Serfon, Cedric; Serin, Laurent; Serkin, Leonid; Serre, Thomas; Seuster, Rolf; Severini, Horst; Sforza, Federico; Sfyrla, Anna; Shabalina, Elizaveta; Shamim, Mansoora; Shan, Lianyou; Shank, James; Shao, Qi Tao; Shapiro, Marjorie; Shatalov, Pavel; Shaw, Kate; Sherwood, Peter; Shimizu, Shima; Shimojima, Makoto; Shin, Taeksu; Shiyakova, Mariya; Shmeleva, Alevtina; Shochet, Mel; Short, Daniel; Shrestha, Suyog; Shulga, Evgeny; Shupe, Michael; Shushkevich, Stanislav; Sicho, Petr; Sidorov, Dmitri; Sidoti, Antonio; Siegert, Frank; Sijacki, Djordje; Silbert, Ohad; Silva, Jos\\'e; Silver, Yiftah; Silverstein, Daniel; Silverstein, Samuel; Simak, Vladislav; Simard, Olivier; Simic, Ljiljana; Simion, Stefan; Simioni, Eduard; Simmons, Brinick; Simoniello, Rosa; Simonyan, Margar; Sinervo, Pekka; Sinev, Nikolai; Sipica, Valentin; Siragusa, Giovanni; Sircar, Anirvan; Sisakyan, Alexei; Sivoklokov, Serguei; Sjolin, Jorgen; Sjursen, Therese; Skinnari, Louise Anastasia; Skottowe, Hugh Philip; Skovpen, Kirill; Skubic, Patrick; Slater, Mark; Slavicek, Tomas; Sliwa, Krzysztof; Smakhtin, Vladimir; Smart, Ben; Smestad, Lillian; Smirnov, Sergei; Smirnov, Yury; Smirnova, Lidia; Smirnova, Oxana; Smith, Kenway; Smizanska, Maria; Smolek, Karel; Snesarev, Andrei; Snidero, Giacomo; Snow, Joel; Snyder, Scott; Sobie, Randall; Socher, Felix; Sodomka, Jaromir; Soffer, Abner; Soh, Dart-yin; Solans, Carlos; Solar, Michael; Solc, Jaroslav; Soldatov, Evgeny; Soldevila, Urmila; Solfaroli Camillocci, Elena; Solodkov, Alexander; Solovyanov, Oleg; Solovyev, Victor; Soni, Nitesh; Sood, Alexander; Sopko, Vit; Sopko, Bruno; Sosebee, Mark; Soualah, Rachik; Soueid, Paul; Soukharev, Andrey; South, David; Spagnolo, Stefania; Span\\`o, Francesco; Spearman, William Robert; Spighi, Roberto; Spigo, Giancarlo; Spousta, Martin; Spreitzer, Teresa; Spurlock, Barry; St Denis, Richard Dante; Stahlman, Jonathan; Stamen, Rainer; Stanecka, Ewa; Stanek, Robert; Stanescu, Cristian; Stanescu-Bellu, Madalina; Stanitzki, Marcel Michael; Stapnes, Steinar; Starchenko, Evgeny; Stark, Jan; Staroba, Pavel; Starovoitov, Pavel; Staszewski, Rafal; Stavina, Pavel; Steele, Genevieve; Steinbach, Peter; Steinberg, Peter; Stekl, Ivan; Stelzer, Bernd; Stelzer, Harald Joerg; Stelzer-Chilton, Oliver; Stenzel, Hasko; Stern, Sebastian; Stewart, Graeme; Stillings, Jan Andre; Stockton, Mark; Stoebe, Michael; Stoerig, Kathrin; Stoicea, Gabriel; Stonjek, Stefan; Stradling, Alden; Straessner, Arno; Strandberg, Jonas; Strandberg, Sara; Strandlie, Are; Strauss, Emanuel; Strauss, Michael; Strizenec, Pavol; Strohmer, Raimund; Strom, David; Stroynowski, Ryszard; Stucci, Stefania Antonia; Stugu, Bjarne; Stumer, Iuliu; Stupak, John; Sturm, Philipp; Styles, Nicholas Adam; Su, Dong; Su, Jun; Subramania, Halasya Siva; Subramaniam, Rajivalochan; Succurro, Antonella; Sugaya, Yorihito; Suhr, Chad; Suk, Michal; Sulin, Vladimir; Sultansoy, Saleh; Sumida, Toshi; Sun, Xiaohu; Sundermann, Jan Erik; Suruliz, Kerim; Susinno, Giancarlo; Sutton, Mark; Suzuki, Yu; Svatos, Michal; Swedish, Stephen; Swiatlowski, Maximilian; Sykora, Ivan; Sykora, Tomas; Ta, Duc; Tackmann, Kerstin; Taenzer, Joe; Taffard, Anyes; Tafirout, Reda; Taiblum, Nimrod; Takahashi, Yuta; Takai, Helio; Takashima, Ryuichi; Takeda, Hiroshi; Takeshita, Tohru; Takubo, Yosuke; Talby, Mossadek; Talyshev, Alexey; Tam, Jason; Tamsett, Matthew; Tan, Kong Guan; Tanaka, Junichi; Tanaka, Reisaburo; Tanaka, Satoshi; Tanaka, Shuji; Tanasijczuk, Andres Jorge; Tani, Kazutoshi; Tannoury, Nancy; Tapprogge, Stefan; Tarem, Shlomit; Tarrade, Fabien; Tartarelli, Giuseppe Francesco; Tas, Petr; Tasevsky, Marek; Tashiro, Takuya; Tassi, Enrico; Tavares Delgado, Ademar; Tayalati, Yahya; Taylor, Christopher; Taylor, Frank; Taylor, Geoffrey; Taylor, Wendy; Teischinger, Florian Alfred; Teixeira Dias Castanheira, Matilde; Teixeira-Dias, Pedro; Temming, Kim Katrin; Ten Kate, Herman; Teng, Ping-Kun; Terada, Susumu; Terashi, Koji; Terron, Juan; Terzo, Stefano; Testa, Marianna; Teuscher, Richard; Therhaag, Jan; Theveneaux-Pelzer, Timoth\\'ee; Thoma, Sascha; Thomas, Juergen; Thompson, Emily; Thompson, Paul; Thompson, Peter; Thompson, Stan; Thomsen, Lotte Ansgaard; Thomson, Evelyn; Thomson, Mark; Thong, Wai Meng; Thun, Rudolf; Tian, Feng; Tibbetts, Mark James; Tic, Tom\\'{a}\\v{s}; Tikhomirov, Vladimir; Tikhonov, Yury; Timoshenko, Sergey; Tiouchichine, Elodie; Tipton, Paul; Tisserant, Sylvain; Todorov, Theodore; Todorova-Nova, Sharka; Toggerson, Brokk; Tojo, Junji; Tok\\'ar, Stanislav; Tokushuku, Katsuo; Tollefson, Kirsten; Tomlinson, Lee; Tomoto, Makoto; Tompkins, Lauren; Toms, Konstantin; Topilin, Nikolai; Torrence, Eric; Torres, Heberth; Torr\\'o Pastor, Emma; Toth, Jozsef; Touchard, Francois; Tovey, Daniel; Tran, Huong Lan; Trefzger, Thomas; Tremblet, Louis; Tricoli, Alessandro; Trigger, Isabel Marian; Trincaz-Duvoid, Sophie; Tripiana, Martin; Triplett, Nathan; Trischuk, William; Trocm\\'e, Benjamin; Troncon, Clara; Trottier-McDonald, Michel; Trovatelli, Monica; True, Patrick; Trzebinski, Maciej; Trzupek, Adam; Tsarouchas, Charilaos; Tseng, Jeffrey; Tsiareshka, Pavel; Tsionou, Dimitra; Tsipolitis, Georgios; Tsirintanis, Nikolaos; Tsiskaridze, Shota; Tsiskaridze, Vakhtang; Tskhadadze, Edisher; Tsukerman, Ilya; Tsulaia, Vakhtang; Tsung, Jieh-Wen; Tsuno, Soshi; Tsybychev, Dmitri; Tua, Alan; Tudorache, Alexandra; Tudorache, Valentina; Tuna, Alexander Naip; Tupputi, Salvatore; Turchikhin, Semen; Turecek, Daniel; Turk Cakir, Ilkay; Turra, Ruggero; Tuts, Michael; Tykhonov, Andrii; Tylmad, Maja; Tyndel, Mike; Uchida, Kirika; Ueda, Ikuo; Ueno, Ryuichi; Ughetto, Michael; Ugland, Maren; Uhlenbrock, Mathias; Ukegawa, Fumihiko; Unal, Guillaume; Undrus, Alexander; Unel, Gokhan; Ungaro, Francesca; Unno, Yoshinobu; Urbaniec, Dustin; Urquijo, Phillip; Usai, Giulio; Usanova, Anna; Vacavant, Laurent; Vacek, Vaclav; Vachon, Brigitte; Valencic, Nika; Valentinetti, Sara; Valero, Alberto; Valery, Loic; Valkar, Stefan; Valladolid Gallego, Eva; Vallecorsa, Sofia; Valls Ferrer, Juan Antonio; Van Berg, Richard; Van Der Deijl, Pieter; van der Geer, Rogier; van der Graaf, Harry; Van Der Leeuw, Robin; van der Ster, Daniel; van Eldik, Niels; van Gemmeren, Peter; Van Nieuwkoop, Jacobus; van Vulpen, Ivo; van Woerden, Marius Cornelis; Vanadia, Marco; Vandelli, Wainer; Vaniachine, Alexandre; Vankov, Peter; Vannucci, Francois; Vardanyan, Gagik; Vari, Riccardo; Varnes, Erich; Varol, Tulin; Varouchas, Dimitris; Vartapetian, Armen; Varvell, Kevin; Vassilakopoulos, Vassilios; Vazeille, Francois; Vazquez Schroeder, Tamara; Veatch, Jason; Veloso, Filipe; Veneziano, Stefano; Ventura, Andrea; Ventura, Daniel; Venturi, Manuela; Venturi, Nicola; Venturini, Alessio; Vercesi, Valerio; Verducci, Monica; Verkerke, Wouter; Vermeulen, Jos; Vest, Anja; Vetterli, Michel; Viazlo, Oleksandr; Vichou, Irene; Vickey, Trevor; Vickey Boeriu, Oana Elena; Viehhauser, Georg; Viel, Simon; Vigne, Ralph; Villa, Mauro; Villaplana Perez, Miguel; Vilucchi, Elisabetta; Vincter, Manuella; Vinogradov, Vladimir; Virzi, Joseph; Vitells, Ofer; Viti, Michele; Vivarelli, Iacopo; Vives Vaque, Francesc; Vlachos, Sotirios; Vladoiu, Dan; Vlasak, Michal; Vogel, Adrian; Vokac, Petr; Volpi, Guido; Volpi, Matteo; Volpini, Giovanni; von der Schmitt, Hans; von Radziewski, Holger; von Toerne, Eckhard; Vorobel, Vit; Vos, Marcel; Voss, Rudiger; Vossebeld, Joost; Vranjes, Nenad; Vranjes Milosavljevic, Marija; Vrba, Vaclav; Vreeswijk, Marcel; Vu Anh, Tuan; Vuillermet, Raphael; Vukotic, Ilija; Vykydal, Zdenek; Wagner, Wolfgang; Wagner, Peter; Wahrmund, Sebastian; Wakabayashi, Jun; Walch, Shannon; Walder, James; Walker, Rodney; Walkowiak, Wolfgang; Wall, Richard; Waller, Peter; Walsh, Brian; Wang, Chiho; Wang, Haichen; Wang, Hulin; Wang, Jike; Wang, Jin; Wang, Kuhan; Wang, Rui; Wang, Song-Ming; Wang, Tan; Wang, Xiaoxiao; Warburton, Andreas; Ward, Patricia; Wardrope, David Robert; Warsinsky, Markus; Washbrook, Andrew; Wasicki, Christoph; Watanabe, Ippei; Watkins, Peter; Watson, Alan; Watson, Ian; Watson, Miriam; Watts, Gordon; Watts, Stephen; Waugh, Anthony; Waugh, Ben; Webb, Samuel; Weber, Michele; Weber, Stefan Wolf; Webster, Jordan S; Weidberg, Anthony; Weigell, Philipp; Weingarten, Jens; Weiser, Christian; Weits, Hartger; Wells, Phillippa; Wenaus, Torre; Wendland, Dennis; Weng, Zhili; Wengler, Thorsten; Wenig, Siegfried; Wermes, Norbert; Werner, Matthias; Werner, Per; Wessels, Martin; Wetter, Jeffrey; Whalen, Kathleen; White, Andrew; White, Martin; White, Ryan; White, Sebastian; Whiteson, Daniel; Whittington, Denver; Wicke, Daniel; Wickens, Fred; Wiedenmann, Werner; Wielers, Monika; Wienemann, Peter; Wiglesworth, Craig; Wiik-Fuchs, Liv Antje Mari; Wijeratne, Peter Alexander; Wildauer, Andreas; Wildt, Martin Andre; Wilkens, Henric George; Will, Jonas Zacharias; Williams, Hugh; Williams, Sarah; Willis, William; Willocq, Stephane; Wilson, John; Wilson, Alan; Wingerter-Seez, Isabelle; Winkelmann, Stefan; Winklmeier, Frank; Wittgen, Matthias; Wittig, Tobias; Wittkowski, Josephine; Wollstadt, Simon Jakob; Wolter, Marcin Wladyslaw; Wolters, Helmut; Wong, Wei-Cheng; Wosiek, Barbara; Wotschack, Jorg; Woudstra, Martin; Wozniak, Krzysztof; Wraight, Kenneth; Wright, Michael; Wu, Sau Lan; Wu, Xin; Wu, Yusheng; Wulf, Evan; Wyatt, Terry Richard; Wynne, Benjamin; Xella, Stefania; Xiao, Meng; Xu, Chao; Xu, Da; Xu, Lailin; Yabsley, Bruce; Yacoob, Sahal; Yamada, Miho; Yamaguchi, Hiroshi; Yamaguchi, Yohei; Yamamoto, Akira; Yamamoto, Kyoko; Yamamoto, Shimpei; Yamamura, Taiki; Yamanaka, Takashi; Yamauchi, Katsuya; Yamazaki, Yuji; Yan, Zhen; Yang, Haijun; Yang, Hongtao; Yang, Un-Ki; Yang, Yi; Yanush, Serguei; Yao, Liwen; Yasu, Yoshiji; Yatsenko, Elena; Yau Wong, Kaven Henry; Ye, Jingbo; Ye, Shuwei; Yen, Andy L; Yildirim, Eda; Yilmaz, Metin; Yoosoofmiya, Reza; Yorita, Kohei; Yoshida, Rikutaro; Yoshihara, Keisuke; Young, Charles; Young, Christopher John; Youssef, Saul; Yu, David Ren-Hwa; Yu, Jaehoon; Yu, Jie; Yuan, Li; Yurkewicz, Adam; Zabinski, Bartlomiej; Zaidan, Remi; Zaitsev, Alexander; Zaman, Aungshuman; Zambito, Stefano; Zanello, Lucia; Zanzi, Daniele; Zaytsev, Alexander; Zeitnitz, Christian; Zeman, Martin; Zemla, Andrzej; Zengel, Keith; Zenin, Oleg; \\v{Z}eni\\v{s}, Tibor; Zerwas, Dirk; Zevi della Porta, Giovanni; Zhang, Dongliang; Zhang, Huaqiao; Zhang, Jinlong; Zhang, Lei; Zhang, Xueyao; Zhang, Zhiqing; Zhao, Zhengguo; Zhemchugov, Alexey; Zhong, Jiahang; Zhou, Bing; Zhou, Lei; Zhou, Ning; Zhu, Cheng Guang; Zhu, Hongbo; Zhu, Junjie; Zhu, Yingchun; Zhuang, Xuai; Zibell, Andre; Zieminska, Daria; Zimine, Nikolai; Zimmermann, Christoph; Zimmermann, Robert; Zimmermann, Simone; Zimmermann, Stephanie; Zinonos, Zinonas; Ziolkowski, Michael; Zitoun, Robert; Zobernig, Georg; Zoccoli, Antonio; zur Nedden, Martin; Zurzolo, Giovanni; Zutshi, Vishnu; Zwalinski, Lukasz

    2014-01-01

    The prompt and non-prompt production cross-sections for the $\\chi_{c1}$ and $\\chi_{c2}$ charmonium states are measured in $pp$ collisions at $\\sqrt{s}=7$ TeV with the ATLAS detector at the LHC using 4.5 fb-1 of integrated luminosity. The $\\chi_{c}$ states are reconstructed through the radiative decay $\\chi_{c}\\rightarrow J/\\psi\\,\\gamma$ (with $J/\\psi\\rightarrow\\mu^{+}\\mu^{-}$) where photons are reconstructed from $\\gamma\\rightarrow e^{+}e^{-}$ conversions. The production rate of the $\\chi_{c2}$ state relative to the $\\chi_{c1}$ state is measured for prompt and non-prompt $\\chi_{c}$ as a function of $J/\\psi$ transverse momentum. The prompt $\\chi_{c}$ cross-sections are combined with existing measurements of prompt $J/\\psi$ production to derive the fraction of prompt $J/\\psi$ produced in feed-down from $\\chi_{c}$ decays. The fractions of $\\chi_{c1}$ and $\\chi_{c2}$ produced in $b$-hadron decays are also measured. In addition to measurements of inclusive $\\chi_{c}$ production, the branching fraction ${\\cal B}(B^...

  13. Discovery of omega meson, first neutral vector meson

    International Nuclear Information System (INIS)

    Anon.

    1976-01-01

    A personal account of the discovery of the ω meson is given by researcher B. Maglich. His account includes such topics as early and unsuccessful searches for a neutral vector meson (by himself and others), eventual discovery of the rho meson, the Goldhaber effect, and the observation and characterization of the ω meson. Explanatory physics notes on electromagnetic structure experiments and the determination of the quantum numbers of the ω meson are provided for nonspecialists. Also included are an outline of the relation between vector mesons and nuclear forces, a reprint of the Physical Review Letter on Evidence for a T = 0 three-pion resonance, and a scientific autobiography of the researcher. 14 figures, 1 table

  14. Observation of CP Violation in the Neutral B Meson System

    Energy Technology Data Exchange (ETDEWEB)

    Levy, S

    2004-06-16

    This dissertation presents a measurement of time-dependent CP-violating asymmetries in neutral B meson decays collected with the BABAR detector at the PEP-II asymmetric-energy B Factory at the Stanford Linear Accelerator Center. The data sample consists of about 88 million {Upsilon}(4S) {yields} B{bar B} decays collected between 1999 and 2002. We study events in which one neutral B meson decay to the CP-eigenstates J/{psi} K{sub S}{sup 0}, {psi}(2S)K{sub S}{sup 0}, {chi}{sub c1}K{sub S}{sup 0}, and {eta}{sub c}K{sub S}{sup 0}, or to flavor-eigenstates involving D{sup (*)}{pi}/{rho}/a{sub 1} and J/{psi}K*{sup 0}(K*{sup 0} {yields} K{sup +} {pi}{sup -}), is fully reconstructed. The flavor of the other neutral B meson is tagged at the time of its decay, mainly using the charge of identified leptons and kaons. The proper time elapsed between the meson decays is determined by measuring the distance between the decay vertices. The amplitude of the CP-violating asymmetry, which in the Standard Model is proportional to sin2{beta}, is determined from a simultaneous maximum-likelihood fit to the time-difference distribution of the flavor- and CP-eigenstate samples. We measure sin2{beta} = 0.755 {+-} 0.074 (stat) {+-} 0.030 (syst).

  15. Observation of a New Narrow Axial-Vector Meson alpha(1)(1420)

    Czech Academy of Sciences Publication Activity Database

    Adolph, C.; Akhunzyanov, R.; Alexeev, M.; Alexeev, G. D.; Amoroso, A.; Andrieux, V.; Anosov, V.; Austregesilo, A.; Azevedo, C.; Badelek, B.; Balestra, F.; Barth, J.; Beck, R.; Bedfer, Y.; Bernhard, J.; Bicker, K.; Bielert, E. R.; Birsa, R.; Bisplinghoff, J.; Bodlák, M.; Boer, M.; Bordalo, P.; Bradamante, F.; Braun, C.; Bressan, A.; Büchele, M.; Burtin, E.; Chang, W.-C.; Chiosso, M.; Choi, I.; Chung, S. U.; Cicuttin, A.; Crespo, M.; Curiel, Q.; Dalla Torre, S.; Dasgupta, S. S.; Dasgupta, S.; Denisov, O.; Dhara, L.; Donskov, S. V.; Doshita, N.; Duic, V.; Dunnweber, W.; Dziewiecki, M.; Efremov, A.; Eversheim, P.D.; Eyrich, W.; Faessler, M.; Ferrero, A.; Finger, M.; Finger jr., M.; Fischer, H.; Franco, C.; Fresne von Hohenesche, N.; Friedrich, J. M.; Frolov, V.; Gautheron, F.; Gavrichtchouk, O. P.; Gerassimov, S.; Gnesi, I.; Gorzellik, M.; Grabmüller, S.; Grasso, A.; Grosse-Perdekapm, M.; Grube, B.; Grussenmeyer, T.; Guskov, A.; Haas, F.; von Harrach, D.; Hahne, D.; Hashimoto, R.; Heinsius, F. H.; Herrmann, E.; Hinterberger, F.; Horikawa, N.; d´Hose, N.; Hsieh, C.-Yu.; Huber, S.; Ishimoto, S.; Ivanov, A.; Ivanshin, Yu.; Iwata, T.; Jahn, R.; Jarý, V.; Jörg, P.; Joosten, R.; Kabuss, E.; Ketzer, B.; Khaustov, G. V.; Khokhlov, Yu. A.; Kisselev, Y.; Klein, F.; Klimaszewski, K.; Koivuniemi, J. H.; Kolosov, V. N.; Kondo, K.; Königsmann, K.; Konorov, I.; Konstantinov, V. F.; Kotzinian, A. M.; Kouznetsov, O.; Krämer, M.; Kremser, P.; Krinner, F.; Kroumchtein, Z. V.; Kuchinski, N.; Kunne, F.; Kurek, K.; Kurjata, R. P.; Lednev, A. A.; Lehmann, A.; Levillain, M.; Levorato, S.; Lichtenstadt, J.; Maggiora, A.; Magnon, A.; Makins, N.; Makke, N.; Mallot, G.; Marchand, C.; Martin, A.; Marzec, J.; Matoušek, J.; Matsuda, H.; Matsuda, T.; Meshcheryakov, G.; Meyer, W.; Michigami, T.; Mikhailov, Yu. V.; Miyachi, Y.; Nagaytsev, A.; Nagel, T.; Nerling, F.; Neyret, D.; Nikolaenko, V. I.; Nový, J.; Nowak, W. D.; Nunes, A.S.; Olshevsky, A. G.; Orlov, I.; Ostrick, M.; Panzieri, D.; Parsamyan, B.; Paul, S.; Peng, J.-C.; Pereira, F.; Pešek, M.; Peshekhonov, D. V.; Platchkov, S.; Pochodzalla, J.; Polyakov, V.; Pretz, J.; Quaresma, M.; Quintans, C.; Ramos, S.; Regali, C.; Reicherz, G.; Riedl, C.; Rocco, E.; Rossiyskaya, N. S.; Ryabchikov, D.; Rychter, A.; Samoylenko, V. D.; Sandacz, A.; Santos, C.; Sarkar, S.; Savin, I. A.; Sbrizzai, G.; Schiavon, P.; Schmeing, S.; Schmidt, K.; Schlüter, T.; Selyunin, A.; Schmieden, H.; Schönning, K.; Schopferer, S.; Shevchenko, O. Yu.; Silva, L.; Sinha, L.; Sirtl, S.; Slunecka, M.; Sozzi, F.; Srnka, Aleš; Stolarski, M.; Šulc, M.; Suzuki, H.; Szabelski, A.; Szameitat, T.; Sznajder, P.; Takekawa, S.; Ter Wolbeek, J.; Tessaro, S.; Tessarotto, F.; Thibaud, F.; Tskhay, V.; Uhl, S.; Veloso, J.; Virius, M.; Wallner, S.; Weisrock, T.; Wilfert, M.; Zaremba, K.; Zavertyaev, M.; Zemlyanichkina, E.; Ziembicki, M.; Zink, A.

    2015-01-01

    Roč. 115, č. 8 (2015), 082001:1-6 ISSN 0031-9007 R&D Projects: GA MŠk(CZ) LO1212 Institutional support: RVO:68081731 Keywords : COMPASS * pion-nucleon scattering * hadron spectroscopy * light-meson spectrum * axial-vector mesons * exotic mesons Subject RIV: BH - Optics, Masers, Lasers Impact factor: 7.645, year: 2015

  16. Radiative decays of the Upsilon(1S) meson

    International Nuclear Information System (INIS)

    Besson, D.Z.

    1986-01-01

    Using the CLEO detector at the Cornell Electron Storage Ring, the author is able to measure the QCD scaling parameter Λ/sub MS/ as well as the strong coupling constant α/sub s/ through a measurement of the direct photon energy spectrum resulting from decays of the Upsilon(1S) meson. The author finds fair agreement with previous work. In addition, the author sets limits on exclusive two-body radiative decays of the Upsilon(1S) meson and see no evidence for the type of such two-body decays which are observed in psi decays

  17. Exclusive production of meson pairs and resonances in proton-proton collisions

    Energy Technology Data Exchange (ETDEWEB)

    Lebiedowicz, Piotr [Institute of Nuclear Physics PAN, PL-31-342 Cracow (Poland); Szczurek, Antoni [Institute of Nuclear Physics PAN, PL-31-342 Cracow, Poland and University of Rzeszow, PL-35-959 Rzeszow (Poland)

    2013-04-15

    We report a study of the central exclusive production of {pi}{sup +}{pi}{sup -} and K{sup +}K{sup -} pairs in high energy hadron-hadron collisions. The amplitude is calculated in the Regge approach including both pomeron and secondary reggeon exchanges and absorption effects due to proton-proton interaction and {pi}{pi} (KK) rescattering. We discuss a measurement of exclusive production of a scalar {chi}{sub c0} meson via {chi}{sub c0}{yields}{pi}{sup +}{pi}{sup -}, K{sup +}K{sup -} decay. We find that the relative contribution of resonance states and the {pi}{pi} (KK) continuum strongly depend on the cut on pion (kaon) transverse momentum. We compare the results with the existing experimental data and present predictions for the RHIC, Tevatron and LHC colliders. We discuss also the f{sub 2} (1270) meson production mediated by an effective tensor pomeron exchanges.

  18. Observation of $B^0_s\\rightarrow\\chi_{c1}\\phi$ decay and study of $B^0\\rightarrow\\chi_{c1,2}K^{*0}$ decays

    CERN Document Server

    INSPIRE-00258707; Adeva, B; Adinolfi, M; Adrover, C; Affolder, A; Ajaltouni, Z; Albrecht, J; Alessio, F; Alexander, M; Ali, S; Alkhazov, G; Alvarez Cartelle, P; Alves Jr, A A; Amato, S; Amerio, S; Amhis, Y; Anderlini, L; Anderson, J; Andreassen, R; Andrews, J E; Appleby, R B; Aquines Gutierrez, O; Archilli, F; Artamonov, A; Artuso, M; Aslanides, E; Auriemma, G; Baalouch, M; Bachmann, S; Back, J J; Baesso, C; Balagura, V; Baldini, W; Barlow, R J; Barschel, C; Barsuk, S; Barter, W; Bauer, Th; Bay, A; Beddow, J; Bedeschi, F; Bediaga, I; Belogurov, S; Belous, K; Belyaev, I; Ben-Haim, E; Bencivenni, G; Benson, S; Benton, J; Berezhnoy, A; Bernet, R; Bettler, M -O; van Beuzekom, M; Bien, A; Bifani, S; Bird, T; Bizzeti, A; Bjørnstad, P M; Blake, T; Blanc, F; Blouw, J; Blusk, S; Bocci, V; Bondar, A; Bondar, N; Bonivento, W; Borghi, S; Borgia, A; Bowcock, T J V; Bowen, E; Bozzi, C; Brambach, T; van den Brand, J; Bressieux, J; Brett, D; Britsch, M; Britton, T; Brook, N H; Brown, H; Burducea, I; Bursche, A; Busetto, G; Buytaert, J; Cadeddu, S; Callot, O; Calvi, M; Calvo Gomez, M; Camboni, A; Campana, P; Campora Perez, D; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carranza-Mejia, H; Carson, L; Carvalho Akiba, K; Casse, G; Castillo Garcia, L; Cattaneo, M; Cauet, Ch; Cenci, R; Charles, M; Charpentier, Ph; Chen, P; Chiapolini, N; Chrzaszcz, M; Ciba, K; Cid Vidal, X; Ciezarek, G; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Coca, C; Coco, V; Cogan, J; Cogneras, E; Collins, P; Comerma-Montells, A; Contu, A; Cook, A; Coombes, M; Coquereau, S; Corti, G; Couturier, B; Cowan, G A; Craik, D C; Cunliffe, S; Currie, R; D'Ambrosio, C; David, P; David, P N Y; Davis, A; De Bonis, I; De Bruyn, K; De Capua, S; De Cian, M; De Miranda, J M; De Paula, L; De Silva, W; De Simone, P; Decamp, D; Deckenhoff, M; Del Buono, L; Déléage, N; Derkach, D; Deschamps, O; Dettori, F; Di Canto, A; Di Ruscio, F; Dijkstra, H; Dogaru, M; Donleavy, S; Dordei, F; Dosil Suárez, A; Dossett, D; Dovbnya, A; Dupertuis, F; Dzhelyadin, R; Dziurda, A; Dzyuba, A; Easo, S; Egede, U; Egorychev, V; Eidelman, S; van Eijk, D; Eisenhardt, S; Eitschberger, U; Ekelhof, R; Eklund, L; El Rifai, I; Elsasser, Ch; Elsby, D; Falabella, A; Färber, C; Fardell, G; Farinelli, C; Farry, S; Fave, V; Ferguson, D; Fernandez Albor, V; Ferreira Rodrigues, F; Ferro-Luzzi, M; Filippov, S; Fiore, M; Fitzpatrick, C; Fontana, M; Fontanelli, F; Forty, R; Francisco, O; Frank, M; Frei, C; Frosini, M; Furcas, S; Furfaro, E; Gallas Torreira, A; Galli, D; Gandelman, M; Gandini, P; Gao, Y; Garofoli, J; Garosi, P; Garra Tico, J; Garrido, L; Gaspar, C; Gauld, R; Gersabeck, E; Gersabeck, M; Gershon, T; Ghez, Ph; Gibson, V; Giubega, L; Gligorov, V V; Göbel, C; Golubkov, D; Golutvin, A; Gomes, A; Gordon, H; Grabalosa Gándara, M; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graziani, G; Grecu, A; Greening, E; Gregson, S; Griffith, P; Grünberg, O; Gui, B; Gushchin, E; Guz, Yu; Gys, T; Hadjivasiliou, C; Haefeli, G; Haen, C; Haines, S C; Hall, S; Hamilton, B; Hampson, T; Hansmann-Menzemer, S; Harnew, N; Harnew, S T; Harrison, J; Hartmann, T; He, J; Head, T; Heijne, V; Hennessy, K; Henrard, P; Hernando Morata, J A; van Herwijnen, E; Hicheur, A; Hicks, E; Hill, D; Hoballah, M; Holtrop, M; Hombach, C; Hopchev, P; Hulsbergen, W; Hunt, P; Huse, T; Hussain, N; Hutchcroft, D; Hynds, D; Iakovenko, V; Idzik, M; Ilten, P; Jacobsson, R; Jaeger, A; Jans, E; Jaton, P; Jawahery, A; Jing, F; John, M; Johnson, D; Jones, C R; Joram, C; Jost, B; Kaballo, M; Kandybei, S; Kanso, W; Karacson, M; Karbach, T M; Kenyon, I R; Ketel, T; Keune, A; Khanji, B; Kochebina, O; Komarov, I; Koopman, R F; Koppenburg, P; Korolev, M; Kozlinskiy, A; Kravchuk, L; Kreplin, K; Kreps, M; Krocker, G; Krokovny, P; Kruse, F; Kucharczyk, M; Kudryavtsev, V; Kvaratskheliya, T; La Thi, V N; Lacarrere, D; Lafferty, G; Lai, A; Lambert, D; Lambert, R W; Lanciotti, E; Lanfranchi, G; Langenbruch, C; Latham, T; Lazzeroni, C; Le Gac, R; van Leerdam, J; Lees, J -P; Lefèvre, R; Leflat, A; Lefrançois, J; Leo, S; Leroy, O; Lesiak, T; Leverington, B; Li, Y; Li Gioi, L; Liles, M; Lindner, R; Linn, C; Liu, B; Liu, G; Lohn, S; Longstaff, I; Lopes, J H; Lopez-March, N; Lu, H; Lucchesi, D; Luisier, J; Luo, H; Machefert, F; Machikhiliyan, I V; Maciuc, F; Maev, O; Malde, S; Manca, G; Mancinelli, G; Marconi, U; Märki, R; Marks, J; Martellotti, G; Martens, A; Martín Sánchez, A; Martinelli, M; Martinez Santos, D; Martins Tostes, D; Massafferri, A; Matev, R; Mathe, Z; Matteuzzi, C; Maurice, E; Mazurov, A; Mc Skelly, B; McCarthy, J; McNab, A; McNulty, R; Meadows, B; Meier, F; Meissner, M; Merk, M; Milanes, D A; Minard, M -N; Molina Rodriguez, J; Monteil, S; Moran, D; Morawski, P; Mordà, A; Morello, M J; Mountain, R; Mous, I; Muheim, F; Müller, K; Muresan, R; Muryn, B; Muster, B; Naik, P; Nakada, T; Nandakumar, R; Nasteva, I; Needham, M; Neubert, S; Neufeld, N; Nguyen, A D; Nguyen, T D; Nguyen-Mau, C; Nicol, M; Niess, V; Niet, R; Nikitin, N; Nikodem, T; Nomerotski, A; Novoselov, A; Oblakowska-Mucha, A; Obraztsov, V; Oggero, S; Ogilvy, S; Okhrimenko, O; Oldeman, R; Orlandea, M; Otalora Goicochea, J M; Owen, P; Oyanguren, A; Pal, B K; Palano, A; Palutan, M; Panman, J; Papanestis, A; Pappagallo, M; Parkes, C; Parkinson, C J; Passaleva, G; Patel, G D; Patel, M; Patrick, G N; Patrignani, C; Pavel-Nicorescu, C; Pazos Alvarez, A; Pellegrino, A; Penso, G; Pepe Altarelli, M; Perazzini, S; Perez Trigo, E; Pérez-Calero Yzquierdo, A; Perret, P; Perrin-Terrin, M; Pessina, G; Petridis, K; Petrolini, A; Phan, A; Picatoste Olloqui, E; Pietrzyk, B; Pilař, T; Pinci, D; Playfer, S; Plo Casasus, M; Polci, F; Polok, G; Poluektov, A; Polyakov, I; Polycarpo, E; Popov, A; Popov, D; Popovici, B; Potterat, C; Powell, A; Prisciandaro, J; Pritchard, A; Prouve, C; Pugatch, V; Puig Navarro, A; Punzi, G; Qian, W; Rademacker, J H; Rakotomiaramanana, B; Rangel, M S; Raniuk, I; Rauschmayr, N; Raven, G; Redford, S; Reid, M M; dos Reis, A C; Ricciardi, S; Richards, A; Rinnert, K; Rives Molina, V; Roa Romero, D A; Robbe, P; Rodrigues, E; Rodriguez Perez, P; Roiser, S; Romanovsky, V; Romero Vidal, A; Rouvinet, J; Ruf, T; Ruffini, F; Ruiz, H; Ruiz Valls, P; Sabatino, G; Saborido Silva, J J; Sagidova, N; Sail, P; Saitta, B; Salustino Guimaraes, V; Salzmann, C; Sanmartin Sedes, B; Sannino, M; Santacesaria, R; Santamarina Rios, C; Santovetti, E; Sapunov, M; Sarti, A; Satriano, C; Satta, A; Savrie, M; Savrina, D; Schaack, P; Schiller, M; Schindler, H; Schlupp, M; Schmelling, M; Schmidt, B; Schneider, O; Schopper, A; Schune, M -H; Schwemmer, R; Sciascia, B; Sciubba, A; Seco, M; Semennikov, A; Sepp, I; Serra, N; Serrano, J; Seyfert, P; Shapkin, M; Shapoval, I; Shatalov, P; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, O; Shevchenko, V; Shires, A; Silva Coutinho, R; Sirendi, M; Skwarnicki, T; Smith, N A; Smith, E; Smith, J; Smith, M; Sokoloff, M D; Soler, F J P; Soomro, F; Souza, D; Souza De Paula, B; Spaan, B; Sparkes, A; Spradlin, P; Stagni, F; Stahl, S; Steinkamp, O; Stoica, S; Stone, S; Storaci, B; Straticiuc, M; Straumann, U; Subbiah, V K; Sun, L; Swientek, S; Syropoulos, V; Szczekowski, M; Szczypka, P; Szumlak, T; T'Jampens, S; Teklishyn, M; Teodorescu, E; Teubert, F; Thomas, C; Thomas, E; van Tilburg, J; Tisserand, V; Tobin, M; Tolk, S; Tonelli, D; Topp-Joergensen, S; Torr, N; Tournefier, E; Tourneur, S; Tran, M T; Tresch, M; Tsaregorodtsev, A; Tsopelas, P; Tuning, N; Ubeda Garcia, M; Ukleja, A; Urner, D; Ustyuzhanin, A; Uwer, U; Vagnoni, V; Valenti, G; Vallier, A; Van Dijk, M; Vazquez Gomez, R; Vazquez Regueiro, P; Vázquez Sierra, C; Vecchi, S; Velthuis, J J; Veltri, M; Veneziano, G; Vesterinen, M; Viaud, B; Vieira, D; Vilasis-Cardona, X; Vollhardt, A; Volyanskyy, D; Voong, D; Vorobyev, A; Vorobyev, V; Voß, C; Voss, H; Waldi, R; Wallace, C; Wallace, R; Wandernoth, S; Wang, J; Ward, D R; Watson, N K; Webber, A D; Websdale, D; Whitehead, M; Wicht, J; Wiechczynski, J; Wiedner, D; Wiggers, L; Wilkinson, G; Williams, M P; Williams, M; Wilson, F F; Wimberley, J; Wishahi, J; Witek, M; Wotton, S A; Wright, S; Wu, S; Wyllie, K; Xie, Y; Xing, Z; Yang, Z; Young, R; Yuan, X; Yushchenko, O; Zangoli, M; Zavertyaev, M; Zhang, F; Zhang, L; Zhang, W C; Zhang, Y; Zhelezov, A; Zhokhov, A; Zhong, L; Zvyagin, A

    2013-01-01

    The first observation of the decay $B^0_s\\rightarrow\\chi_{c1}\\phi$ and a study of $B^0\\rightarrow\\chi_{c1,2}K^{*0}$ decays are presented. The analysis is performed using a dataset, corresponding to an integrated luminosity of 1.0 fb$^{-1}$, collected by the LHCb experiment in pp collisions at a centre-of-mass energy of 7 TeV. The following ratios of branching fractions are measured: \\begin{equation*} \\begin{array}{lll} \\dfrac{\\cal{B}(B^0_s\\rightarrow\\chi_{c1}\\phi)}{\\cal{B}(B^0_s\\rightarrow J/\\psi\\phi)} &=& (18.9 \\pm1.8\\,(stat)\\pm1.3\\,(syst)\\pm0.8\\,(\\cal{B})) \\times 10^{-2}, \\\\ \\dfrac{\\cal{B}(B^0\\rightarrow\\chi_{c1}K^{*0})}{\\cal{B}(B^0\\rightarrow J/\\psi K^{*0})} &=& (19.8 \\pm1.1\\,(stat)\\pm1.2\\,(syst)\\pm0.9\\,(\\cal{B})) \\times 10^{-2}, \\\\ \\dfrac{\\cal{B}(B^0\\rightarrow\\chi_{c2}K^{*0})}{\\cal{B}(B^0\\rightarrow\\chi_{c 1}K^{*0})} &=& (17.1 \\pm5.0\\,(stat)\\pm1.7\\,(syst)\\pm1.1\\,(\\cal{B})) \\times 10^{-2}, \\\\ \\end{array} \\end{equation*} where the third uncertainty is due to the limited knowledge o...

  19. Study of the exclusive production of the Meson $ \\chi_{c0}$ in CMS / LHC Experiment

    CERN Document Server

    Da Silva Ramos Carneiro, Marilia

    2013-01-01

    We present a study of the central exclusive pro duction of the c 0 meson in pp collisions at p s = 7 TeV in the CMS detector at the LHC collider. The c 0 is a c c meson state with the same quantum numb ers as the Higgs b oson, so it's observation is a go o d opp ortunity to test the exclusive pro duction mechanism. We b egin with a brief description of the Standard Mo del, diraction physics and the exp erimental environment. The analysis was done using data collected in 2010 by CMS. We p erformed eciency studies using real data and a sample of simulated Monte Carlo events and a preliminary estimation of the cross section

  20. Co-cultivation of mutant Penicillium oxalicum SAU(E)-3.510 and Pleurotus ostreatus for simultaneous biosynthesis of xylanase and laccase under solid-state fermentation.

    Science.gov (United States)

    Dwivedi, Pallavi; Vivekanand, V; Pareek, Nidhi; Sharma, Amit; Singh, Rajesh P

    2011-10-01

    Co-cultivation of mutant Penicillium oxalicum SAU(E)-3.510 and Pleurotus ostreatus MTCC 1804 was evaluated for the production of xylanase-laccase mixture under solid-state fermentation (SSF) condition. Growth compatibility between mutant P. oxalicum SAU(E)-3.510 and white rot fungi (P. ostreatus MTCC 1804, Trametes hirsuta MTCC 136 and Pycnoporus sp. MTCC 137) was analyzed by growing them on potato dextrose agar plate. Extracellular enzyme activities were determined spectrophotometrically. Under derived conditions, paired culturing of mutant P. oxalicum SAU(E)-3.510 and P. ostreatus MTCC 1804 resulted in 58% and 33% higher levels of xylanase and laccase production, respectively. A combination of sugarcane bagasse and black gram husk in a ratio of 3:1 was found to be the most ideal solid substrate and support for fungal colonization and enzyme production during co-cultivation. Maximum levels of xylanase (8205.31 ± 168.31 IU g(-1)) and laccase (375.53 ± 34.17 IU g(-1)) during SSF were obtained by using 4 g of solid support with 80% of moisture content. Furthermore, expressions of both xylanase and laccase were characterized during mixed culture by zymogram analysis. Improved levels of xylanase and laccase biosynthesis were achieved by co-culturing the mutant P. oxalicum SAU(E)-3.510 and P. ostreatus MTCC 1804. This may be because of efficient substrate utilization as compared to their respective monocultures in the presence of lignin degradation compounds because of synergistic action of xylanase and laccase. Understanding and developing the process of co-cultivation appears productive for the development of mixed enzyme preparation with tremendous potential for biobleaching. Copyright © 2011 Elsevier B.V. All rights reserved.

  1. Hadroproduction of the {chi}{sub 1} and {chi}{sub 2} states of charmonium in 800-GeV/c proton-silicon interactions

    Energy Technology Data Exchange (ETDEWEB)

    Alexopoulos, T. [University of Wisconsin, Madison, Wisconsin 53706 (United States); Antoniazzi, L. [University and INFN of Pavia, I-27100 Pavia, (Italy); Arenton, M. [University of Virginia, Charlottesville, Virginia 22901 (United States); Ballagh, H. C. [University of California at Berkeley, Berkeley, California 94720 (United States); Bingham, H. [University of California at Berkeley, Berkeley, California 94720 (United States); Blankman, A. [University of Pennsylvania, Philadelphia, Pennsylvania 19104 (United States); Block, M. [Northwestern University, Evanston, Illinois 60208 (United States); Boden, A. [University of California at Los Angeles, Los Angeles, California 90024 (United States); Bonomi, G. [University and INFN of Pavia, I-27100 Pavia, (Italy); Cao, Z. L. [University of Virginia, Charlottesville, Virginia 22901 (United States)] (and others)

    2000-08-01

    The cross sections for the hadroproduction of the {chi}{sub 1} and {chi}{sub 2} states of charmonium in proton-silicon collisions at {radical}(s)=38.8 GeV have been measured in Fermilab fixed target experiment 771. The {chi} states were observed via their radiative decay to J/{psi}{gamma}, where the photon converted to e{sup +}e{sup -} in the material of the spectrometer. The estimated values for the {chi}{sub 1} and {chi}{sub 2} cross sections for x{sub F}>0 are 263{+-}69(stat){+-}32(syst) and 498{+-}143(stat){+-}67(syst) nb per nucleon, respectively. The resulting {sigma}({chi}{sub 1})/{sigma}({chi}{sub 2}) ratio of 0.53{+-}0.20(stat){+-}0.07(syst), although somewhat larger than most theoretical expectations, can be accommodated by the latest theoretical estimates. (c) 2000 The American Physical Society.

  2. Formation of the Chi 1 and Chi 2 charmonium states in pantip annihilation at the ISR

    International Nuclear Information System (INIS)

    Fay, J.

    1986-01-01

    R704 experiment has studied the Chi 1 and Chi 2 charmonium states (cantic) in their J/Psi Gamma decay. These states are directly formed in the interaction of a hydrogen molecular jet target with a antiprotons beam permanently cooled, circulating in the ring 2 of the ISR. This process allows a high luminosity to be reached (up to 3 10 30 cm -2 s -1 ). The huge hadronic background leads to detect only electromagnetic final states. The detector is a two-arm no magnetic spectrometer in two parts. The first one is devoted to charged particle detection: tracking (MWPC, scintillators) and electron identification (Cerenkov). The second one forms a calorimeter measuring the position and the energy of photons and electrons (lead-scintillator sandwiches, proportional chambers using analogue read-out and lead-glass wall). Event selection is based on Psi identification from two electron tracks (one in each arm) and search for the radiated photon reconstructed from the Chi decay kinematics. For Chi 1 and Chi 2 respectively, a set of 32 and 55 events is found with a negligeable background level and one obtains values on mass, width and branching ratios on pantip. These results are compared with theoretical prediction from QCD inspired models: masses are well described by potential methods and sum rules (within a 10 MeV uncertainly). For the widths, only a raw value can be achieved while branching ratios are in good agreement with our measurements [fr

  3. Structure of the (0+,1+) mesons Bs0 and Bs1, and the strong coupling constant gBs0BK and gBs1B*K

    International Nuclear Information System (INIS)

    Wang, Z. G.

    2008-01-01

    In this article, we take the point of view that the bottomed (0 + ,1 + ) mesons B s0 and B s1 are the conventional bs meson and calculate the strong coupling constants g B s0 BK and g B s1 B*K with the light-cone QCD sum rules. The numerical values of strong coupling constants g B s1 B*K and g B s0 BK are very large and support the hadronic dressing mechanism. Just like the scalar mesons f 0 (980), a 0 (980), D s0 and axial-vector meson D s1 , the (0 + ,1 + ) bottomed mesons B s0 and B s1 may have small bs kernels of the typical bs meson size. The strong couplings to the hadronic channels (or the virtual mesons loops) may result in smaller masses than the conventional bs mesons in the potential quark models and enrich the pure bs states with other components.

  4. QCD sum-rules analysis of vector (1-) heavy quarkonium meson-hybrid mixing

    Science.gov (United States)

    Palameta, A.; Ho, J.; Harnett, D.; Steele, T. G.

    2018-02-01

    We use QCD Laplace sum rules to study meson-hybrid mixing in vector (1-) heavy quarkonium. We compute the QCD cross-correlator between a heavy meson current and a heavy hybrid current within the operator product expansion. In addition to leading-order perturbation theory, we include four- and six-dimensional gluon condensate contributions as well as a six-dimensional quark condensate contribution. We construct several single and multiresonance models that take known hadron masses as inputs. We investigate which resonances couple to both currents and so exhibit meson-hybrid mixing. Compared to single resonance models that include only the ground state, we find that models that also include excited states lead to significantly improved agreement between QCD and experiment. In the charmonium sector, we find that meson-hybrid mixing is consistent with a two-resonance model consisting of the J /ψ and a 4.3 GeV resonance. In the bottomonium sector, we find evidence for meson-hybrid mixing in the ϒ (1 S ) , ϒ (2 S ), ϒ (3 S ), and ϒ (4 S ).

  5. Measurement of the production cross section ratio $\\sigma(\\chi_{b2}(1\\mathrm{P}))/ \\sigma(\\chi_{b1}(1\\mathrm{P}))$ in pp collisions at $\\sqrt{s}$ = 8 TeV

    CERN Document Server

    Khachatryan, Vardan; Tumasyan, Armen; Adam, Wolfgang; Bergauer, Thomas; Dragicevic, Marko; Erö, Janos; Fabjan, Christian; Friedl, Markus; Fruehwirth, Rudolf; Ghete, Vasile Mihai; Hartl, Christian; Hörmann, Natascha; Hrubec, Josef; Jeitler, Manfred; Kiesenhofer, Wolfgang; Knünz, Valentin; Krammer, Manfred; Krätschmer, Ilse; Liko, Dietrich; Mikulec, Ivan; Rabady, Dinyar; Rahbaran, Babak; Rohringer, Herbert; Schöfbeck, Robert; Strauss, Josef; Taurok, Anton; Treberer-Treberspurg, Wolfgang; Waltenberger, Wolfgang; Wulz, Claudia-Elisabeth; Mossolov, Vladimir; Shumeiko, Nikolai; Suarez Gonzalez, Juan; Alderweireldt, Sara; Bansal, Monika; Bansal, Sunil; Cornelis, Tom; De Wolf, Eddi A; Janssen, Xavier; Knutsson, Albert; Luyckx, Sten; Ochesanu, Silvia; Roland, Benoit; Rougny, Romain; Van De Klundert, Merijn; Van Haevermaet, Hans; Van Mechelen, Pierre; Van Remortel, Nick; Van Spilbeeck, Alex; Blekman, Freya; Blyweert, Stijn; D'Hondt, Jorgen; Daci, Nadir; Heracleous, Natalie; Keaveney, James; Lowette, Steven; Maes, Michael; Olbrechts, Annik; Python, Quentin; Strom, Derek; Tavernier, Stefaan; Van Doninck, Walter; Van Mulders, Petra; Van Onsem, Gerrit Patrick; Villella, Ilaria; Caillol, Cécile; Clerbaux, Barbara; De Lentdecker, Gilles; Dobur, Didar; Favart, Laurent; Gay, Arnaud; Grebenyuk, Anastasia; Léonard, Alexandre; Mohammadi, Abdollah; Perniè, Luca; Reis, Thomas; Seva, Tomislav; Thomas, Laurent; Vander Velde, Catherine; Vanlaer, Pascal; Wang, Jian; Adler, Volker; Beernaert, Kelly; Benucci, Leonardo; Cimmino, Anna; Costantini, Silvia; Crucy, Shannon; Dildick, Sven; Fagot, Alexis; Garcia, Guillaume; Mccartin, Joseph; Ocampo Rios, Alberto Andres; Ryckbosch, Dirk; Salva Diblen, Sinem; Sigamani, Michael; Strobbe, Nadja; Thyssen, Filip; Tytgat, Michael; Yazgan, Efe; Zaganidis, Nicolas; Basegmez, Suzan; Beluffi, Camille; Bruno, Giacomo; Castello, Roberto; Caudron, Adrien; Ceard, Ludivine; Da Silveira, Gustavo Gil; Delaere, Christophe; Du Pree, Tristan; Favart, Denis; Forthomme, Laurent; Giammanco, Andrea; Hollar, Jonathan; Jez, Pavel; Komm, Matthias; Lemaitre, Vincent; Nuttens, Claude; Pagano, Davide; Perrini, Lucia; Pin, Arnaud; Piotrzkowski, Krzysztof; Popov, Andrey; Quertenmont, Loic; Selvaggi, Michele; Vidal Marono, Miguel; Vizan Garcia, Jesus Manuel; Beliy, Nikita; Caebergs, Thierry; Daubie, Evelyne; Hammad, Gregory Habib; Aldá Júnior, Walter Luiz; Alves, Gilvan; Brito, Lucas; Correa Martins Junior, Marcos; Dos Reis Martins, Thiago; Mora Herrera, Clemencia; Pol, Maria Elena; Carvalho, Wagner; Chinellato, Jose; Custódio, Analu; Melo Da Costa, Eliza; De Jesus Damiao, Dilson; De Oliveira Martins, Carley; Fonseca De Souza, Sandro; Malbouisson, Helena; Matos Figueiredo, Diego; Mundim, Luiz; Nogima, Helio; Prado Da Silva, Wanda Lucia; Santaolalla, Javier; Santoro, Alberto; Sznajder, Andre; Tonelli Manganote, Edmilson José; Vilela Pereira, Antonio; Bernardes, Cesar Augusto; Dogra, Sunil; Tomei, Thiago; De Moraes Gregores, Eduardo; Mercadante, Pedro G; Novaes, Sergio F; Padula, Sandra; Aleksandrov, Aleksandar; Genchev, Vladimir; Iaydjiev, Plamen; Marinov, Andrey; Piperov, Stefan; Rodozov, Mircho; Stoykova, Stefka; Sultanov, Georgi; Tcholakov, Vanio; Vutova, Mariana; Dimitrov, Anton; Glushkov, Ivan; Hadjiiska, Roumyana; Kozhuharov, Venelin; Litov, Leander; Pavlov, Borislav; Petkov, Peicho; Bian, Jian-Guo; Chen, Guo-Ming; Chen, He-Sheng; Chen, Mingshui; Du, Ran; Jiang, Chun-Hua; Liang, Song; Plestina, Roko; Tao, Junquan; Wang, Xianyou; Wang, Zheng; Asawatangtrakuldee, Chayanit; Ban, Yong; Guo, Yifei; Li, Qiang; Li, Wenbo; Liu, Shuai; Mao, Yajun; Qian, Si-Jin; Wang, Dayong; Zhang, Linlin; Zou, Wei; Avila, Carlos; Chaparro Sierra, Luisa Fernanda; Florez, Carlos; Gomez, Juan Pablo; Gomez Moreno, Bernardo; Sanabria, Juan Carlos; Godinovic, Nikola; Lelas, Damir; Polic, Dunja; Puljak, Ivica; Antunovic, Zeljko; Kovac, Marko; Brigljevic, Vuko; Kadija, Kreso; Luetic, Jelena; Mekterovic, Darko; Sudic, Lucija; Attikis, Alexandros; Mavromanolakis, Georgios; Mousa, Jehad; Nicolaou, Charalambos; Ptochos, Fotios; Razis, Panos A; Bodlak, Martin; Finger, Miroslav; Finger Jr, Michael; Assran, Yasser; Ellithi Kamel, Ali; Mahmoud, Mohammed; Radi, Amr; Kadastik, Mario; Murumaa, Marion; Raidal, Martti; Tiko, Andres; Eerola, Paula; Fedi, Giacomo; Voutilainen, Mikko; Härkönen, Jaakko; Karimäki, Veikko; Kinnunen, Ritva; Kortelainen, Matti J; Lampén, Tapio; Lassila-Perini, Kati; Lehti, Sami; Lindén, Tomas; Luukka, Panja-Riina; Mäenpää, Teppo; Peltola, Timo; Tuominen, Eija; Tuominiemi, Jorma; Tuovinen, Esa; Wendland, Lauri; Tuuva, Tuure; Besancon, Marc; Couderc, Fabrice; Dejardin, Marc; Denegri, Daniel; Fabbro, Bernard; Faure, Jean-Louis; Favaro, Carlotta; Ferri, Federico; Ganjour, Serguei; Givernaud, Alain; Gras, Philippe; Hamel de Monchenault, Gautier; Jarry, Patrick; Locci, Elizabeth; Malcles, Julie; Rander, John; Rosowsky, André; Titov, Maksym; Baffioni, Stephanie; Beaudette, Florian; Busson, Philippe; Charlot, Claude; Dahms, Torsten; Dalchenko, Mykhailo; Dobrzynski, Ludwik; Filipovic, Nicolas; Florent, Alice; Granier de Cassagnac, Raphael; Mastrolorenzo, Luca; Miné, Philippe; Mironov, Camelia; Naranjo, Ivo Nicolas; Nguyen, Matthew; Ochando, Christophe; Paganini, Pascal; Regnard, Simon; Salerno, Roberto; Sauvan, Jean-Baptiste; Sirois, Yves; Veelken, Christian; Yilmaz, Yetkin; Zabi, Alexandre; Agram, Jean-Laurent; Andrea, Jeremy; Aubin, Alexandre; Bloch, Daniel; Brom, Jean-Marie; Chabert, Eric Christian; Collard, Caroline; Conte, Eric; Fontaine, Jean-Charles; Gelé, Denis; Goerlach, Ulrich; Goetzmann, Christophe; Le Bihan, Anne-Catherine; Van Hove, Pierre; Gadrat, Sébastien; Beauceron, Stephanie; Beaupere, Nicolas; Boudoul, Gaelle; Bouvier, Elvire; Brochet, Sébastien; Carrillo Montoya, Camilo Andres; Chasserat, Julien; Chierici, Roberto; Contardo, Didier; Depasse, Pierre; El Mamouni, Houmani; Fan, Jiawei; Fay, Jean; Gascon, Susan; Gouzevitch, Maxime; Ille, Bernard; Kurca, Tibor; Lethuillier, Morgan; Mirabito, Laurent; Perries, Stephane; Ruiz Alvarez, José David; Sabes, David; Sgandurra, Louis; Sordini, Viola; Vander Donckt, Muriel; Verdier, Patrice; Viret, Sébastien; Xiao, Hong; Tsamalaidze, Zviad; Autermann, Christian; Beranek, Sarah; Bontenackels, Michael; Edelhoff, Matthias; Feld, Lutz; Hindrichs, Otto; Klein, Katja; Ostapchuk, Andrey; Perieanu, Adrian; Raupach, Frank; Sammet, Jan; Schael, Stefan; Weber, Hendrik; Wittmer, Bruno; Zhukov, Valery; Ata, Metin; Dietz-Laursonn, Erik; Duchardt, Deborah; Erdmann, Martin; Fischer, Robert; Güth, Andreas; Hebbeker, Thomas; Heidemann, Carsten; Hoepfner, Kerstin; Klingebiel, Dennis; Knutzen, Simon; Kreuzer, Peter; Merschmeyer, Markus; Meyer, Arnd; Millet, Philipp; Olschewski, Mark; Padeken, Klaas; Papacz, Paul; Reithler, Hans; Schmitz, Stefan Antonius; Sonnenschein, Lars; Teyssier, Daniel; Thüer, Sebastian; Weber, Martin; Cherepanov, Vladimir; Erdogan, Yusuf; Flügge, Günter; Geenen, Heiko; Geisler, Matthias; Haj Ahmad, Wael; Heister, Arno; Hoehle, Felix; Kargoll, Bastian; Kress, Thomas; Kuessel, Yvonne; Lingemann, Joschka; Nowack, Andreas; Nugent, Ian Michael; Perchalla, Lars; Pooth, Oliver; Stahl, Achim; Asin, Ivan; Bartosik, Nazar; Behr, Joerg; Behrenhoff, Wolf; Behrens, Ulf; Bell, Alan James; Bergholz, Matthias; Bethani, Agni; Borras, Kerstin; Burgmeier, Armin; Cakir, Altan; Calligaris, Luigi; Campbell, Alan; Choudhury, Somnath; Costanza, Francesco; Diez Pardos, Carmen; Dooling, Samantha; Dorland, Tyler; Eckerlin, Guenter; Eckstein, Doris; Eichhorn, Thomas; Flucke, Gero; Garay Garcia, Jasone; Geiser, Achim; Gunnellini, Paolo; Hauk, Johannes; Hempel, Maria; Horton, Dean; Jung, Hannes; Kalogeropoulos, Alexis; Kasemann, Matthias; Katsas, Panagiotis; Kieseler, Jan; Kleinwort, Claus; Krücker, Dirk; Lange, Wolfgang; Leonard, Jessica; Lipka, Katerina; Lobanov, Artur; Lohmann, Wolfgang; Lutz, Benjamin; Mankel, Rainer; Marfin, Ihar; Melzer-Pellmann, Isabell-Alissandra; Meyer, Andreas Bernhard; Mittag, Gregor; Mnich, Joachim; Mussgiller, Andreas; Naumann-Emme, Sebastian; Nayak, Aruna; Novgorodova, Olga; Nowak, Friederike; Ntomari, Eleni; Perrey, Hanno; Pitzl, Daniel; Placakyte, Ringaile; Raspereza, Alexei; Ribeiro Cipriano, Pedro M; Ron, Elias; Sahin, Mehmet Özgür; Salfeld-Nebgen, Jakob; Saxena, Pooja; Schmidt, Ringo; Schoerner-Sadenius, Thomas; Schröder, Matthias; Seitz, Claudia; Spannagel, Simon; Vargas Trevino, Andrea Del Rocio; Walsh, Roberval; Wissing, Christoph; Aldaya Martin, Maria; Blobel, Volker; Centis Vignali, Matteo; Draeger, Arne-Rasmus; Erfle, Joachim; Garutti, Erika; Goebel, Kristin; Görner, Martin; Haller, Johannes; Hoffmann, Malte; Höing, Rebekka Sophie; Kirschenmann, Henning; Klanner, Robert; Kogler, Roman; Lange, Jörn; Lapsien, Tobias; Lenz, Teresa; Marchesini, Ivan; Ott, Jochen; Peiffer, Thomas; Pietsch, Niklas; Poehlsen, Jennifer; Pöhlsen, Thomas; Rathjens, Denis; Sander, Christian; Schettler, Hannes; Schleper, Peter; Schlieckau, Eike; Schmidt, Alexander; Seidel, Markus; Sola, Valentina; Stadie, Hartmut; Steinbrück, Georg; Troendle, Daniel; Usai, Emanuele; Vanelderen, Lukas; Barth, Christian; Baus, Colin; Berger, Joram; Böser, Christian; Butz, Erik; Chwalek, Thorsten; De Boer, Wim; Descroix, Alexis; Dierlamm, Alexander; Feindt, Michael; Frensch, Felix; Giffels, Manuel; Hartmann, Frank; Hauth, Thomas; Husemann, Ulrich; Katkov, Igor; Kornmayer, Andreas; Kuznetsova, Ekaterina; Lobelle Pardo, Patricia; Mozer, Matthias Ulrich; Müller, Thomas; Nürnberg, Andreas; Quast, Gunter; Rabbertz, Klaus; Ratnikov, Fedor; Röcker, Steffen; Simonis, Hans-Jürgen; Stober, Fred-Markus Helmut; Ulrich, Ralf; Wagner-Kuhr, Jeannine; Wayand, Stefan; Weiler, Thomas; Wolf, Roger; Anagnostou, Georgios; Daskalakis, Georgios; Geralis, Theodoros; Giakoumopoulou, Viktoria Athina; Kyriakis, Aristotelis; Loukas, Demetrios; Markou, Athanasios; Markou, Christos; Psallidas, Andreas; Topsis-Giotis, Iasonas; Kesisoglou, Stilianos; Panagiotou, Apostolos; Saoulidou, Niki; Stiliaris, Efstathios; Aslanoglou, Xenofon; Evangelou, Ioannis; Flouris, Giannis; Foudas, Costas; Kokkas, Panagiotis; Manthos, Nikolaos; Papadopoulos, Ioannis; Paradas, Evangelos; Bencze, Gyorgy; Hajdu, Csaba; Hidas, Pàl; Horvath, Dezso; Sikler, Ferenc; Veszpremi, Viktor; Vesztergombi, Gyorgy; Zsigmond, Anna Julia; Beni, Noemi; Czellar, Sandor; Karancsi, János; Molnar, Jozsef; Palinkas, Jozsef; Szillasi, Zoltan; Raics, Peter; Trocsanyi, Zoltan Laszlo; Ujvari, Balazs; Swain, Sanjay Kumar; Beri, Suman Bala; Bhatnagar, Vipin; Dhingra, Nitish; Gupta, Ruchi; Bhawandeep, Bhawandeep; Kalsi, Amandeep Kaur; Kaur, Manjit; Mittal, Monika; Nishu, Nishu; Singh, Jasbir; Kumar, Ashok; Kumar, Arun; Ahuja, Sudha; Bhardwaj, Ashutosh; Choudhary, Brajesh C; Kumar, Ajay; Malhotra, Shivali; Naimuddin, Md; Ranjan, Kirti; Sharma, Varun; Banerjee, Sunanda; Bhattacharya, Satyaki; Chatterjee, Kalyanmoy; Dutta, Suchandra; Gomber, Bhawna; Jain, Sandhya; Jain, Shilpi; Khurana, Raman; Modak, Atanu; Mukherjee, Swagata; Roy, Debarati; Sarkar, Subir; Sharan, Manoj; Abdulsalam, Abdulla; Dutta, Dipanwita; Kailas, Swaminathan; Kumar, Vineet; Mohanty, Ajit Kumar; Pant, Lalit Mohan; Shukla, Prashant; Topkar, Anita; Aziz, Tariq; Banerjee, Sudeshna; Bhowmik, Sandeep; Chatterjee, Rajdeep Mohan; Dewanjee, Ram Krishna; Dugad, Shashikant; Ganguly, Sanmay; Ghosh, Saranya; Guchait, Monoranjan; Gurtu, Atul; Kole, Gouranga; Kumar, Sanjeev; Maity, Manas; Majumder, Gobinda; Mazumdar, Kajari; Mohanty, Gagan Bihari; Parida, Bibhuti; Sudhakar, Katta; Wickramage, Nadeesha; Bakhshiansohi, Hamed; Behnamian, Hadi; Etesami, Seyed Mohsen; Fahim, Ali; Goldouzian, Reza; Jafari, Abideh; Khakzad, Mohsen; Mohammadi Najafabadi, Mojtaba; Naseri, Mohsen; Paktinat Mehdiabadi, Saeid; Rezaei Hosseinabadi, Ferdos; Safarzadeh, Batool; Zeinali, Maryam; Felcini, Marta; Grunewald, Martin; Abbrescia, Marcello; Barbone, Lucia; Calabria, Cesare; Chhibra, Simranjit Singh; Colaleo, Anna; Creanza, Donato; De Filippis, Nicola; De Palma, Mauro; Fiore, Luigi; Iaselli, Giuseppe; Maggi, Giorgio; Maggi, Marcello; My, Salvatore; Nuzzo, Salvatore; Pompili, Alexis; Pugliese, Gabriella; Radogna, Raffaella; Selvaggi, Giovanna; Silvestris, Lucia; Singh, Gurpreet; Venditti, Rosamaria; Verwilligen, Piet; Zito, Giuseppe; Abbiendi, Giovanni; Benvenuti, Alberto; Bonacorsi, Daniele; Braibant-Giacomelli, Sylvie; Brigliadori, Luca; Campanini, Renato; Capiluppi, Paolo; Castro, Andrea; Cavallo, Francesca Romana; Codispoti, Giuseppe; Cuffiani, Marco; Dallavalle, Gaetano-Marco; Fabbri, Fabrizio; Fanfani, Alessandra; Fasanella, Daniele; Giacomelli, Paolo; Grandi, Claudio; Guiducci, Luigi; Marcellini, Stefano; Masetti, Gianni; Montanari, Alessandro; Navarria, Francesco; Perrotta, Andrea; Primavera, Federica; Rossi, Antonio; Rovelli, Tiziano; Siroli, Gian Piero; Tosi, Nicolò; Travaglini, Riccardo; Albergo, Sebastiano; Cappello, Gigi; Chiorboli, Massimiliano; Costa, Salvatore; Giordano, Ferdinando; Potenza, Renato; Tricomi, Alessia; Tuve, Cristina; Barbagli, Giuseppe; Ciulli, Vitaliano; Civinini, Carlo; D'Alessandro, Raffaello; Focardi, Ettore; Gallo, Elisabetta; Gonzi, Sandro; Gori, Valentina; Lenzi, Piergiulio; Meschini, Marco; Paoletti, Simone; Sguazzoni, Giacomo; Tropiano, Antonio; Benussi, Luigi; Bianco, Stefano; Fabbri, Franco; Piccolo, Davide; Ferro, Fabrizio; Lo Vetere, Maurizio; Robutti, Enrico; Tosi, Silvano; Dinardo, Mauro Emanuele; Fiorendi, Sara; Gennai, Simone; Gerosa, Raffaele; Ghezzi, Alessio; Govoni, Pietro; Lucchini, Marco Toliman; Malvezzi, Sandra; Manzoni, Riccardo Andrea; Martelli, Arabella; Marzocchi, Badder; Menasce, Dario; Moroni, Luigi; Paganoni, Marco; Pedrini, Daniele; Ragazzi, Stefano; Redaelli, Nicola; Tabarelli de Fatis, Tommaso; Buontempo, Salvatore; Cavallo, Nicola; Di Guida, Salvatore; Fabozzi, Francesco; Iorio, Alberto Orso Maria; Lista, Luca; Meola, Sabino; Merola, Mario; Paolucci, Pierluigi; Azzi, Patrizia; Bacchetta, Nicola; Bisello, Dario; Branca, Antonio; Carlin, Roberto; Checchia, Paolo; Dall'Osso, Martino; Dorigo, Tommaso; Dosselli, Umberto; Galanti, Mario; Gasparini, Fabrizio; Gasparini, Ugo; Giubilato, Piero; Gonella, Franco; Gozzelino, Andrea; Kanishchev, Konstantin; Lacaprara, Stefano; Margoni, Martino; Montecassiano, Fabio; Pazzini, Jacopo; Pozzobon, Nicola; Ronchese, Paolo; Simonetto, Franco; Tosi, Mia; Zotto, Pierluigi; Zucchetta, Alberto; Zumerle, Gianni; Gabusi, Michele; Ratti, Sergio P; Riccardi, Cristina; Salvini, Paola; Vitulo, Paolo; Biasini, Maurizio; Bilei, Gian Mario; Ciangottini, Diego; Fanò, Livio; Lariccia, Paolo; Mantovani, Giancarlo; Menichelli, Mauro; Romeo, Francesco; Saha, Anirban; Santocchia, Attilio; Spiezia, Aniello; Androsov, Konstantin; Azzurri, Paolo; Bagliesi, Giuseppe; Bernardini, Jacopo; Boccali, Tommaso; Broccolo, Giuseppe; Castaldi, Rino; Ciocci, Maria Agnese; Dell'Orso, Roberto; Donato, Silvio; Fiori, Francesco; Foà, Lorenzo; Giassi, Alessandro; Grippo, Maria Teresa; Ligabue, Franco; Lomtadze, Teimuraz; Martini, Luca; Messineo, Alberto; Moon, Chang-Seong; Palla, Fabrizio; Rizzi, Andrea; Savoy-Navarro, Aurore; Serban, Alin Titus; Spagnolo, Paolo; Squillacioti, Paola; Tenchini, Roberto; Tonelli, Guido; Venturi, Andrea; Verdini, Piero Giorgio; Vernieri, Caterina; Barone, Luciano; Cavallari, Francesca; D'imperio, Giulia; Del Re, Daniele; Diemoz, Marcella; Grassi, Marco; Jorda, Clara; Longo, Egidio; Margaroli, Fabrizio; Meridiani, Paolo; Micheli, Francesco; Nourbakhsh, Shervin; Organtini, Giovanni; Paramatti, Riccardo; Rahatlou, Shahram; Rovelli, Chiara; Santanastasio, Francesco; Soffi, Livia; Traczyk, Piotr; Amapane, Nicola; Arcidiacono, Roberta; Argiro, Stefano; Arneodo, Michele; Bellan, Riccardo; Biino, Cristina; Cartiglia, Nicolo; Casasso, Stefano; Costa, Marco; Degano, Alessandro; Demaria, Natale; Dujany, Giulio; Finco, Linda; Mariotti, Chiara; Maselli, Silvia; Migliore, Ernesto; Monaco, Vincenzo; Musich, Marco; Obertino, Maria Margherita; Ortona, Giacomo; Pacher, Luca; Pastrone, Nadia; Pelliccioni, Mario; Pinna Angioni, Gian Luca; Potenza, Alberto; Romero, Alessandra; Ruspa, Marta; Sacchi, Roberto; Solano, Ada; Staiano, Amedeo; Tamponi, Umberto; Belforte, Stefano; Candelise, Vieri; Casarsa, Massimo; Cossutti, Fabio; Della Ricca, Giuseppe; Gobbo, Benigno; La Licata, Chiara; Marone, Matteo; Montanino, Damiana; Schizzi, Andrea; Umer, Tomo; Zanetti, Anna; Chang, Sunghyun; Kropivnitskaya, Anna; Nam, Soon-Kwon; Kim, Dong Hee; Kim, Gui Nyun; Kim, Min Suk; Kong, Dae Jung; Lee, Sangeun; Oh, Young Do; Park, Hyangkyu; Sakharov, Alexandre; Son, Dong-Chul; Kim, Tae Jeong; Kim, Jae Yool; Song, Sanghyeon; Choi, Suyong; Gyun, Dooyeon; Hong, Byung-Sik; Jo, Mihee; Kim, Hyunchul; Kim, Yongsun; Lee, Byounghoon; Lee, Kyong Sei; Park, Sung Keun; Roh, Youn; Choi, Minkyoo; Kim, Ji Hyun; Park, Inkyu; Park, Sangnam; Ryu, Geonmo; Ryu, Min Sang; Choi, Young-Il; Choi, Young Kyu; Goh, Junghwan; Kim, Donghyun; Kwon, Eunhyang; Lee, Jongseok; Seo, Hyunkwan; Yu, Intae; Juodagalvis, Andrius; Komaragiri, Jyothsna Rani; Md Ali, Mohd Adli Bin; Castilla-Valdez, Heriberto; De La Cruz-Burelo, Eduard; Heredia-de La Cruz, Ivan; Lopez-Fernandez, Ricardo; Sánchez Hernández, Alberto; Carrillo Moreno, Salvador; Vazquez Valencia, Fabiola; Pedraza, Isabel; Salazar Ibarguen, Humberto Antonio; Casimiro Linares, Edgar; Morelos Pineda, Antonio; Krofcheck, David; Butler, Philip H; Reucroft, Steve; Ahmad, Ashfaq; Ahmad, Muhammad; Hassan, Qamar; Hoorani, Hafeez R; Khalid, Shoaib; Khan, Wajid Ali; Khurshid, Taimoor; Shah, Mehar Ali; Shoaib, Muhammad; Bialkowska, Helena; Bluj, Michal; Boimska, Bożena; Frueboes, Tomasz; Górski, Maciej; Kazana, Malgorzata; Nawrocki, Krzysztof; Romanowska-Rybinska, Katarzyna; Szleper, Michal; Zalewski, Piotr; Brona, Grzegorz; Bunkowski, Karol; Cwiok, Mikolaj; Dominik, Wojciech; Doroba, Krzysztof; Kalinowski, Artur; Konecki, Marcin; Krolikowski, Jan; Misiura, Maciej; Olszewski, Michał; Wolszczak, Weronika; Bargassa, Pedrame; Beirão Da Cruz E Silva, Cristóvão; Faccioli, Pietro; Ferreira Parracho, Pedro Guilherme; Gallinaro, Michele; Nguyen, Federico; Rodrigues Antunes, Joao; Seixas, Joao; Varela, Joao; Vischia, Pietro; Golutvin, Igor; Gorbunov, Ilya; Karjavin, Vladimir; Konoplyanikov, Viktor; Korenkov, Vladimir; Lanev, Alexander; Malakhov, Alexander; Matveev, Viktor; Mitsyn, Valeri Valentinovitch; Moisenz, Petr; Palichik, Vladimir; Perelygin, Victor; Shmatov, Sergey; Skatchkov, Nikolai; Smirnov, Vitaly; Tikhonenko, Elena; Yuldashev, Bekhzod S; Zarubin, Anatoli; Golovtsov, Victor; Ivanov, Yury; Kim, Victor; Levchenko, Petr; Murzin, Victor; Oreshkin, Vadim; Smirnov, Igor; Sulimov, Valentin; Uvarov, Lev; Vavilov, Sergey; Vorobyev, Alexey; Vorobyev, Andrey; Andreev, Yuri; Dermenev, Alexander; Gninenko, Sergei; Golubev, Nikolai; Kirsanov, Mikhail; Krasnikov, Nikolai; Pashenkov, Anatoli; Tlisov, Danila; Toropin, Alexander; Epshteyn, Vladimir; Gavrilov, Vladimir; Lychkovskaya, Natalia; Popov, Vladimir; Safronov, Grigory; Semenov, Sergey; Spiridonov, Alexander; Stolin, Viatcheslav; Vlasov, Evgueni; Zhokin, Alexander; Andreev, Vladimir; Azarkin, Maksim; Dremin, Igor; Kirakosyan, Martin; Leonidov, Andrey; Mesyats, Gennady; Rusakov, Sergey V; Vinogradov, Alexey; Belyaev, Andrey; Boos, Edouard; Dubinin, Mikhail; Dudko, Lev; Ershov, Alexander; Gribushin, Andrey; Klyukhin, Vyacheslav; Kodolova, Olga; Lokhtin, Igor; Obraztsov, Stepan; Petrushanko, Sergey; Savrin, Viktor; Snigirev, Alexander; Azhgirey, Igor; Bayshev, Igor; Bitioukov, Sergei; Kachanov, Vassili; Kalinin, Alexey; Konstantinov, Dmitri; Krychkine, Victor; Petrov, Vladimir; Ryutin, Roman; Sobol, Andrei; Tourtchanovitch, Leonid; Troshin, Sergey; Tyurin, Nikolay; Uzunian, Andrey; Volkov, Alexey; Adzic, Petar; Ekmedzic, Marko; Milosevic, Jovan; Rekovic, Vladimir; Alcaraz Maestre, Juan; Battilana, Carlo; Calvo, Enrique; Cerrada, Marcos; Chamizo Llatas, Maria; Colino, Nicanor; De La Cruz, Begona; Delgado Peris, Antonio; Domínguez Vázquez, Daniel; Escalante Del Valle, Alberto; Fernandez Bedoya, Cristina; Fernández Ramos, Juan Pablo; Flix, Jose; Fouz, Maria Cruz; Garcia-Abia, Pablo; Gonzalez Lopez, Oscar; Goy Lopez, Silvia; Hernandez, Jose M; Josa, Maria Isabel; Merino, Gonzalo; Navarro De Martino, Eduardo; Pérez Calero Yzquierdo, Antonio María; Puerta Pelayo, Jesus; Quintario Olmeda, Adrián; Redondo, Ignacio; Romero, Luciano; Senghi Soares, Mara; Albajar, Carmen; de Trocóniz, Jorge F; Missiroli, Marino; Moran, Dermot; Brun, Hugues; Cuevas, Javier; Fernandez Menendez, Javier; Folgueras, Santiago; Gonzalez Caballero, Isidro; Lloret Iglesias, Lara; Brochero Cifuentes, Javier Andres; Cabrillo, Iban Jose; Calderon, Alicia; Duarte Campderros, Jordi; Fernandez, Marcos; Gomez, Gervasio; Graziano, Alberto; Lopez Virto, Amparo; Marco, Jesus; Marco, Rafael; Martinez Rivero, Celso; Matorras, Francisco; Munoz Sanchez, Francisca Javiela; Piedra Gomez, Jonatan; Rodrigo, Teresa; Rodríguez-Marrero, Ana Yaiza; Ruiz-Jimeno, Alberto; Scodellaro, Luca; Vila, Ivan; Vilar Cortabitarte, Rocio; Abbaneo, Duccio; Auffray, Etiennette; Auzinger, Georg; Bachtis, Michail; Baillon, Paul; Ball, Austin; Barney, David; Benaglia, Andrea; Bendavid, Joshua; Benhabib, Lamia; Benitez, Jose F; Bernet, Colin; Bianchi, Giovanni; Bloch, Philippe; Bocci, Andrea; Bonato, Alessio; Bondu, Olivier; Botta, Cristina; Breuker, Horst; Camporesi, Tiziano; Cerminara, Gianluca; Colafranceschi, Stefano; D'Alfonso, Mariarosaria; D'Enterria, David; Dabrowski, Anne; David Tinoco Mendes, Andre; De Guio, Federico; De Roeck, Albert; De Visscher, Simon; Dobson, Marc; Dordevic, Milos; Dupont-Sagorin, Niels; Elliott-Peisert, Anna; Eugster, Jürg; Franzoni, Giovanni; Funk, Wolfgang; Gigi, Dominique; Gill, Karl; Giordano, Domenico; Girone, Maria; Glege, Frank; Guida, Roberto; Gundacker, Stefan; Guthoff, Moritz; Hammer, Josef; Hansen, Magnus; Harris, Philip; Hegeman, Jeroen; Innocente, Vincenzo; Janot, Patrick; Kousouris, Konstantinos; Krajczar, Krisztian; Lecoq, Paul; Lourenco, Carlos; Magini, Nicolo; Malgeri, Luca; Mannelli, Marcello; Marrouche, Jad; Masetti, Lorenzo; Meijers, Frans; Mersi, Stefano; Meschi, Emilio; Moortgat, Filip; Morovic, Srecko; Mulders, Martijn; Musella, Pasquale; Orsini, Luciano; Pape, Luc; Perez, Emmanuelle; Perrozzi, Luca; Petrilli, Achille; Petrucciani, Giovanni; Pfeiffer, Andreas; Pierini, Maurizio; Pimiä, Martti; Piparo, Danilo; Plagge, Michael; Racz, Attila; Rolandi, Gigi; Rovere, Marco; Sakulin, Hannes; Schäfer, Christoph; Schwick, Christoph; Sharma, Archana; Siegrist, Patrice; Silva, Pedro; Simon, Michal; Sphicas, Paraskevas; Spiga, Daniele; Steggemann, Jan; Stieger, Benjamin; Stoye, Markus; Treille, Daniel; Tsirou, Andromachi; Veres, Gabor Istvan; Vlimant, Jean-Roch; Wardle, Nicholas; Wöhri, Hermine Katharina; Wollny, Heiner; Zeuner, Wolfram Dietrich; Bertl, Willi; Deiters, Konrad; Erdmann, Wolfram; Horisberger, Roland; Ingram, Quentin; Kaestli, Hans-Christian; Kotlinski, Danek; Langenegger, Urs; Renker, Dieter; Rohe, Tilman; Bachmair, Felix; Bäni, Lukas; Bianchini, Lorenzo; Bortignon, Pierluigi; Buchmann, Marco-Andrea; Casal, Bruno; Chanon, Nicolas; Deisher, Amanda; Dissertori, Günther; Dittmar, Michael; Donegà, Mauro; Dünser, Marc; Eller, Philipp; Grab, Christoph; Hits, Dmitry; Lustermann, Werner; Mangano, Boris; Marini, Andrea Carlo; Martinez Ruiz del Arbol, Pablo; Meister, Daniel; Mohr, Niklas; Nägeli, Christoph; Nessi-Tedaldi, Francesca; Pandolfi, Francesco; Pauss, Felicitas; Peruzzi, Marco; Quittnat, Milena; Rebane, Liis; Rossini, Marco; Starodumov, Andrei; Takahashi, Maiko; Theofilatos, Konstantinos; Wallny, Rainer; Weber, Hannsjoerg Artur; Amsler, Claude; Canelli, Maria Florencia; Chiochia, Vincenzo; De Cosa, Annapaola; Hinzmann, Andreas; Hreus, Tomas; Kilminster, Benjamin; Lange, Clemens; Millan Mejias, Barbara; Ngadiuba, Jennifer; Robmann, Peter; Ronga, Frederic Jean; Taroni, Silvia; Verzetti, Mauro; Yang, Yong; Cardaci, Marco; Chen, Kuan-Hsin; Ferro, Cristina; Kuo, Chia-Ming; Lin, Willis; Lu, Yun-Ju; Volpe, Roberta; Yu, Shin-Shan; Chang, Paoti; Chang, You-Hao; Chang, Yu-Wei; Chao, Yuan; Chen, Kai-Feng; Chen, Po-Hsun; Dietz, Charles; Grundler, Ulysses; Hou, George Wei-Shu; Kao, Kai-Yi; Lei, Yeong-Jyi; Liu, Yueh-Feng; Lu, Rong-Shyang; Majumder, Devdatta; Petrakou, Eleni; Tzeng, Yeng-Ming; Wilken, Rachel; Asavapibhop, Burin; Srimanobhas, Norraphat; Suwonjandee, Narumon; Adiguzel, Aytul; Bakirci, Mustafa Numan; Cerci, Salim; Dozen, Candan; Dumanoglu, Isa; Eskut, Eda; Girgis, Semiray; Gokbulut, Gul; Gurpinar, Emine; Hos, Ilknur; Kangal, Evrim Ersin; Kayis Topaksu, Aysel; Onengut, Gulsen; Ozdemir, Kadri; Ozturk, Sertac; Polatoz, Ayse; Sogut, Kenan; Sunar Cerci, Deniz; Tali, Bayram; Topakli, Huseyin; Vergili, Mehmet; Akin, Ilina Vasileva; Bilin, Bugra; Bilmis, Selcuk; Gamsizkan, Halil; Karapinar, Guler; Ocalan, Kadir; Sekmen, Sezen; Surat, Ugur Emrah; Yalvac, Metin; Zeyrek, Mehmet; Gülmez, Erhan; Isildak, Bora; Kaya, Mithat; Kaya, Ozlem; Bahtiyar, Hüseyin; Barlas, Esra; Cankocak, Kerem; Vardarli, Fuat Ilkehan; Yücel, Mete; Levchuk, Leonid; Sorokin, Pavel; Brooke, James John; Clement, Emyr; Cussans, David; Flacher, Henning; Frazier, Robert; Goldstein, Joel; Grimes, Mark; Heath, Greg P; Heath, Helen F; Jacob, Jeson; Kreczko, Lukasz; Lucas, Chris; Meng, Zhaoxia; Newbold, Dave M; Paramesvaran, Sudarshan; Poll, Anthony; Senkin, Sergey; Smith, Vincent J; Williams, Thomas; Bell, Ken W; Belyaev, Alexander; Brew, Christopher; Brown, Robert M; Cockerill, David JA; Coughlan, John A; Harder, Kristian; Harper, Sam; Olaiya, Emmanuel; Petyt, David; Shepherd-Themistocleous, Claire; Thea, Alessandro; Tomalin, Ian R; Womersley, William John; Worm, Steven; Baber, Mark; Bainbridge, Robert; Buchmuller, Oliver; Burton, Darren; Colling, David; Cripps, Nicholas; Cutajar, Michael; Dauncey, Paul; Davies, Gavin; Della Negra, Michel; Dunne, Patrick; Ferguson, William; Fulcher, Jonathan; Futyan, David; Gilbert, Andrew; Hall, Geoffrey; Iles, Gregory; Jarvis, Martyn; Karapostoli, Georgia; Kenzie, Matthew; Lane, Rebecca; Lucas, Robyn; Lyons, Louis; Magnan, Anne-Marie; Malik, Sarah; Mathias, Bryn; Nash, Jordan; Nikitenko, Alexander; Pela, Joao; Pesaresi, Mark; Petridis, Konstantinos; Raymond, David Mark; Rogerson, Samuel; Rose, Andrew; Seez, Christopher; Sharp, Peter; Tapper, Alexander; Vazquez Acosta, Monica; Virdee, Tejinder; Cole, Joanne; Hobson, Peter R; Khan, Akram; Kyberd, Paul; Leggat, Duncan; Leslie, Dawn; Martin, William; Reid, Ivan; Symonds, Philip; Teodorescu, Liliana; Turner, Mark; Dittmann, Jay; Hatakeyama, Kenichi; Kasmi, Azeddine; Liu, Hongxuan; Scarborough, Tara; Charaf, Otman; Cooper, Seth; Henderson, Conor; Rumerio, Paolo; Avetisyan, Aram; Bose, Tulika; Fantasia, Cory; Lawson, Philip; Richardson, Clint; Rohlf, James; Sperka, David; St John, Jason; Sulak, Lawrence; Alimena, Juliette; Berry, Edmund; Bhattacharya, Saptaparna; Christopher, Grant; Cutts, David; Demiragli, Zeynep; Ferapontov, Alexey; Garabedian, Alex; Heintz, Ulrich; Kukartsev, Gennadiy; Laird, Edward; Landsberg, Greg; Luk, Michael; Narain, Meenakshi; Segala, Michael; Sinthuprasith, Tutanon; Speer, Thomas; Swanson, Joshua; Breedon, Richard; Breto, Guillermo; Calderon De La Barca Sanchez, Manuel; Chauhan, Sushil; Chertok, Maxwell; Conway, John; Conway, Rylan; Cox, Peter Timothy; Erbacher, Robin; Gardner, Michael; Ko, Winston; Lander, Richard; Miceli, Tia; Mulhearn, Michael; Pellett, Dave; Pilot, Justin; Ricci-Tam, Francesca; Searle, Matthew; Shalhout, Shalhout; Smith, John; Squires, Michael; Stolp, Dustin; Tripathi, Mani; Wilbur, Scott; Yohay, Rachel; Cousins, Robert; Everaerts, Pieter; Farrell, Chris; Hauser, Jay; Ignatenko, Mikhail; Rakness, Gregory; Takasugi, Eric; Valuev, Vyacheslav; Weber, Matthias; Babb, John; Burt, Kira; Clare, Robert; Ellison, John Anthony; Gary, J William; Hanson, Gail; Heilman, Jesse; Ivova Rikova, Mirena; Jandir, Pawandeep; Kennedy, Elizabeth; Lacroix, Florent; Liu, Hongliang; Long, Owen Rosser; Luthra, Arun; Malberti, Martina; Nguyen, Harold; Olmedo Negrete, Manuel; Shrinivas, Amithabh; Sumowidagdo, Suharyo; Wimpenny, Stephen; Andrews, Warren; Branson, James G; Cerati, Giuseppe Benedetto; Cittolin, Sergio; D'Agnolo, Raffaele Tito; Evans, David; Holzner, André; Kelley, Ryan; Klein, Daniel; Lebourgeois, Matthew; Letts, James; Macneill, Ian; Olivito, Dominick; Padhi, Sanjay; Palmer, Christopher; Pieri, Marco; Sani, Matteo; Sharma, Vivek; Simon, Sean; Sudano, Elizabeth; Tadel, Matevz; Tu, Yanjun; Vartak, Adish; Welke, Charles; Würthwein, Frank; Yagil, Avraham; Yoo, Jaehyeok; Barge, Derek; Bradmiller-Feld, John; Campagnari, Claudio; Danielson, Thomas; Dishaw, Adam; Flowers, Kristen; Franco Sevilla, Manuel; Geffert, Paul; George, Christopher; Golf, Frank; Gouskos, Loukas; Incandela, Joe; Justus, Christopher; Mccoll, Nickolas; Richman, Jeffrey; Stuart, David; To, Wing; West, Christopher; Apresyan, Artur; Bornheim, Adolf; Bunn, Julian; Chen, Yi; Di Marco, Emanuele; Duarte, Javier; Mott, Alexander; Newman, Harvey B; Pena, Cristian; Rogan, Christopher; Spiropulu, Maria; Timciuc, Vladlen; Wilkinson, Richard; Xie, Si; Zhu, Ren-Yuan; Azzolini, Virginia; Calamba, Aristotle; Carlson, Benjamin; Ferguson, Thomas; Iiyama, Yutaro; Paulini, Manfred; Russ, James; Vogel, Helmut; Vorobiev, Igor; Cumalat, John Perry; Ford, William T; Gaz, Alessandro; Luiggi Lopez, Eduardo; Nauenberg, Uriel; Smith, James; Stenson, Kevin; Ulmer, Keith; Wagner, Stephen Robert; Alexander, James; Chatterjee, Avishek; Chu, Jennifer; Dittmer, Susan; Eggert, Nicholas; Mirman, Nathan; Nicolas Kaufman, Gala; Patterson, Juliet Ritchie; Ryd, Anders; Salvati, Emmanuele; Skinnari, Louise; Sun, Werner; Teo, Wee Don; Thom, Julia; Thompson, Joshua; Tucker, Jordan; Weng, Yao; Winstrom, Lucas; Wittich, Peter; Winn, Dave; Abdullin, Salavat; Albrow, Michael; Anderson, Jacob; Apollinari, Giorgio; Bauerdick, Lothar AT; Beretvas, Andrew; Berryhill, Jeffrey; Bhat, Pushpalatha C; Burkett, Kevin; Butler, Joel Nathan; Cheung, Harry; Chlebana, Frank; Cihangir, Selcuk; Elvira, Victor Daniel; Fisk, Ian; Freeman, Jim; Gao, Yanyan; Gottschalk, Erik; Gray, Lindsey; Green, Dan; Grünendahl, Stefan; Gutsche, Oliver; Hanlon, Jim; Hare, Daryl; Harris, Robert M; Hirschauer, James; Hooberman, Benjamin; Jindariani, Sergo; Johnson, Marvin; Joshi, Umesh; Kaadze, Ketino; Klima, Boaz; Kreis, Benjamin; Kwan, Simon; Linacre, Jacob; Lincoln, Don; Lipton, Ron; Liu, Tiehui; Lykken, Joseph; Maeshima, Kaori; Marraffino, John Michael; Martinez Outschoorn, Verena Ingrid; Maruyama, Sho; Mason, David; McBride, Patricia; Mishra, Kalanand; Mrenna, Stephen; Musienko, Yuri; Nahn, Steve; Newman-Holmes, Catherine; O'Dell, Vivian; Prokofyev, Oleg; Sexton-Kennedy, Elizabeth; Sharma, Seema; Soha, Aron; Spalding, William J; Spiegel, Leonard; Taylor, Lucas; Tkaczyk, Slawek; Tran, Nhan Viet; Uplegger, Lorenzo; Vaandering, Eric Wayne; Vidal, Richard; Whitbeck, Andrew; Whitmore, Juliana; Yang, Fan; Acosta, Darin; Avery, Paul; Bourilkov, Dimitri; Carver, Matthew; Cheng, Tongguang; Curry, David; Das, Souvik; De Gruttola, Michele; Di Giovanni, Gian Piero; Field, Richard D; Fisher, Matthew; Furic, Ivan-Kresimir; Hugon, Justin; Konigsberg, Jacobo; Korytov, Andrey; Kypreos, Theodore; Low, Jia Fu; Matchev, Konstantin; Milenovic, Predrag; Mitselmakher, Guenakh; Muniz, Lana; Rinkevicius, Aurelijus; Shchutska, Lesya; Snowball, Matthew; Yelton, John; Zakaria, Mohammed; Hewamanage, Samantha; Linn, Stephan; Markowitz, Pete; Martinez, German; Rodriguez, Jorge Luis; Adams, Todd; Askew, Andrew; Bochenek, Joseph; Diamond, Brendan; Haas, Jeff; Hagopian, Sharon; Hagopian, Vasken; Johnson, Kurtis F; Prosper, Harrison; Veeraraghavan, Venkatesh; Weinberg, Marc; Baarmand, Marc M; Hohlmann, Marcus; Kalakhety, Himali; Yumiceva, Francisco; Adams, Mark Raymond; Apanasevich, Leonard; Bazterra, Victor Eduardo; Berry, Douglas; Betts, Russell Richard; Bucinskaite, Inga; Cavanaugh, Richard; Evdokimov, Olga; Gauthier, Lucie; Gerber, Cecilia Elena; Hofman, David Jonathan; Khalatyan, Samvel; Kurt, Pelin; Moon, Dong Ho; O'Brien, Christine; Silkworth, Christopher; Turner, Paul; Varelas, Nikos; Albayrak, Elif Asli; Bilki, Burak; Clarida, Warren; Dilsiz, Kamuran; Duru, Firdevs; Haytmyradov, Maksat; Merlo, Jean-Pierre; Mermerkaya, Hamit; Mestvirishvili, Alexi; Moeller, Anthony; Nachtman, Jane; Ogul, Hasan; Onel, Yasar; Ozok, Ferhat; Penzo, Aldo; Rahmat, Rahmat; Sen, Sercan; Tan, Ping; Tiras, Emrah; Wetzel, James; Yetkin, Taylan; Yi, Kai; Barnett, Bruce Arnold; Blumenfeld, Barry; Bolognesi, Sara; Fehling, David; Gritsan, Andrei; Maksimovic, Petar; Martin, Christopher; Swartz, Morris; Baringer, Philip; Bean, Alice; Benelli, Gabriele; Bruner, Christopher; Gray, Julia; Kenny III, Raymond Patrick; Malek, Magdalena; Murray, Michael; Noonan, Daniel; Sanders, Stephen; Sekaric, Jadranka; Stringer, Robert; Wang, Quan; Wood, Jeffrey Scott; Barfuss, Anne-Fleur; Chakaberia, Irakli; Ivanov, Andrew; Khalil, Sadia; Makouski, Mikhail; Maravin, Yurii; Saini, Lovedeep Kaur; Shrestha, Shruti; Skhirtladze, Nikoloz; Svintradze, Irakli; Gronberg, Jeffrey; Lange, David; Rebassoo, Finn; Wright, Douglas; Baden, Drew; Belloni, Alberto; Calvert, Brian; Eno, Sarah Catherine; Gomez, Jaime; Hadley, Nicholas John; Kellogg, Richard G; Kolberg, Ted; Lu, Ying; Marionneau, Matthieu; Mignerey, Alice; Pedro, Kevin; Skuja, Andris; Tonjes, Marguerite; Tonwar, Suresh C; Apyan, Aram; Barbieri, Richard; Bauer, Gerry; Busza, Wit; Cali, Ivan Amos; Chan, Matthew; Di Matteo, Leonardo; Dutta, Valentina; Gomez Ceballos, Guillelmo; Goncharov, Maxim; Gulhan, Doga; Klute, Markus; Lai, Yue Shi; Lee, Yen-Jie; Levin, Andrew; Luckey, Paul David; Ma, Teng; Paus, Christoph; Ralph, Duncan; Roland, Christof; Roland, Gunther; Stephans, George; Stöckli, Fabian; Sumorok, Konstanty; Velicanu, Dragos; Veverka, Jan; Wyslouch, Bolek; Yang, Mingming; Zanetti, Marco; Zhukova, Victoria; Dahmes, Bryan; Gude, Alexander; Kao, Shih-Chuan; Klapoetke, Kevin; Kubota, Yuichi; Mans, Jeremy; Pastika, Nathaniel; Rusack, Roger; Singovsky, Alexander; Tambe, Norbert; Turkewitz, Jared; Acosta, John Gabriel; Oliveros, Sandra; Avdeeva, Ekaterina; Bloom, Kenneth; Bose, Suvadeep; Claes, Daniel R; Dominguez, Aaron; Gonzalez Suarez, Rebeca; Keller, Jason; Knowlton, Dan; Kravchenko, Ilya; Lazo-Flores, Jose; Malik, Sudhir; Meier, Frank; Snow, Gregory R; Dolen, James; Godshalk, Andrew; Iashvili, Ia; Kharchilava, Avto; Kumar, Ashish; Rappoccio, Salvatore; Alverson, George; Barberis, Emanuela; Baumgartel, Darin; Chasco, Matthew; Haley, Joseph; Massironi, Andrea; Morse, David Michael; Nash, David; Orimoto, Toyoko; Trocino, Daniele; Wang, Ren-Jie; Wood, Darien; Zhang, Jinzhong; Hahn, Kristan Allan; Kubik, Andrew; Mucia, Nicholas; Odell, Nathaniel; Pollack, Brian; Pozdnyakov, Andrey; Schmitt, Michael Henry; Stoynev, Stoyan; Sung, Kevin; Velasco, Mayda; Won, Steven; Brinkerhoff, Andrew; Chan, Kwok Ming; Drozdetskiy, Alexey; Hildreth, Michael; Jessop, Colin; Karmgard, Daniel John; Kellams, Nathan; Lannon, Kevin; Luo, Wuming; Lynch, Sean; Marinelli, Nancy; Pearson, Tessa; Planer, Michael; Ruchti, Randy; Valls, Nil; Wayne, Mitchell; Wolf, Matthias; Woodard, Anna; Antonelli, Louis; Brinson, Jessica; Bylsma, Ben; Durkin, Lloyd Stanley; Flowers, Sean; Hill, Christopher; Hughes, Richard; Kotov, Khristian; Ling, Ta-Yung; Puigh, Darren; Rodenburg, Marissa; Smith, Geoffrey; Winer, Brian L; Wolfe, Homer; Wulsin, Howard Wells; Driga, Olga; Elmer, Peter; Hebda, Philip; Hunt, Adam; Koay, Sue Ann; Lujan, Paul; Marlow, Daniel; Medvedeva, Tatiana; Mooney, Michael; Olsen, James; Piroué, Pierre; Quan, Xiaohang; Saka, Halil; Stickland, David; Tully, Christopher; Werner, Jeremy Scott; Zenz, Seth Conrad; Zuranski, Andrzej; Brownson, Eric; Mendez, Hector; Ramirez Vargas, Juan Eduardo; Barnes, Virgil E; Benedetti, Daniele; Bolla, Gino; Bortoletto, Daniela; De Mattia, Marco; Hu, Zhen; Jha, Manoj; Jones, Matthew; Jung, Kurt; Kress, Matthew; Leonardo, Nuno; Lopes Pegna, David; Maroussov, Vassili; Merkel, Petra; Miller, David Harry; Neumeister, Norbert; Radburn-Smith, Benjamin Charles; Shi, Xin; Shipsey, Ian; Silvers, David; Svyatkovskiy, Alexey; Wang, Fuqiang; Xie, Wei; Xu, Lingshan; Yoo, Hwi Dong; Zablocki, Jakub; Zheng, Yu; Parashar, Neeti; Stupak, John; Adair, Antony; Akgun, Bora; Ecklund, Karl Matthew; Geurts, Frank JM; Li, Wei; Michlin, Benjamin; Padley, Brian Paul; Redjimi, Radia; Roberts, Jay; Zabel, James; Betchart, Burton; Bodek, Arie; Covarelli, Roberto; de Barbaro, Pawel; Demina, Regina; Eshaq, Yossof; Ferbel, Thomas; Garcia-Bellido, Aran; Goldenzweig, Pablo; Han, Jiyeon; Harel, Amnon; Khukhunaishvili, Aleko; Petrillo, Gianluca; Vishnevskiy, Dmitry; Ciesielski, Robert; Demortier, Luc; Goulianos, Konstantin; Lungu, Gheorghe; Mesropian, Christina; Arora, Sanjay; Barker, Anthony; Chou, John Paul; Contreras-Campana, Christian; Contreras-Campana, Emmanuel; Duggan, Daniel; Ferencek, Dinko; Gershtein, Yuri; Gray, Richard; Halkiadakis, Eva; Hidas, Dean; Kaplan, Steven; Lath, Amitabh; Panwalkar, Shruti; Park, Michael; Patel, Rishi; Salur, Sevil; Schnetzer, Steve; Somalwar, Sunil; Stone, Robert; Thomas, Scott; Thomassen, Peter; Walker, Matthew; Rose, Keith; Spanier, Stefan; York, Andrew; Bouhali, Othmane; Castaneda Hernandez, Alfredo; Eusebi, Ricardo; Flanagan, Will; Gilmore, Jason; Kamon, Teruki; Khotilovich, Vadim; Krutelyov, Vyacheslav; Montalvo, Roy; Osipenkov, Ilya; Pakhotin, Yuriy; Perloff, Alexx; Roe, Jeffrey; Rose, Anthony; Safonov, Alexei; Sakuma, Tai; Suarez, Indara; Tatarinov, Aysen; Akchurin, Nural; Cowden, Christopher; Damgov, Jordan; Dragoiu, Cosmin; Dudero, Phillip Russell; Faulkner, James; Kovitanggoon, Kittikul; Kunori, Shuichi; Lee, Sung Won; Libeiro, Terence; Volobouev, Igor; Appelt, Eric; Delannoy, Andrés G; Greene, Senta; Gurrola, Alfredo; Johns, Willard; Maguire, Charles; Mao, Yaxian; Melo, Andrew; Sharma, Monika; Sheldon, Paul; Snook, Benjamin; Tuo, Shengquan; Velkovska, Julia; Arenton, Michael Wayne; Boutle, Sarah; Cox, Bradley; Francis, Brian; Goodell, Joseph; Hirosky, Robert; Ledovskoy, Alexander; Li, Hengne; Lin, Chuanzhe; Neu, Christopher; Wood, John; Clarke, Christopher; Harr, Robert; Karchin, Paul Edmund; Kottachchi Kankanamge Don, Chamath; Lamichhane, Pramod; Sturdy, Jared; Belknap, Donald; Carlsmith, Duncan; Cepeda, Maria; Dasu, Sridhara; Dodd, Laura; Duric, Senka; Friis, Evan; Hall-Wilton, Richard; Herndon, Matthew; Hervé, Alain; Klabbers, Pamela; Lanaro, Armando; Lazaridis, Christos; Levine, Aaron; Loveless, Richard; Mohapatra, Ajit; Ojalvo, Isabel; Perry, Thomas; Pierro, Giuseppe Antonio; Polese, Giovanni; Ross, Ian; Sarangi, Tapas; Savin, Alexander; Smith, Wesley H; Vuosalo, Carl; Woods, Nathaniel

    2015-04-09

    A measurement of the production cross section ratio $\\sigma(\\chi_{b2}(1\\mathrm{P}))/ \\sigma(\\chi_{b1}(1\\mathrm{P}))$ is presented. The $\\chi_{b1}(1\\mathrm{P})$ and $\\chi_{b2}(1\\mathrm{P})$ bottomonium states, promptly produced in pp collisions at $\\sqrt{s}$= 8 TeV, are detected by the CMS experiment at the CERN LHC through their radiative decays $\\chi_{b1,2}(1\\mathrm{P}) \\rightarrow \\Upsilon(1\\mathrm{S}) + \\gamma$. The emitted photons are measured through their conversion to e$^+$e$^-$ pairs, whose reconstruction allows the two states to be resolved. The $\\Upsilon(1\\mathrm{S})$ is measured through its decay to two muons. An event sample corresponding to an integrated luminosity of 20.7 fb$^{-1}$ is used to measure the cross section ratio in a phase-space region defined by the photon pseudorapidity, |$\\eta^\\gamma$| < 1.0; the $\\Upsilon(1\\mathrm{S})$ rapidity, |$y^\\Upsilon$| < 1.5; and the $\\Upsilon(1\\mathrm{S})$ transverse momentum, 7 < $p_{\\mathrm{T}}^\\Upsilon$ < 40 GeV. The cross section ratio sh...

  6. Measurement of the ratio of prompt $\\chi_{c}$ to $J/\\psi$ production in $pp$ collisions at $\\sqrt{s}=7$ TeV

    CERN Document Server

    INSPIRE-00258707; Abellan Beteta, C; Adeva, B; Adinolfi, M; Adrover, C; Affolder, A; Ajaltouni, Z; Albrecht, J; Alessio, F; Alexander, M; Ali, S; Alkhazov, G; Alvarez Cartelle, P; Alves Jr, A A; Amato, S; Amhis, Y; Anderson, J; Appleby, R B; Aquines Gutierrez, O; Archilli, F; Arrabito, L; Artamonov, A; Artuso, M; Aslanides, E; Auriemma, G; Bachmann, S; Back, J J; Balagura, V; Baldini, W; Barlow, R J; Barschel, C; Barsuk, S; Barter, W; Bates, A; Bauer, C; Bauer, Th; Bay, A; Bediaga, I; Belogurov, S; Belous, K; Belyaev, I; Ben-Haim, E; Benayoun, M; Bencivenni, G; Benson, S; Benton, J; Bernet, R; Bettler, M-O; van Beuzekom, M; Bien, A; Bifani, S; Bird, T; Bizzeti, A; Bjørnstad, P M; Blake, T; Blanc, F; Blanks, C; Blouw, J; Blusk, S; Bobrov, A; Bocci, V; Bondar, A; Bondar, N; Bonivento, W; Borghi, S; Borgia, A; Bowcock, T J V; Bozzi, C; Brambach, T; van den Brand, J; Bressieux, J; Brett, D; Britsch, M; Britton, T; Brook, N H; Brown, H; Büchler-Germann, A; Burducea, I; Bursche, A; Buytaert, J; Cadeddu, S; Callot, O; Calvi, M; Calvo Gomez, M; Camboni, A; Campana, P; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carson, L; Carvalho Akiba, K; Casse, G; Cattaneo, M; Cauet, Ch; Charles, M; Charpentier, Ph; Chiapolini, N; Ciba, K; Cid Vidal, X; Ciezarek, G; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Coca, C; Coco, V; Cogan, J; Collins, P; Comerma-Montells, A; Contu, A; Cook, A; Coombes, M; Corti, G; Couturier, B; Cowan, G A; Currie, R; D'Ambrosio, C; David, P; David, P N Y; De Bonis, I; De Bruyn, K; De Capua, S; De Cian, M; De Lorenzi, F; De Miranda, J M; De Paula, L; De Simone, P; Decamp, D; Deckenhoff, M; Degaudenzi, H; Del Buono, L; Deplano, C; Derkach, D; Deschamps, O; Dettori, F; Dickens, J; Dijkstra, H; Diniz Batista, P; Domingo Bonal, F; Donleavy, S; Dordei, F; Dosil Suárez, A; Dossett, D; Dovbnya, A; Dupertuis, F; Dzhelyadin, R; Dziurda, A; Easo, S; Egede, U; Egorychev, V; Eidelman, S; van Eijk, D; Eisele, F; Eisenhardt, S; Ekelhof, R; Eklund, L; Elsasser, Ch; Elsby, D; Esperante Pereira, D; Falabella, A; Färber, C; Fardell, G; Farinelli, C; Farry, S; Fave, V; Fernandez Albor, V; Ferro-Luzzi, M; Filippov, S; Fitzpatrick, C; Fontana, M; Fontanelli, F; Forty, R; Francisco, O; Frank, M; Frei, C; Frosini, M; Furcas, S; Gallas Torreira, A; Galli, D; Gandelman, M; Gandini, P; Gao, Y; Garnier, J-C; Garofoli, J; Garra Tico, J; Garrido, L; Gascon, D; Gaspar, C; Gauld, R; Gauvin, N; Gersabeck, M; Gershon, T; Ghez, Ph; Gibson, V; Gligorov, V V; Göbel, C; Golubkov, D; Golutvin, A; Gomes, A; Gordon, H; Grabalosa Gándara, M; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graziani, G; Grecu, A; Greening, E; Gregson, S; Gui, B; Gushchin, E; Guz, Yu; Gys, T; Hadjivasiliou, C; Haefeli, G; Haen, C; Haines, S C; Hampson, T; Hansmann-Menzemer, S; Harji, R; Harnew, N; Harrison, J; Harrison, P F; Hartmann, T; He, J; Heijne, V; Hennessy, K; Henrard, P; Hernando Morata, J A; van Herwijnen, E; Hicks, E; Holubyev, K; Hopchev, P; Hulsbergen, W; Hunt, P; Huse, T; Huston, R S; Hutchcroft, D; Hynds, D; Iakovenko, V; Ilten, P; Imong, J; Jacobsson, R; Jaeger, A; Jahjah Hussein, M; Jans, E; Jansen, F; Jaton, P; Jean-Marie, B; Jing, F; John, M; Johnson, D; Jones, C R; Jost, B; Kaballo, M; Kandybei, S; Karacson, M; Karbach, T M; Keaveney, J; Kenyon, I R; Kerzel, U; Ketel, T; Keune, A; Khanji, B; Kim, Y M; Knecht, M; Koopman, R F; Koppenburg, P; Korolev, M; Kozlinskiy, A; Kravchuk, L; Kreplin, K; Kreps, M; Krocker, G; Krokovny, P; Kruse, F; Kruzelecki, K; Kucharczyk, M; Kudryavtsev, V; Kvaratskheliya, T; La Thi, V N; Lacarrere, D; Lafferty, G; Lai, A; Lambert, D; Lambert, R W; Lanciotti, E; Lanfranchi, G; Langenbruch, C; Latham, T; Lazzeroni, C; Le Gac, R; van Leerdam, J; Lees, J-P; Lefèvre, R; Leflat, A; Lefrançois, J; Leroy, O; Lesiak, T; Li, L; Li Gioi, L; Lieng, M; Liles, M; Lindner, R; Linn, C; Liu, B; Liu, G; von Loeben, J; Lopes, J H; Lopez Asamar, E; Lopez-March, N; Lu, H; Luisier, J; Mac Raighne, A; Machefert, F; Machikhiliyan, I V; Maciuc, F; Maev, O; Magnin, J; Malde, S; Mamunur, R M D; Manca, G; Mancinelli, G; Mangiafave, N; Marconi, U; Märki, R; Marks, J; Martellotti, G; Martens, A; Martin, L; Martín Sánchez, A; Martinelli, M; Martinez Santos, D; Massafferri, A; Mathe, Z; Matteuzzi, C; Matveev, M; Maurice, E; Maynard, B; Mazurov, A; McGregor, G; McNulty, R; Meissner, M; Merk, M; Merkel, J; Miglioranzi, S; Milanes, D A; Minard, M-N; Molina Rodriguez, J; Monteil, S; Moran, D; Morawski, P; Mountain, R; Mous, I; Muheim, F; Müller, K; Muresan, R; Muryn, B; Muster, B; Mylroie-Smith, J; Naik, P; Nakada, T; Nandakumar, R; Nasteva, I; Needham, M; Neufeld, N; Nguyen, A D; Nguyen-Mau, C; Nicol, M; Niess, V; Nikitin, N; Nikodem, T; Nomerotski, A; Novoselov, A; Oblakowska-Mucha, A; Obraztsov, V; Oggero, S; Ogilvy, S; Okhrimenko, O; Oldeman, R; Orlandea, M; Otalora Goicochea, J M; Owen, P; Pal, B K; Palacios, J; Palano, A; Palutan, M; Panman, J; Papanestis, A; Pappagallo, M; Parkes, C; Parkinson, C J; Passaleva, G; Patel, G D; Patel, M; Paterson, S K; Patrick, G N; Patrignani, C; Pavel-Nicorescu, C; Pazos Alvarez, A; Pellegrino, A; Penso, G; Pepe Altarelli, M; Perazzini, S; Perego, D L; Perez Trigo, E; Pérez-Calero Yzquierdo, A; Perret, P; Perrin-Terrin, M; Pessina, G; Petrolini, A; Phan, A; Picatoste Olloqui, E; Pie Valls, B; Pietrzyk, B; Pilař, T; Pinci, D; Plackett, R; Playfer, S; Plo Casasus, M; Polok, G; Poluektov, A; Polycarpo, E; Popov, D; Popovici, B; Potterat, C; Powell, A; Prisciandaro, J; Pugatch, V; Puig Navarro, A; Qian, W; Rademacker, J H; Rakotomiaramanana, B; Rangel, M S; Raniuk, I; Raven, G; Redford, S; Reid, M M; dos Reis, A C; Ricciardi, S; Richards, A; Rinnert, K; Roa Romero, D A; Robbe, P; Rodrigues, E; Rodrigues, F; Rodriguez Perez, P; Rogers, G J; Roiser, S; Romanovsky, V; Rosello, M; Rouvinet, J; Ruf, T; Ruiz, H; Sabatino, G; Saborido Silva, J J; Sagidova, N; Sail, P; Saitta, B; Salzmann, C; Sannino, M; Santacesaria, R; Santamarina Rios, C; Santinelli, R; Santovetti, E; Sapunov, M; Sarti, A; Satriano, C; Satta, A; Savrie, M; Savrina, D; Schaack, P; Schiller, M; Schleich, S; Schlupp, M; Schmelling, M; Schmidt, B; Schneider, O; Schopper, A; Schune, M-H; Schwemmer, R; Sciascia, B; Sciubba, A; Seco, M; Semennikov, A; Senderowska, K; Sepp, I; Serra, N; Serrano, J; Seyfert, P; Shapkin, M; Shapoval, I; Shatalov, P; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, O; Shevchenko, V; Shires, A; Silva Coutinho, R; Skwarnicki, T; Smith, N A; Smith, E; Sobczak, K; Soler, F J P; Solomin, A; Soomro, F; Souza De Paula, B; Spaan, B; Sparkes, A; Spradlin, P; Stagni, F; Stahl, S; Steinkamp, O; Stoica, S; Stone, S; Storaci, B; Straticiuc, M; Straumann, U; Subbiah, V K; Swientek, S; Szczekowski, M; Szczypka, P; Szumlak, T; T'Jampens, S; Teodorescu, E; Teubert, F; Thomas, C; Thomas, E; van Tilburg, J; Tisserand, V; Tobin, M; Tolk, S; Topp-Joergensen, S; Torr, N; Tournefier, E; Tourneur, S; Tran, M T; Tsaregorodtsev, A; Tuning, N; Ubeda Garcia, M; Ukleja, A; Urquijo, P; Uwer, U; Vagnoni, V; Valenti, G; Vazquez Gomez, R; Vazquez Regueiro, P; Vecchi, S; Velthuis, J J; Veltri, M; Viaud, B; Videau, I; Vieira, D; Vilasis-Cardona, X; Visniakov, J; Vollhardt, A; Volyanskyy, D; Voong, D; Vorobyev, A; Vorobyev, V; Voss, H; Waldi, R; Wandernoth, S; Wang, J; Ward, D R; Watson, N K; Webber, A D; Websdale, D; Whitehead, M; Wiedner, D; Wiggers, L; Wilkinson, G; Williams, M P; Williams, M; Wilson, F F; Wishahi, J; Witek, M; Witzeling, W; Wotton, S A; Wyllie, K; Xie, Y; Xing, F; Xing, Z; Yang, Z; Young, R; Yushchenko, O; Zangoli, M; Zavertyaev, M; Zhang, F; Zhang, L; Zhang, W C; Zhang, Y; Zhelezov, A; Zhong, L; Zvyagin, A

    2012-12-05

    The prompt production of charmonium $\\chi_{c}$ and $J/\\psi$ states is studied in proton-proton collisions at a centre-of-mass energy of $\\sqrt{s}=7$ TeV at the Large Hadron Collider. The $\\chi_{c}$ and $J/\\psi$ mesons are identified through their decays $\\chi_{c}\\rightarrow J/\\psi \\gamma$ and $J/\\psi\\rightarrow \\mu^+\\mu^-$ using 36 pb$^{-1}$ of data collected by the LHCb detector in 2010. The ratio of the prompt production cross-sections for $\\chi_{c}$ and $J/\\psi$, $\\sigma (\\chi_{c}\\rightarrow J/\\psi \\gamma)/ \\sigma (J/\\psi)$, is determined as a function of the $J/\\psi$ transverse momentum in the range $2 < p_{\\mathrm T}^{J/\\psi} < 15$ GeV/$c$. The results are in excellent agreement with next-to-leading order non-relativistic expectations and show a significant discrepancy compared with the colour singlet model prediction at leading order, especially in the low $p_{\\mathrm T}^{J/\\psi}$ region.

  7. Relating Trp-Glu dipeptide fluorescence to molecular conformation: the role of the discrete Chi 1 and Chi 2 angles.

    Science.gov (United States)

    Eisenberg, Azaria Solomon; Juszczak, Laura J

    2013-07-05

    Molecular dynamics (MD), coupled with fluorescence data for charged dipeptides of tryptophanyl glutamic acid (Trp-Glu), reveal a detailed picture of how specific conformation affects fluorescence. Fluorescence emission spectra and time-resolved emission measurements have been collected for all four charged species. MD simulations 20 to 30 ns in length have also been carried out for the Trp-Glu species, as simulation provides aqueous phase conformational data that can be correlated with the fluorescence data. The calculations show that each dipeptide species is characterized by a similar set of six, discrete Chi 1, Chi 2 dihedral angle pairs. The preferred Chi 1 angles--60°, 180°, and 300°--play the significant role in positioning the terminal amine relative to the indole ring. A Chi 1 angle of 60° results in the arching of the backbone over the indole ring and no interaction of the ring with the terminal amine. Chi 1 values of 180° and 300° result in an extension of the backbone away from the indole ring and a NH3 cation-π interaction with indole. This interaction is believed responsible for charge transfer quenching. Two fluorescence lifetimes and their corresponding amplitudes correlate with the Chi 1 angle probability distribution for all four charged Trp-Glu dipeptides. Fluorescence emission band maxima are also consistent with the proposed pattern of terminal amine cation quenching of fluorescence. Copyright © 2013 Wiley Periodicals, Inc.

  8. Observation of Matter-Antimatter Asymmetry in the Neutral B Meson System

    Energy Technology Data Exchange (ETDEWEB)

    Rahatlou, S

    2003-12-19

    In this dissertation, a measurement of CP-violating effects in decays of neutral B meson is presented. The data sample for this measurement consists of about 88 million {Upsilon}(4S) {yields} B{bar B} decays collected between 1999 and 2002 with the BABAR detector at the PEP-II asymmetric-energy e{sup +}e{sup -} collider, located at the Stanford Linear Accelerator Center. One neutral B meson is fully reconstructed in the CP eigenstates J/{psi} K{sub S}{sup 0}, {psi}(2S)K{sub S}{sup 0}, {chi}{sub c1}K{sub S}{sup 0}, and {eta}{sub c}K{sub S}{sup 0}, or in the flavor eigenstates D(*){sup -} {pi}{sup +}/{rho}{sup +}/a{sub 1}{sup +} and J/{psi} K*{sup 0} (K*{sup 0} {yields} K{sup +}{pi}{sup -}). The other B meson is determined to be either a B{sup 0} or a {bar B}{sup 0}, at the time of its decay, from the properties of its decay products. The proper time {Delta}t elapsed between the decay of the two mesons is determined by reconstructing their decay vertices, and by measuring the distance between them. The CP asymmetry amplitude sin2{beta} is determined by the distributions of {Delta}t in events with a reconstructed B meson in CP eigenstates. The detector resolution and the b-flavor-tagging parameters are constrained by the {Delta}t distributions of events with a fully reconstructed flavor eigenstate. From a simultaneous maximum-likelihood fit to the {Delta}t distributions of all selected events in CP and flavor eigenstates, the value of sin2{beta} is measured to be 0.755 {+-} 0.074(stat) {+-} 0.030(syst). This value is in agreement with the Standard Model prediction, and represents a successful test of the Kobayashi-Maskawa mechanism of CP violation.

  9. The size of chi = arg (-Vts Vtb* Vcs* Vcb) and physics beyond the Standard Model

    CERN Document Server

    Aguilar-Saavedra, J A; Branco, Gustavo Castello; Nebot, M

    2004-01-01

    We analyse the allowed range of values of chi, both in the Standard Model and in models with New Physics, pointing out that a relatively large value of chi, e.g. of order lambda, is only possible in models where the unitarity of the 3x3 Cabibbo-Kobayashi-Maskawa matrix is violated through the introduction of extra Q=2/3 quarks. We study the interesting case where the extra quark is an isosinglet, determining the allowed range for chi and the effect of a large chi on various low-energy observables, such as CP asymmetries in B meson decays. We also discuss the correlated effects which would be observable at high energy colliders, like decays t -> cZ, modifications of the cross section and forward-backward asymmetry in e+ e- -> ttbar and the direct production of a new quark.

  10. Temperature-dependent cross sections for meson-meson nonresonant reactions in hadronic matter

    International Nuclear Information System (INIS)

    Zhang Yiping; Xu Xiaoming; Ge Huijun

    2010-01-01

    We present a potential of which the short-distance part is given by one gluon exchange plus perturbative one- and two-loop corrections and of which the large-distance part exhibits a temperature-dependent constant value. The Schroedinger equation with this temperature-dependent potential yields a temperature dependence of the mesonic quark-antiquark relative-motion wave function and of meson masses. The temperature dependence of the potential, the wave function and the meson masses brings about temperature dependence of cross sections for the nonresonant reactions ππ→ρρ for I=2, KK→K*K* for I=1, KK*→K*K* for I=1, πK→ρK* for I=3/2, πK*→ρK* for I=3/2, ρK→ρK* for I=3/2 and πK*→ρK for I=3/2. As the temperature increases, the rise or fall of peak cross sections is determined by the increased radii of initial mesons, the loosened bound states of final mesons, and the total-mass difference of the initial and final mesons. The temperature-dependent cross sections and meson masses are parametrized.

  11. χ_{c1} and χ_{c2} Resonance Parameters with the Decays χ_{c1,c2}→J/ψμ^{+}μ^{-}.

    Science.gov (United States)

    Aaij, R; Adeva, B; Adinolfi, M; Ajaltouni, Z; Akar, S; Albrecht, J; Alessio, F; Alexander, M; Alfonso Albero, A; Ali, S; Alkhazov, G; Alvarez Cartelle, P; Alves, A A; Amato, S; Amerio, S; Amhis, Y; An, L; Anderlini, L; Andreassi, G; Andreotti, M; Andrews, J E; Appleby, R B; Archilli, F; d'Argent, P; Arnau Romeu, J; Artamonov, A; Artuso, M; Aslanides, E; Atzeni, M; Auriemma, G; Baalouch, M; Babuschkin, I; Bachmann, S; Back, J J; Badalov, A; Baesso, C; Baker, S; Balagura, V; Baldini, W; Baranov, A; Barlow, R J; Barschel, C; Barsuk, S; Barter, W; Baryshnikov, F; Batozskaya, V; Battista, V; Bay, A; Beaucourt, L; Beddow, J; Bedeschi, F; Bediaga, I; Beiter, A; Bel, L J; Beliy, N; Bellee, V; Belloli, N; Belous, K; Belyaev, I; Ben-Haim, E; Bencivenni, G; Benson, S; Beranek, S; Berezhnoy, A; Bernet, R; Berninghoff, D; Bertholet, E; Bertolin, A; Betancourt, C; Betti, F; Bettler, M-O; van Beuzekom, M; Bezshyiko, Ia; Bifani, S; Billoir, P; Birnkraut, A; Bizzeti, A; Bjørn, M; Blake, T; Blanc, F; Blusk, S; Bocci, V; Boettcher, T; Bondar, A; Bondar, N; Bordyuzhin, I; Borghi, S; Borisyak, M; Borsato, M; Bossu, F; Boubdir, M; Bowcock, T J V; Bowen, E; Bozzi, C; Braun, S; Britton, T; Brodzicka, J; Brundu, D; Buchanan, E; Burr, C; Bursche, A; Buytaert, J; Byczynski, W; Cadeddu, S; Cai, H; Calabrese, R; Calladine, R; Calvi, M; Calvo Gomez, M; Camboni, A; Campana, P; Campora Perez, D H; Capriotti, L; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carniti, P; Carson, L; Carvalho Akiba, K; Casse, G; Cassina, L; Cattaneo, M; Cavallero, G; Cenci, R; Chamont, D; Chapman, M G; Charles, M; Charpentier, Ph; Chatzikonstantinidis, G; Chefdeville, M; Chen, S; Cheung, S F; Chitic, S-G; Chobanova, V; Chrzaszcz, M; Chubykin, A; Ciambrone, P; Cid Vidal, X; Ciezarek, G; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Cogan, J; Cogneras, E; Cogoni, V; Cojocariu, L; Collins, P; Colombo, T; Comerma-Montells, A; Contu, A; Cook, A; Coombs, G; Coquereau, S; Corti, G; Corvo, M; Costa Sobral, C M; Couturier, B; Cowan, G A; Craik, D C; Crocombe, A; Cruz Torres, M; Currie, R; D'Ambrosio, C; Da Cunha Marinho, F; Dall'Occo, E; Dalseno, J; Davis, A; De Aguiar Francisco, O; De Capua, S; De Cian, M; De Miranda, J M; De Paula, L; De Serio, M; De Simone, P; Dean, C T; Decamp, D; Del Buono, L; Dembinski, H-P; Demmer, M; Dendek, A; Derkach, D; Deschamps, O; Dettori, F; Dey, B; Di Canto, A; Di Nezza, P; Dijkstra, H; Dordei, F; Dorigo, M; Dosil Suárez, A; Douglas, L; Dovbnya, A; Dreimanis, K; Dufour, L; Dujany, G; Durante, P; Dzhelyadin, R; Dziewiecki, M; Dziurda, A; Dzyuba, A; Easo, S; Ebert, M; Egede, U; Egorychev, V; Eidelman, S; Eisenhardt, S; Eitschberger, U; Ekelhof, R; Eklund, L; Ely, S; Esen, S; Evans, H M; Evans, T; Falabella, A; Farley, N; Farry, S; Fazzini, D; Federici, L; Ferguson, D; Fernandez, G; Fernandez Declara, P; Fernandez Prieto, A; Ferrari, F; Ferreira Rodrigues, F; Ferro-Luzzi, M; Filippov, S; Fini, R A; Fiorini, M; Firlej, M; Fitzpatrick, C; Fiutowski, T; Fleuret, F; Fohl, K; Fontana, M; Fontanelli, F; Forshaw, D C; Forty, R; Franco Lima, V; Frank, M; Frei, C; Fu, J; Funk, W; Furfaro, E; Färber, C; Gabriel, E; Gallas Torreira, A; Galli, D; Gallorini, S; Gambetta, S; Gandelman, M; Gandini, P; Gao, Y; Garcia Martin, L M; García Pardiñas, J; Garra Tico, J; Garrido, L; Garsed, P J; Gascon, D; Gaspar, C; Gavardi, L; Gazzoni, G; Gerick, D; Gersabeck, E; Gersabeck, M; Gershon, T; Ghez, Ph; Gianì, S; Gibson, V; Girard, O G; Giubega, L; Gizdov, K; Gligorov, V V; Golubkov, D; Golutvin, A; Gomes, A; Gorelov, I V; Gotti, C; Govorkova, E; Grabowski, J P; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graverini, E; Graziani, G; Grecu, A; Greim, R; Griffith, P; Grillo, L; Gruber, L; Gruberg Cazon, B R; Grünberg, O; Gushchin, E; Guz, Yu; Gys, T; Göbel, C; Hadavizadeh, T; Hadjivasiliou, C; Haefeli, G; Haen, C; Haines, S C; Hamilton, B; Han, X; Hancock, T H; Hansmann-Menzemer, S; Harnew, N; Harnew, S T; Hasse, C; Hatch, M; He, J; Hecker, M; Heinicke, K; Heister, A; Hennessy, K; Henrard, P; Henry, L; van Herwijnen, E; Heß, M; Hicheur, A; Hill, D; Hombach, C; Hopchev, P H; Hu, W; Huard, Z C; Hulsbergen, W; Humair, T; Hushchyn, M; Hutchcroft, D; Ibis, P; Idzik, M; Ilten, P; Jacobsson, R; Jalocha, J; Jans, E; Jawahery, A; Jiang, F; John, M; Johnson, D; Jones, C R; Joram, C; Jost, B; Jurik, N; Kandybei, S; Karacson, M; Kariuki, J M; Karodia, S; Kazeev, N; Kecke, M; Keizer, F; Kelsey, M; Kenzie, M; Ketel, T; Khairullin, E; Khanji, B; Khurewathanakul, C; Kirn, T; Klaver, S; Klimaszewski, K; Klimkovich, T; Koliiev, S; Kolpin, M; Kopecna, R; Koppenburg, P; Kosmyntseva, A; Kotriakhova, S; Kozeiha, M; Kravchuk, L; Kreps, M; Kress, F; Krokovny, P; Kruse, F; Krzemien, W; Kucewicz, W; Kucharczyk, M; Kudryavtsev, V; Kuonen, A K; Kvaratskheliya, T; Lacarrere, D; Lafferty, G; Lai, A; Lanfranchi, G; Langenbruch, C; Latham, T; Lazzeroni, C; Le Gac, R; Leflat, A; Lefrançois, J; Lefèvre, R; Lemaitre, F; Lemos Cid, E; Leroy, O; Lesiak, T; Leverington, B; Li, P-R; Li, T; Li, Y; Li, Z; Likhomanenko, T; Lindner, R; Lionetto, F; Lisovskyi, V; Liu, X; Loh, D; Loi, A; Longstaff, I; Lopes, J H; Lucchesi, D; Luchinsky, A; Lucio Martinez, M; Luo, H; Lupato, A; Luppi, E; Lupton, O; Lusiani, A; Lyu, X; Machefert, F; Maciuc, F; Macko, V; Mackowiak, P; Maddrell-Mander, S; Maev, O; Maguire, K; Maisuzenko, D; Majewski, M W; Malde, S; Malecki, B; Malinin, A; Maltsev, T; Manca, G; Mancinelli, G; Marangotto, D; Maratas, J; Marchand, J F; Marconi, U; Marin Benito, C; Marinangeli, M; Marino, P; Marks, J; Martellotti, G; Martin, M; Martinelli, M; Martinez Santos, D; Martinez Vidal, F; Massacrier, L M; Massafferri, A; Matev, R; Mathad, A; Mathe, Z; Matteuzzi, C; Mauri, A; Maurice, E; Maurin, B; Mazurov, A; McCann, M; McNab, A; McNulty, R; Mead, J V; Meadows, B; Meaux, C; Meier, F; Meinert, N; Melnychuk, D; Merk, M; Merli, A; Michielin, E; Milanes, D A; Millard, E; Minard, M-N; Minzoni, L; Mitzel, D S; Mogini, A; Molina Rodriguez, J; Mombächer, T; Monroy, I A; Monteil, S; Morandin, M; Morello, M J; Morgunova, O; Moron, J; Morris, A B; Mountain, R; Muheim, F; Mulder, M; Müller, D; Müller, J; Müller, K; Müller, V; Naik, P; Nakada, T; Nandakumar, R; Nandi, A; Nasteva, I; Needham, M; Neri, N; Neubert, S; Neufeld, N; Neuner, M; Nguyen, T D; Nguyen-Mau, C; Nieswand, S; Niet, R; Nikitin, N; Nikodem, T; Nogay, A; O'Hanlon, D P; Oblakowska-Mucha, A; Obraztsov, V; Ogilvy, S; Oldeman, R; Onderwater, C J G; Ossowska, A; Otalora Goicochea, J M; Owen, P; Oyanguren, A; Pais, P R; Palano, A; Palutan, M; Papanestis, A; Pappagallo, M; Pappalardo, L L; Parker, W; Parkes, C; Passaleva, G; Pastore, A; Patel, M; Patrignani, C; Pearce, A; Pellegrino, A; Penso, G; Pepe Altarelli, M; Perazzini, S; Perret, P; Pescatore, L; Petridis, K; Petrolini, A; Petrov, A; Petruzzo, M; Picatoste Olloqui, E; Pietrzyk, B; Pikies, M; Pinci, D; Pisani, F; Pistone, A; Piucci, A; Placinta, V; Playfer, S; Plo Casasus, M; Polci, F; Poli Lener, M; Poluektov, A; Polyakov, I; Polycarpo, E; Pomery, G J; Ponce, S; Popov, A; Popov, D; Poslavskii, S; Potterat, C; Price, E; Prisciandaro, J; Prouve, C; Pugatch, V; Puig Navarro, A; Pullen, H; Punzi, G; Qian, W; Quagliani, R; Quintana, B; Rachwal, B; Rademacker, J H; Rama, M; Ramos Pernas, M; Rangel, M S; Raniuk, I; Ratnikov, F; Raven, G; Ravonel Salzgeber, M; Reboud, M; Redi, F; Reichert, S; Dos Reis, A C; Remon Alepuz, C; Renaudin, V; Ricciardi, S; Richards, S; Rihl, M; Rinnert, K; Rives Molina, V; Robbe, P; Robert, A; Rodrigues, A B; Rodrigues, E; Rodriguez Lopez, J A; Rogozhnikov, A; Roiser, S; Rollings, A; Romanovskiy, V; Romero Vidal, A; Ronayne, J W; Rotondo, M; Rudolph, M S; Ruf, T; Ruiz Valls, P; Ruiz Vidal, J; Saborido Silva, J J; Sadykhov, E; Sagidova, N; Saitta, B; Salustino Guimaraes, V; Sanchez Mayordomo, C; Sanmartin Sedes, B; Santacesaria, R; Santamarina Rios, C; Santimaria, M; Santovetti, E; Sarpis, G; Sarti, A; Satriano, C; Satta, A; Saunders, D M; Savrina, D; Schael, S; Schellenberg, M; Schiller, M; Schindler, H; Schmelling, M; Schmelzer, T; Schmidt, B; Schneider, O; Schopper, A; Schreiner, H F; Schubiger, M; Schune, M-H; Schwemmer, R; Sciascia, B; Sciubba, A; Semennikov, A; Sepulveda, E S; Sergi, A; Serra, N; Serrano, J; Sestini, L; Seyfert, P; Shapkin, M; Shapoval, I; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, V; Siddi, B G; Silva Coutinho, R; Silva de Oliveira, L; Simi, G; Simone, S; Sirendi, M; Skidmore, N; Skwarnicki, T; Smith, E; Smith, I T; Smith, J; Smith, M; Soares Lavra, L; Sokoloff, M D; Soler, F J P; Souza De Paula, B; Spaan, B; Spradlin, P; Sridharan, S; Stagni, F; Stahl, M; Stahl, S; Stefko, P; Stefkova, S; Steinkamp, O; Stemmle, S; Stenyakin, O; Stepanova, M; Stevens, H; Stone, S; Storaci, B; Stracka, S; Stramaglia, M E; Straticiuc, M; Straumann, U; Sun, J; Sun, L; Sutcliffe, W; Swientek, K; Syropoulos, V; Szumlak, T; Szymanski, M; T'Jampens, S; Tayduganov, A; Tekampe, T; Tellarini, G; Teubert, F; Thomas, E; van Tilburg, J; Tilley, M J; Tisserand, V; Tobin, M; Tolk, S; Tomassetti, L; Tonelli, D; Toriello, F; Tourinho Jadallah Aoude, R; Tournefier, E; Traill, M; Tran, M T; Tresch, M; Trisovic, A; Tsaregorodtsev, A; Tsopelas, P; Tully, A; Tuning, N; Ukleja, A; Usachov, A; Ustyuzhanin, A; Uwer, U; Vacca, C; Vagner, A; Vagnoni, V; Valassi, A; Valat, S; Valenti, G; Vazquez Gomez, R; Vazquez Regueiro, P; Vecchi, S; van Veghel, M; Velthuis, J J; Veltri, M; Veneziano, G; Venkateswaran, A; Verlage, T A; Vernet, M; Vesterinen, M; Viana Barbosa, J V; Viaud, B; Vieira, D; Vieites Diaz, M; Viemann, H; Vilasis-Cardona, X; Vitti, M; Volkov, V; Vollhardt, A; Voneki, B; Vorobyev, A; Vorobyev, V; Voß, C; de Vries, J A; Vázquez Sierra, C; Waldi, R; Wallace, C; Wallace, R; Walsh, J; Wang, J; Ward, D R; Wark, H M; Watson, N K; Websdale, D; Weiden, A; Weisser, C; Whitehead, M; Wicht, J; Wilkinson, G; Wilkinson, M; Williams, M; Williams, M P; Williams, M; Williams, T; Wilson, F F; Wimberley, J; Winn, M; Wishahi, J; Wislicki, W; Witek, M; Wormser, G; Wotton, S A; Wraight, K; Wyllie, K; Xie, Y; Xu, M; Xu, Z; Yang, Z; Yang, Z; Yao, Y; Yin, H; Yu, J; Yuan, X; Yushchenko, O; Zarebski, K A; Zavertyaev, M; Zhang, L; Zhang, Y; Zhelezov, A; Zheng, Y; Zhu, X; Zhukov, V; Zonneveld, J B; Zucchelli, S

    2017-12-01

    The decays χ_{c1}→J/ψμ^{+}μ^{-} and χ_{c2}→J/ψμ^{+}μ^{-} are observed and used to study the resonance parameters of the χ_{c1} and χ_{c2} mesons. The masses of these states are measured to be m(χ_{c1})=3510.71±0.04(stat)±0.09(syst)  MeV and m(χ_{c2})=3556.10±0.06(stat)±0.11(syst)  MeV, where the knowledge of the momentum scale for charged particles dominates the systematic uncertainty. The momentum-scale uncertainties largely cancel in the mass difference m(χ_{c2})-m(χ_{c1})=45.39±0.07(stat)±0.03(syst)  MeV. The natural width of the χ_{c2} meson is measured to be Γ(χ_{c2})=2.10±0.20(stat)±0.02(syst)  MeV. These results are in good agreement with and have comparable precision to the current world averages.

  12. Structure of exotic nuclei and superheavy elements in meson field theory

    Energy Technology Data Exchange (ETDEWEB)

    Linn, Khin Nyan

    2008-07-15

    In this work the nuclear structure of exotic nuclei and superheavy nuclei is studied in a relativistic framework. In the relativistic mean-field (RMF) approximation, the nucleons interact with each other through the exchange of various effective mesons (scalar, vector, isovector-vector). Ground state properties of exotic nuclei and superheavy nuclei are studied in the RMF theory with the three different parameter sets (ChiM,NL3,NL-Z2). Axial deformation of nuclei within two drip lines are performed with the parameter set (ChiM). The position of drip lines are investigated with three different parameter sets (ChiM,NL3,NL-Z2) and compared with the experimental drip line nuclei. In addition, the structure of hypernuclei are studied and for a certain isotope, hyperon halo nucleus is predicted. (orig.)

  13. Structure of exotic nuclei and superheavy elements in meson field theory

    International Nuclear Information System (INIS)

    Linn, Khin Nyan

    2008-07-01

    In this work the nuclear structure of exotic nuclei and superheavy nuclei is studied in a relativistic framework. In the relativistic mean-field (RMF) approximation, the nucleons interact with each other through the exchange of various effective mesons (scalar, vector, isovector-vector). Ground state properties of exotic nuclei and superheavy nuclei are studied in the RMF theory with the three different parameter sets (ChiM,NL3,NL-Z2). Axial deformation of nuclei within two drip lines are performed with the parameter set (ChiM). The position of drip lines are investigated with three different parameter sets (ChiM,NL3,NL-Z2) and compared with the experimental drip line nuclei. In addition, the structure of hypernuclei are studied and for a certain isotope, hyperon halo nucleus is predicted. (orig.)

  14. The (0+,1+) heavy meson multiplet in an extended NJL model

    International Nuclear Information System (INIS)

    Ebert, T.; Feldmann, T.; Friedrich, R.; Reinhardt, H.

    1994-09-01

    In this letter we reconsider the previously given description of heavy mesons with a bosonized extended NJL model that combines heavy quark and chiral symmetry. In that work the naive gradient expansion of the quark determinant was used, which satisfactorily works in the light sector but does not adequately describe the heavy (0 + , 1 + ) mesons. By investigating the exact momentum dependence of the quark loop we demonstrate that the naive gradient expansion in the heavy sector is not the right method to treat the unphysical q anti q-thresholds which would be absent in confining theories. We propose a modified gradient expansion which adequately extrapolates from the low-momentum region beyond threshold. This expansion gives a satisfactory description even of the (0 + , 1 + ) heavy mesons whose masses are significantly above threshold. (orig.)

  15. PROPERTIES OF THE $omega$ MESON

    Energy Technology Data Exchange (ETDEWEB)

    Shafer, J. B.; Murray, J. J.; Ferro-Luzzi, M.; Huwe, D. O.

    1963-06-15

    Properties of the omega meson were studied from the reaction K/sup -/ + p yields LAMBDA + omega in a 72-in. hydrogen bubble chamber. The momentum of the K/sup -/ mesons was 1.2 to 1.75 Bev/c. The mass of the omega meson is found to be 782 Mev with a width, predominated by three-meson( pi ) decay mode, estimated to be less than 4 Mev. Branching ratios for omega -meson decay into pi /sup +/ pi /sup -/ pi /sup o/, pi /sup o/ gamma , pi /sup +/ i/ sup -/, and e/sup +/e/sup -o/ were determined. (R.E.U.)

  16. Scalar mesons and radiative vector meson decays

    International Nuclear Information System (INIS)

    Gokalp, A.; Ylmaz, O

    2002-01-01

    The light scalar mesons with vacuum quantum numbers J p =0 ++ have fundamental importance in understanding low energy QCD phenomenology and the symmetry breaking mechanisms in QCD. The nature and quark substructure of the best known scalar mesons, isoscalar σ(500), f0(980) and isovector a0(980) have been a subject of continuous controversy. The radioactive decay of neutral vector mesons ρ, w and φ into a single photon and a pair of neutral pseudoscalar mesons have been studied in order to obtain information on the nature of these scalar mesons. For such studies, it is essential that a reliable understanding of the mechanisms for these decays should be at hand. In this work, we investigate the particularly interesting mechanism of the exchange of scalar mesons for the radiative vector meson decays by analysing the experimental results such as measured decay rates and invariant mass spectra and compare them with the theoretical prediction of different reaction mechanisms

  17. Remarks on surfaces with $c_1^2 =2\\chi -1$ having non-trivial 2-torsion

    OpenAIRE

    MURAKAMI, Masaaki

    2013-01-01

    We shall show that any complex minimal surface of general type with $c_1^2 = 2\\chi -1$ having non-trivial 2-torsion divisors, where $c_1^2$ and $\\chi$ are the first Chern number of a surface and the Euler characteristic of the structure sheaf respectively, has the Euler characteristic $\\chi$ not exceeding 4. Moreover, we shall give a complete description for the surfaces of the case $\\chi =4$, and prove that the coarse moduli space for surfaces of this case is a unirational variety of dimensi...

  18. Electroproduction and photoproduction of vector mesons and generalized vector meson dominance

    International Nuclear Information System (INIS)

    Fraas, H.; Kuroda, M.

    1977-05-01

    Using generalized vector meson dominance, electro- and photoproduction of vector mesons is studied. The unnatural parity exchange part of ω(1.2) production is estimated to be about one fourth of that of ω-production. The off diagonal transition model suggests the suppression of diffractive rho(1.2) and ω(1.2) production. (orig.) [de

  19. Production of mesons with new flavor in e+e- collisions

    International Nuclear Information System (INIS)

    Maharana, J.; Singh, L.P.

    1980-01-01

    Cross sections for production of BB-bar, B-barB*+B-bar*B, and B*B-bar* mesons (carrying b-quark quantum numbers) in e + e - annihilation are estimated and differential cross sections are evaluated. The cross sections for e + e - → e + e - eta/sub b/, e + e - → e + e - chi/sub b/, and e + e - → e + e - BB-bar are computed in the equivalent-photon approximation

  20. A lattice QCD calculation of the transverse decay constant of the b1(1235) meson

    International Nuclear Information System (INIS)

    Jansen, K.; McNeile, C.; Michael, C.; Urbach, C.

    2009-10-01

    We review various B meson decays that require knowledge of the transverse decay constant of the b 1 (1235) meson. We report on an exploratory lattice QCD calculation of the transverse decay constant of the b 1 meson. The lattice QCD calculations used unquenched gauge configurations, at two lattice spacings, generated with two flavours of sea quarks. The twisted mass formalism is used. (orig.)

  1. Characterization of new cell line stably expressing CHI3L1 oncogene

    Directory of Open Access Journals (Sweden)

    Chekhonin V. P.

    2011-06-01

    Full Text Available Aim. To characterize the immortalized 293 cell line after stable transfection with human oncogene (CHI3L1. Methods. 293 cells, stably transfected with pcDNA3.1_CHI3L1, and 293 cells, stably transfected with pcDNA3.1 as a negative control, were used throughout all experiments. The clones of CHI3L1-expressing 293 cells and 293 cells, transfected with pcDNA3.1, were analyzed by immunofluorescence and confocal microscopy. Cell proliferation was measured using MTT assay; analyses of ERK1/2 and AKT activation and their cellular localization were performed with anti-phospho-ERK and anti-phospho-AKT antibodies. Specific activation of MAP and PI3 kinases was measured by densitometric analysis of Western-blot signals. Results. The obtained results show quite modest ability of CHI3L1 to stimulate cell growth and reflect rather an improved cellular plating efficiency of the 293 cells stably transfected with pcDNA3.1_CHI3L1 as compared to the 293 cells transfected with an «empty» vector. ERK1/2 and AKT are activated in the 293_CHI3L1 cells. In these cells phosphorylated ERK1/2 were localized in both cell cytoplasm and nuclei while AKT only in cytoplasm. The 293_CHI3L1 cells differed from the 293 cells, transfected with an «empty» vector, in their size and ability to adhere to the culture plates. Conclusions. The overexpression of CHI3L1 is likely to have an important role in tumorigenesis via a mechanism which involves activation of PI3K and ERK1/2 pathways. The tumors which can be induced by orthotopic implantation of the transformed human cells with overexpressed human oncogene CHI3L1 into the rat brain can be used as a target for anticancer drug development.

  2. mRNA expression of EgCHI1, EgCHI2, and EgCHI3 in oil palm leaves (Elaeis guineesis Jacq.) after treatment with Ganoderma boninense pat. and Trichoderma harzianum Rifai.

    Science.gov (United States)

    Naher, Laila; Tan, Soon Guan; Ho, Chai Ling; Yusuf, Umi Kalsom; Ahmad, Siti Hazar; Abdullah, Faridah

    2012-01-01

    Basal stem rot (BSR) disease caused by the fungus Ganoderma boninense is the most serious disease affecting the oil palm; this is because the disease escapes the early disease detection. The biocontrol agent Trichoderma harzianum can protect the disease only at the early stage of the disease. In the present study, the expression levels of three oil palm (Elaeis guineensis Jacq.) chitinases encoding EgCHI1, EgCHI2, and EgCHI3 at 2, 5, and 8 weeks inoculation were measured in oil palm leaves from plants treated with G. boninense or T. harzianum alone or both. The five-month-old oil palm seedlings were treated with Gano-wood blocks inoculum and trichomulch. Expression of EgCHI1, EgCHI2, and EgCHI3 in treated leaves tissue was determined by real-time PCR. Oil palm chitinases were not strongly expressed in oil palm leaves of plants treated with G. boninense alone compared to other treatments. Throughout the 8-week experiment, expression of EgCHI1 increased more than 3-fold in leaves of plants treated with T. harzianum and G. boninense when compared to those of control and other treated plants. The data illustrated that chitinase cDNA expression varied depending on tissue and the type of treatment.

  3. A thermodynamical analysis of the π and K meson valence structure functions

    International Nuclear Information System (INIS)

    Angelini, C.; Pazzi, R.

    1982-01-01

    The π and K meson valance structure functions are analysed in the framework of a thermodynamical model already applied to the nucleon. We obtain a simple expression which reproduces quite well the data for chi > 0.3. The effective temperatures are found to be of the order of 20 MeV for the pion and 65 MeV for the kaon. (orig.)

  4. mRNA Expression of EgCHI1, EgCHI2, and EgCHI3 in Oil Palm Leaves (Elaeis guineesis Jacq. after Treatment with Ganoderma boninense Pat. and Trichoderma harzianum Rifai

    Directory of Open Access Journals (Sweden)

    Laila Naher

    2012-01-01

    Full Text Available Background. Basal stem rot (BSR disease caused by the fungus Ganoderma boninense is the most serious disease affecting the oil palm; this is because the disease escapes the early disease detection. The biocontrol agent Trichoderma harzianum can protect the disease only at the early stage of the disease. In the present study, the expression levels of three oil palm (Elaeis guineensis Jacq. chitinases encoding EgCHI1, EgCHI2, and EgCHI3 at 2, 5, and 8 weeks inoculation were measured in oil palm leaves from plants treated with G. boninense or T. harzianum alone or both. Methods. The five-month-old oil palm seedlings were treated with Gano-wood blocks inoculum and trichomulch. Expression of EgCHI1, EgCHI2, and EgCHI3 in treated leaves tissue was determined by real-time PCR. Results. Oil palm chitinases were not strongly expressed in oil palm leaves of plants treated with G. boninense alone compared to other treatments. Throughout the 8-week experiment, expression of EgCHI1 increased more than 3-fold in leaves of plants treated with T. harzianum and G. boninense when compared to those of control and other treated plants. Conclusion. The data illustrated that chitinase cDNA expression varied depending on tissue and the type of treatment.

  5. mRNA Expression of EgCHI1, EgCHI2, and EgCHI3 in Oil Palm Leaves (Elaeis guineesis Jacq.) after Treatment with Ganoderma boninense Pat. and Trichoderma harzianum Rifai

    Science.gov (United States)

    Naher, Laila; Tan, Soon Guan; Ho, Chai Ling; Yusuf, Umi Kalsom; Ahmad, Siti Hazar; Abdullah, Faridah

    2012-01-01

    Background. Basal stem rot (BSR) disease caused by the fungus Ganoderma boninense is the most serious disease affecting the oil palm; this is because the disease escapes the early disease detection. The biocontrol agent Trichoderma harzianum can protect the disease only at the early stage of the disease. In the present study, the expression levels of three oil palm (Elaeis guineensis Jacq.) chitinases encoding EgCHI1, EgCHI2, and EgCHI3 at 2, 5, and 8 weeks inoculation were measured in oil palm leaves from plants treated with G. boninense or T. harzianum alone or both. Methods. The five-month-old oil palm seedlings were treated with Gano-wood blocks inoculum and trichomulch. Expression of EgCHI1, EgCHI2, and EgCHI3 in treated leaves tissue was determined by real-time PCR. Results. Oil palm chitinases were not strongly expressed in oil palm leaves of plants treated with G. boninense alone compared to other treatments. Throughout the 8-week experiment, expression of EgCHI1 increased more than 3-fold in leaves of plants treated with T. harzianum and G. boninense when compared to those of control and other treated plants. Conclusion. The data illustrated that chitinase cDNA expression varied depending on tissue and the type of treatment. PMID:22919345

  6. Measurement of the ratio of prompt {chi}{sub c} to J/{psi} production in pp collisions at {radical}(s)=7 TeV

    Energy Technology Data Exchange (ETDEWEB)

    Aaij, R. [Nikhef National Institute for Subatomic Physics, Amsterdam (Netherlands); Abellan Beteta, C. [Universitat de Barcelona, Barcelona (Spain); Adeva, B. [Universidad de Santiago de Compostela, Santiago de Compostela (Spain); Adinolfi, M. [H.H. Wills Physics Laboratory, University of Bristol, Bristol (United Kingdom); Adrover, C. [CPPM, Aix-Marseille Universite, CNRS/IN2P3, Marseille (France); Affolder, A. [Oliver Lodge Laboratory, University of Liverpool, Liverpool (United Kingdom); Ajaltouni, Z. [Clermont Universite, Universite Blaise Pascal, CNRS/IN2P3, LPC, Clermont-Ferrand (France); Albrecht, J.; Alessio, F. [European Organization for Nuclear Research (CERN), Geneva (Switzerland); Alexander, M. [School of Physics and Astronomy, University of Glasgow, Glasgow (United Kingdom); Ali, S. [Nikhef National Institute for Subatomic Physics, Amsterdam (Netherlands); Alkhazov, G. [Petersburg Nuclear Physics Institute (PNPI), Gatchina (Russian Federation); Alvarez Cartelle, P. [Universidad de Santiago de Compostela, Santiago de Compostela (Spain); Alves, A.A. [Sezione INFN di Roma La Sapienza, Roma (Italy); Amato, S. [Universidade Federal do Rio de Janeiro (UFRJ), Rio de Janeiro (Brazil); Amhis, Y. [Ecole Polytechnique Federale de Lausanne (EPFL), Lausanne (Switzerland); Anderson, J. [Physik-Institut, Universitaet Zuerich, Zuerich (Switzerland); Appleby, R.B. [School of Physics and Astronomy, University of Manchester, Manchester (United Kingdom); Aquines Gutierrez, O. [Max-Planck-Institut fuer Kernphysik (MPIK), Heidelberg (Germany); Archilli, F. [Laboratori Nazionali dell' INFN di Frascati, Frascati (Italy); European Organization for Nuclear Research (CERN), Geneva (Switzerland); and others

    2012-12-05

    The prompt production of charmonium {chi}{sub c} and J/{psi} states is studied in proton-proton collisions at a centre-of-mass energy of {radical}(s)=7 TeV at the Large Hadron Collider. The {chi}{sub c} and J/{psi} mesons are identified through their decays {chi}{sub c}{yields}J/{psi}{gamma} and J/{psi}{yields}{mu}{sup +}{mu}{sup -} using 36 pb{sup -1} of data collected by the LHCb detector in 2010. The ratio of the prompt production cross-sections for {chi}{sub c} and J/{psi}, {sigma}({chi}{sub c}{yields}J/{psi}{gamma})/{sigma}(J/{psi}), is determined as a function of the J/{psi} transverse momentum in the range 2

  7. A lattice QCD calculation of the transverse decay constant of the b{sub 1}(1235) meson

    Energy Technology Data Exchange (ETDEWEB)

    Jansen, K. [Deutsches Elektronen-Synchrotron (DESY), Zeuthen (Germany). John von Neumann-Inst. fuer Computing NIC; McNeile, C. [Wuppertal Univ. (Germany). Theoretische Teilchenphysik; Michael, C. [Liverpool Univ. (United Kingdom). Theoretical Physics Division, Dept. of Mathematical Sciences; Urbach, C. [Humboldt-Univ., Berlin (Germany). Theorie der Elementarteilchen

    2009-10-15

    We review various B meson decays that require knowledge of the transverse decay constant of the b{sub 1}(1235) meson. We report on an exploratory lattice QCD calculation of the transverse decay constant of the b{sub 1} meson. The lattice QCD calculations used unquenched gauge configurations, at two lattice spacings, generated with two flavours of sea quarks. The twisted mass formalism is used. (orig.)

  8. Ds1*(2860) and Ds3*(2860): candidates for 1D charmed-strange mesons

    International Nuclear Information System (INIS)

    Song, Qin-Tao; Chen, Dian-Yong; Liu, Xiang; Matsuki, Takayuki

    2015-01-01

    Newly observed two charmed-strange resonances, D s1 * (2860) and D s3 * (2860), are investigated by calculating their Okubo-Zweig-Iizuka-allowed strong decays, which shows that they are suitable candidates for the 1 3 D 1 and 1 3 D 3 states in the charmed-strange meson family. Our study also predicts other main decay modes of D s1 * (2860) and D s3 * (2860), which can be accessible at the future experiment. In addition, the decay behaviors of the spin partners of D s1 * (2860) and D s3 * (2860), i.e., 1D(2 - ) and 1D'(2 - ), are predicted in this work, which are still missing at present. The experimental search for the missing 1D(2 - ) and 1D'(2 - ) charmed-strange mesons is an intriguing and challenging task for further experiments. (orig.)

  9. Exotic hybrid mesons in hard electroproduction

    CERN Document Server

    Anikin, I V; Szymanowski, L; Teryaev, O V; Wallon, S

    2005-01-01

    We estimate the sizeable cross section for deep exclusive electroproduction of an exotic $J^{PC}=1^{-+}$ hybrid meson in the Bjorken regime. The production amplitude scales like the one for usual meson electroproduction, i.e. as $1/Q^2$. This is due to the non-vanishing leading twist distribution amplitude for the hybrid meson, which may be normalized thanks to its relation to the energy momentum tensor and to the QCD sum rules technique. The hard amplitude is considered up to next-to-leading order in $\\alpha_{S}$ and we explore the consequences of fixing the renormalization scale ambiguity through the BLM procedure. We study the particular case where the hybrid meson decays through a $\\pi\\eta $ meson pair. We discuss the $\\pi\\eta$ generalized distribution amplitude and then calculate the production amplitude for this process. We propose a forward-backward asymmetry in the production of $\\pi$ and $\\eta$ mesons as a signal for the hybrid meson production. We briefly comment on hybrid electroproduction at very ...

  10. Electrical properties of resistive switches based on Ba{sub 1-{chi}S}r{sub {chi}T}iO{sub 3} thin films prepared by RF co-sputtering

    Energy Technology Data Exchange (ETDEWEB)

    Marquez H, A.; Hernandez R, E.; Zapata T, M. [IPN, Centro de Investigacion en Ciencia Aplicada y Tecnologia Avanzada, Calzada Legaria No. 694, Col. Irrigacion, 11500 Mexico D. F. (Mexico); Guillen R, J. [Instituto Tecnologico y de Estudios Superiores de Monterrey, Campus Tampico, Puerto Industrial, Altamira 89600, Tamaulipas (Mexico); Cruz, M. P. [UNAM, Centro de Nanociencias y Nanotecnologia, Km. 107 Carretera Tijuana-Ensenada, 22860 Ensenada, Baja California (Mexico); Calzadilla A, O. [Universidad de la Habana, Facultad de Fisica-IMRE, San Lazaro y L. Municipio Plaza de la Revolucion, La Habana, Cuba (Cuba); Melendez L, M., E-mail: amarquez@ipn.m [IPN, Centro de Investigacion y de Estudios Avanzados, Departamento de Fisica, A. P. 14-740, 07000 Mexico D. F. (Mexico)

    2010-07-01

    In this work, was proposed the use of Ba{sub 1-{chi}S}r{sub {chi}T}iO{sub 3}(0{<=}x{<=}1) thin films for the construction of metal-insulator-metal heterostructures; and their great potential for the development of non-volatile resistance memories (ReRAM) is shown. The deposition of Ba{sub 1-{chi}S}r{sub {chi}T}iO{sub 3} thin films was done by the RF co-sputtering technique using two magnetron sputtering cathodes with BaTiO{sub 3} and SrTiO{sub 3} targets. The chemical composition (x parameter) in the deposited Ba{sub 1-{chi}S}r{sub {chi}T}iO{sub 3} thin films was varied through the RF powder applied to the targets. The constructed metal-insulator-metal heterostructures were Al/Ba{sub 1-{chi}S}r{sub {chi}T}iO{sub 3}/nichrome. The I-V measurements of the heterostructures showed that their hysteretic characteristics change depending on the Ba/Sr ratio of the Ba{sub 1-{chi}S}r{sub {chi}T}iO{sub 3} thin films; the Ba/Sr ratio was determined by employing the energy dispersive spectroscopy; Sem micrographs showed that Ba{sub 1-{chi}S}r{sub {chi}T}iO{sub 3} thin films were uniform without cracks or pinholes. Additionally, the analysis of the X-ray diffraction results indicated the substitutional incorporation of Sr into the BaTiO{sub 3} lattice and the obtainment of crystalline films for the entire range of the x values. (Author)

  11. Meson-nucleus potentials and the search for meson-nucleus bound states

    Science.gov (United States)

    Metag, V.; Nanova, M.; Paryev, E. Ya.

    2017-11-01

    Recent experiments studying the meson-nucleus interaction to extract meson-nucleus potentials are reviewed. The real part of the potentials quantifies whether the interaction is attractive or repulsive while the imaginary part describes the meson absorption in nuclei. The review is focused on mesons which are sufficiently long-lived to potentially form meson-nucleus quasi-bound states. The presentation is confined to meson production off nuclei in photon-, pion-, proton-, and light-ion induced reactions and heavy-ion collisions at energies near the production threshold. Tools to extract the potential parameters are presented. In most cases, the real part of the potential is determined by comparing measured meson momentum distributions or excitation functions with collision model or transport model calculations. The imaginary part is extracted from transparency ratio measurements. Results on K+ ,K0 ,K- , η ,η‧ , ω, and ϕ mesons are presented and compared with theoretical predictions. The interaction of K+ and K0 mesons with nuclei is found to be weakly repulsive, while the K- , η ,η‧ , ω and ϕ meson-nucleus potentials are attractive, however, with widely different strengths. Because of meson absorption in the nuclear medium the imaginary parts of the meson-nucleus potentials are all negative, again with a large spread. An outlook on planned experiments in the charm sector is given. In view of the determined potential parameters, the criteria and chances for experimentally observing meson-nucleus quasi-bound states are discussed. The most promising candidates appear to be the η and η‧ mesons.

  12. Photoproduction of the f1(1285 ) meson

    Science.gov (United States)

    Dickson, R.; Schumacher, R. A.; Adhikari, K. P.; Akbar, Z.; Amaryan, M. J.; Anefalos Pereira, S.; Badui, R. A.; Ball, J.; Battaglieri, M.; Batourine, V.; Bedlinskiy, I.; Biselli, A.; Boiarinov, S.; Briscoe, W. J.; Burkert, V. D.; Cao, T.; Carman, D. S.; Celentano, A.; Chandavar, S.; Charles, G.; Chetry, T.; Ciullo, G.; Colaneri, L.; Cole, P. L.; Compton, N.; Contalbrigo, M.; Cortes, O.; Crede, V.; D'Angelo, A.; Dashyan, N.; De Vita, R.; De Sanctis, E.; Deur, A.; Djalali, C.; Dugger, M.; Dupre, R.; El Alaoui, A.; El Fassi, L.; Eugenio, P.; Fanchini, E.; Fedotov, G.; Filippi, A.; Fleming, J. A.; Gevorgyan, N.; Ghandilyan, Y.; Gilfoyle, G. P.; Giovanetti, K. L.; Girod, F. X.; Gothe, R. W.; Griffioen, K. A.; Guo, L.; Hafidi, K.; Hakobyan, H.; Hanretty, C.; Harrison, N.; Hattawy, M.; Holtrop, M.; Hicks, K.; Hughes, S. M.; Ilieva, Y.; Ireland, D. G.; Ishkhanov, B. S.; Isupov, E. L.; Jiang, H.; Jo, H. S.; Joosten, S.; Keller, D.; Khachatryan, G.; Khandaker, M.; Kim, A.; Kim, W.; Klein, F. J.; Kubarovsky, V.; Kuleshov, S. V.; Lanza, L.; Lenisa, P.; Livingston, K.; Lu, H. Y.; MacGregor, I. J. D.; Mattione, P.; McKinnon, B.; Meyer, C. A.; Mirazita, M.; Markov, N.; Mokeev, V.; Moriya, K.; Munevar, E.; Murdoch, G.; Nadel-Turonski, P.; Net, L. A.; Ni, A.; Osipenko, M.; Ostrovidov, A. I.; Park, K.; Pasyuk, E.; Phelps, W.; Pisano, S.; Pogorelko, O.; Price, J. W.; Prok, Y.; Puckett, A. J. R.; Raue, B. A.; Ripani, M.; Rizzo, A.; Rosner, G.; Roy, P.; Salgado, C.; Seder, E.; Sharabian, Y. G.; Skorodumina, Iu.; Smith, E. S.; Smith, G. D.; Sober, D.; Sokhan, D.; Sparveris, N.; Stepanyan, S.; Strakovsky, I. I.; Stankovic, I.; Strauch, S.; Sytnik, V.; Taiuti, M.; Ungaro, M.; Voskanyan, H.; Voutier, E.; Walford, N. K.; Watts, D. P.; Weygand, D.; Wood, M. H.; Zachariou, N.; Zana, L.; Zhang, J.; Zonta, I.; CLAS Collaboration

    2016-06-01

    The f1(1285 ) meson with mass 1281.0 ±0.8 MeV/c2 and width 18.4 ±1.4 MeV (full width at half maximum) was measured for the first time in photoproduction from a proton target using CLAS at Jefferson Lab. Differential cross sections were obtained via the η π+π-,K+K¯0π- , and K-K0π+ decay channels from threshold up to a center-of-mass energy of 2.8 GeV. The mass, width, and an amplitude analysis of the η π+π- final-state Dalitz distribution are consistent with the axial-vector JP=1+ f1(1285 ) identity, rather than the pseudoscalar 0- η (1295 ) . The production mechanism is more consistent with s -channel decay of a high-mass N* state and not with t -channel meson exchange. Decays to η π π go dominantly via the intermediate a0±(980 ) π∓ states, with the branching ratio Γ [a0π (noK ¯K )] /Γ [η π π (all)] =0.74 ±0.09 . The branching ratios Γ (K K ¯π ) /Γ (η π π ) =0.216 ±0.033 and Γ (γ ρ0) /Γ (η π π ) =0.047 ±0.018 were also obtained. The first is in agreement with previous data for the f1(1285 ) , while the latter is lower than the world average.

  13. Photoproduction of eta mesons from threshold to 1.2 GeV

    International Nuclear Information System (INIS)

    Rigney, A.; Breuer, M.; Hoffman-Rothe, P.; Anton, G.; Arends, J.; Berrier-Ronsin, G.; Beulertz, W.; Blanpied, G.; Bock, A.; Bruns, M.; Didelez, J.; Djaladi, C.; Edel, G.; Frascaria, R.; Maass, R.; Helbing, K.; Hey, J.; Noeldeke, G.; Hourani, E.; Mayers, M.; Preedom, B.; Ritchie, B.; Rosier, L.; Saghai, B.; Schumacher, M.; Smend, F.; Whisnant, S.

    1995-01-01

    We have measured total and differential cross sections for η-meson photo-production on 7 cm thick 1 H, 2 D, and 14 N liquid targets from threshold to 1.2 GeV, using the tagged Bremsstrahlung photon beam produced by the electrons extracted from the ELSA storage ring at Bonn. The photoreaction was identified by detecting the η decay products in the neutral meson spectrometer SPES0-2π, while the recoil baryons (proton, neutron, or deuteron) were detected by a variety of large angle scintillator detectors. Some of our recent preliminary results, both theoretical and experimental, will be discussed. copyright 1995 American Institute of Physics

  14. About oscillations in the system of K0 mesons

    International Nuclear Information System (INIS)

    Beshtoev, Kh.M.

    2011-01-01

    This work considers K 0 -, K 0 bar - meson mixings and oscillations via K 1 0 , K 2 0 - meson states at strangeness violation by the weak interactions and K 1 0 -, K 2 0 - meson mixings and oscillations via K S -, K L - meson states at CP violation by the weak interactions without and with taking into account decay widths. We work in the framework of the masses mixing scheme. It is shown that K 1 0 -(K S -) meson states appear at big distances from the K 0 -mesons source after their decays (τ L ≥ τ S (τ 2 ≥τ 1 )) due to oscillations of residual K 2 0 (K L ) mesons and then again we see short-living K 1 0 (K S ) mesons. It is implied that K L ↔K S meson oscillations are absent. The case is also considered when at CP violation unitarity is violated, but orthogonality of K S , K L states remains. The general expressions for probabilities of meson oscillations (transitions) are given

  15. Exotic hybrid mesons in hard electroproduction

    International Nuclear Information System (INIS)

    Anikin, I.V.; Pire, B.; Szymanowski, L.; Teryaev, O.V.; Wallon, S.

    2005-01-01

    We estimate the sizeable cross section for deep exclusive electroproduction of an exotic J PC =1 -+ hybrid meson in the Bjorken regime. The production amplitude scales like the one for usual meson electroproduction, i.e., as 1/Q 2 . This is due to the nonvanishing leading twist distribution amplitude for the hybrid meson, which may be normalized thanks to its relation to the energy-momentum tensor and to the QCD sum rules technique. The hard amplitude is considered up to next-to-leading order in α S and we explore the consequences of fixing the renormalization scale ambiguity through the Brodsky-Lepage-Mackenzie (BLM) procedure. We study the particular case where the hybrid meson decays through a πη meson pair. We discuss the πη generalized distribution amplitude and then calculate the production amplitude for this process. We propose a forward-backward asymmetry in the production of π and η mesons as a signal for the hybrid meson production. We briefly comment on hybrid electroproduction at very high energy, in the diffractive limit where a QCD Odderon exchange mechanism should dominate. The conclusion of our study is that hard electroproduction is a promising way to study exotic hybrid mesons, in particular, at JLAB, HERA (HERMES), or CERN (Compass)

  16. Computing K and D meson masses with Nf=2+1+1 twisted mass lattice QCD

    International Nuclear Information System (INIS)

    Baron, Remi; Blossier, Benoit; Boucaud, Philippe

    2010-05-01

    We discuss the computation of the mass of the K and D mesons within the framework of N f =2+1+1 twisted mass lattice QCD from a technical point of view. These quantities are essential, already at the level of generating gauge configurations, being obvious candidates to tune the strange and charm quark masses to their physical values. In particular, we address the problems related to the twisted mass flavor and parity symmetry breaking, which arise when considering a non-degenerate (c,s) doublet. We propose and verify the consistency of three methods to extract the K and D meson masses in this framework. (orig.)

  17. B-meson spectroscopy in HQET at order 1/m

    International Nuclear Information System (INIS)

    Bernardoni, Fabio; Fritsch, Patrick; Univ. Autonoma de Madrid; Gerardin, Antoine; Univ. Blaise Pascal CNRS/IN2P3, Aubiere; Heitger, Jochen; Hippel, Georg von; Simma, Hubert

    2015-05-01

    We present a study of the B spectrum performed in the framework of Heavy Quark Effective Theory expanded to next-to-leading order in 1/m b and non-perturbative in the strong coupling. Our analyses have been performed on N f =2 lattice gauge field ensembles corresponding to three different lattice spacings and a wide range of pion masses. We obtain the B s -meson mass and hyperfine splittings of the B- and B s -mesons that are in good agreement with the experimental values and examine the mass difference m B s -m B as a further cross-check of our previous estimate of the b-quark mass. We also report on the mass splitting between the first excited state and the ground state in the B and B s systems.

  18. Meson photoproduction (CLAS)

    Energy Technology Data Exchange (ETDEWEB)

    Steffen Strauch

    2009-10-01

    This is a brief and selective discussion of meson photoproduction measurements with the CEBAF Large Acceptance Spectrometer (CLAS) at Jefferson Lab. Meson photo- production is being used as a tool for various investigations, including the spectroscopy of baryons and mesons and the search for vector-meson medium modifications.

  19. Spin-zero mesons and current algebras

    International Nuclear Information System (INIS)

    Wellner, M.

    1977-01-01

    Large chiral algebras, using the f and d coefficients of SU(3) can be constructed with spin-1/2 baryons. Such algebras have been found useful in some previous investigations. This article examines under what conditions similar or identical current algebras may be realized with spin-0 mesons. A curious lack of analogy emerges between meson and baryon currents. Second-class currents, made of mesons, are required in some algebras. If meson and baryon currents are to satisfy the same extended SU(3) algebra, four meson nonets are needed, in terms of which we give an explicit construction for the currents

  20. Meson Correlators in Finite Temperature Lattice QCD

    CERN Document Server

    De Forcrand, Philippe; Hashimoto, T; Hioki, S; Matsufuru, H; Miyamura, O; Nakamura, A; Takaishi, T; Umeda, T; Stamatescu, I O; CERN. Geneva; Forcrand, Ph. de

    2001-01-01

    We analyze temporal and spatial meson correlators in quenched lattice QCD at T>0. Below T_c we observe little change in the meson properties as compared with T=0. Above T_c we observe new features: chiral symmetry restoration and signals of plasma formation, but also indication of persisting mesonic (metastable) states and different temporal and spatial masses in the mesonic channels. This suggests a complex picture of QGP in the region 1 - 1.5 T_c.

  1. Possible violation of the ΔI=1/2 rule in non-mesonic hypernuclear weak decay

    International Nuclear Information System (INIS)

    Schumacher, R.A.

    1991-01-01

    The weak decays of strange mesons and free hyperons strongly favor ΔI=1/2 amplitudes over ΔI=3/2 amplitudes. It is now known to what extent this rule applies to the non-mesonic interactions of the type Λp → np and Λn → nn. This paper examines existing data on non-mesonic decays of light hypernuclei in order to obtain a quantitative estimate of the relative strength of the two isospin channels., The data show that a pure ΔI=1/2 decay amplitude is ruled out at the 1.6σ level, and favor a solution where either: (1) both isospin channels contribute about equally, or (2) the ΔI=3/2 channel dominates by an order of magnitude

  2. Chiral Quark-Meson model of N and DELTA with vector mesons

    International Nuclear Information System (INIS)

    Broniowski, W.; Banerjee, M.K.

    1985-10-01

    Vector mesons rho, A 1 and ω are introduced in the Chiral Quark-Meson Theory (CQMT) of N and Δ. We propose a new viewpoint for developing CQMT from QCD at the mean-field level. The SU(2) x SU(2) chiral Lagrangian incorporates universal coupling. Accordingly, rho is coupled to the conserved isospin current, A to the partially conserved axial-vector current (PCAC), and ω to the conserved baryon current. As a result the only parameter of the model not directly related to experiment is the quark-pion coupling constant. A fully self-consistent mean-field solution to the model is found for fields in the hedgehog ansatz. The vector mesons play a very important role in the system. They contribute significantly to the values of observables and produce a high-quality fit to many data. The classical stability of the system with respect to hedgehog excitations is analyzed through the use of the Quark-Meson RPA equations (QMRPA)

  3. Meson factories

    International Nuclear Information System (INIS)

    Dicello, J.F.; Zaider, M.; Bradbury, J.N.

    1979-01-01

    Technological improvements in accelerator design in the 1960's resulted in the capability to develop medium-energy proton accelerators with beam intensities of almost 1 mA. These beams are able to produce fluxes of secondary particles, including pions, muons, neutrinos, and neutrons, which are as much as 10,000 times as intense as those previously available. Those machines built for optimum meson production are commonly called meson factories. The characteristics of these facilities are reviewed, and the present programs in applied research, and some potential areas of future work are discussed

  4. Mass spectrum of 1-+ exotic mesons from lattice QCD

    International Nuclear Information System (INIS)

    Cook, M. S.; Fiebig, H. R.

    2006-01-01

    Time correlation functions of a hybrid exotic meson operator, with J PC =1 -+ , generated in quenched lattice QCD are subjected to a (Bayesian) maximum entropy analysis. Five distinct spectral levels are uncovered. Their extrapolation into the physical pion mass region suggests a possible relationship to experimentally known states π 1 (1400) and π 1 (1600), and also to a state in the 2 GeV region carrying the same quantum numbers

  5. Asymptotic energy scale factors for pseudoscalar meson scattering and charmed meson couplings

    International Nuclear Information System (INIS)

    Thews, R.L.

    1977-01-01

    Energy scale factors ν 0 for PP → PP scattering amplitudes are related via absence of exotic resonances of ratios of tensor to vector coupling strengths. These same ratios are extracted from FESR's for non-exotic reactions. The scale factors obtained are all of the order of 1.0 GeV 2 or less, indepedent of quantum numbers. This contradicts the expectations of dual amplitudes in which ν 0 =1/α', and trajectory slopes are smaller for charmed mesons. Decay widths for tensor mesons are predicted. An observed SU(3) violation for the ratio A 2 → KantiK/K** → Kπ is shown to be consistent with the FESR results. Charmed meson decays are predicted to be factors of 2 to 3 larger than those predicted by SU(4). (author)

  6. Hard electroproduction of hybrid mesons

    International Nuclear Information System (INIS)

    Anikin, I.V.; LPT Universite Paris-Sud, Orsay; Szymanowski, L.; Teryaev, O.V.; ); Wallon, S.

    2005-01-01

    We estimate the sizeable cross section for deep exclusive electroproduction of an exotic J PC = 1 -+ hybrid meson in the Bjorken regime. The production amplitude scales like the one for usual meson electroproduction, i.e. as 1/Q 2 . This is due to the non-vanishing leading twist distribution amplitude for the hybrid meson, which may be normalized thanks to its relation to the energy momentum tensor and to the QCD sum rules technique. The hard amplitude is considered up to next-to-leading order in as and we explore the consequences of fixing the renormalization scale ambiguity through the BLM procedure. (author)

  7. Charge parity exotic mesons

    International Nuclear Information System (INIS)

    Burden, C.J.

    1998-01-01

    Full text: Evidence for a meson with exotic quantum numbers J PC 1 -+ , the ρ(1405), has been observed at the AGS at Brookhaven and Crystal Barrel at CERN. This meson is exotic to the extent that its quantum numbers are not consistent with the generalised Pauli exclusion principle applied to the naive constituent quark model. In a fully relativistic field theoretic treatment, however, there is nothing in principle to preclude the existence of charge parity exotics. Using our earlier covariant Bethe-Salpeter model of light-quark mesons with no new parameter fitting we demonstrate the existence of a q - q-bar bound state with the quantum numbers of the ρ

  8. ''VECTON-1'' two-arm spectrometer for rho--meson photoproduction study

    International Nuclear Information System (INIS)

    Anokhin, M.V.; Kanetsyan, A.R.; Kukarev, V.M.

    1977-01-01

    A two-arm spectrometer for registering p - mesons according to a charged pion and one of the neutral pion disintegration photons has been designed. The spectrometer arm which registers charged pion comprises a deflecting magnet, dual wide-gap spark chambers and dual scintillation counters. The spectrometer arm for registering the disintegration photon comprises a scintillation counter, a dual wide-gap spark chamber and a shower detector. The principal characteristics of the spectrometer components are listed. The functional diagram of the useful events selection unit is discussed. It is shown that the experimental results obtained with the aid of the ''VEKTON-1'' set-up are in good agreement with the earlier results: P - meson rest energy is 731+-30 MeV, the resonant range width is 195+-58 MeV

  9. Search for rare B meson decays into Ds+ mesons

    International Nuclear Information System (INIS)

    Albrecht, H.; Ehrlichmann, H.; Hamacher, T.; Hofmann, R.P.; Kirchhoff, T.; Nau, A.; Nowak, S.; Schroeder, H.; Schulz, H.D.; Walter, M.; Wurth, R.; Appuhn, R.D.; Hast, C.; Kolanoski, H.; Lange, A.; Lindner, A.; Mankel, R.; Schieber, M.; Siegmund, T.; Spaan, B.; Thurn, H.; Toepfer, D.; Walther, A.; Wegener, D.; Britton, D.I.; Charlesworth, C.E.K.; Edwards, K.W.; Hyatt, E.R.F.; Kapitza, H.; Krieger, P.; MacFarlane, D.B.; Patel, P.M.; Prentice, J.D.; Saull, P.R.B.; Tzamariudaki, K.; Van de Water, R.G.; Yoon, T.S.; Ressing, D.; Schmidtler, M.; Schneider, M.; Schubert, K.R.; Strahl, K.; Waldi, R.; Weseler, S.; Balagura, V.; Belyaev, I.; Chechelnitsky, S.; Danilov, M.; Droutskoy, A.; Gershtein, Yu.; Golutvin, A.; Gorelov, I.; Kostina, G.; Lubimov, V.; Pakhlov, P.; Ratnikov, F.; Semenov, S.; Shibaev, V.; Soloshenko, V.; Tichomirov, I.; Zaitsev, Yu.

    1993-01-01

    A search has been performed for rare B meson decays into D s + mesons arising from b→u transitions, W exchange modes, B + annihilation processes, and decays where the D s + is not produced via a W→c anti s quark pair coupling, using the ARGUS detector operating on the Y(4S) resonance at the e + e - storage ring DORIS II. Upper limits for individual decay modes are obtained. In addition, from a study of D s + l - correlations an upper limit of BR(B→D s + l - X)<1.2%(90% CL) is determined. (orig.)

  10. Formation des etats $\\chi_1$ et $\\chi_2$ du charmonium dans l'annihilation $p\\bar{p}$ aux ISR

    OpenAIRE

    Fay , J.

    1986-01-01

    Un des buts de l'expérience R704 est l'étude des états $\\chi_1$ et $\\chi_2$ du charmonium $(c\\bar{c)}$ dans leur annihilation J/$\\psi$ + photon. Ces états sont formés par interaction d'un jet moléculaire d'hydrogène sur un faisceau refroidi d'antiprotons. L'importance du bruit de fond hadronique conduit à ne s'intéresser qu'aux états finaux électromagnétiques. L'appareillage de détection est essentiellement constitué de deux bras symétriques non magnétiques en deux parties. La première s'inté...

  11. Genetic variants in CHI3L1 influencing YKL-40 levels

    DEFF Research Database (Denmark)

    Kjaergaard, Alisa D; Johansen, Julia S; Nordestgaard, Børge G

    2013-01-01

    Despite its important role in many serious diseases, the genetic background for plasma YKL-40 has still not been systematically catalogued. Therefore, we aimed at identifying genetic variants in CHI3L1 influencing plasma YKL-40 levels in the general population.......Despite its important role in many serious diseases, the genetic background for plasma YKL-40 has still not been systematically catalogued. Therefore, we aimed at identifying genetic variants in CHI3L1 influencing plasma YKL-40 levels in the general population....

  12. Computing K and D meson masses with N{sub f}=2+1+1 twisted mass lattice QCD

    Energy Technology Data Exchange (ETDEWEB)

    Baron, Remi [CEA, Centre de Saclay, 91 - Gif-sur-Yvette (France). IRFU/Service de Physique Nucleaire; Blossier, Benoit; Boucaud, Philippe [Paris XI Univ., 91 - Orsay (FR). Lab. de Physique Theorique] (and others)

    2010-05-15

    We discuss the computation of the mass of the K and D mesons within the framework of N{sub f}=2+1+1 twisted mass lattice QCD from a technical point of view. These quantities are essential, already at the level of generating gauge configurations, being obvious candidates to tune the strange and charm quark masses to their physical values. In particular, we address the problems related to the twisted mass flavor and parity symmetry breaking, which arise when considering a non-degenerate (c,s) doublet. We propose and verify the consistency of three methods to extract the K and D meson masses in this framework. (orig.)

  13. Chiral Extrapolations of the $\\boldsymbol{ρ(770)}$ Meson in $\\mathbf{N_f=2+1}$ Lattice QCD Simulations

    Energy Technology Data Exchange (ETDEWEB)

    Molina, Raquel [Univ. of Sao Paulo (Brazil); Hu, Bitao [George Washington Univ., Washington, DC (United States); Doering, Michael [Thomas Jefferson National Accelerator Facility (TJNAF), Newport News, VA (United States); George Washington Univ., Washington, DC (United States); Mai, Maxim [George Washington Univ., Washington, DC (United States); Alexandru, Andrei [George Washington Univ., Washington, DC (United States)

    2018-04-01

    Several lattice QCD simulations of meson-meson scattering in p-wave and Isospin = 1 in Nf = 2 + 1 flavours have been carried out recently. Unitarized Chiral Perturbation Theory is used to perform extrapolations to the physical point. In contrast to previous findings on the analyses of Nf = 2 lattice data, where most of the data seems to be in agreement, some discrepancies are detected in the Nf = 2 + 1 lattice data analyses, which could be due to different masses of the strange quark, meson decay constants, initial constraints in the simulation, or other lattice artifacts. In addition, the low-energy constants are compared to the ones from a recent analysis of Nf = 2 lattice data.

  14. Search for scalar mesons

    International Nuclear Information System (INIS)

    Pennington, M.R.

    1989-01-01

    The search for I = 0 0 ++ mesons is described. The crucial role played by the states in the 1 GeV region is highlighted. An analysis program that with unimpeachable data would produce definitive results on these is outlined and shown with present data to provide prima facie evidence for dynamics beyond that of the quark model. The authors briefly speculate on the current status of the lowest mass scalar mesons and discuss how experiment can resolve the unanswered issues. 30 references, 6 figures, 1 table

  15. Production and decay rates of the iota meson

    International Nuclear Information System (INIS)

    Frank, M.; O'Donnell, P.J.; Toronto Univ., Ontario

    1984-01-01

    We correlate the results for the mass spectrum of low lying isoscalar-pseudoscalar mesons with the production decay rates from J/psi->γP, with P=eta 1 , eta' 1 , eta 2 and iota and study the radiative decays of the iota meson. We conclude that the iota meson has to be interpreted as having a strong gluonium component. (orig.)

  16. Study of the excited 1{sup -} charm and charm-strange mesons

    Energy Technology Data Exchange (ETDEWEB)

    Li, Qiang; Jiang, Yue; Wang, Tianhong; Yuan, Han; Wang, Guo-Li [Harbin Institute of Technology, Harbin (China); Chang, Chao-Hsi [CCAST (World Laboratory), P.O. Box 8730, Beijing (China); Chinese Academy of Sciences, Institute of Theoretical Physics, P.O. Box 2735, Beijing (China)

    2017-05-15

    We give a systematical study on the recently reported excited charm and charm-strange mesons with potential 1{sup -} spin-parity, including the D{sup *}{sub s1}(2700){sup +}, D{sup *}{sub s1}(2860){sup +}, D{sup *}(2600){sup 0}, D{sup *}(2650){sup 0}, D{sup *}{sub 1}(2680){sup 0} and D{sup *}{sub 1}(2760){sup 0}. The main strong decay properties are obtained in the framework of Bethe-Salpeter (BS) methods. Our results reveal that the two 1{sup -} charm-strange mesons can be well described by the further 2{sup 3}S{sub 1}-1{sup 3}D{sub 1} mixing scheme with a mixing angle of (8.7{sup +3.9}{sub -3.2}) {sup circle}. The predicted decay ratio (B(D{sup *}K))/(B(D K)) for D{sup *}{sub s1}(2860) is 0.62{sup +0.22}{sub -0.12}. D{sup *}(2600){sup 0} can also be explained as the 2{sup 3}S{sub 1} predominant state with a mixing angle of -(7.5{sup +4.0}{sub -3.3}) {sup circle}. Considering the mass range, D{sup *}(2650){sup 0} and D{sup *}{sub 1}(2680){sup 0} are more likely to be the 2{sup 3}S{sub 1} predominant states, although the total widths under the two 2{sup 3}S{sub 1} and 1{sup 3}D{sub 1} assignments have no great conflict with the current experimental data. The calculated width for the LHCb D{sup *}{sub 1}(2760){sup 0} seems to be about 100 MeV larger than the experimental measurement if taking it as 1{sup 3}D{sub 1} or 1{sup 3}D{sub 1} dominant state c anti u. The comparisons with other calculations and several important decay ratios are also presented. For the identification of these 1{sup -} charm mesons, further experimental information, such as (B(Dπ))/(B(D{sup *}π)), is necessary. (orig.)

  17. Vector-meson dominance revisited

    Directory of Open Access Journals (Sweden)

    Terschlüsen Carla

    2012-12-01

    Full Text Available The interaction of mesons with electromagnetism is often well described by the concept of vector-meson dominance (VMD. However, there are also examples where VMD fails. A simple chiral Lagrangian for pions, rho and omega mesons is presented which can account for the respective agreement and disagreement between VMD and phenomenology in the sector of light mesons.

  18. Coherent production of a1- mesons and (ρπ)- systems by antineutrinos on neon

    International Nuclear Information System (INIS)

    Marage, P.; Sacton, J.; Willocq, S.; Aderholz, M.; Wittek, W.; Allport, P.P.; Baton, J.P.; Neveu, M.; Burtovoy, V.; Clayton, E.F.; Mobayyen, M.M.; Wainstein, S.; Cooper-Sarkar, A.M.; Guy, J.; Venus, W.; Jones, G.T.; O'Neale, S.; Varvell, K.; Matsinos, E.; Simopoulou, E.; Vayaki, A.; Morrison, D.R.O.; Wachsmuth, H.; Sansum, R.A.

    1991-01-01

    The coherent production of 3π systems by charged current antineutrino interactions on neon nuclei is studied in the bubble chamber BEBC exposed to the CERN SPS wide band beam. The coherent signal is attributed mainly to (ρπ) production, where the (ρπ) system is either non-resonant or comes from the decay of a 1 mesons. The kinematical variables and the total cross section are compared with the predictions of the meson dominance model. (orig.)

  19. Search for rare B meson decays into D+s mesons

    International Nuclear Information System (INIS)

    Albrecht, H.; Ehrlichmann, H.; Hamacher, T.

    1993-04-01

    A search has been performed for rare B meson decays into D s + mesons arising from b → u transitions, W exchange modes, B + annihilation processes, and decays where the D s + is not produced via a W → c anti s quark pair coupling, using the ARGUS detector operating on the Y(4S) resonance at the e + e - storage ring DORIS II. Upper limits for individual decay modes are obtained. In addition, from a study of D s + l - correlations an upper limit of BR(B → D s + l - X) < 1.2% (90% CL) is determined. (orig.)

  20. Meson masses and decay constants from unquenched lattice QCD

    Energy Technology Data Exchange (ETDEWEB)

    Jansen, K. [Deutsches Elektronen-Synchrotron (DESY), Zeuthen (Germany); McNeile, C. [Glasgow Univ. (United Kingdom). Dept. of Physics and Astronomy; Michael, C. [Liverpool Univ. (United Kingdom). Theoretical Physics Div., Dept. of Mathematical Sciences; Urbach, C. [Humboldt Univ. Berlin (Germany). Inst. fuer Physik

    2009-06-15

    We report results for the masses of the flavour non-singlet light 0{sup ++}, 1{sup --}, and 1{sup +-} mesons from unquenched lattice QCD at two lattice spacings. The twisted mass formalism was used with two flavours of sea quarks. For the 0{sup ++} and 1{sup +-} mesons we look for the effect of decays on the mass dependence. For the light vector mesons we study the chiral extrapolations of the mass. We report results for the leptonic and transverse decay constants of the meson. We test the mass dependence of the KRSF relations. (orig.)

  1. Meson masses and decay constants from unquenched lattice QCD

    International Nuclear Information System (INIS)

    Jansen, K.; McNeile, C.; Michael, C.; Urbach, C.

    2009-06-01

    We report results for the masses of the flavour non-singlet light 0 ++ , 1 -- , and 1 +- mesons from unquenched lattice QCD at two lattice spacings. The twisted mass formalism was used with two flavours of sea quarks. For the 0 ++ and 1 +- mesons we look for the effect of decays on the mass dependence. For the light vector mesons we study the chiral extrapolations of the mass. We report results for the leptonic and transverse decay constants of the meson. We test the mass dependence of the KRSF relations. (orig.)

  2. J/ψ and ρ0 meson production at H1

    International Nuclear Information System (INIS)

    Kenyon, I.R.

    1996-01-01

    The production of J/ψ and ρ 0 mesons from e-p collisions, both in Deep Inelastic Scattering (DIS) and at Q 2 ∼ 0, has been studied using the H1 detector at HERA. The features of elastic ρ 0 production at Q 2 ∼ 0 are those expected from the Generalized Vector Dominance Model (VDM). However the elastic DIS ρ 0 and DIS J/ψ production as well as the elastic J/ψ production at Q 2 ∼ 0 all show features consistent with models that are inspired by perturbative QCD (pQCD). This pattern indicates that the appearance of a hard scale in vector meson production (either the quark mass, or large Q 2 ) results in a transition from VDM to pQCD. A final topic is the comparison of inelastic J/ψ production to a prediction from the photon-gluon fusion process in NLO. (author)

  3. Measurement of D* meson with two jets in photoproduction with the H1 detector at HERA

    International Nuclear Information System (INIS)

    Staykova, Zlatka

    2011-02-01

    Photoproduction events containing a charmed meson D *± and two jets are investigated with the H1 detector using the HERA II data sample. The measurement is based on e + p collisions during the period of 2006/2007 data taking and uses integrated luminosity of 113.14 pb -1 . The kinematic range of the measurement covers 100 GeV γp 2 2 . The D * mesons are reconstructed in the decay channel, D *± →D 0 π ± →K -+ π ± π ± . Jets were reconstructed using the inclusive k t algorithm and are selected if they have transverse momenta of p t (jet)>3.5 GeV. One of the jets has to be associated with the D * meson itself, such that the parent charmed quark can be tagged. The phase space of the measurement is limited within the central rapidity for the D * meson and the D * jet , vertical stroke η vertical stroke <1.5 while the second jet was measured within, -1.5<η<2.9. Single differential cross sections and double differential distributions were measured and compared to Leading Order Monte Carlo (MC) event generators, Pythia and Cascade and with the Next-to-Leading order MC generator MC rate at NLO. (orig.)

  4. In vivo CHI3L1 (YKL-40 expression in astrocytes in acute and chronic neurological diseases

    Directory of Open Access Journals (Sweden)

    Hamilton Ronald L

    2010-06-01

    Full Text Available Abstract Background CHI3L1 (YKL-40 is up-regulated in a variety of inflammatory conditions and cancers. We have previously reported elevated CHI3L1 concentration in the cerebrospinal fluid (CSF of human and non-human primates with lentiviral encephalitis and using immunohistochemistry showed that CHI3L1 was associated with astrocytes. Methods In the current study CHI3L1 transcription and expression were evaluated in a variety of acute and chronic human neurological diseases. Results ELISA revealed significant elevation of CHI3L1 in the CSF of multiple sclerosis (MS patients as well as mild elevation with aging. In situ hybridization (ISH showed CHI3L1 transcription mostly associated with reactive astrocytes, that was more pronounced in inflammatory conditions like lentiviral encephalitis and MS. Comparison of CHI3L1 expression in different stages of brain infarction showed that YKL40 was abundantly expressed in astrocytes during acute phases and diminished to low levels in chronic infarcts. Conclusions Taken together, these findings demonstrate that CHI3L1 is induced in astrocytes in a variety of neurological diseases but that it is most abundantly associated with astrocytes in regions of inflammatory cells.

  5. D-Meson Mixing in 2+1-Flavor Lattice QCD

    Energy Technology Data Exchange (ETDEWEB)

    Chang, Chia Cheng [William-Mary Coll.; Bouchard, C. M. [William-Mary Coll.; El-Khadra, A. X. [Illinois U., Urbana; Freeland, E. [Art Inst. of Chicago; Gámiz, E. [Granada U., Theor. Phys. Astrophys.; Kronfeld, A. S. [Fermilab; Laiho, J. W. [Syracuse U.; Neil, E. T. [Colorado U.; Simone, J. N. [Fermilab; Van de Water, R. S. [Fermilab

    2017-01-20

    We present results for neutral D-meson mixing in 2+1-flavor lattice QCD. We compute the matrix elements for all five operators that contribute to D mixing at short distances, including those that only arise beyond the Standard Model. Our results have an uncertainty similar to those of the ETM collaboration (with 2 and with 2+1+1 flavors). This work shares many features with a recent publication on B mixing and with ongoing work on heavy-light decay constants from the Fermilab Lattice and MILC Collaborations.

  6. Study of the $B^{0}\\rightarrow\\chi_{c1,2} K^{*0}$ decays at the LHCb experiment

    CERN Document Server

    Polyakov, Ivan

    In this research, the ratios of the branching fractions of the $B^{0}\\rightarrow\\chi_{c1} K^{*0}$, $B^{0}\\rightarrow\\chi_{c2} K^{*0}$ and $B^{0}\\rightarrow J/\\psi K^{*0}$ decays are measured: \\begin{equation*} \\begin{array}{lll} \\dfrac{{\\cal B}(B^{0}\\rightarrow \\chi_{c1} K^{*0})}{{\\cal B}(B^{0}\\rightarrow J/\\psi K^{*0})} &=& (19.8~\\pm1.1~(stat)\\pm1.2~(syst)\\pm0.9\\,({\\cal B}_{\\chi_{c1}}))\\times 10^{-2}, \

  7. Scattering amplitudes to all orders in meson exchange

    International Nuclear Information System (INIS)

    Silbar, R.R.; Mattis, M.P.

    1990-01-01

    As the number of colors in QCD, N C , becomes large, it is possible to sum up all meson-exchange contributions, however arbitrarily complicated, to meson-baryon and baryon-baryon scattering. A semi-classical structure for the two-flavor theory emerges, in close correspondence to vector-meson-augmented Skyrme models. In this limit, baryons act as extended static sources for the classical meson fields. This leads to non-linear differential equations for the classical meson fields which can be solved numerically for static radial (hedgehog-like) solutions. The non-linear terms in the equations of motion for the quantized meson fields can then be simplified, to leading order in 1/N C , by replacing all factors of the meson field but one by the previously-found classical field. This results in linear, Schroedinger-like equations, which are easily solved. For the meson-baryon case the solution can be subsequently analyzed to obtain the phase shifts for the scattering and, from these, the baryon resonance spectrum of the model. As the warm-up, we have carried out this calculation for the simple case of σ mesons only, finding sensible results. 8 refs., 3 figs

  8. Confirmation of the 1-+ meson exotics in the ηπ0 system

    International Nuclear Information System (INIS)

    Adams, G.S.; Adams, T.; Bar-Yam, Z.; Bishop, J.M.; Bodyagin, V.A.; Brown, D.S.; Cason, N.M.; Chung, S.U.; Cummings, J.P.; Demianov, A.I.; Danyo, K.; Dowd, J.P.; Eugenio, P.; Fan, X.L.; Gribushin, A.M.; Hackenburg, R.W.; Hayek, M.; Hu, J.; Ivanov, E.I.

    2007-01-01

    The exclusive reaction π - p→ηπ 0 n, η→π + π - π 0 at 18GeV/c has been studied with a partial wave analysis on a sample of 23 492 ηπ 0 n events from BNL experiment E852. A mass-dependent fit is consistent with a resonant hypothesis for the P + wave, thus providing evidence for a neutral exotic meson with J PC =1 -+ , a mass of 1257±20±25MeV/c 2 , and a width of 354±64±60MeV/c 2 . New interpretations of the meson exotics in neutral ηπ 0 system observed in E852 and Crystal Barrel experiments are discussed

  9. In-medium meson properties and screening correlators

    International Nuclear Information System (INIS)

    Bazavov, A; Karsch, F; Mukherjee, Swagato; Petreczky, P; Maezawa, Y

    2014-01-01

    We study spatial meson correlation functions consisting of strange quarks, strange and charm quarks and charm quarks in (2 + 1)-flavor QCD using the highly improved staggered quark action. We find that the in-medium modification of the meson correlators decreases with increasing charm quark content and decreasing size. In particular, we find strong in-medium modification of φ and D s meson correlators around the chiral transition temperature T c , while J/ψ and η c correlators show strong in-medium modification only at temperatures of 1.4T c .

  10. Asymptotics of Heavy-Meson Form Factors

    CERN Document Server

    Grozin, A.G.; Grozin, Andrey G.; Neubert, Matthias

    1997-01-01

    Using methods developed for hard exclusive QCD processes, we calculate the asymptotic behaviour of heavy-meson form factors at large recoil. It is determined by the leading- and subleading-twist meson wave functions. For $1\\ll |v\\cdot v'|\\ll m_Q/\\Lambda$, the form factors are dominated by the Isgur--Wise function, which is determined by the interference between the wave functions of leading and subleading twist. At $|v\\cdot v'|\\gg m_Q/\\Lambda$, they are dominated by two functions arising at order $1/m_Q$ in the heavy-quark expansion, which are determined by the leading-twist wave function alone. The sum of these contributions describes the form factors in the whole region $|v\\cdot v'|\\gg 1$. As a consequence, there is an exact zero in the form factor for the scattering of longitudinally polarized $B^*$ mesons at some value $v\\cdot v'\\sim m_b/\\Lambda$, and an approximate zero in the form factor of $B$ mesons in the timelike region ($v\\cdot v'\\sim -m_b/\\Lambda$). We obtain the evolution equations and sum rules ...

  11. MesonNet Workshop on Meson Transition Form Factors

    CERN Document Server

    Eidelman, S; Hanhart, C; Kubis, B; Kupsc, A; Leupold, S; Moskal, P; Schadmand, S

    2012-01-01

    The mini-proceedings of the Workshop on Meson Transition Form Factors held in Cracow from May 29th to 30th, 2012 introduce the meson transition form factor project with special emphasis on the interrelations between the various form factors (on-shell, single off-shell, double off-shell). Short summaries of the talks presented at the workshop follow.

  12. B-meson anomalies and Higgs physics in flavored U(1)' model

    Science.gov (United States)

    Bian, Ligong; Lee, Hyun Min; Park, Chan Beom

    2018-04-01

    We consider a simple extension of the Standard Model with flavor-dependent U(1)', that has been proposed to explain some of B-meson anomalies recently reported at LHCb. The U(1)' charge is chosen as a linear combination of anomaly-free B_3-L_3 and L_μ -L_τ . In this model, the flavor structure in the SM is restricted due to flavor-dependent U(1)' charges, in particular, quark mixings are induced by a small vacuum expectation value of the extra Higgs doublet. As a result, it is natural to get sizable flavor-violating Yukawa couplings of heavy Higgs bosons involving the bottom quark. In this article, we focus on the phenomenology of the Higgs sector of the model including extra Higgs doublet and singlet scalars. We impose various bounds on the extended Higgs sector from Higgs and electroweak precision data, B-meson mixings and decays as well as unitarity and stability bounds, then discuss the productions and decays of heavy Higgs bosons at the LHC.

  13. Is a charmed axial-vector meson already found

    International Nuclear Information System (INIS)

    Matsuda, S.

    1976-12-01

    A calculation is presented of the production rate via e + e - annihilation for a charmed p-wave meson of Jsup(P) = 1 + , based on a non-relativistic quark model of charmed hadrons. The results strongly suggest that the charmed axial-vector meson should be found copiously in association with a ground-state charmed meson. (author)

  14. The continuing saga of the /sup 1/P/sub 1/ (q-barq) mesonic states

    International Nuclear Information System (INIS)

    Dalitz, R.H.; Tuan, S.F.

    1986-01-01

    The mesonic states predicted by the quark model to have the structure (q-barq) do not allow all combinations possible for the quantum numbers (JPC). The happy situation for the /sup 3/P/sub J/ states does not hold for the /sup 1/P/sub 1/ state. The experimenter is therefore faced by a double difficulty, the difficulty of forming the /sup 1/P/sub 1/ through the channels available to him and the difficulty of detecting the /sup 1/P/sub 1/ state when it is formed. The difficulty about the detection and study of /sup 1/P/sub 1/ states is not intrinsic but circumstantial. It is not intrinsic because the B-meson is readily produced and studied, the same being true for Q/sub B/, although this has been a more confused situation because of the mixing between the Q/sub A/ and Q/sub B/ states. Porter has devoted considerable attention to the search for the /sup 1/P/sub 1/ (c-barc) state and the authors outline that discussion in this paper. They also describe the formation of the state Psi' (3685), since this has a large cross section in e/sup +/e/sup -/ annihilation, and to look for the /sup 1/P/sub 1/ state as a product among its decay modes

  15. Molecular components in P-wave charmed-strange mesons

    CERN Document Server

    Ortega, Pablo G.

    2016-10-26

    Results obtained by various experiments show that the $D_{s0}^{\\ast}(2317)$ and $D_{s1}(2460)$ mesons are very narrow states located below the $DK$ and $D^{\\ast}K$ thresholds, respectively. This is markedly in contrast with the expectations of naive quark models and heavy quark symmetry. Motivated by a recent lattice study which addresses the mass shifts of the $c\\bar{s}$ ground states with quantum numbers $J^{P}=0^{+}$ ($D_{s0}^{\\ast}(2317)$) and $J^{P}=1^{+}$ ($D_{s1}(2460)$) due to their coupling with $S$-wave $D^{(\\ast)}K$ thresholds, we perform a similar analysis within a nonrelativistic constituent quark model in which quark-antiquark and meson-meson degrees of freedom are incorporated. The quark model has been applied to a wide range of hadronic observables and thus the model parameters are completely constrained. The coupling between quark-antiquark and meson-meson Fock components is done using a modified version of the $^{3}P_{0}$ decay model. We observe that the coupling of the $0^{+}$ $(1^{+})$ mes...

  16. Experimental evidence for hadroproduction of exotic mesons

    International Nuclear Information System (INIS)

    G. S. Adams; T. Adams; Z. Bar-Yam; J. M. Bishop; V. A. Bodyagin; B. B. Brabson; D. S. Brown; N. M. Cason; S. U. Chung; R. R. Crittenden; J. P. Cummings; K. Danyo; S. Denisov; V. Dorofeev; J. P. Dowd; A. R. Dzierba; P. Eugenio; J. Gunter; R. W. Hackenburg; M. Hayek; E. I. Ivanov; I. Kachaev; W. Kern; E. King; O. L. Kodolova; V. L. Korotkikh; M. A. Kostin; J. Kuhn; R. Lindenbusch; V. Lipaev; J. M. LoSecco; J. J. Manak; J. Napolitano; M. Nozar; C. Olchanski; A. I. Ostrovidov; T. K. Pedlar; A. Popov; D. R. Rust; D. Ryabchikov; A. H. Sanjari; L. I. Sarycheva; E. Scott; K. K. Seth; N. Shenhav; W. D. Shephard; N. B. Sinev; J. A. Smith; P. T. Smith; D. L. Stienike; T. Sulanke; S. A. Taegar; S. Teige; D. R. Thompson; I. N. Vardanyan; D. P. Weygand; D. White; H. J. Willutzki; J. Wise; M. Witkowski; A. A. Yershov; D. Zhao

    2001-01-01

    New measurements of peripheral meson production are presented. The data confirm the existence of exotic mesons at 1.4 and 1.6 GeV/c2. The latter state dominates the eta'pi- decay spectrum. The data on eta pi+pi-pi- decay show large strength in several exotic (Jpc = 1- +) waves as well

  17. Measurement of the relative prompt production rate of $\\chi_{c2}$ and $\\chi_{c1}$ in pp collisions at $\\sqrt{s}$ = 7 TeV

    CERN Document Server

    Chatrchyan, Serguei; Sirunyan, Albert M; Tumasyan, Armen; Adam, Wolfgang; Aguilo, Ernest; Bergauer, Thomas; Dragicevic, Marko; Erö, Janos; Fabjan, Christian; Friedl, Markus; Fruehwirth, Rudolf; Ghete, Vasile Mihai; Hammer, Josef; Hörmann, Natascha; Hrubec, Josef; Jeitler, Manfred; Kiesenhofer, Wolfgang; Knünz, Valentin; Krammer, Manfred; Krätschmer, Ilse; Liko, Dietrich; Mikulec, Ivan; Pernicka, Manfred; Rahbaran, Babak; Rohringer, Christine; Rohringer, Herbert; Schöfbeck, Robert; Strauss, Josef; Taurok, Anton; Waltenberger, Wolfgang; Walzel, Gerhard; Widl, Edmund; Wulz, Claudia-Elisabeth; Mossolov, Vladimir; Shumeiko, Nikolai; Suarez Gonzalez, Juan; Bansal, Monika; Bansal, Sunil; Cornelis, Tom; De Wolf, Eddi A; Janssen, Xavier; Luyckx, Sten; Mucibello, Luca; Ochesanu, Silvia; Roland, Benoit; Rougny, Romain; Selvaggi, Michele; Staykova, Zlatka; Van Haevermaet, Hans; Van Mechelen, Pierre; Van Remortel, Nick; Van Spilbeeck, Alex; Blekman, Freya; Blyweert, Stijn; D'Hondt, Jorgen; Gonzalez Suarez, Rebeca; Kalogeropoulos, Alexis; Maes, Michael; Olbrechts, Annik; Van Doninck, Walter; Van Mulders, Petra; Van Onsem, Gerrit Patrick; Villella, Ilaria; Clerbaux, Barbara; De Lentdecker, Gilles; Dero, Vincent; Gay, Arnaud; Hreus, Tomas; Léonard, Alexandre; Marage, Pierre Edouard; Mohammadi, Abdollah; Reis, Thomas; Thomas, Laurent; Vander Marcken, Gil; Vander Velde, Catherine; Vanlaer, Pascal; Wang, Jian; Adler, Volker; Beernaert, Kelly; Cimmino, Anna; Costantini, Silvia; Garcia, Guillaume; Grunewald, Martin; Klein, Benjamin; Lellouch, Jérémie; Marinov, Andrey; Mccartin, Joseph; Ocampo Rios, Alberto Andres; Ryckbosch, Dirk; Strobbe, Nadja; Thyssen, Filip; Tytgat, Michael; Verwilligen, Piet; Walsh, Sinead; Yazgan, Efe; Zaganidis, Nicolas; Basegmez, Suzan; Bruno, Giacomo; Castello, Roberto; Ceard, Ludivine; Delaere, Christophe; Du Pree, Tristan; Favart, Denis; Forthomme, Laurent; Giammanco, Andrea; Hollar, Jonathan; Lemaitre, Vincent; Liao, Junhui; Militaru, Otilia; Nuttens, Claude; Pagano, Davide; Pin, Arnaud; Piotrzkowski, Krzysztof; Schul, Nicolas; Vizan Garcia, Jesus Manuel; Beliy, Nikita; Caebergs, Thierry; Daubie, Evelyne; Hammad, Gregory Habib; Alves, Gilvan; Correa Martins Junior, Marcos; De Jesus Damiao, Dilson; Martins, Thiago; Pol, Maria Elena; Henrique Gomes E Souza, Moacyr; Aldá Júnior, Walter Luiz; Carvalho, Wagner; Custódio, Analu; Melo Da Costa, Eliza; De Oliveira Martins, Carley; Fonseca De Souza, Sandro; Matos Figueiredo, Diego; Mundim, Luiz; Nogima, Helio; Oguri, Vitor; Prado Da Silva, Wanda Lucia; Santoro, Alberto; Soares Jorge, Luana; Sznajder, Andre; Souza Dos Anjos, Tiago; Bernardes, Cesar Augusto; De Almeida Dias, Flavia; Tomei, Thiago; De Moraes Gregores, Eduardo; Lagana, Caio; Da Cunha Marinho, Franciole; Mercadante, Pedro G; Novaes, Sergio F; Padula, Sandra; Genchev, Vladimir; Iaydjiev, Plamen; Piperov, Stefan; Rodozov, Mircho; Stoykova, Stefka; Sultanov, Georgi; Tcholakov, Vanio; Trayanov, Rumen; Vutova, Mariana; Dimitrov, Anton; Hadjiiska, Roumyana; Kozhuharov, Venelin; Litov, Leander; Pavlov, Borislav; Petkov, Peicho; Bian, Jian-Guo; Chen, Guo-Ming; Chen, He-Sheng; Jiang, Chun-Hua; Liang, Dong; Liang, Song; Meng, Xiangwei; Tao, Junquan; Wang, Jian; Wang, Xianyou; Wang, Zheng; Xiao, Hong; Xu, Ming; Zang, Jingjing; Zhang, Zhen; Asawatangtrakuldee, Chayanit; Ban, Yong; Guo, Yifei; Li, Wenbo; Liu, Shuai; Mao, Yajun; Qian, Si-Jin; Teng, Haiyun; Wang, Dayong; Zhang, Linlin; Zou, Wei; Avila, Carlos; Gomez, Juan Pablo; Gomez Moreno, Bernardo; Osorio Oliveros, Andres Felipe; Sanabria, Juan Carlos; Godinovic, Nikola; Lelas, Damir; Plestina, Roko; Polic, Dunja; Puljak, Ivica; Antunovic, Zeljko; Kovac, Marko; Brigljevic, Vuko; Duric, Senka; Kadija, Kreso; Luetic, Jelena; Morovic, Srecko; Attikis, Alexandros; Galanti, Mario; Mavromanolakis, Georgios; Mousa, Jehad; Nicolaou, Charalambos; Ptochos, Fotios; Razis, Panos A; Finger, Miroslav; Finger Jr, Michael; Assran, Yasser; Elgammal, Sherif; Ellithi Kamel, Ali; Khalil, Shaaban; Mahmoud, Mohammed; Radi, Amr; Kadastik, Mario; Müntel, Mait; Raidal, Martti; Rebane, Liis; Tiko, Andres; Eerola, Paula; Fedi, Giacomo; Voutilainen, Mikko; Härkönen, Jaakko; Heikkinen, Mika Aatos; Karimäki, Veikko; Kinnunen, Ritva; Kortelainen, Matti J; Lampén, Tapio; Lassila-Perini, Kati; Lehti, Sami; Lindén, Tomas; Luukka, Panja-Riina; Mäenpää, Teppo; Peltola, Timo; Tuominen, Eija; Tuominiemi, Jorma; Tuovinen, Esa; Ungaro, Donatella; Wendland, Lauri; Banzuzi, Kukka; Karjalainen, Ahti; Korpela, Arja; Tuuva, Tuure; Besancon, Marc; Choudhury, Somnath; Dejardin, Marc; Denegri, Daniel; Fabbro, Bernard; Faure, Jean-Louis; Ferri, Federico; Ganjour, Serguei; Givernaud, Alain; Gras, Philippe; Hamel de Monchenault, Gautier; Jarry, Patrick; Locci, Elizabeth; Malcles, Julie; Millischer, Laurent; Nayak, Aruna; Rander, John; Rosowsky, André; Shreyber, Irina; Titov, Maksym; Baffioni, Stephanie; Beaudette, Florian; Benhabib, Lamia; Bianchini, Lorenzo; Bluj, Michal; Broutin, Clementine; Busson, Philippe; Charlot, Claude; Daci, Nadir; Dahms, Torsten; Dobrzynski, Ludwik; Granier de Cassagnac, Raphael; Haguenauer, Maurice; Miné, Philippe; Mironov, Camelia; Naranjo, Ivo Nicolas; Nguyen, Matthew; Ochando, Christophe; Paganini, Pascal; Sabes, David; Salerno, Roberto; Sirois, Yves; Veelken, Christian; Zabi, Alexandre; Agram, Jean-Laurent; Andrea, Jeremy; Bloch, Daniel; Bodin, David; Brom, Jean-Marie; Cardaci, Marco; Chabert, Eric Christian; Collard, Caroline; Conte, Eric; Drouhin, Frédéric; Ferro, Cristina; Fontaine, Jean-Charles; Gelé, Denis; Goerlach, Ulrich; Juillot, Pierre; Le Bihan, Anne-Catherine; Van Hove, Pierre; Fassi, Farida; Mercier, Damien; Beauceron, Stephanie; Beaupere, Nicolas; Bondu, Olivier; Boudoul, Gaelle; Chasserat, Julien; Chierici, Roberto; Contardo, Didier; Depasse, Pierre; El Mamouni, Houmani; Fay, Jean; Gascon, Susan; Gouzevitch, Maxime; Ille, Bernard; Kurca, Tibor; Lethuillier, Morgan; Mirabito, Laurent; Perries, Stephane; Sordini, Viola; Tschudi, Yohann; Verdier, Patrice; Viret, Sébastien; Tsamalaidze, Zviad; Anagnostou, Georgios; Autermann, Christian; Beranek, Sarah; Edelhoff, Matthias; Feld, Lutz; Heracleous, Natalie; Hindrichs, Otto; Jussen, Ruediger; Klein, Katja; Merz, Jennifer; Ostapchuk, Andrey; Perieanu, Adrian; Raupach, Frank; Sammet, Jan; Schael, Stefan; Sprenger, Daniel; Weber, Hendrik; Wittmer, Bruno; Zhukov, Valery; Ata, Metin; Caudron, Julien; Dietz-Laursonn, Erik; Duchardt, Deborah; Erdmann, Martin; Fischer, Robert; Güth, Andreas; Hebbeker, Thomas; Heidemann, Carsten; Hoepfner, Kerstin; Klingebiel, Dennis; Kreuzer, Peter; Magass, Carsten; Merschmeyer, Markus; Meyer, Arnd; Olschewski, Mark; Papacz, Paul; Pieta, Holger; Reithler, Hans; Schmitz, Stefan Antonius; Sonnenschein, Lars; Steggemann, Jan; Teyssier, Daniel; Weber, Martin; Bontenackels, Michael; Cherepanov, Vladimir; Erdogan, Yusuf; Flügge, Günter; Geenen, Heiko; Geisler, Matthias; Haj Ahmad, Wael; Hoehle, Felix; Kargoll, Bastian; Kress, Thomas; Kuessel, Yvonne; Nowack, Andreas; Perchalla, Lars; Pooth, Oliver; Sauerland, Philip; Stahl, Achim; Aldaya Martin, Maria; Behr, Joerg; Behrenhoff, Wolf; Behrens, Ulf; Bergholz, Matthias; Bethani, Agni; Borras, Kerstin; Burgmeier, Armin; Cakir, Altan; Calligaris, Luigi; Campbell, Alan; Castro, Elena; Costanza, Francesco; Dammann, Dirk; Diez Pardos, Carmen; Eckerlin, Guenter; Eckstein, Doris; Flucke, Gero; Geiser, Achim; Glushkov, Ivan; Gunnellini, Paolo; Habib, Shiraz; Hauk, Johannes; Hellwig, Gregor; Jung, Hannes; Kasemann, Matthias; Katsas, Panagiotis; Kleinwort, Claus; Kluge, Hannelies; Knutsson, Albert; Krämer, Mira; Krücker, Dirk; Kuznetsova, Ekaterina; Lange, Wolfgang; Lohmann, Wolfgang; Lutz, Benjamin; Mankel, Rainer; Marfin, Ihar; Marienfeld, Markus; Melzer-Pellmann, Isabell-Alissandra; Meyer, Andreas Bernhard; Mnich, Joachim; Mussgiller, Andreas; Naumann-Emme, Sebastian; Olzem, Jan; Perrey, Hanno; Petrukhin, Alexey; Pitzl, Daniel; Raspereza, Alexei; Ribeiro Cipriano, Pedro M; Riedl, Caroline; Ron, Elias; Rosin, Michele; Salfeld-Nebgen, Jakob; Schmidt, Ringo; Schoerner-Sadenius, Thomas; Sen, Niladri; Spiridonov, Alexander; Stein, Matthias; Walsh, Roberval; Wissing, Christoph; Blobel, Volker; Draeger, Jula; Enderle, Holger; Erfle, Joachim; Gebbert, Ulla; Görner, Martin; Hermanns, Thomas; Höing, Rebekka Sophie; Kaschube, Kolja; Kaussen, Gordon; Kirschenmann, Henning; Klanner, Robert; Lange, Jörn; Mura, Benedikt; Nowak, Friederike; Peiffer, Thomas; Pietsch, Niklas; Rathjens, Denis; Sander, Christian; Schettler, Hannes; Schleper, Peter; Schlieckau, Eike; Schmidt, Alexander; Schröder, Matthias; Schum, Torben; Seidel, Markus; Sola, Valentina; Stadie, Hartmut; Steinbrück, Georg; Thomsen, Jan; Vanelderen, Lukas; Barth, Christian; Berger, Joram; Böser, Christian; Chwalek, Thorsten; De Boer, Wim; Descroix, Alexis; Dierlamm, Alexander; Feindt, Michael; Guthoff, Moritz; Hackstein, Christoph; Hartmann, Frank; Hauth, Thomas; Heinrich, Michael; Held, Hauke; Hoffmann, Karl-Heinz; Honc, Simon; Katkov, Igor; Komaragiri, Jyothsna Rani; Lobelle Pardo, Patricia; Martschei, Daniel; Mueller, Steffen; Müller, Thomas; Niegel, Martin; Nürnberg, Andreas; Oberst, Oliver; Oehler, Andreas; Ott, Jochen; Quast, Gunter; Rabbertz, Klaus; Ratnikov, Fedor; Ratnikova, Natalia; Röcker, Steffen; Scheurer, Armin; Schilling, Frank-Peter; Schott, Gregory; Simonis, Hans-Jürgen; Stober, Fred-Markus Helmut; Troendle, Daniel; Ulrich, Ralf; Wagner-Kuhr, Jeannine; Wayand, Stefan; Weiler, Thomas; Zeise, Manuel; Daskalakis, Georgios; Geralis, Theodoros; Kesisoglou, Stilianos; Kyriakis, Aristotelis; Loukas, Demetrios; Manolakos, Ioannis; Markou, Athanasios; Markou, Christos; Mavrommatis, Charalampos; Ntomari, Eleni; Gouskos, Loukas; Mertzimekis, Theodoros; Panagiotou, Apostolos; Saoulidou, Niki; Evangelou, Ioannis; Foudas, Costas; Kokkas, Panagiotis; Manthos, Nikolaos; Papadopoulos, Ioannis; Patras, Vaios; Bencze, Gyorgy; Hajdu, Csaba; Hidas, Pàl; Horvath, Dezso; Sikler, Ferenc; Veszpremi, Viktor; Vesztergombi, Gyorgy; Beni, Noemi; Czellar, Sandor; Molnar, Jozsef; Palinkas, Jozsef; Szillasi, Zoltan; Karancsi, János; Raics, Peter; Trocsanyi, Zoltan Laszlo; Ujvari, Balazs; Beri, Suman Bala; Bhatnagar, Vipin; Dhingra, Nitish; Gupta, Ruchi; Kaur, Manjit; Mehta, Manuk Zubin; Nishu, Nishu; Saini, Lovedeep Kaur; Sharma, Archana; Singh, Jasbir; Kumar, Ashok; Kumar, Arun; Ahuja, Sudha; Bhardwaj, Ashutosh; Choudhary, Brajesh C; Malhotra, Shivali; Naimuddin, Md; Ranjan, Kirti; Sharma, Varun; Shivpuri, Ram Krishen; Banerjee, Sunanda; Bhattacharya, Satyaki; Dutta, Suchandra; Gomber, Bhawna; Jain, Sandhya; Jain, Shilpi; Khurana, Raman; Sarkar, Subir; Sharan, Manoj; Abdulsalam, Abdulla; Choudhury, Rajani Kant; Dutta, Dipanwita; Kailas, Swaminathan; Kumar, Vineet; Mehta, Pourus; Mohanty, Ajit Kumar; Pant, Lalit Mohan; Shukla, Prashant; Aziz, Tariq; Ganguly, Sanmay; Guchait, Monoranjan; Maity, Manas; Majumder, Gobinda; Mazumdar, Kajari; Mohanty, Gagan Bihari; Parida, Bibhuti; Sudhakar, Katta; Wickramage, Nadeesha; Banerjee, Sudeshna; Dugad, Shashikant; Arfaei, Hessamaddin; Bakhshiansohi, Hamed; Etesami, Seyed Mohsen; Fahim, Ali; Hashemi, Majid; Hesari, Hoda; Jafari, Abideh; Khakzad, Mohsen; Mohammadi Najafabadi, Mojtaba; Paktinat Mehdiabadi, Saeid; Safarzadeh, Batool; Zeinali, Maryam; Abbrescia, Marcello; Barbone, Lucia; Calabria, Cesare; Chhibra, Simranjit Singh; Colaleo, Anna; Creanza, Donato; De Filippis, Nicola; De Palma, Mauro; Fiore, Luigi; Iaselli, Giuseppe; Lusito, Letizia; Maggi, Giorgio; Maggi, Marcello; Marangelli, Bartolomeo; My, Salvatore; Nuzzo, Salvatore; Pacifico, Nicola; Pompili, Alexis; Pugliese, Gabriella; Selvaggi, Giovanna; Silvestris, Lucia; Singh, Gurpreet; Venditti, Rosamaria; Zito, Giuseppe; Abbiendi, Giovanni; Benvenuti, Alberto; Bonacorsi, Daniele; Braibant-Giacomelli, Sylvie; Brigliadori, Luca; Capiluppi, Paolo; Castro, Andrea; Cavallo, Francesca Romana; Cuffiani, Marco; Dallavalle, Gaetano-Marco; Fabbri, Fabrizio; Fanfani, Alessandra; Fasanella, Daniele; Giacomelli, Paolo; Grandi, Claudio; Guiducci, Luigi; Marcellini, Stefano; Masetti, Gianni; Meneghelli, Marco; Montanari, Alessandro; Navarria, Francesco; Odorici, Fabrizio; Perrotta, Andrea; Primavera, Federica; Rossi, Antonio; Rovelli, Tiziano; Siroli, Gian Piero; Travaglini, Riccardo; Albergo, Sebastiano; Cappello, Gigi; Chiorboli, Massimiliano; Costa, Salvatore; Potenza, Renato; Tricomi, Alessia; Tuve, Cristina; Barbagli, Giuseppe; Ciulli, Vitaliano; Civinini, Carlo; D'Alessandro, Raffaello; Focardi, Ettore; Frosali, Simone; Gallo, Elisabetta; Gonzi, Sandro; Meschini, Marco; Paoletti, Simone; Sguazzoni, Giacomo; Tropiano, Antonio; Benussi, Luigi; Bianco, Stefano; Colafranceschi, Stefano; Fabbri, Franco; Piccolo, Davide; Fabbricatore, Pasquale; Musenich, Riccardo; Tosi, Silvano; Benaglia, Andrea; De Guio, Federico; Di Matteo, Leonardo; Fiorendi, Sara; Gennai, Simone; Ghezzi, Alessio; Malvezzi, Sandra; Manzoni, Riccardo Andrea; Martelli, Arabella; Massironi, Andrea; Menasce, Dario; Moroni, Luigi; Paganoni, Marco; Pedrini, Daniele; Ragazzi, Stefano; Redaelli, Nicola; Sala, Silvano; Tabarelli de Fatis, Tommaso; Buontempo, Salvatore; Carrillo Montoya, Camilo Andres; Cavallo, Nicola; De Cosa, Annapaola; Dogangun, Oktay; Fabozzi, Francesco; Iorio, Alberto Orso Maria; Lista, Luca; Meola, Sabino; Merola, Mario; Paolucci, Pierluigi; Azzi, Patrizia; Bacchetta, Nicola; Bisello, Dario; Branca, Antonio; Carlin, Roberto; Checchia, Paolo; Dorigo, Tommaso; Gasparini, Fabrizio; Gasparini, Ugo; Gozzelino, Andrea; Kanishchev, Konstantin; Lacaprara, Stefano; Lazzizzera, Ignazio; Margoni, Martino; Meneguzzo, Anna Teresa; Pazzini, Jacopo; Pozzobon, Nicola; Ronchese, Paolo; Simonetto, Franco; Torassa, Ezio; Tosi, Mia; Vanini, Sara; Zotto, Pierluigi; Zucchetta, Alberto; Zumerle, Gianni; Gabusi, Michele; Ratti, Sergio P; Riccardi, Cristina; Torre, Paola; Vitulo, Paolo; Biasini, Maurizio; Bilei, Gian Mario; Fanò, Livio; Lariccia, Paolo; Lucaroni, Andrea; Mantovani, Giancarlo; Menichelli, Mauro; Nappi, Aniello; Romeo, Francesco; Saha, Anirban; Santocchia, Attilio; Spiezia, Aniello; Taroni, Silvia; Azzurri, Paolo; Bagliesi, Giuseppe; Boccali, Tommaso; Broccolo, Giuseppe; Castaldi, Rino; D'Agnolo, Raffaele Tito; Dell'Orso, Roberto; Fiori, Francesco; Foà, Lorenzo; Giassi, Alessandro; Kraan, Aafke; Ligabue, Franco; Lomtadze, Teimuraz; Martini, Luca; Messineo, Alberto; Palla, Fabrizio; Rizzi, Andrea; Serban, Alin Titus; Spagnolo, Paolo; Squillacioti, Paola; Tenchini, Roberto; Tonelli, Guido; Venturi, Andrea; Verdini, Piero Giorgio; Barone, Luciano; Cavallari, Francesca; Del Re, Daniele; Diemoz, Marcella; Fanelli, Cristiano; Grassi, Marco; Longo, Egidio; Meridiani, Paolo; Micheli, Francesco; Nourbakhsh, Shervin; Organtini, Giovanni; Paramatti, Riccardo; Rahatlou, Shahram; Sigamani, Michael; Soffi, Livia; Amapane, Nicola; Arcidiacono, Roberta; Argiro, Stefano; Arneodo, Michele; Biino, Cristina; Cartiglia, Nicolo; Costa, Marco; Demaria, Natale; Mariotti, Chiara; Maselli, Silvia; Migliore, Ernesto; Monaco, Vincenzo; Musich, Marco; Obertino, Maria Margherita; Pastrone, Nadia; Pelliccioni, Mario; Potenza, Alberto; Romero, Alessandra; Sacchi, Roberto; Solano, Ada; Staiano, Amedeo; Usai, Emanuele; Vilela Pereira, Antonio; Belforte, Stefano; Candelise, Vieri; Cossutti, Fabio; Della Ricca, Giuseppe; Gobbo, Benigno; Marone, Matteo; Montanino, Damiana; Penzo, Aldo; Schizzi, Andrea; Heo, Seong Gu; Kim, Tae Yeon; Nam, Soon-Kwon; Chang, Sunghyun; Kim, Dong Hee; Kim, Gui Nyun; Kong, Dae Jung; Park, Hyangkyu; Ro, Sang-Ryul; Son, Dong-Chul; Son, Taejin; Kim, Jae Yool; Kim, Zero Jaeho; Song, Sanghyeon; Choi, Suyong; Gyun, Dooyeon; Hong, Byung-Sik; Jo, Mihee; Kim, Hyunchul; Kim, Tae Jeong; Lee, Kyong Sei; Moon, Dong Ho; Park, Sung Keun; Choi, Minkyoo; Kim, Ji Hyun; Park, Chawon; Park, Inkyu; Park, Sangnam; Ryu, Geonmo; Cho, Yongjin; Choi, Young-Il; Choi, Young Kyu; Goh, Junghwan; Kim, Min Suk; Kwon, Eunhyang; Lee, Byounghoon; Lee, Jongseok; Lee, Sungeun; Seo, Hyunkwan; Yu, Intae; Bilinskas, Mykolas Jurgis; Grigelionis, Ignas; Janulis, Mindaugas; Juodagalvis, Andrius; Castilla-Valdez, Heriberto; De La Cruz-Burelo, Eduard; Heredia-de La Cruz, Ivan; Lopez-Fernandez, Ricardo; Magaña Villalba, Ricardo; Martínez-Ortega, Jorge; Sánchez-Hernández, Alberto; Villasenor-Cendejas, Luis Manuel; Carrillo Moreno, Salvador; Vazquez Valencia, Fabiola; Salazar Ibarguen, Humberto Antonio; Casimiro Linares, Edgar; Morelos Pineda, Antonio; Reyes-Santos, Marco A; Krofcheck, David; Bell, Alan James; Butler, Philip H; Doesburg, Robert; Reucroft, Steve; Silverwood, Hamish; Ahmad, Muhammad; Ansari, Muhammad Hamid; Asghar, Muhammad Irfan; Hoorani, Hafeez R; Khalid, Shoaib; Khan, Wajid Ali; Khurshid, Taimoor; Qazi, Shamona; Shah, Mehar Ali; Shoaib, Muhammad; Bialkowska, Helena; Boimska, Bozena; Frueboes, Tomasz; Gokieli, Ryszard; Górski, Maciej; Kazana, Malgorzata; Nawrocki, Krzysztof; Romanowska-Rybinska, Katarzyna; Szleper, Michal; Wrochna, Grzegorz; Zalewski, Piotr; Brona, Grzegorz; Bunkowski, Karol; Cwiok, Mikolaj; Dominik, Wojciech; Doroba, Krzysztof; Kalinowski, Artur; Konecki, Marcin; Krolikowski, Jan; Almeida, Nuno; Bargassa, Pedrame; David Tinoco Mendes, Andre; Faccioli, Pietro; Ferreira Parracho, Pedro Guilherme; Gallinaro, Michele; Seixas, Joao; Varela, Joao; Vischia, Pietro; Belotelov, Ivan; Bunin, Pavel; Gavrilenko, Mikhail; Golutvin, Igor; Gorbunov, Ilya; Kamenev, Alexey; Karjavin, Vladimir; Kozlov, Guennady; Lanev, Alexander; Malakhov, Alexander; Moisenz, Petr; Palichik, Vladimir; Perelygin, Victor; Shmatov, Sergey; Smirnov, Vitaly; Volodko, Anton; Zarubin, Anatoli; Evstyukhin, Sergey; Golovtsov, Victor; Ivanov, Yury; Kim, Victor; Levchenko, Petr; Murzin, Victor; Oreshkin, Vadim; Smirnov, Igor; Sulimov, Valentin; Uvarov, Lev; Vavilov, Sergey; Vorobyev, Alexey; Vorobyev, Andrey; Andreev, Yuri; Dermenev, Alexander; Gninenko, Sergei; Golubev, Nikolai; Kirsanov, Mikhail; Krasnikov, Nikolai; Matveev, Viktor; Pashenkov, Anatoli; Tlisov, Danila; Toropin, Alexander; Epshteyn, Vladimir; Erofeeva, Maria; Gavrilov, Vladimir; Kossov, Mikhail; Lychkovskaya, Natalia; Popov, Vladimir; Safronov, Grigory; Semenov, Sergey; Stolin, Viatcheslav; Vlasov, Evgueni; Zhokin, Alexander; Belyaev, Andrey; Boos, Edouard; Dubinin, Mikhail; Dudko, Lev; Ershov, Alexander; Gribushin, Andrey; Klyukhin, Vyacheslav; Kodolova, Olga; Lokhtin, Igor; Markina, Anastasia; Obraztsov, Stepan; Perfilov, Maxim; Petrushanko, Sergey; Popov, Andrey; Sarycheva, Ludmila; Savrin, Viktor; Snigirev, Alexander; Andreev, Vladimir; Azarkin, Maksim; Dremin, Igor; Kirakosyan, Martin; Leonidov, Andrey; Mesyats, Gennady; Rusakov, Sergey V; Vinogradov, Alexey; Azhgirey, Igor; Bayshev, Igor; Bitioukov, Sergei; Grishin, Viatcheslav; Kachanov, Vassili; Konstantinov, Dmitri; Krychkine, Victor; Petrov, Vladimir; Ryutin, Roman; Sobol, Andrei; Tourtchanovitch, Leonid; Troshin, Sergey; Tyurin, Nikolay; Uzunian, Andrey; Volkov, Alexey; Adzic, Petar; Djordjevic, Milos; Ekmedzic, Marko; Krpic, Dragomir; Milosevic, Jovan; Aguilar-Benitez, Manuel; Alcaraz Maestre, Juan; Arce, Pedro; Battilana, Carlo; Calvo, Enrique; Cerrada, Marcos; Chamizo Llatas, Maria; Colino, Nicanor; De La Cruz, Begona; Delgado Peris, Antonio; Domínguez Vázquez, Daniel; Fernandez Bedoya, Cristina; Fernández Ramos, Juan Pablo; Ferrando, Antonio; Flix, Jose; Fouz, Maria Cruz; Garcia-Abia, Pablo; Gonzalez Lopez, Oscar; Goy Lopez, Silvia; Hernandez, Jose M; Josa, Maria Isabel; Merino, Gonzalo; Puerta Pelayo, Jesus; Quintario Olmeda, Adrián; Redondo, Ignacio; Romero, Luciano; Santaolalla, Javier; Senghi Soares, Mara; Willmott, Carlos; Albajar, Carmen; Codispoti, Giuseppe; de Trocóniz, Jorge F; Brun, Hugues; Cuevas, Javier; Fernandez Menendez, Javier; Folgueras, Santiago; Gonzalez Caballero, Isidro; Lloret Iglesias, Lara; Piedra Gomez, Jonatan; Brochero Cifuentes, Javier Andres; Cabrillo, Iban Jose; Calderon, Alicia; Chuang, Shan-Huei; Duarte Campderros, Jordi; Felcini, Marta; Fernandez, Marcos; Gomez, Gervasio; Gonzalez Sanchez, Javier; Graziano, Alberto; Jorda, Clara; Lopez Virto, Amparo; Marco, Jesus; Marco, Rafael; Martinez Rivero, Celso; Matorras, Francisco; Munoz Sanchez, Francisca Javiela; Rodrigo, Teresa; Rodríguez-Marrero, Ana Yaiza; Ruiz-Jimeno, Alberto; Scodellaro, Luca; Vila, Ivan; Vilar Cortabitarte, Rocio; Abbaneo, Duccio; Auffray, Etiennette; Auzinger, Georg; Bachtis, Michail; Baillon, Paul; Ball, Austin; Barney, David; Benitez, Jose F; Bernet, Colin; Bianchi, Giovanni; Bloch, Philippe; Bocci, Andrea; Bonato, Alessio; Botta, Cristina; Breuker, Horst; Camporesi, Tiziano; Cerminara, Gianluca; Christiansen, Tim; Coarasa Perez, Jose Antonio; D'Enterria, David; Dabrowski, Anne; De Roeck, Albert; Di Guida, Salvatore; Dobson, Marc; Dupont-Sagorin, Niels; Elliott-Peisert, Anna; Frisch, Benjamin; Funk, Wolfgang; Georgiou, Georgios; Giffels, Manuel; Gigi, Dominique; Gill, Karl; Giordano, Domenico; Giunta, Marina; Glege, Frank; Gomez-Reino Garrido, Robert; Govoni, Pietro; Gowdy, Stephen; Guida, Roberto; Hansen, Magnus; Harris, Philip; Hartl, Christian; Harvey, John; Hegner, Benedikt; Hinzmann, Andreas; Innocente, Vincenzo; Janot, Patrick; Kaadze, Ketino; Karavakis, Edward; Kousouris, Konstantinos; Lecoq, Paul; Lee, Yen-Jie; Lenzi, Piergiulio; Lourenco, Carlos; Magini, Nicolo; Maki, Tuula; Malberti, Martina; Malgeri, Luca; Mannelli, Marcello; Masetti, Lorenzo; Meijers, Frans; Mersi, Stefano; Meschi, Emilio; Moser, Roland; Mozer, Matthias Ulrich; Mulders, Martijn; Musella, Pasquale; Nesvold, Erik; Orimoto, Toyoko; Orsini, Luciano; Palencia Cortezon, Enrique; Perez, Emmanuelle; Perrozzi, Luca; Petrilli, Achille; Pfeiffer, Andreas; Pierini, Maurizio; Pimiä, Martti; Piparo, Danilo; Polese, Giovanni; Quertenmont, Loic; Racz, Attila; Reece, William; Rodrigues Antunes, Joao; Rolandi, Gigi; Rovelli, Chiara; Rovere, Marco; Sakulin, Hannes; Santanastasio, Francesco; Schäfer, Christoph; Schwick, Christoph; Segoni, Ilaria; Sekmen, Sezen; Sharma, Archana; Siegrist, Patrice; Silva, Pedro; Simon, Michal; Sphicas, Paraskevas; Spiga, Daniele; Tsirou, Andromachi; Veres, Gabor Istvan; Vlimant, Jean-Roch; Wöhri, Hermine Katharina; Worm, Steven; Zeuner, Wolfram Dietrich; Bertl, Willi; Deiters, Konrad; Erdmann, Wolfram; Gabathuler, Kurt; Horisberger, Roland; Ingram, Quentin; Kaestli, Hans-Christian; König, Stefan; Kotlinski, Danek; Langenegger, Urs; Meier, Frank; Renker, Dieter; Rohe, Tilman; Sibille, Jennifer; Bäni, Lukas; Bortignon, Pierluigi; Buchmann, Marco-Andrea; Casal, Bruno; Chanon, Nicolas; Deisher, Amanda; Dissertori, Günther; Dittmar, Michael; Donegà, Mauro; Dünser, Marc; Eugster, Jürg; Freudenreich, Klaus; Grab, Christoph; Hits, Dmitry; Lecomte, Pierre; Lustermann, Werner; Marini, Andrea Carlo; Martinez Ruiz del Arbol, Pablo; Mohr, Niklas; Moortgat, Filip; Nägeli, Christoph; Nef, Pascal; Nessi-Tedaldi, Francesca; Pandolfi, Francesco; Pape, Luc; Pauss, Felicitas; Peruzzi, Marco; Ronga, Frederic Jean; Rossini, Marco; Sala, Leonardo; Sanchez, Ann - Karin; Starodumov, Andrei; Stieger, Benjamin; Takahashi, Maiko; Tauscher, Ludwig; Thea, Alessandro; Theofilatos, Konstantinos; Treille, Daniel; Urscheler, Christina; Wallny, Rainer; Weber, Hannsjoerg Artur; Wehrli, Lukas; Amsler, Claude; Chiochia, Vincenzo; De Visscher, Simon; Favaro, Carlotta; Ivova Rikova, Mirena; Millan Mejias, Barbara; Otiougova, Polina; Robmann, Peter; Snoek, Hella; Tupputi, Salvatore; Verzetti, Mauro; Chang, Yuan-Hann; Chen, Kuan-Hsin; Kuo, Chia-Ming; Li, Syue-Wei; Lin, Willis; Liu, Zong-Kai; Lu, Yun-Ju; Mekterovic, Darko; Singh, Anil; Volpe, Roberta; Yu, Shin-Shan; Bartalini, Paolo; Chang, Paoti; Chang, You-Hao; Chang, Yu-Wei; Chao, Yuan; Chen, Kai-Feng; Dietz, Charles; Grundler, Ulysses; Hou, George Wei-Shu; Hsiung, Yee; Kao, Kai-Yi; Lei, Yeong-Jyi; Lu, Rong-Shyang; Majumder, Devdatta; Petrakou, Eleni; Shi, Xin; Shiu, Jing-Ge; Tzeng, Yeng-Ming; Wan, Xia; Wang, Minzu; Adiguzel, Aytul; Bakirci, Mustafa Numan; Cerci, Salim; Dozen, Candan; Dumanoglu, Isa; Eskut, Eda; Girgis, Semiray; Gokbulut, Gul; Gurpinar, Emine; Hos, Ilknur; Kangal, Evrim Ersin; Karaman, Turker; Karapinar, Guler; Kayis Topaksu, Aysel; Onengut, Gulsen; Ozdemir, Kadri; Ozturk, Sertac; Polatoz, Ayse; Sogut, Kenan; Sunar Cerci, Deniz; Tali, Bayram; Topakli, Huseyin; Vergili, Latife Nukhet; Vergili, Mehmet; Akin, Ilina Vasileva; Aliev, Takhmasib; Bilin, Bugra; Bilmis, Selcuk; Deniz, Muhammed; Gamsizkan, Halil; Guler, Ali Murat; Ocalan, Kadir; Ozpineci, Altug; Serin, Meltem; Sever, Ramazan; Surat, Ugur Emrah; Yalvac, Metin; Yildirim, Eda; Zeyrek, Mehmet; Gülmez, Erhan; Isildak, Bora; Kaya, Mithat; Kaya, Ozlem; Ozkorucuklu, Suat; Sonmez, Nasuf; Cankocak, Kerem; Levchuk, Leonid; Bostock, Francis; Brooke, James John; Clement, Emyr; Cussans, David; Flacher, Henning; Frazier, Robert; Goldstein, Joel; Grimes, Mark; Heath, Greg P; Heath, Helen F; Kreczko, Lukasz; Metson, Simon; Newbold, Dave M; Nirunpong, Kachanon; Poll, Anthony; Senkin, Sergey; Smith, Vincent J; Williams, Thomas; Basso, Lorenzo; Bell, Ken W; Belyaev, Alexander; Brew, Christopher; Brown, Robert M; Cockerill, David JA; Coughlan, John A; Harder, Kristian; Harper, Sam; Jackson, James; Kennedy, Bruce W; Olaiya, Emmanuel; Petyt, David; Radburn-Smith, Benjamin Charles; Shepherd-Themistocleous, Claire; Tomalin, Ian R; Womersley, William John; Bainbridge, Robert; Ball, Gordon; Beuselinck, Raymond; Buchmuller, Oliver; Colling, David; Cripps, Nicholas; Cutajar, Michael; Dauncey, Paul; Davies, Gavin; Della Negra, Michel; Ferguson, William; Fulcher, Jonathan; Futyan, David; Gilbert, Andrew; Guneratne Bryer, Arlo; Hall, Geoffrey; Hatherell, Zoe; Hays, Jonathan; Iles, Gregory; Jarvis, Martyn; Karapostoli, Georgia; Lyons, Louis; Magnan, Anne-Marie; Marrouche, Jad; Mathias, Bryn; Nandi, Robin; Nash, Jordan; Nikitenko, Alexander; Papageorgiou, Anastasios; Pela, Joao; Pesaresi, Mark; Petridis, Konstantinos; Pioppi, Michele; Raymond, David Mark; Rogerson, Samuel; Rose, Andrew; Ryan, Matthew John; Seez, Christopher; Sharp, Peter; Sparrow, Alex; Stoye, Markus; Tapper, Alexander; Vazquez Acosta, Monica; Virdee, Tejinder; Wakefield, Stuart; Wardle, Nicholas; Whyntie, Tom; Chadwick, Matthew; Cole, Joanne; Hobson, Peter R; Khan, Akram; Kyberd, Paul; Leggat, Duncan; Leslie, Dawn; Martin, William; Reid, Ivan; Symonds, Philip; Teodorescu, Liliana; Turner, Mark; Hatakeyama, Kenichi; Liu, Hongxuan; Scarborough, Tara; Charaf, Otman; Henderson, Conor; Rumerio, Paolo; Avetisyan, Aram; Bose, Tulika; Fantasia, Cory; Heister, Arno; St John, Jason; Lawson, Philip; Lazic, Dragoslav; Rohlf, James; Sperka, David; Sulak, Lawrence; Alimena, Juliette; Bhattacharya, Saptaparna; Cutts, David; Ferapontov, Alexey; Heintz, Ulrich; Jabeen, Shabnam; Kukartsev, Gennadiy; Laird, Edward; Landsberg, Greg; Luk, Michael; Narain, Meenakshi; Nguyen, Duong; Segala, Michael; Sinthuprasith, Tutanon; Speer, Thomas; Tsang, Ka Vang; Breedon, Richard; Breto, Guillermo; Calderon De La Barca Sanchez, Manuel; Chauhan, Sushil; Chertok, Maxwell; Conway, John; Conway, Rylan; Cox, Peter Timothy; Dolen, James; Erbacher, Robin; Gardner, Michael; Houtz, Rachel; Ko, Winston; Kopecky, Alexandra; Lander, Richard; Miceli, Tia; Pellett, Dave; Ricci-Tam, Francesca; Rutherford, Britney; Searle, Matthew; Smith, John; Squires, Michael; Tripathi, Mani; Vasquez Sierra, Ricardo; Andreev, Valeri; Cline, David; Cousins, Robert; Duris, Joseph; Erhan, Samim; Everaerts, Pieter; Farrell, Chris; Hauser, Jay; Ignatenko, Mikhail; Jarvis, Chad; Plager, Charles; Rakness, Gregory; Schlein, Peter; Traczyk, Piotr; Valuev, Vyacheslav; Weber, Matthias; Babb, John; Clare, Robert; Dinardo, Mauro Emanuele; Ellison, John Anthony; Gary, J William; Giordano, Ferdinando; Hanson, Gail; Jeng, Geng-Yuan; Liu, Hongliang; Long, Owen Rosser; Luthra, Arun; Nguyen, Harold; Paramesvaran, Sudarshan; Sturdy, Jared; Sumowidagdo, Suharyo; Wilken, Rachel; Wimpenny, Stephen; Andrews, Warren; Branson, James G; Cerati, Giuseppe Benedetto; Cittolin, Sergio; Evans, David; Golf, Frank; Holzner, André; Kelley, Ryan; Lebourgeois, Matthew; Letts, James; Macneill, Ian; Mangano, Boris; Padhi, Sanjay; Palmer, Christopher; Petrucciani, Giovanni; Pieri, Marco; Sani, Matteo; Sharma, Vivek; Simon, Sean; Sudano, Elizabeth; Tadel, Matevz; Tu, Yanjun; Vartak, Adish; Wasserbaech, Steven; Würthwein, Frank; Yagil, Avraham; Yoo, Jaehyeok; Barge, Derek; Bellan, Riccardo; Campagnari, Claudio; D'Alfonso, Mariarosaria; Danielson, Thomas; Flowers, Kristen; Geffert, Paul; Incandela, Joe; Justus, Christopher; Kalavase, Puneeth; Koay, Sue Ann; Kovalskyi, Dmytro; Krutelyov, Vyacheslav; Lowette, Steven; Mccoll, Nickolas; Pavlunin, Viktor; Rebassoo, Finn; Ribnik, Jacob; Richman, Jeffrey; Rossin, Roberto; Stuart, David; To, Wing; West, Christopher; Apresyan, Artur; Bornheim, Adolf; Chen, Yi; Di Marco, Emanuele; Duarte, Javier; Gataullin, Marat; Ma, Yousi; Mott, Alexander; Newman, Harvey B; Rogan, Christopher; Spiropulu, Maria; Timciuc, Vladlen; Veverka, Jan; Wilkinson, Richard; Xie, Si; Yang, Yong; Zhu, Ren-Yuan; Akgun, Bora; Azzolini, Virginia; Calamba, Aristotle; Carroll, Ryan; Ferguson, Thomas; Iiyama, Yutaro; Jang, Dong Wook; Liu, Yueh-Feng; Paulini, Manfred; Vogel, Helmut; Vorobiev, Igor; Cumalat, John Perry; Drell, Brian Robert; Edelmaier, Christopher; Ford, William T; Gaz, Alessandro; Heyburn, Bernadette; Luiggi Lopez, Eduardo; Smith, James; Stenson, Kevin; Ulmer, Keith; Wagner, Stephen Robert; Alexander, James; Chatterjee, Avishek; Eggert, Nicholas; Gibbons, Lawrence Kent; Heltsley, Brian; Khukhunaishvili, Aleko; Kreis, Benjamin; Mirman, Nathan; Nicolas Kaufman, Gala; Patterson, Juliet Ritchie; Ryd, Anders; Salvati, Emmanuele; Sun, Werner; Teo, Wee Don; Thom, Julia; Thompson, Joshua; Tucker, Jordan; Vaughan, Jennifer; Weng, Yao; Winstrom, Lucas; Wittich, Peter; Winn, Dave; Abdullin, Salavat; Albrow, Michael; Anderson, Jacob; Bauerdick, Lothar AT; Beretvas, Andrew; Berryhill, Jeffrey; Bhat, Pushpalatha C; Bloch, Ingo; Burkett, Kevin; Butler, Joel Nathan; Chetluru, Vasundhara; Cheung, Harry; Chlebana, Frank; Elvira, Victor Daniel; Fisk, Ian; Freeman, Jim; Gao, Yanyan; Green, Dan; Gutsche, Oliver; Hanlon, Jim; Harris, Robert M; Hirschauer, James; Hooberman, Benjamin; Jindariani, Sergo; Johnson, Marvin; Joshi, Umesh; Kilminster, Benjamin; Klima, Boaz; Kunori, Shuichi; Kwan, Simon; Leonidopoulos, Christos; Linacre, Jacob; Lincoln, Don; Lipton, Ron; Lykken, Joseph; Maeshima, Kaori; Marraffino, John Michael; Maruyama, Sho; Mason, David; McBride, Patricia; Mishra, Kalanand; Mrenna, Stephen; Musienko, Yuri; Newman-Holmes, Catherine; O'Dell, Vivian; Prokofyev, Oleg; Sexton-Kennedy, Elizabeth; Sharma, Seema; Spalding, William J; Spiegel, Leonard; Tan, Ping; Taylor, Lucas; Tkaczyk, Slawek; Tran, Nhan Viet; Uplegger, Lorenzo; Vaandering, Eric Wayne; Vidal, Richard; Whitmore, Juliana; Wu, Weimin; Yang, Fan; Yumiceva, Francisco; Yun, Jae Chul; Acosta, Darin; Avery, Paul; Bourilkov, Dimitri; Chen, Mingshui; Cheng, Tongguang; Das, Souvik; De Gruttola, Michele; Di Giovanni, Gian Piero; Dobur, Didar; Drozdetskiy, Alexey; Field, Richard D; Fisher, Matthew; Fu, Yu; Furic, Ivan-Kresimir; Gartner, Joseph; Hugon, Justin; Kim, Bockjoo; Konigsberg, Jacobo; Korytov, Andrey; Kropivnitskaya, Anna; Kypreos, Theodore; Low, Jia Fu; Matchev, Konstantin; Milenovic, Predrag; Mitselmakher, Guenakh; Muniz, Lana; Remington, Ronald; Rinkevicius, Aurelijus; Sellers, Paul; Skhirtladze, Nikoloz; Snowball, Matthew; Yelton, John; Zakaria, Mohammed; Gaultney, Vanessa; Hewamanage, Samantha; Lebolo, Luis Miguel; Linn, Stephan; Markowitz, Pete; Martinez, German; Rodriguez, Jorge Luis; Adams, Todd; Askew, Andrew; Bochenek, Joseph; Chen, Jie; Diamond, Brendan; Gleyzer, Sergei V; Haas, Jeff; Hagopian, Sharon; Hagopian, Vasken; Jenkins, Merrill; Johnson, Kurtis F; Prosper, Harrison; Veeraraghavan, Venkatesh; Weinberg, Marc; Baarmand, Marc M; Dorney, Brian; Hohlmann, Marcus; Kalakhety, Himali; Vodopiyanov, Igor; Adams, Mark Raymond; Anghel, Ioana Maria; Apanasevich, Leonard; Bai, Yuting; Bazterra, Victor Eduardo; Betts, Russell Richard; Bucinskaite, Inga; Callner, Jeremy; Cavanaugh, Richard; Evdokimov, Olga; Gauthier, Lucie; Gerber, Cecilia Elena; Hofman, David Jonathan; Khalatyan, Samvel; Lacroix, Florent; Malek, Magdalena; O'Brien, Christine; Silkworth, Christopher; Strom, Derek; Turner, Paul; Varelas, Nikos; Akgun, Ugur; Albayrak, Elif Asli; Bilki, Burak; Clarida, Warren; Duru, Firdevs; Griffiths, Scott; Merlo, Jean-Pierre; Mermerkaya, Hamit; Mestvirishvili, Alexi; Moeller, Anthony; Nachtman, Jane; Newsom, Charles Ray; Norbeck, Edwin; Onel, Yasar; Ozok, Ferhat; Sen, Sercan; Tiras, Emrah; Wetzel, James; Yetkin, Taylan; Yi, Kai; Barnett, Bruce Arnold; Blumenfeld, Barry; Bolognesi, Sara; Fehling, David; Giurgiu, Gavril; Gritsan, Andrei; Guo, Zijin; Hu, Guofan; Maksimovic, Petar; Rappoccio, Salvatore; Swartz, Morris; Whitbeck, Andrew; Baringer, Philip; Bean, Alice; Benelli, Gabriele; Grachov, Oleg; Kenny Iii, Raymond Patrick; Murray, Michael; Noonan, Daniel; Sanders, Stephen; Stringer, Robert; Tinti, Gemma; Wood, Jeffrey Scott; Zhukova, Victoria; Barfuss, Anne-Fleur; Bolton, Tim; Chakaberia, Irakli; Ivanov, Andrew; Khalil, Sadia; Makouski, Mikhail; Maravin, Yurii; Shrestha, Shruti; Svintradze, Irakli; Gronberg, Jeffrey; Lange, David; Wright, Douglas; Baden, Drew; Boutemeur, Madjid; Calvert, Brian; Eno, Sarah Catherine; Gomez, Jaime; Hadley, Nicholas John; Kellogg, Richard G; Kirn, Malina; Kolberg, Ted; Lu, Ying; Marionneau, Matthieu; Mignerey, Alice; Pedro, Kevin; Peterman, Alison; Skuja, Andris; Temple, Jeffrey; Tonjes, Marguerite; Tonwar, Suresh C; Twedt, Elizabeth; Apyan, Aram; Bauer, Gerry; Bendavid, Joshua; Busza, Wit; Butz, Erik; Cali, Ivan Amos; Chan, Matthew; Dutta, Valentina; Gomez Ceballos, Guillelmo; Goncharov, Maxim; Hahn, Kristan Allan; Kim, Yongsun; Klute, Markus; Krajczar, Krisztian; Li, Wei; Luckey, Paul David; Ma, Teng; Nahn, Steve; Paus, Christoph; Ralph, Duncan; Roland, Christof; Roland, Gunther; Rudolph, Matthew; Stephans, George; Stöckli, Fabian; Sumorok, Konstanty; Sung, Kevin; Velicanu, Dragos; Wenger, Edward Allen; Wolf, Roger; Wyslouch, Bolek; Yang, Mingming; Yilmaz, Yetkin; Yoon, Sungho; Zanetti, Marco; Cooper, Seth; Dahmes, Bryan; De Benedetti, Abraham; Franzoni, Giovanni; Gude, Alexander; Kao, Shih-Chuan; Klapoetke, Kevin; Kubota, Yuichi; Mans, Jeremy; Pastika, Nathaniel; Rusack, Roger; Sasseville, Michael; Singovsky, Alexander; Tambe, Norbert; Turkewitz, Jared; Cremaldi, Lucien Marcus; Kroeger, Rob; Perera, Lalith; Rahmat, Rahmat; Sanders, David A; Avdeeva, Ekaterina; Bloom, Kenneth; Bose, Suvadeep; Butt, Jamila; Claes, Daniel R; Dominguez, Aaron; Eads, Michael; Keller, Jason; Kravchenko, Ilya; Lazo-Flores, Jose; Malbouisson, Helena; Malik, Sudhir; Snow, Gregory R; Baur, Ulrich; Godshalk, Andrew; Iashvili, Ia; Jain, Supriya; Kharchilava, Avto; Kumar, Ashish; Shipkowski, Simon Peter; Smith, Kenneth; Alverson, George; Barberis, Emanuela; Baumgartel, Darin; Chasco, Matthew; Haley, Joseph; Nash, David; Trocino, Daniele; Wood, Darien; Zhang, Jinzhong; Anastassov, Anton; Kubik, Andrew; Mucia, Nicholas; Odell, Nathaniel; Ofierzynski, Radoslaw Adrian; Pollack, Brian; Pozdnyakov, Andrey; Schmitt, Michael Henry; Stoynev, Stoyan; Velasco, Mayda; Won, Steven; Antonelli, Louis; Berry, Douglas; Brinkerhoff, Andrew; Hildreth, Michael; Jessop, Colin; Karmgard, Daniel John; Kolb, Jeff; Lannon, Kevin; Luo, Wuming; Lynch, Sean; Marinelli, Nancy; Morse, David Michael; Pearson, Tessa; Planer, Michael; Ruchti, Randy; Slaunwhite, Jason; Valls, Nil; Wayne, Mitchell; Wolf, Matthias; Bylsma, Ben; Durkin, Lloyd Stanley; Hill, Christopher; Hughes, Richard; Kotov, Khristian; Ling, Ta-Yung; Puigh, Darren; Rodenburg, Marissa; Vuosalo, Carl; Williams, Grayson; Winer, Brian L; Adam, Nadia; Berry, Edmund; Elmer, Peter; Gerbaudo, Davide; Halyo, Valerie; Hebda, Philip; Hegeman, Jeroen; Hunt, Adam; Jindal, Pratima; Lopes Pegna, David; Lujan, Paul; Marlow, Daniel; Medvedeva, Tatiana; Mooney, Michael; Olsen, James; Piroué, Pierre; Quan, Xiaohang; Raval, Amita; Safdi, Ben; Saka, Halil; Stickland, David; Tully, Christopher; Werner, Jeremy Scott; Zuranski, Andrzej; Acosta, Jhon Gabriel; Brownson, Eric; Huang, Xing Tao; Lopez, Angel; Mendez, Hector; Oliveros, Sandra; Ramirez Vargas, Juan Eduardo; Zatserklyaniy, Andriy; Alagoz, Enver; Barnes, Virgil E; Benedetti, Daniele; Bolla, Gino; Bortoletto, Daniela; De Mattia, Marco; Everett, Adam; Hu, Zhen; Jones, Matthew; Koybasi, Ozhan; Kress, Matthew; Laasanen, Alvin T; Leonardo, Nuno; Maroussov, Vassili; Merkel, Petra; Miller, David Harry; Neumeister, Norbert; Shipsey, Ian; Silvers, David; Svyatkovskiy, Alexey; Vidal Marono, Miguel; Yoo, Hwi Dong; Zablocki, Jakub; Zheng, Yu; Guragain, Samir; Parashar, Neeti; Adair, Antony; Boulahouache, Chaouki; Ecklund, Karl Matthew; Geurts, Frank JM; Padley, Brian Paul; Redjimi, Radia; Roberts, Jay; Zabel, James; Betchart, Burton; Bodek, Arie; Chung, Yeon Sei; Covarelli, Roberto; de Barbaro, Pawel; Demina, Regina; Eshaq, Yossof; Ferbel, Thomas; Garcia-Bellido, Aran; Goldenzweig, Pablo; Han, Jiyeon; Harel, Amnon; Miner, Daniel Carl; Vishnevskiy, Dmitry; Zielinski, Marek; Bhatti, Anwar; Ciesielski, Robert; Demortier, Luc; Goulianos, Konstantin; Lungu, Gheorghe; Malik, Sarah; Mesropian, Christina; Arora, Sanjay; Barker, Anthony; Chou, John Paul; Contreras-Campana, Christian; Contreras-Campana, Emmanuel; Duggan, Daniel; Ferencek, Dinko; Gershtein, Yuri; Gray, Richard; Halkiadakis, Eva; Hidas, Dean; Lath, Amitabh; Panwalkar, Shruti; Park, Michael; Patel, Rishi; Rekovic, Vladimir; Robles, Jorge; Rose, Keith; Salur, Sevil; Schnetzer, Steve; Seitz, Claudia; Somalwar, Sunil; Stone, Robert; Thomas, Scott; Cerizza, Giordano; Hollingsworth, Matthew; Spanier, Stefan; Yang, Zong-Chang; York, Andrew; Eusebi, Ricardo; Flanagan, Will; Gilmore, Jason; Kamon, Teruki; Khotilovich, Vadim; Montalvo, Roy; Osipenkov, Ilya; Pakhotin, Yuriy; Perloff, Alexx; Roe, Jeffrey; Safonov, Alexei; Sakuma, Tai; Sengupta, Sinjini; Suarez, Indara; Tatarinov, Aysen; Toback, David; Akchurin, Nural; Damgov, Jordan; Dragoiu, Cosmin; Dudero, Phillip Russell; Jeong, Chiyoung; Kovitanggoon, Kittikul; Lee, Sung Won; Libeiro, Terence; Roh, Youn; Volobouev, Igor; Appelt, Eric; Delannoy, Andrés G; Florez, Carlos; Greene, Senta; Gurrola, Alfredo; Johns, Willard; Johnston, Cody; Kurt, Pelin; Maguire, Charles; Melo, Andrew; Sharma, Monika; Sheldon, Paul; Snook, Benjamin; Tuo, Shengquan; Velkovska, Julia; Arenton, Michael Wayne; Balazs, Michael; Boutle, Sarah; Cox, Bradley; Francis, Brian; Goodell, Joseph; Hirosky, Robert; Ledovskoy, Alexander; Lin, Chuanzhe; Neu, Christopher; Wood, John; Yohay, Rachel; Gollapinni, Sowjanya; Harr, Robert; Karchin, Paul Edmund; Kottachchi Kankanamge Don, Chamath; Lamichhane, Pramod; Sakharov, Alexandre; Anderson, Michael; Belknap, Donald; Borrello, Laura; Carlsmith, Duncan; Cepeda, Maria; Dasu, Sridhara; Friis, Evan; Gray, Lindsey; Grogg, Kira Suzanne; Grothe, Monika; Hall-Wilton, Richard; Herndon, Matthew; Hervé, Alain; Klabbers, Pamela; Klukas, Jeffrey; Lanaro, Armando; Lazaridis, Christos; Leonard, Jessica; Loveless, Richard; Mohapatra, Ajit; Ojalvo, Isabel; Palmonari, Francesco; Pierro, Giuseppe Antonio; Ross, Ian; Savin, Alexander; Smith, Wesley H; Swanson, Joshua

    2012-12-14

    A measurement is presented of the relative prompt production rate of $\\chi_{c2}$ and $\\chi_{c1}$ with 4.6 inverse femtobarns of data collected by the CMS experiment at the LHC in pp collisions at $\\sqrt{s}$ = 7 TeV. The two states are measured via their radiative decays $\\chi_{c} \\to J/\\psi + \\gamma$, with the photon converting into a dielectron pair for J/$\\psi$ rapidity abs(y(J/$\\psi$)) 0.5 GeV. The measurement is given for six intervals of pt(J/$\\psi$) between 7 and 25 GeV. The results are compared to theoretical predictions.

  18. Measurement of the mass splittings between the b{bar b}{chi}{sub b,J}(1P) states

    Energy Technology Data Exchange (ETDEWEB)

    Edwards, K.W.; Edwards, K.W. [Institute of Particle Physics (Canada); Bellerive, A.; Bellerive, A.; Janicek, R.; Janicek, R.; MacFarlane, D.B.; MacFarlane, D.B.; Patel, P.M.; Patel, P.M. [Institute of Particle Physics (Canada); Sadoff, A.J. [Ithaca College, Ithaca, New York,14850 (United States); Ammar, R.; Baringer, P.; Bean, A.; Besson, D.; Coppage, D.; Darling, C.; Davis, R.; Kotov, S.; Kravchenko, I.; Kwak, N.; Zhou, L. [University of Kansas, Lawrence, Kansas, 66045 (United States); Anderson, S.; Kubota, Y.; Lee, S.J.; ONeill, J.J.; Poling, R.; Riehle, T.; Smith, A. [University of Minnesota, Minneapolis, Minnesota, 55455 (United States); Alam, M.S.; Athar, S.B.; Ling, Z.; Mahmood, A.H.; Timm, S.; Wappler, F. [State University of New York at Albany, Albany, New York, 12222 (United States); Anastassov, A.; Duboscq, J.E.; Fujino, D.; Gan, K.K.; Hart, T.; Honscheid, K.; Kagan, H.; Kass, R.; Lee, J.; Schwarthoff, H.; Spencer, M.B.; Sung, M.; Undrus, A.; Wolf, A.; Zoeller, M.M. [Ohio State University, Columbus, Ohio, 43210 (United States); Richichi, S.J.; Severini, H.; Skubic, P. [University of Oklahoma, Norman, Oklahoma, 73019 (United States); Bishai, M.; Fast, J.; Hinson, J.W.; Menon, N.; Miller, D.H.; Shibata, E.I.; Shipsey, I.P.; Yurko, M. [Purdue University, West Lafayette, Indiana, 47907 (United States); Glenn, S.; Kwon, Y.; Lyon, A.L.; Roberts, S.; Thorndike, E.H. [University of Rochester, Rochester, New York, 14627 (United States); Jessop, C.P.; Lingel, K.; Marsiske, H.; Perl, M.L.; Savinov, V.; Ugolini, D.; Zhou, X. [Stanford Linear Accelerator Center, Stanford University, Stanford, California, 94309 (United States); Coan, T.E.; Fadeyev, V.; Korolkov, I.; Maravin, Y.; Narsky, I.; Shelkov, V.; Staeck, J.; Stroynowski, R.; Volobouev, I.; Ye, J. [Southern Methodist University, Dallas, Texas, 75275 (United States); Artuso, M.; Azfar, F.; Efimov, A.; Goldberg, M.; He, D.; Kopp, S.; Moneti, G.C.; Mountain, R.; Schuh, S.; Skwarnicki, T.; and others

    1999-02-01

    We present new measurements of photon energies and branching fractions for the radiative transitions {Upsilon}(2S){r_arrow}{gamma}{chi}{sub b(J=0,1,2)}(1P). The masses of the {chi}{sub b} states are determined from the measured radiative photon energies. The ratio of mass splittings between the {chi}{sub b} substates, r{equivalent_to}(M{sub J=2}{minus}M{sub J=1})/(M{sub J=1}{minus}M{sub J=0}), with M the {chi}{sub b} mass, provides information on the nature of the b{bar b} confining potential. We find r(1P)=0.542{plus_minus}0.022{plus_minus}0.024. This value is somewhat lower than the previous world average, but more consistent with the theoretical expectation that r(1P){lt}r(2P); i.e., that this mass splitting ratio is smaller for the {chi}{sub b}(1P) states than for the {chi}{sub b}(2P) states. {copyright} {ital 1999} {ital The American Physical Society}

  19. Multistrange Meson-Baryon Dynamics and Resonance Generation

    Science.gov (United States)

    Khemchandani, K. P.; Martínez Torres, A.; Hosaka, A.; Nagahiro, H.; Navarra, F. S.; Nielsen, M.

    2018-05-01

    In this talk I review our recent studies on meson-baryon systems with strangeness - 1 and - 2. The motivation of our works is to find resonances generated as a consequence of coupled channel meson-baryon interactions. The coupled channels are all meson-baryon systems formed by combining a pseudoscalar or a vector meson with an octet baryon such that the system has the strange quantum number equal to - 1 or - 2. The lowest order meson-baryon interaction amplitudes are obtained from Lagrangians based on the chiral and the hidden local symmetries related to the vector mesons working as the gauge bosons. These lowest order amplitudes are used as an input to solve the Bethe-Salpeter equation and a search for poles is made in the resulting amplitudes, in the complex plane. In case of systems with strangeness - 1, we find evidence for the existence of some hyperons such as: Λ(2000), Σ(1750), Σ(1940), Σ(2000). More recently, in the study of strangeness - 2 systems we have found two narrow resonances which can be related to Ξ (1690) and Ξ(2120). In this latter work, we have obtained the lowest order amplitudes relativistically as well as in the nonrelativistic approximation to solve the scattering equations. We find that the existence of the poles in the complex plane does not get affected by the computation of the scattering equation with the lowest order amplitudes obtained in the nonrelativistic approximation.

  20. Exclusive φ meson production in HERMES

    International Nuclear Information System (INIS)

    Golembiovskaya, Mayya

    2014-03-01

    In the present work exclusive φ meson leptoproduction at HERMES experiment in DESY was studied using the data collected at HERA accelerator in the period from 1998 till 2000 and from 2006 till 2007 years. In the analysis unpolarized and longitudinally polarized hydrogen and deuteron targets were used, the beam consisted of longitudinally polarized leptons. Via measurement of the angular and momentum distribution of the φ meson decay products 23 spin density matrix elements (SDMEs) for the φ meson were obtained. The number of SDMEs was defined by the experiment conditions, e.g. by the beam and target polarization directions. For the mentioned time period φ meson SDMEs were defined at HERMES for the first time. The quantities U 1 , U 2 and U 3 which can be used to check presence of unnatural parity exchange (UPE) mechanism in phi meson production were calculated from SDMEs. All the results were obtained in 3 kinematic bins of Q 2 , 4 kinematic bins of t' and for the integrated kinematics. No statistically significant difference between the results for hydrogen and deuteron targets was observed. The UPE quantities were found to be zero within 2 σ for the integrated kinematics, indicating negligible contribution of UPE for the φ meson production which is in agreement with theory predictions. The test of s-channel helicity conservation hypothesis via comparison of corresponding SDME values showed helicity conservation for the φ meson production.

  1. Exclusive φ meson production in HERMES

    Energy Technology Data Exchange (ETDEWEB)

    Golembiovskaya, Mayya

    2014-03-15

    In the present work exclusive φ meson leptoproduction at HERMES experiment in DESY was studied using the data collected at HERA accelerator in the period from 1998 till 2000 and from 2006 till 2007 years. In the analysis unpolarized and longitudinally polarized hydrogen and deuteron targets were used, the beam consisted of longitudinally polarized leptons. Via measurement of the angular and momentum distribution of the φ meson decay products 23 spin density matrix elements (SDMEs) for the φ meson were obtained. The number of SDMEs was defined by the experiment conditions, e.g. by the beam and target polarization directions. For the mentioned time period φ meson SDMEs were defined at HERMES for the first time. The quantities U{sub 1}, U{sub 2} and U{sub 3} which can be used to check presence of unnatural parity exchange (UPE) mechanism in phi meson production were calculated from SDMEs. All the results were obtained in 3 kinematic bins of Q{sup 2}, 4 kinematic bins of t' and for the integrated kinematics. No statistically significant difference between the results for hydrogen and deuteron targets was observed. The UPE quantities were found to be zero within 2 σ for the integrated kinematics, indicating negligible contribution of UPE for the φ meson production which is in agreement with theory predictions. The test of s-channel helicity conservation hypothesis via comparison of corresponding SDME values showed helicity conservation for the φ meson production.

  2. The Meson Spectroscopy Program at the Jefferson Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Filippi, Alessandro [Istituto Nazionale di Fisica Nucleare (INFN), Torino (Italy). et al.

    2015-06-01

    The experimental techniques that will be applied by the next generation meson spectroscopy experiments at JLab are described. For the first time, these experiments will be able to exploit the features of a photon beam of unprecedented intensity and momentum resolution, that will allow to perform precision studies of meson states with masses below 3 GeV/c2. Photon induced reactions will enhance the production of spin-1 mesons, that are of particular interest according to the most recent Lattice QCD calculations of the lightest exotic hybrid meson.

  3. Mesonic effects in nuclear physics

    International Nuclear Information System (INIS)

    Johnson, M.

    1978-01-01

    The relation between mesons and nucleons and the properties of nuclear matter, as presently understood, is considered in these lectures. Feynman diagrams, meson theoretical nucleon-nucleon interactions, mesonic components in nuclear wave functions, direct observation of mesonic components in NN scattering above the pion production threshold, nuclear matter theory, and pion condensation are treated. 120 references

  4. Relations de Dispersion et Diffusion des Glueballs et des Mesons dans la Theorie de Jauge U(1)(2+1) Compacte

    Science.gov (United States)

    Ahmed, Chaara El Mouez

    Nous avons etudie les relations de dispersion et la diffusion des glueballs et des mesons dans le modele U(1)_{2+1} compact. Ce modele a ete souvent utilise comme un simple modele de la chromodynamique quantique (QCD), parce qu'il possede le confinement ainsi que les etats de glueballs. Par contre, sa structure mathematique est beaucoup plus simple que la QCD. Notre methode consiste a diagonaliser l'Hamiltonien de ce modele dans une base appropriee de graphes et sur reseau impulsion, afin de generer les relations de dispersion des glueballs et des mesons. Pour la diffusion, nous avons utilise la methode dependante du temps pour calculer la matrice S et la section efficace de diffusion des glueballs et des mesons. Les divers resultats obtenus semblent etre en accord avec les travaux anterieurs de Hakim, Alessandrini et al., Irving et al., qui eux, utilisent plutot la theorie des perturbations en couplage fort, et travaillent sur un reseau espace-temps.

  5. The search for scalar mesons

    International Nuclear Information System (INIS)

    Pennington, M.R.

    1988-09-01

    The search of I = 0 0 ++ mesons is described. We highlight the crucial role played by the states in the 1 GeV region. An analysis program that with unimpeachable data would produce definitive results on these is outlined and shown with present data to provide prima facie evidence for dynamics beyond that of the quark model. We briefly speculate on the current status of the lowest mass scalar mesons and discuss how experiment can resolve the unanswered issues. 30 refs., 6 figs., 1 tab

  6. Semileptonic Branching Fractions of Charged and Neutral B Mesons

    International Nuclear Information System (INIS)

    Athanas, M.; Brower, W.; Masek, G.; Paar, H.P.; Gronberg, J.; Kutschke, R.; Menary, S.; Morrison, R.J.; Nakanishi, S.; Nelson, H.N.; Nelson, T.K.; Qiao, C.; Richman, J.D.; Ryd, A.; Tajima, H.; Sperka, D.; Witherell, M.S.; Balest, R.; Cho, K.; Ford, W.T.; Johnson, D.R.; Lingel, K.; Lohner, M.; Rankin, P.; Smith, J.G.; Alexander, J.P.; Bebek, C.; Berkelman, K.; Bloom, K.; Browder, T.E.; Cassel, D.G.; Cho, H.A.; Coffman, D.M.; Crowcroft, D.S.; Drell, P.S.; Dumas, D.; Ehrlich, R.; Gaidarev, P.; Garcia-Sciveres, M.; Geiser, B.; Gittelman, B.; Gray, S.W.; Hartill, D.L.; Heltsley, B.K.; Henderson, S.; Jones, C.D.; Jones, S.L.; Kandaswamy, J.; Katayama, N.; Kim, P.C.; Kreinick, D.L.; Ludwig, G.S.; Masui, J.; Mevissen, J.; Mistry, N.B.; Ng, C.R.; Nordberg, E.; Patterson, J.R.; Peterson, D.; Riley, D.; Salman, S.; Sapper, M.; Wuerthwein, F.; Avery, P.; Freyberger, A.; Rodriguez, J.; Yang, S.; Yelton, J.; Cinabro, D.; Liu, T.; Saulnier, M.; Wilson, R.; Yamamoto, H.; Bergfeld, T.; Eisenstein, B.I.; Gollin, G.; Ong, B.; Palmer, M.; Selen, M.; Thaler, J.J.; Edwards, K.W.; Ogg, M.; Bellerive, A.; Britton, D.I.; Hyatt, E.R.F.; MacFarlane, D.B.; Patel, P.M.; Spaan, B.; Sadoff, A.J.; Ammar, R.; Baringer, P.; Bean, A.; Besson, D.; Coppage, D.; Copty, N.; Davis, R.; Hancock, N.; Kelly, M.; Kotov, S.; Kravchenko, I.; Kwak, N.; Lam, H.; Kubota, Y.; Lattery, M.; Momayezi, M.; Nelson, J.K.; Patton, S.; Poling, R.; Savinov, V.; Schrenk, S.; Wang, R.; Alam, M.S.; Kim, I.J.; Ling, Z.; Mahmood, A.H.; O'Neill, J.J.; Severini, H.; Sun, C.R.; Wappler, F.; Crawford, G.; Daubenmier, C.M.; Fulton, R.; Fujino, D.; Gan, K.K.; Honscheid, K.; Kagan, H.; Kass, R.; Lee, J.; Malchow, R.; Skovpen, Y.; Sung, M.; White, C.; Zoeller, M.M.; Butler, F.; Fu, X.; Nemati, B.; Ross, W.R.; Skubic, P.; Wood, M.; Bishai, M.; Fast, J.; Gerndt, E.; McIlwain, R.L.; Miao, T.; Miller, D.H.; Modesitt, M.; Payne, D.; Shibata, E.I.; Shipsey, I.P.J.; Wang, P.N.; Battle, M.; Ernst, J.; Gibbons, L.; Kwon, Y.

    1994-01-01

    An examination of leptons in Υ(4S) events tagged by reconstructed B meson decays yields semileptonic branching fractions of b - =(10.1±1.8±1.5)% for charged and b 0 =(10.9±0.7±1.1)% for neutral B mesons. This is the first measurement for charged B mesons. Assuming equality of the charged and neutral semileptonic widths, the ratio b - /b 0 =0.93±0.18±0.12 is equivalent to the ratio of lifetimes

  7. Meson spectroscopy experiment at KEK - E/iota puzzle

    International Nuclear Information System (INIS)

    Tsuru, Tsuneaki

    1985-01-01

    Physics interests at the KEK (National Laboratory for High Energy Physics) are (1) search for exotic mesons such as glueballs (gg), meiktons (q anti q g) and multiquark states (q sup(2 - )q 2 ), (2) search for missing ordinary mesons (q anti q) and confirmation of unestablished mesons, and (3) new informations of quark contents of mesons, mixing angles of SU(3) singlet-octet and tests of conservations law. Special interest is in search for exotics such as glueballs and meiktons. (2) is a so-called meson spectroscopy experiment. This is important not only in itself but also in identifying newly discovered states as exotics because exotics have often same quantum numbers as ordinary mesons. Contents are the following: glueballs and E/iota puzzles, spectrometer system, experiments, performance of the spectrometer, physics outputs, E/iota puzzles and πI experiment, future plans. (Mori, K.)

  8. Computing K and D meson masses with N-f=2+1+1 twisted mass lattice QCD

    NARCIS (Netherlands)

    Baron, Remi; Boucaud, Philippe; Carbonell, Jaume; Drach, Vincent; Farchioni, Federico; Herdoiza, Gregorio; Jansen, Karl; Michael, Chris; Montvay, Istvan; Pallante, Elisabetta; Pene, Olivier; Reker, Siebren; Urbach, Carsten; Wagner, Marc; Wenger, Urs

    We discuss the computation of the mass of the K and D mesons within the framework of N-f = 2 + 1 + 1 twisted mass lattice QCD from a technical point of view. These quantities are essential, already at the level of generating gauge configurations, being obvious candidates to tune the strange and

  9. Meson facility. Powerful new research tool

    International Nuclear Information System (INIS)

    Lobashev, V.M.; Tavkhelidze, A.N.

    A meson facility is being built at the Institute of Nuclear Research, USSR Academy of Sciences, in Troitsk, where the Scientific Center, USSR Academy of Sciences is located. The facility will include a linear accelerator for protons and negative hydrogen ions with 600 MeV energy and 0.5-1 mA beam current. Some fundamental studies that can be studied at a meson facility are described in the areas of elementary particles, neutron physics, solid state physics, and applied research. The characteristics of the linear accelerator are given and the meson facility's experimental complex is described

  10. Dicty_cDB: CHI134 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHI134 (Link to dictyBase) - - - Contig-U11723-1 CHI134P (Link... to Original site) CHI134F 581 CHI134Z 736 CHI134P 1297 - - Show CHI134 Library CH (Link to library) Clone ID CHI134 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11723-1 Original site URL http://dict...gl*kta*g*IIMESNKSSSHGDVSTSPSFLNNHHQFNNGGDIIPKKKKNRIMHVG SYEVGKTLGNGTFGKVKLGTNICTK...PVIEAPKTRRMSLDSR MLNGDQQSLVEKNQHMASPRTSKGIFKXSTTTTKSPEKTIIELKRSLEESGLFTKKKGPY LXLCFDEDNSVKFQIEIVKICNLDLTGIQLKRLSGDTWKYKDICT

  11. A theory of scalar mesons

    International Nuclear Information System (INIS)

    Hooft, G. t'; Isidori, G.; Maiani, L.; Polosa, A.D.; Riquer, V.

    2008-01-01

    We discuss the effect of the instanton induced, six-fermion effective Lagrangian on the decays of the lightest scalar mesons in the diquark-antidiquark picture. This addition allows for a remarkably good description of light scalar meson decays. The same effective Lagrangian produces a mixing of the lightest scalars with the positive parity qq-bar states. Comparing with previous work where the qq-bar mesons are identified with the nonet at 1200-1700 MeV, we find that the mixing required to fit the mass spectrum is in good agreement with the instanton coupling obtained from light scalar decays. A coherent picture of scalar mesons as a mixture of tetraquark states (dominating in the lightest mesons) and heavy qq-bar states (dominating in the heavier mesons) emerges

  12. Charmed meson production at LHCb

    International Nuclear Information System (INIS)

    Müller, Dominik

    2016-01-01

    Measurements of charm meson production are important tests for QCD predictions and LHCb is uniquely suited to perform these measurements in the forward region. This paper summarises recent charm meson production measurements performed by LHCb of J/ψ and open charm mesons and the associated production of ϒ and open charm mesons. The J/ψ and open charm meson measurements are performed with data recorded in Run 2 of the Large Hadron Collider. With proton-proton collisions at √s = 13 TeV, these open a new regime in which QCD predictions for charm meson production may be precisely tested. Furthermore, ratios of cross-sections at different centre-of-mass energies benefit of cancellation of both experimental and theoretical uncertainties, providing a new sensitive test of the QCD calculations. Measurements of ϒ and open charm meson associated production are performed using √s = 7 TeV and √s = 8 TeV data and constitute the first observation of this production channel.

  13. Perspective of meson science

    International Nuclear Information System (INIS)

    Yamazaki, T.; Nagamine, K.

    1992-01-01

    Unstable particles such as mesons and muons are now used in various research domains of physics, chemistry, engineering, and life sciences. This book is aimed at summarizing the present exploratory activities and giving future perspectives from a very broad scope. It contains 27 contributions in a wide range of subjects, such as μSR studies of superconductivities, magnetism, muon beam and μSr methodology, theoretical accounts of muon hyperfine interactions, muon catalyzed fusion processes, metastable exotic atoms, medical diagnostics, strangeness nuclear physics, mesons in nuclei, meson-related nuclear reactions and structure, and exotic decays of mesons

  14. SACLAY: Eta mesons at Saturne

    Energy Technology Data Exchange (ETDEWEB)

    Anon.

    1992-05-15

    Using a nuclear reaction, the new tagged eta meson facility now operating at the French Saturne National Laboratory in Saclay produces eta mesons (together with recoil helium-3 nuclei) by proton bombardment of a deuterium target. The proton beam is extracted from the Saturne synchrotron at 893 MeV, stabilized to 80 keV. This is a scant 1.5 MeV above the reaction threshold and close to the energy where eta production peaks.

  15. SACLAY: Eta mesons at Saturne

    International Nuclear Information System (INIS)

    Anon.

    1992-01-01

    Using a nuclear reaction, the new tagged eta meson facility now operating at the French Saturne National Laboratory in Saclay produces eta mesons (together with recoil helium-3 nuclei) by proton bombardment of a deuterium target. The proton beam is extracted from the Saturne synchrotron at 893 MeV, stabilized to 80 keV. This is a scant 1.5 MeV above the reaction threshold and close to the energy where eta production peaks

  16. Exploring the role of CHI3L1 in pre-metastatic lungs of mammary tumor-bearing mice

    Directory of Open Access Journals (Sweden)

    Stephania eLibreros

    2013-12-01

    Full Text Available Elevated levels of chitinase-3-like-1 (CHI3L1 are associated with poor prognosis, shorter recurrence-free intervals and low survival in breast cancer patients. Breast cancer often metastasizes to the lung. We hypothesized that molecules expressed in the pre-metastatic lung microenvironment could support the newly immigrant tumor cells by providing growth and angiogenic factors. Macrophages are known to play an important role in tumor growth by releasing pro-angiogenic molecules. Using mouse mammary tumor models, we have previously shown that during neoplastic progression both the mammary tumor cells and splenic macrophages from tumor-bearing mice express higher levels of CHI3L1 compared to normal control mice. However, the role of CHI3L1 in inducing angiogenesis by macrophages at the pulmonary microenvironment to support newly arriving breast cancer cells is not yet known. In this study, we determined the expression of CHI3L1 in bronchoalveolar lavage macrophages and interstitial macrophages in regulating angiogenesis that could support the growth of newly immigrant mammary tumor cells into the lung. Here we show that in vitro treatment of pulmonary macrophages with recombinant murine CHI3L1 resulted in enhanced expression of pro-angiogenic molecules including CCL2, CXCL2 and MMP-9. We and others have previously shown that inhibition of CHI3L1 decreases the production of angiogenic molecules. In this study, we explored if in vivo administration of chitin microparticles has an effect on the expression of CHI3L1 and pro-angiogenic molecules in the lungs of mammary tumor-bearing mice. We show that treatment with chitin microparticles decreases the expression of CHI3L1 and pro-angiogenic molecules in the metastatic lung. These studies suggest that targeting CHI3L1 may serve as a potential therapeutic agent to inhibit angiogenesis and thus possibly tumor growth and metastasis.

  17. Charged track multiplicity in B meson decay

    International Nuclear Information System (INIS)

    Brandenburg, G.; Ershov, A.; Gao, Y. S.; Kim, D. Y.-J.; Wilson, R.; Browder, T. E.; Li, Y.; Rodriguez, J. L.; Yamamoto, H.; Bergfeld, T.

    2000-01-01

    We have used the CLEO II detector to study the multiplicity of charged particles in the decays of B mesons produced at the Υ(4S) resonance. Using a sample of 1.5x10 6 B meson pairs, we find the mean inclusive charged particle multiplicity to be 10.71±0.02 -0.15 +0.21 for the decay of the pair. This corresponds to a mean multiplicity of 5.36±0.01 -0.08 +0.11 for a single B meson. Using the same data sample, we have also extracted the mean multiplicities in semileptonic and nonleptonic decays. We measure a mean of 7.82±0.05 -0.19 +0.21 charged particles per BB(bar sign) decay when both mesons decay semileptonically. When neither B meson decays semileptonically, we measure a mean charged particle multiplicity of 11.62±0.04 -0.18 +0.24 per BB(bar sign) pair. (c) 2000 The American Physical Society

  18. Quantum chromodynamics with infinite number of vector mesons

    International Nuclear Information System (INIS)

    Geshkenbejn, B.V.

    1988-01-01

    Families of vector mesons Ρ,Ψ,Υ, contain an infinite number of resonances with gradually increasing widths are considered. The asymptotic freedom requirement involves a relationship between the electric width of k-th resonance and its mass M k derivative over the number k. It is shown that for the families of Ψ and Υ mesons the moment from experimental function R(s) is equal to the sum of the moment from a bare quark loop and the edge term which stems from replacing of summation by integration. These equalities are fulfilled up to 1% for 60 moments in the Ψ-meson family and up to 2% for 96 moments in the Υ-meson family. The electronic widths of the resonances and the Ρ-meson mass are calculated. 7 refs

  19. QCD sum rules study of the JPC=1-- charmonium Y mesons

    International Nuclear Information System (INIS)

    Albuquerque, R.M.; Nielsen, M.

    2009-01-01

    We use QCD sum rules to test the nature of the recently observed mesons Y(4260), Y(4350) and Y(4660), assumed to be exotic four-quark (cc-bar qq-bar) or (cc-bar ss-bar) states with J PC =1 -- . We work at leading order in α s , consider the contributions of higher dimension condensates and keep terms which are linear in the strange quark mass m s . We find for the (cc-bar ss-bar) state a mass m Y =(4.65±0.10) GeV which is compatible with the experimental candidate Y(4660), while for the (cc-bar qq-bar) state we find a mass m Y =(4.49±0.11) GeV, which is still consistent with the mass of the experimental candidate Y(4350). With the tetraquark structure we are working we cannot explain the Y(4260) as a tetraquark state. We also consider molecular D s0 D-bar s * and D 0 D-bar * states. For the D s0 D-bar s * molecular state we get m D s0 D -bar s* =(4.42±0.10) GeV which is consistent, considering the errors, with the mass of the meson Y(4350) and for the D 0 D-bar* molecular state we get m D 0 D -bar*=(4.27±0.10) GeV in excellent agreement with the mass of the meson Y(4260)

  20. Chiral symmetry breaking and the spin content of the ρ and ρ' mesons

    International Nuclear Information System (INIS)

    Glozman, L.Ya.; Lang, C.B.; Limmer, M.

    2011-01-01

    Using interpolators with different SU(2) L xSU(2) R transformation properties we study the chiral symmetry and spin contents of the ρ and ρ ' mesons in lattice simulations with dynamical quarks. A ratio of couplings of the q-bar γ i τq and q-bar σ 0i τq interpolators to a given meson state at different resolution scales tells one about the degree of chiral symmetry breaking in the meson wave function at these scales. Using a Gaussian gauge invariant smearing of the quark fields in the interpolators, we are able to extract the chiral content of mesons up to the infrared resolution of ∼1 fm. In the ground state ρ meson the chiral symmetry is strongly broken with comparable contributions of both the (0,1)+(1,0) and (1/2,1/2) b chiral representations with the former being the leading contribution. In contrast, in the ρ ' meson the degree of chiral symmetry breaking is manifestly smaller and the leading representation is (1/2,1/2) b . Using a unitary transformation from the chiral basis to the 2S+1 L J basis, we are able to define and measure the angular momentum content of mesons in the rest frame. This definition is different from the traditional one which uses parton distributions in the infinite momentum frame. The ρ meson is practically a 3 S 1 state with no obvious trace of a 'spin crisis'. The ρ ' meson has a sizeable contribution of the 3 D 1 wave, which implies that the ρ ' meson cannot be considered as a pure radial excitation of the ρ meson.

  1. Measurement of inclusive and DiJet D{sup *}-meson photoproduction at the H1-experiment at HERA

    Energy Technology Data Exchange (ETDEWEB)

    Urban, K.

    2009-03-15

    In the present analysis the production mechanism of charm quarks in electron proton scattering at the HERA collider is investigated using 30.68 pb{sup -1}, 68.23 pb{sup -1} and 93.39 pb{sup -1} of data collected with the H1 experiment. Events containing charm quarks are detected by the reconstruction of D{sup *} mesons in the kinematic domain of photoproduction. For the first time D{sup *} mesons are selected on the basis of the third level of the H1 Fast Track Trigger. Compared to the previous analysis the phase space studied was extended significantly and the data statistics increased by a factor of eight. The investigated kinematic region covers photons of virtuality of Q{sup 2}<2 GeV{sup 2} and photon-proton center-of-mass energies in the range of 100mesons are measured with transverse momenta of at least 1.8 GeV and pseudorapidities vertical stroke {eta} vertical stroke <1.5. The measurement in photoproduction and low p{sub t}(D{sup *}) is of particular interest since it allows the test of different theoretical models at the limit of applicability of pertubative QCD. In a further measurement, which is based on the events with D{sup *} mesons, at least two jets are selected. Jets with p{sub t}>4 GeV and p{sub t}>3 GeV, are studied in the pseudorapidity range of vertical stroke {eta} vertical stroke <1.5, where one of the selected jets is associated with the D{sup *} meson. The investigation of two hard partons, by means of the jets, results in an improved understanding of the production mechanism of charm quarks. This measurement demonstrates that resolved photon processes play an important role in the photoproduction of charm quarks. Single and double differential cross sections of both event samples are compared to predictions of perturbative QCD in leading and next to leading order. (orig.)

  2. Issues in light meson spectroscopy: The case for meson spectroscopy at CEBAF

    Energy Technology Data Exchange (ETDEWEB)

    Godfrey, S. [Carleton Univ., Ottawa (Canada)

    1994-04-01

    The author reviews some outstanding issues in meson spectroscopy. The most important qualitative issue is whether hadrons with explicit gluonic degrees of freedom exist. To answer this question requires a much better understanding of conventional q{bar q} mesons. The author therefore begins by examining the status of conventional meson spectroscopy and how the situation can be improved. The expected properties of gluonic excitations are discussed with particular emphasis on hybrids to give guidance to experimental searches. Multiquark systems are commented upon as they are likely to be important in the mass region under study and will have to be understood better. In the final section the author discusses the opportunities that CEBAF can offer for the study of meson spectroscopy.

  3. Radiative decay of light and heavy mesons

    International Nuclear Information System (INIS)

    Barik, N.; Dash, P.C.

    1994-01-01

    The M1 transition among the vector (V) and pseudoscalar (P) mesons in the light and heavy flavor sectors has been investigated in a potential model of independent quarks. Going beyond the static approximation, to add some momentum dependence due to the recoil effect in a more realistic calculation, we find an improvement in the results for the radiative decay of light flavored mesons. However, our prediction on the decay rates for the mesons (D * and B * ) in the heavy flavor sector remains unaffected and compares well with those of other model calculations

  4. Measurement of elastic electroproduction of $\\phi$ mesons at HERA

    CERN Document Server

    Adloff, C.; Andrieu, B.; Arkadov, V.; Astvatsatourov, A.; Ayyaz, I.; Babaev, A.; Bahr, J.; Baranov, P.; Barrelet, E.; Bartel, W.; Bassler, U.; Bate, P.; Beglarian, A.; Behnke, O.; Beier, C.; Belousov, A.; Benisch, T.; Berger, Christoph; Bernardi, G.; Berndt, T.; Bizot, J.C.; Borras, K.; Boudry, V.; Braunschweig, W.; Brisson, V.; Broker, H.B.; Brown, D.P.; Bruckner, W.; Bruel, P.; Bruncko, D.; Burger, J.; Busser, F.W.; Bunyatyan, A.; Burkhardt, H.; Burrage, A.; Buschhorn, G.; Campbell, A.J.; Cao, Jun; Carli, T.; Caron, S.; Chabert, E.; Clarke, D.; Clerbaux, B.; Collard, C.; Contreras, J.G.; Coughlan, J.A.; Cousinou, M.C.; Cox, B.E.; Cozzika, G.; Cvach, J.; Dainton, J.B.; Dau, W.D.; Daum, K.; David, M.; Davidsson, M.; Delcourt, B.; Delerue, N.; Demirchyan, R.; De Roeck, A.; De Wolf, E.A.; Diaconu, C.; Dixon, P.; Dodonov, V.; Dowell, J.D.; Droutskoi, A.; Duprel, C.; Eckerlin, Guenter; Eckstein, D.; Efremenko, V.; Egli, S.; Eichler, R.; Eisele, F.; Eisenhandler, E.; Ellerbrock, M.; Elsen, E.; Erdmann, M.; Erdmann, W.; Faulkner, P.J.W.; Favart, L.; Fedotov, A.; Felst, R.; Ferencei, J.; Ferron, S.; Fleischer, M.; Flugge, G.; Fomenko, A.; Foresti, I.; Formanek, J.; Foster, J.M.; Franke, G.; Gabathuler, E.; Gabathuler, K.; Garvey, J.; Gassner, J.; Gayler, Joerg; Gerhards, R.; Ghazarian, S.; Goerlich, L.; Gogitidze, N.; Goldberg, M.; Goodwin, C.; Grab, C.; Grassler, H.; Greenshaw, T.; Grindhammer, Guenter; Hadig, T.; Haidt, D.; Hajduk, L.; Haynes, W.J.; Heinemann, B.; Heinzelmann, G.; Henderson, R.C.W.; Hengstmann, S.; Henschel, H.; Heremans, R.; Herrera, G.; Herynek, I.; Hilgers, M.; Hiller, K.H.; Hladky, J.; Hoting, P.; Hoffmann, D.; Hoprich, W.; Horisberger, R.; Hurling, S.; Ibbotson, M.; Issever, C.; Jacquet, M.; Jaffre, M.; Janauschek, L.; Jansen, D.M.; Janssen, X.; Jemanov, V.; Jonsson, L.; Johnson, D.P.; Jones, M.A.S.; Jung, H.; Kastli, H.K.; Kant, D.; Kapichine, M.; Karlsson, M.; Karschnick, O.; Kaufmann, O.; Kausch, M.; Keil, F.; Keller, N.; Kennedy, J.; Kenyon, I.R.; Kermiche, S.; Kiesling, Christian M.; Klein, M.; Kleinwort, C.; Knies, G.; Koblitz, B.; Kolya, S.D.; Korbel, V.; Kostka, P.; Kotelnikov, S.K.; Krasny, M.W.; Krehbiel, H.; Kroseberg, J.; Krucker, D.; Kruger, K.; Kupper, A.; Kuhr, T.; Kurca, T.; Kutuev, R.; Lachnit, W.; Lahmann, R.; Lamb, D.; Landon, M.P.J.; Lange, W.; Lastovicka, T.; Lebedev, A.; Leissner, B.; Lemrani, R.; Lendermann, V.; Levonian, S.; Lindstrom, M.; Lobodzinska, E.; Lobodzinski, B.; Loktionova, N.; Lubimov, V.; Luders, S.; Luke, D.; Lytkin, L.; Magnussen, N.; Mahlke-Kruger, H.; Malden, N.; Malinovski, E.; Malinovski, I.; Maracek, R.; Marage, P.; Marks, J.; Marshall, R.; Martyn, H.U.; Martyniak, J.; Maxfield, S.J.; Mehta, A.; Meier, K.; Merkel, P.; Metlica, F.; Meyer, H.; Meyer, J.; Meyer, P.O.; Mikocki, S.; Milstead, D.; Mkrtchyan, T.; Mohr, R.; Mohrdieck, S.; Mondragon, M.N.; Moreau, F.; Morozov, A.; Morris, J.V.; Muller, K.; Murin, P.; Nagovizin, V.; Naroska, B.; Naumann, J.; Naumann, T.; Nellen, G.; Newman, Paul R.; Nicholls, T.C.; Niebergall, F.; Niebuhr, C.; Nix, O.; Nowak, G.; Nunnemann, T.; Olsson, J.E.; Ozerov, D.; Panassik, V.; Pascaud, C.; Patel, G.D.; Perez, E.; Phillips, J.P.; Pitzl, D.; Poschl, R.; Potachnikova, I.; Povh, B.; Rabbertz, K.; Radel, G.; Rauschenberger, J.; Reimer, P.; Reisert, B.; Reyna, D.; Riess, S.; Rizvi, E.; Robmann, P.; Roosen, R.; Rostovtsev, A.; Royon, C.; Rusakov, S.; Rybicki, K.; Sankey, D.P.C.; Scheins, J.; Schilling, F.P.; Schleper, P.; Schmidt, D.; Schoeffel, L.; Schoning, A.; Schorner, T.; Schroder, V.; Schultz-Coulon, H.C.; Sedlak, K.; Sefkow, F.; Chekelian, V.I.; Sheviakov, I.; Shtarkov, L.N.; Siegmon, G.; Sievers, P.; Sirois, Y.; Sloan, T.; Smirnov, P.; Solochenko, V.; Solovev, Y.; Spaskov, V.; Specka, Arnd E.; Spitzer, H.; Stamen, R.; Steinhart, J.; Stella, B.; Stellberger, A.; Stiewe, J.; Straumann, U.; Struczinski, W.; Swart, M.; Tasevsky, M.; Tchernyshov, V.; Tchetchelnitski, S.; Thompson, Graham; Thompson, P.D.; Tobien, N.; Traynor, D.; Truoel, Peter; Tsipolitis, G.; Turnau, J.; Turney, J.E.; Tzamariudaki, E.; Udluft, S.; Usik, A.; Valkar, S.; Valkarova, A.; Vallee, C.; Van Mechelen, P.; Vazdik, Y.; von Dombrowski, S.; Wacker, K.; Wallny, R.; Walter, T.; Waugh, B.; Weber, G.; Weber, M.; Wegener, D.; Wegner, A.; Wengler, T.; Werner, M.; White, G.; Wiesand, S.; Wilksen, T.; Winde, M.; Winter, G.G.; Wissing, C.; Wobisch, M.; Wollatz, H.; Wunsch, E.; Wyatt, A.C.; Zacek, J.; Zalesak, J.; Zhang, Z.; Zhokin, A.; Zomer, F.; Zsembery, J.

    2000-01-01

    The elastic electroproduction of phi mesons is studied at HERA with the H1 detector for photon virtualities 1 < Q^2 < 15 GeV^2 and hadronic centre of mass energies 40 < W < 130 GeV. The Q^2 and t dependences of the cross section are extracted (t being the square of the four-momentum transfer to the target proton). When plotted as function of (Q^2 + M_V^2) and scaled by the appropriate SU(5) quark charge factor, the phi meson cross section agrees within errors with the cross sections of the vector mesons V = rho, omega and J/psi. A detailed analysis is performed of the phi meson polarisation state and the ratio of the production cross sections for longitudinally and transversely polarised phi mesons is determined. A small but significant violation of s-channel helicity conservation (SCHC) is observed.

  5. Study of $B^+_c$ decays to the $K^+K^-\\pi^+$ final state and evidence for the decay $B^+_c\\to\\chi_{c0}\\pi^+$

    CERN Document Server

    Aaij, Roel; Adinolfi, Marco; Ajaltouni, Ziad; Akar, Simon; Albrecht, Johannes; Alessio, Federico; Alexander, Michael; Ali, Suvayu; Alkhazov, Georgy; Alvarez Cartelle, Paula; Alves Jr, Antonio Augusto; Amato, Sandra; Amerio, Silvia; Amhis, Yasmine; An, Liupan; Anderlini, Lucio; Andreassi, Guido; Andreotti, Mirco; Andrews, Jason; Appleby, Robert; Aquines Gutierrez, Osvaldo; Archilli, Flavio; d'Argent, Philippe; Arnau Romeu, Joan; Artamonov, Alexander; Artuso, Marina; Aslanides, Elie; Auriemma, Giulio; Baalouch, Marouen; Babuschkin, Igor; Bachmann, Sebastian; Back, John; Badalov, Alexey; Baesso, Clarissa; Baldini, Wander; Barlow, Roger; Barschel, Colin; Barsuk, Sergey; Barter, William; Batozskaya, Varvara; Batsukh, Baasansuren; Battista, Vincenzo; Bay, Aurelio; Beaucourt, Leo; Beddow, John; Bedeschi, Franco; Bediaga, Ignacio; Bel, Lennaert; Bellee, Violaine; Belloli, Nicoletta; Belous, Konstantin; Belyaev, Ivan; Ben-Haim, Eli; Bencivenni, Giovanni; Benson, Sean; Benton, Jack; Berezhnoy, Alexander; Bernet, Roland; Bertolin, Alessandro; Betti, Federico; Bettler, Marc-Olivier; van Beuzekom, Martinus; Bezshyiko, Iaroslava; Bifani, Simone; Billoir, Pierre; Bird, Thomas; Birnkraut, Alex; Bitadze, Alexander; Bizzeti, Andrea; Blake, Thomas; Blanc, Frederic; Blouw, Johan; Blusk, Steven; Bocci, Valerio; Boettcher, Thomas; Bondar, Alexander; Bondar, Nikolay; Bonivento, Walter; Borgheresi, Alessio; Borghi, Silvia; Borisyak, Maxim; Borsato, Martino; Bossu, Francesco; Boubdir, Meriem; Bowcock, Themistocles; Bowen, Espen Eie; Bozzi, Concezio; Braun, Svende; Britsch, Markward; Britton, Thomas; Brodzicka, Jolanta; Buchanan, Emma; Burr, Christopher; Bursche, Albert; Buytaert, Jan; Cadeddu, Sandro; Calabrese, Roberto; Calvi, Marta; Calvo Gomez, Miriam; Camboni, Alessandro; Campana, Pierluigi; Campora Perez, Daniel; Campora Perez, Daniel Hugo; Capriotti, Lorenzo; Carbone, Angelo; Carboni, Giovanni; Cardinale, Roberta; Cardini, Alessandro; Carniti, Paolo; Carson, Laurence; Carvalho Akiba, Kazuyoshi; Casse, Gianluigi; Cassina, Lorenzo; Castillo Garcia, Lucia; Cattaneo, Marco; Cauet, Christophe; Cavallero, Giovanni; Cenci, Riccardo; Charles, Matthew; Charpentier, Philippe; Chatzikonstantinidis, Georgios; Chefdeville, Maximilien; Chen, Shanzhen; Cheung, Shu-Faye; Chobanova, Veronika; Chrzaszcz, Marcin; Cid Vidal, Xabier; Ciezarek, Gregory; Clarke, Peter; Clemencic, Marco; Cliff, Harry; Closier, Joel; Coco, Victor; Cogan, Julien; Cogneras, Eric; Cogoni, Violetta; Cojocariu, Lucian; Collazuol, Gianmaria; Collins, Paula; Comerma-Montells, Albert; Contu, Andrea; Cook, Andrew; Coquereau, Samuel; Corti, Gloria; Corvo, Marco; Costa Sobral, Cayo Mar; Couturier, Benjamin; Cowan, Greig; Craik, Daniel Charles; Crocombe, Andrew; Cruz Torres, Melissa Maria; Cunliffe, Samuel; Currie, Robert; D'Ambrosio, Carmelo; Dall'Occo, Elena; Dalseno, Jeremy; David, Pieter; Davis, Adam; De Aguiar Francisco, Oscar; De Bruyn, Kristof; De Capua, Stefano; De Cian, Michel; De Miranda, Jussara; De Paula, Leandro; De Serio, Marilisa; De Simone, Patrizia; Dean, Cameron Thomas; Decamp, Daniel; Deckenhoff, Mirko; Del Buono, Luigi; Demmer, Moritz; Derkach, Denis; Deschamps, Olivier; Dettori, Francesco; Dey, Biplab; Di Canto, Angelo; Dijkstra, Hans; Dordei, Francesca; Dorigo, Mirco; Dosil Su{á}rez, Alvaro; Dovbnya, Anatoliy; Dreimanis, Karlis; Dufour, Laurent; Dujany, Giulio; Dungs, Kevin; Durante, Paolo; Dzhelyadin, Rustem; Dziurda, Agnieszka; Dzyuba, Alexey; D{é}l{é}age, Nicolas; Easo, Sajan; Ebert, Marcus; Egede, Ulrik; Egorychev, Victor; Eidelman, Semen; Eisenhardt, Stephan; Eitschberger, Ulrich; Ekelhof, Robert; Eklund, Lars; Elsasser, Christian; Ely, Scott; Esen, Sevda; Evans, Hannah Mary; Evans, Timothy; Falabella, Antonio; Farley, Nathanael; Farry, Stephen; Fay, Robert; Fazzini, Davide; Ferguson, Dianne; Fernandez Albor, Victor; Fernandez Prieto, Antonio; Ferrari, Fabio; Ferreira Rodrigues, Fernando; Ferro-Luzzi, Massimiliano; Filippov, Sergey; Fini, Rosa Anna; Fiore, Marco; Fiorini, Massimiliano; Firlej, Miroslaw; Fitzpatrick, Conor; Fiutowski, Tomasz; Fleuret, Frederic; Fohl, Klaus; Fontana, Marianna; Fontanelli, Flavio; Forshaw, Dean Charles; Forty, Roger; Franco Lima, Vinicius; Frank, Markus; Frei, Christoph; Fu, Jinlin; Furfaro, Emiliano; F{ä}rber, Christian; Gallas Torreira, Abraham; Galli, Domenico; Gallorini, Stefano; Gambetta, Silvia; Gandelman, Miriam; Gandini, Paolo; Gao, Yuanning; Garcia Martin, Luis Miguel; Garc{í}a Pardi{ñ}as, Juli{á}n; Garra Tico, Jordi; Garrido, Lluis; Garsed, Philip John; Gascon, David; Gaspar, Clara; Gavardi, Laura; Gazzoni, Giulio; Gerick, David; Gersabeck, Evelina; Gersabeck, Marco; Gershon, Timothy; Ghez, Philippe; Gian{ì}, Sebastiana; Gibson, Valerie; Girard, Olivier G{ö}ran; Giubega, Lavinia-Helena; Gizdov, Konstantin; Gligorov, V.V.; Golubkov, Dmitry; Golutvin, Andrey; Gomes, Alvaro; Gorelov, Igor Vladimirovich; Gotti, Claudio; Grabalosa G{á}ndara, Marc; Graciani Diaz, Ricardo; Granado Cardoso, Luis Alberto; Graugés, Eugeni; Graverini, Elena; Graziani, Giacomo; Grecu, Alexandru; Griffith, Peter; Grillo, Lucia; Gruberg Cazon, Barak Raimond; Gr{ü}nberg, Oliver; Gushchin, Evgeny; Guz, Yury; Gys, Thierry; G{ö}bel, Carla; Hadavizadeh, Thomas; Hadjivasiliou, Christos; Haefeli, Guido; Haen, Christophe; Haines, Susan; Hall, Samuel; Hamilton, Brian; Han, Xiaoxue; Hansmann-Menzemer, Stephanie; Harnew, Neville; Harnew, Samuel; Harrison, Jonathan; Hatch, Mark; He, Jibo; Head, Timothy; Heister, Arno; Hennessy, Karol; Henrard, Pierre; Henry, Louis; Hernando Morata, Jose Angel; van Herwijnen, Eric; Heß, Miriam; Hicheur, Adl{è}ne; Hill, Donal; Hombach, Christoph; Hulsbergen, Wouter; Humair, Thibaud; Hushchyn, Mikhail; Hussain, Nazim; Hutchcroft, David; Idzik, Marek; Ilten, Philip; Jacobsson, Richard; Jaeger, Andreas; Jalocha, Pawel; Jans, Eddy; Jawahery, Abolhassan; John, Malcolm; Johnson, Daniel; Jones, Christopher; Joram, Christian; Jost, Beat; Jurik, Nathan; Kandybei, Sergii; Kanso, Walaa; Karacson, Matthias; Kariuki, James Mwangi; Karodia, Sarah; Kecke, Matthieu; Kelsey, Matthew; Kenyon, Ian; Kenzie, Matthew; Ketel, Tjeerd; Khairullin, Egor; Khanji, Basem; Khurewathanakul, Chitsanu; Kirn, Thomas; Klaver, Suzanne; Klimaszewski, Konrad; Koliiev, Serhii; Kolpin, Michael; Komarov, Ilya; Koopman, Rose; Koppenburg, Patrick; Kozachuk, Anastasiia; Kozeiha, Mohamad; Kravchuk, Leonid; Kreplin, Katharina; Kreps, Michal; Krokovny, Pavel; Kruse, Florian; Krzemien, Wojciech; Kucewicz, Wojciech; Kucharczyk, Marcin; Kudryavtsev, Vasily; Kuonen, Axel Kevin; Kurek, Krzysztof; Kvaratskheliya, Tengiz; Lacarrere, Daniel; Lafferty, George; Lai, Adriano; Lambert, Dean; Lanfranchi, Gaia; Langenbruch, Christoph; Langhans, Benedikt; Latham, Thomas; Lazzeroni, Cristina; Le Gac, Renaud; van Leerdam, Jeroen; Lees, Jean-Pierre; Leflat, Alexander; Lefran{ç}ois, Jacques; Lef{è}vre, Regis; Lemaitre, Florian; Lemos Cid, Edgar; Leroy, Olivier; Lesiak, Tadeusz; Leverington, Blake; Li, Yiming; Likhomanenko, Tatiana; Lindner, Rolf; Linn, Christian; Lionetto, Federica; Liu, Bo; Liu, Xuesong; Loh, David; Longstaff, Iain; Lopes, Jose; Lucchesi, Donatella; Lucio Martinez, Miriam; Luo, Haofei; Lupato, Anna; Luppi, Eleonora; Lupton, Oliver; Lusiani, Alberto; Lyu, Xiao-Rui; Machefert, Frederic; Maciuc, Florin; Maev, Oleg; Maguire, Kevin; Malde, Sneha; Malinin, Alexander; Maltsev, Timofei; Manca, Giulia; Mancinelli, Giampiero; Manning, Peter Michael; Maratas, Jan; Marchand, Jean Fran{ç}ois; Marconi, Umberto; Marin Benito, Carla; Marino, Pietro; Marks, J{ö}rg; Martellotti, Giuseppe; Martin, Morgan; Martinelli, Maurizio; Martinez Santos, Diego; Martinez Vidal, Fernando; Martins Tostes, Danielle; Massacrier, Laure Marie; Massafferri, Andr{é}; Matev, Rosen; Mathad, Abhijit; Mathe, Zoltan; Matteuzzi, Clara; Mauri, Andrea; Maurin, Brice; Mazurov, Alexander; McCann, Michael; McCarthy, James; McNab, Andrew; McNulty, Ronan; Meadows, Brian; Meier, Frank; Meissner, Marco; Melnychuk, Dmytro; Merk, Marcel; Merli, Andrea; Michielin, Emanuele; Milanes, Diego Alejandro; Minard, Marie-Noelle; Mitzel, Dominik Stefan; Molina Rodriguez, Josue; Monroy, Ignacio Alberto; Monteil, Stephane; Morandin, Mauro; Morawski, Piotr; Mord{à}, Alessandro; Morello, Michael Joseph; Moron, Jakub; Morris, Adam Benjamin; Mountain, Raymond; Muheim, Franz; Mulder, Mick; Mussini, Manuel; M{ü}ller, Dominik; M{ü}ller, Janine; M{ü}ller, Katharina; M{ü}ller, Vanessa; Naik, Paras; Nakada, Tatsuya; Nandakumar, Raja; Nandi, Anita; Nasteva, Irina; Needham, Matthew; Neri, Nicola; Neubert, Sebastian; Neufeld, Niko; Neuner, Max; Nguyen, Anh Duc; Nguyen-Mau, Chung; Nieswand, Simon; Niet, Ramon; Nikitin, Nikolay; Nikodem, Thomas; Novoselov, Alexey; O'Hanlon, Daniel Patrick; Oblakowska-Mucha, Agnieszka; Obraztsov, Vladimir; Ogilvy, Stephen; Oldeman, Rudolf; Onderwater, Gerco; Otalora Goicochea, Juan Martin; Otto, Adam; Owen, Patrick; Oyanguren, Maria Aranzazu; Pais, Preema Rennee; Palano, Antimo; Palombo, Fernando; Palutan, Matteo; Panman, Jacob; Papanestis, Antonios; Pappagallo, Marco; Pappalardo, Luciano; Parker, William; Parkes, Christopher; Passaleva, Giovanni; Pastore, Alessandra; Patel, Girish; Patel, Mitesh; Patrignani, Claudia; Pearce, Alex; Pellegrino, Antonio; Penso, Gianni; Pepe Altarelli, Monica; Perazzini, Stefano; Perret, Pascal; Pescatore, Luca; Petridis, Konstantinos; Petrolini, Alessandro; Petrov, Aleksandr; Petruzzo, Marco; Picatoste Olloqui, Eduardo; Pietrzyk, Boleslaw; Pikies, Malgorzata; Pinci, Davide; Pistone, Alessandro; Piucci, Alessio; Playfer, Stephen; Plo Casasus, Maximo; Poikela, Tuomas; Polci, Francesco; Poluektov, Anton; Polyakov, Ivan; Polycarpo, Erica; Pomery, Gabriela Johanna; Popov, Alexander; Popov, Dmitry; Popovici, Bogdan; Potterat, C{é}dric; Price, Eugenia; Price, Joseph David; Prisciandaro, Jessica; Pritchard, Adrian; Prouve, Claire; Pugatch, Valery; Puig Navarro, Albert; Punzi, Giovanni; Qian, Wenbin; Quagliani, Renato; Rachwal, Bartolomiej; Rademacker, Jonas; Rama, Matteo; Ramos Pernas, Miguel; Rangel, Murilo; Raniuk, Iurii; Raven, Gerhard; Redi, Federico; Reichert, Stefanie; dos Reis, Alberto; Remon Alepuz, Clara; Renaudin, Victor; Ricciardi, Stefania; Richards, Sophie; Rihl, Mariana; Rinnert, Kurt; Rives Molina, Vicente; Robbe, Patrick; Rodrigues, Ana Barbara; Rodrigues, Eduardo; Rodriguez Lopez, Jairo Alexis; Rodriguez Perez, Pablo; Rogozhnikov, Alexey; Roiser, Stefan; Romanovskiy, Vladimir; Romero Vidal, Antonio; Ronayne, John William; Rotondo, Marcello; Rudolph, Matthew Scott; Ruf, Thomas; Ruiz Valls, Pablo; Saborido Silva, Juan Jose; Sadykhov, Elnur; Sagidova, Naylya; Saitta, Biagio; Salustino Guimaraes, Valdir; Sanchez Mayordomo, Carlos; Sanmartin Sedes, Brais; Santacesaria, Roberta; Santamarina Rios, Cibran; Santimaria, Marco; Santovetti, Emanuele; Sarti, Alessio; Satriano, Celestina; Satta, Alessia; Saunders, Daniel Martin; Savrina, Darya; Schael, Stefan; Schellenberg, Margarete; Schiller, Manuel; Schindler, Heinrich; Schlupp, Maximilian; Schmelling, Michael; Schmelzer, Timon; Schmidt, Burkhard; Schneider, Olivier; Schopper, Andreas; Schubert, Konstantin; Schubiger, Maxime; Schune, Marie Helene; Schwemmer, Rainer; Sciascia, Barbara; Sciubba, Adalberto; Semennikov, Alexander; Sergi, Antonino; Serra, Nicola; Serrano, Justine; Sestini, Lorenzo; Seyfert, Paul; Shapkin, Mikhail; Shapoval, Illya; Shcheglov, Yury; Shears, Tara; Shekhtman, Lev; Shevchenko, Vladimir; Shires, Alexander; Siddi, Benedetto Gianluca; Silva Coutinho, Rafael; Silva de Oliveira, Luiz Gustavo; Simi, Gabriele; Simone, Saverio; Sirendi, Marek; Skidmore, Nicola; Skwarnicki, Tomasz; Smith, Eluned; Smith, Iwan Thomas; Smith, Jackson; Smith, Mark; Snoek, Hella; Sokoloff, Michael; Soler, Paul; Souza, Daniel; Souza De Paula, Bruno; Spaan, Bernhard; Spradlin, Patrick; Sridharan, Srikanth; Stagni, Federico; Stahl, Marian; Stahl, Sascha; Stefko, Pavol; Stefkova, Slavorima; Steinkamp, Olaf; Stemmle, Simon; Stenyakin, Oleg; Stenzel Martins, Julian; Stevenson, Scott; Stoica, Sabin; Stone, Sheldon; Storaci, Barbara; Stracka, Simone; Straticiuc, Mihai; Straumann, Ulrich; Sun, Liang; Sutcliffe, William; Swientek, Krzysztof; Syropoulos, Vasileios; Szczekowski, Marek; Szumlak, Tomasz; T'Jampens, Stephane; Tayduganov, Andrey; Tekampe, Tobias; Tellarini, Giulia; Teubert, Frederic; Thomas, Christopher; Thomas, Eric; van Tilburg, Jeroen; Tisserand, Vincent; Tobin, Mark; Tolk, Siim; Tomassetti, Luca; Tonelli, Diego; Topp-Joergensen, Stig; Toriello, Francis; Tournefier, Edwige; Tourneur, Stephane; Trabelsi, Karim; Traill, Murdo; Tran, Minh T{â}m; Tresch, Marco; Trisovic, Ana; Tsaregorodtsev, Andrei; Tsopelas, Panagiotis; Tully, Alison; Tuning, Niels; Ukleja, Artur; Ustyuzhanin, Andrey; Uwer, Ulrich; Vacca, Claudia; Vagnoni, Vincenzo; Valat, Sebastien; Valenti, Giovanni; Vallier, Alexis; Vazquez Gomez, Ricardo; Vazquez Regueiro, Pablo; Vecchi, Stefania; van Veghel, Maarten; Velthuis, Jaap; Veltri, Michele; Veneziano, Giovanni; Venkateswaran, Aravindhan; Vernet, Maxime; Vesterinen, Mika; Viaud, Benoit; Vieira, Daniel; Vieites Diaz, Maria; Vilasis-Cardona, Xavier; Volkov, Vladimir; Vollhardt, Achim; Voneki, Balazs; Voong, David; Vorobyev, Alexey; Vorobyev, Vitaly; Voß, Christian; de Vries, Jacco; V{á}zquez Sierra, Carlos; Waldi, Roland; Wallace, Charlotte; Wallace, Ronan; Walsh, John; Wang, Jianchun; Ward, David; Wark, Heather Mckenzie; Watson, Nigel; Websdale, David; Weiden, Andreas; Whitehead, Mark; Wicht, Jean; Wilkinson, Guy; Wilkinson, Michael; Williams, Mark Richard James; Williams, Matthew; Williams, Mike; Williams, Timothy; Wilson, Fergus; Wimberley, Jack; Winn, Michael Andreas; Wishahi, Julian; Wislicki, Wojciech; Witek, Mariusz; Wormser, Guy; Wotton, Stephen; Wraight, Kenneth; Wright, Simon; Wyllie, Kenneth; Xie, Yuehong; Xing, Zhou; Xu, Zhirui; Yang, Zhenwei; Yin, Hang; Yu, Jiesheng; Yuan, Xuhao; Yushchenko, Oleg; Zangoli, Maria; Zarebski, Kristian Alexander; Zavertyaev, Mikhail; Zhang, Liming; Zhang, Yanxi; Zhang, Yu; Zhelezov, Alexey; Zheng, Yangheng; Zhokhov, Anatoly; Zhu, Xianglei; Zhukov, Valery; Zucchelli, Stefano

    2016-11-30

    A study of $B_c^+\\to K^+K^-\\pi^+$ decays is performed for the first time using data corresponding to an integrated luminosity of 3.0 $\\mathrm{fb}^{-1}$ collected by the LHCb experiment in $pp$ collisions at centre-of-mass energies of $7$ and $8$ TeV. Evidence for the decay $B_c^+\\to\\chi_{c0}(\\to K^+K^-)\\pi^+$ is reported with a significance of 4.0 standard deviations, resulting in the measurement of $\\frac{\\sigma(B_c^+)}{\\sigma(B^+)}\\times\\mathcal{B}(B_c^+\\to\\chi_{c0}\\pi^+)$ to be $(9.8^{+3.4}_{-3.0}(\\mathrm{stat})\\pm 0.8(\\mathrm{syst}))\\times 10^{-6}$. Here $\\mathcal{B}$ denotes a branching fraction while $\\sigma(B_c^+)$ and $\\sigma(B^+)$ are the production cross-sections for $B_c^+$ and $B^+$ mesons. An indication of $\\overline b c$ weak annihilation is found for the region $m(K^-\\pi^+)<1.834\\mathrm{\\,Ge\\kern -0.1em V\\!/}c^2$, with a significance of 2.4 standard deviations.

  6. Magnetic polarizabilities of light mesons in SU(3 lattice gauge theory

    Directory of Open Access Journals (Sweden)

    E.V. Luschevskaya

    2015-09-01

    Full Text Available We investigate the ground state energies of neutral pseudoscalar and vector meson in SU(3 lattice gauge theory in the strong abelian magnetic field. The energy of ρ0 meson with zero spin projection sz=0 on the axis of the external magnetic field decreases, while the energies with non-zero spins sz=−1 and +1 increase with the field. The energy of π0 meson decreases as a function of the magnetic field. We calculate the magnetic polarizabilities of pseudoscalar and vector mesons for lattice volume 184. For ρ0 with spin |sz|=1 and π0 meson the polarizabilities in the continuum limit have been evaluated. We do not observe any evidence in favour of tachyonic mode existence.

  7. Mesonic atom production in high-energy nuclear collisions

    International Nuclear Information System (INIS)

    Wakai, M.; Bando, H.; Sano, M.

    1987-08-01

    The production probability of π-mesonic atom in high-energy nuclear collisions is estimated by a coalescence model. The production cross section is calculated for p + Ne and Ne + Ne systems at 2.1 GeV/A and 5.0 GeV/A beam energy. It is shown that nuclear fragments with larger charge numbers have the advantage in the formation of π-mesonic atoms. The cross section is proportional to Z 3 and of the order of magnitude of 1 ∼ 10 μb in all the above cases. The production cross sections of K-mesonic atoms are also estimated. (author)

  8. Bs mesons: semileptonic and nonleptonic decays

    Directory of Open Access Journals (Sweden)

    Albertus C.

    2014-01-01

    Full Text Available In this contribution we compute some nonleptonic and semileptonic decay widths of Bs mesons, working in the context of constituent quark models [1, 2]. For the case of semileptonic decays we consider reactions leading to kaons or different Jπ Ds mesons. The study of nonleptonic decays has been done in the factorisation approximation and includes the final states enclosed in Table 2.

  9. Masses of scalar and axial-vector B mesons revisited

    Energy Technology Data Exchange (ETDEWEB)

    Cheng, Hai-Yang [Academia Sinica, Institute of Physics, Taipei (China); Yu, Fu-Sheng [Lanzhou University, School of Nuclear Science and Technology, Lanzhou (China)

    2017-10-15

    The SU(3) quark model encounters a great challenge in describing even-parity mesons. Specifically, the q anti q quark model has difficulties in understanding the light scalar mesons below 1 GeV, scalar and axial-vector charmed mesons and 1{sup +} charmonium-like state X(3872). A common wisdom for the resolution of these difficulties lies on the coupled channel effects which will distort the quark model calculations. In this work, we focus on the near mass degeneracy of scalar charmed mesons, D{sub s0}{sup *} and D{sub 0}{sup *0}, and its implications. Within the framework of heavy meson chiral perturbation theory, we show that near degeneracy can be qualitatively understood as a consequence of self-energy effects due to strong coupled channels. Quantitatively, the closeness of D{sub s0}{sup *} and D{sub 0}{sup *0} masses can be implemented by adjusting two relevant strong couplings and the renormalization scale appearing in the loop diagram. Then this in turn implies the mass similarity of B{sub s0}{sup *} and B{sub 0}{sup *0} mesons. The P{sub 0}{sup *}P{sub 1}{sup '} interaction with the Goldstone boson is crucial for understanding the phenomenon of near degeneracy. Based on heavy quark symmetry in conjunction with corrections from QCD and 1/m{sub Q} effects, we obtain the masses of B{sup *}{sub (s)0} and B{sup '}{sub (s)1} mesons, for example, M{sub B{sub s{sub 0{sup *}}}} = (5715 ± 1) MeV + δΔ{sub S}, M{sub B}{sup {sub '{sub s{sub 1}}}} = (5763 ± 1) MeV + δΔ{sub S} with δΔ{sub S} being 1/m{sub Q} corrections. We find that the predicted mass difference of 48 MeV between B{sup '}{sub s1} and B{sub s0}{sup *} is larger than that of 20-30 MeV inferred from the relativistic quark models, whereas the difference of 15 MeV between the central values of M{sub B}{sup {sub '{sub s{sub 1}}}} and M{sub B}{sup {sub '{sub 1}}} is much smaller than the quark model expectation of 60-100 MeV. Experimentally, it is important to have a precise

  10. C(1480) meson and electromagnetic processes

    International Nuclear Information System (INIS)

    Landsberg, L.G.

    1992-01-01

    Possible processes of production of the vector meson C(1480) → var-phi π, a candidate for exotic states, in electromagnetic processes are considered [photoproduction, e + e - →C(1480) → var-phi π 0 , and the reaction of production of C(1480) in the Coulomb field of a nucleus]. It is shown that coherent Coulomb production of the C(1480) meson allows one to determine the absolute value of BR[C(1480) → var-phi π], which is essential for the interpretation of the nature of this hadron. Possibilities of observing C(1480) mesons in e + e - collisions at the var-phi factory DAΦNE are studied. 27 refs., 12 figs., 1 tab

  11. Spin O decay angular distribution for interfering mesons in electroproduction

    Energy Technology Data Exchange (ETDEWEB)

    Funsten, H.; Gilfoyle, G.

    1994-04-01

    Self analyzing meson electroproduction experiments are currently being planned for the CEBAF CLAS detector. These experiments deduce the spin polarization of outgoing unstable spin s (?)0 mesons from their decay angular distribution, W({theta},{psi}). The large angular acceptance of the CLAS detector permits kinematic tracking of a sufficient number of these events to accurately determine electroproduction amplitudes from the deduced polarization. Maximum polarization information is obtained from W({theta},{psi}) for decay into spin 0 daughters. The helicity of the decaying meson is transferred to the daughter`s relative orbital angular momentum m-projection; none is {open_quotes}absorbed{close_quotes} into daughter helicities. The decaying meson`s helicity maximally appears in W({theta},{psi}). W({theta},{psi}) for spin 0 daughters has been derived for (1) vector meson electroproduction and (2) general interfering mesons produced by incident pions. This paper derives W({theta},{psi}) for electroproduction of two interfering mesons that decay into spin 0 daughters. An application is made to the case of interfering scalar and vector mesons. The derivation is an extension of work by Schil using the general decay formalism of Martin. The expressions can be easily extended to the case of N interfering mesons since interference occurs pairwise in the observable W ({theta},{psi}), a quadratic function of the meson amplitudes. The derivation uses the virtual photon density matrix of Schil which is transformed by a meson electroproduction transition operator, T. The resulting density matrix for the interfering mesons is then converted into a corresponding statistical tensor and contracted into the efficiency tensor for spin 0 daughters.

  12. Plasma YKL-40 and CHI3L1 in systemic inflammation and sepsis—Experience from two prospective cohorts

    DEFF Research Database (Denmark)

    Kornblit, Brian; Hellemann, Dorthe; Munthe-Fog, Lea

    2013-01-01

    YKL-40, derived from the CHI3L1 gene, has been associated with outcome of infectious and inflammatory diseases. We hypothesized that plasma YKL-40 concentrations and CHI3L1 genotype could be used as prognostic biomarkers in the assessment of systemic inflammatory response syndrome (SIRS) and sepsis....... The objective of the study was to assess the prognostic value of plasma YKL-40 and CHI3L1 genotype in patients with SIRS and sepsis. Plasma YKL-40 and CHI3L1 genotype (rs4950928) were analyzed at time of admission to intensive care units (ICU), in two prospective cohorts of consecutive SIRS patients (cohort 1...

  13. Measurement of D{sup *} meson with two jets in photoproduction with the H1 detector at HERA

    Energy Technology Data Exchange (ETDEWEB)

    Staykova, Zlatka

    2011-02-15

    Photoproduction events containing a charmed meson D{sup *{+-}} and two jets are investigated with the H1 detector using the HERA II data sample. The measurement is based on e{sup +}p collisions during the period of 2006/2007 data taking and uses integrated luminosity of 113.14 pb{sup -1}. The kinematic range of the measurement covers 100 GeVmesons are reconstructed in the decay channel, D{sup *{+-}}{yields}D{sup 0}{pi}{sup {+-}}{yields}K{sup -+}{pi}{sup {+-}}{pi}{sup {+-}}. Jets were reconstructed using the inclusive k{sub t} algorithm and are selected if they have transverse momenta of p{sub t}(jet)>3.5 GeV. One of the jets has to be associated with the D{sup *} meson itself, such that the parent charmed quark can be tagged. The phase space of the measurement is limited within the central rapidity for the D{sup *} meson and the D{sup *}{sub jet}, vertical stroke {eta} vertical stroke <1.5 while the second jet was measured within, -1.5<{eta}<2.9. Single differential cross sections and double differential distributions were measured and compared to Leading Order Monte Carlo (MC) event generators, Pythia and Cascade and with the Next-to-Leading order MC generator MC rate at NLO. (orig.)

  14. NLO NRQCD disfavors the interpretation of X(3872) as {chi}{sub c1}(2P)

    Energy Technology Data Exchange (ETDEWEB)

    Butenschoen, Mathias [Wien Univ. (Austria). Fakultaet fuer Physik; He, Zhi-Guo; Kniehl, Bernd A. [Hamburg Univ. (Germany). 2. Inst. fuer Theoretische Physik

    2013-03-15

    We study {chi}{sub c1}(2P) inclusive hadroproduction at next-to-leading order (NLO) within the factorization formalism of nonrelativistic quantum chromodynamics (NRQCD), including both the color-singlet {sup 3}P{sub 1}{sup [1]} and color-octet {sup 3}S{sub 1}{sup [8]} c anti c Fock states. Assuming the recently discovered X(3872) hadron to be the 2P (1{sup ++}) charmonium state, we perform a fit to the cross sections measured by the CDF, CMS, and LHCb Collaborations. We either obtain an unacceptably high value of {chi}{sup 2} or a value of vertical stroke R{sub 2P}{sup '}(0) vertical stroke incompatible with well-established potential models. We thus conclude that NLO NRQCD is incompatible with the hypothesis X(3872){identical_to}{chi}{sub c1}(2P).

  15. Inclusive decays of the B meson and possible life-time difference between Bd0 and B± mesons

    International Nuclear Information System (INIS)

    Tanimoto, Morimitsu

    1992-01-01

    We study branching ratios of the inclusive semileptonic decay and the inclusive anti ccanti s decay of the B meson in the spectator model, focusing on the life-time difference between B d 0 and B + mesons. In the case of τsub(B ± )/τsub(B d 0 )=1, it is impossible to get the branching ratio below 12% for B→eνX without going over 20% for B→anti ccanti s, which is unfavored by the inclusive K - decay of the B meson. It is found that the sizable life-time difference leads to the reasonable inclusive semileptonic decay rate and the inclusive anti ccanti s decay rate. (orig.)

  16. Observation and study of bottom-meson decays to a charm meson, a proton-antiproton pair, and pions

    Energy Technology Data Exchange (ETDEWEB)

    Hong, Tae Min [Univ. of California, Santa Barbara, CA (United States)

    2010-04-27

    Bottom-meson decays with baryons show two unusual features—the branching fractions are enhanced for multibody decays and the baryon-antibaryon subsystem recoils against the other decay products—and their reasons are not yet well understood. Moreover, measurements using explicit reconstruction techniques constitute only about 1% out of about 8% of such decays. This Dissertation reports the study of ten bottom-meson decays (labeled 0– 9) to a proton-antiproton pair, a charm meson, and a system of up to two pions, using the BABAR Experiment’s 455×106 BB pairs produced with the PEP-II asymmetric-energy e+e- collider at the Stanford Linear Accelerator Center.

  17. A Study of Exclusive Nonleptonic Decays of $B$ Mesons into Final States of Strange Mesons and 1S or 2S Charmonia

    Energy Technology Data Exchange (ETDEWEB)

    Warburton, Andreas T. [Univ. of Toronto, ON (Canada)

    1998-01-01

    Bound states of heavy quarks can serve as a laboratory for inquiry into the behaviour of the fundamental strong and electroweak interactions. This thesis examines observations of B0, $\\bar{B}$0, and B± mesons produced in proton-antiproton collisions at centre-of-mass energies of √s=1.8 TeV.

  18. Decays of mesons with charm quarks on the lattice

    International Nuclear Information System (INIS)

    Ali Khan, A.; Braun, V.; Burch, T.; Goeckeler, M.; Schaefer, A.; Schierholz, G.

    2007-10-01

    We investigate mesons containing charm quarks on fine lattices with a -1 ∝ 5 GeV. The quenched approximation is employed using theWilson gauge action at β = 6.6 and nonperturbatively O(a) improvedWilson quarks. We present results for decay constants using various interpolating fields and give preliminary results for form factors of semileptonic decays of D s mesons to light pseudoscalar mesons. (orig.)

  19. Criticality in the configuration-mixed interacting boson model (1) $U(5)-\\hat{Q}(\\chi)\\cdot\\hat{Q}(\\chi)$ mixing

    CERN Document Server

    Hellemans, V; De Baerdemacker, S; Heyde, K

    2008-01-01

    The case of U(5)--$\\hat{Q}(\\chi)\\cdot\\hat{Q}(\\chi)$ mixing in the configuration-mixed Interacting Boson Model is studied in its mean-field approximation. Phase diagrams with analytical and numerical solutions are constructed and discussed. Indications for first-order and second-order shape phase transitions can be obtained from binding energies and from critical exponents, respectively.

  20. Chiral symmetry breaking and the spin content of the ρ and ρ‧ mesons

    Science.gov (United States)

    Glozman, L. Ya.; Lang, C. B.; Limmer, M.

    2011-11-01

    Using interpolators with different SU(2)L × SU(2)R transformation properties we study the chiral symmetry and spin contents of the ρ and ρ‧ mesons in lattice simulations with dynamical quarks. A ratio of couplings of the qbarγi τq and qbarσ0i τq interpolators to a given meson state at different resolution scales tells one about the degree of chiral symmetry breaking in the meson wave function at these scales. Using a Gaussian gauge invariant smearing of the quark fields in the interpolators, we are able to extract the chiral content of mesons up to the infrared resolution of ∼ 1 fm. In the ground state ρ meson the chiral symmetry is strongly broken with comparable contributions of both the (0 , 1) + (1 , 0) and (1 / 2 , 1 / 2) b chiral representations with the former being the leading contribution. In contrast, in the ρ‧ meson the degree of chiral symmetry breaking is manifestly smaller and the leading representation is (1 / 2 , 1 / 2) b. Using a unitary transformation from the chiral basis to the LJ2S+1 basis, we are able to define and measure the angular momentum content of mesons in the rest frame. This definition is different from the traditional one which uses parton distributions in the infinite momentum frame. The ρ meson is practically a 3S1 state with no obvious trace of a "spin crisis". The ρ‧ meson has a sizeable contribution of the 3D1 wave, which implies that the ρ‧ meson cannot be considered as a pure radial excitation of the ρ meson.

  1. First measurement of the B S meson mass

    Science.gov (United States)

    Buskulic, D.; De Bonis, I.; Decamp, D.; Ghez, P.; Goy, C.; Lees, J.-P.; Minard, M.-N.; Pietrzyk, B.; Ariztizabal, F.; Comas, P.; Crespo, J. M.; Delfino, M.; Efthymiopoulos, I.; Fernandez, E.; Fernandez-Bosman, M.; Gaitan, V.; Garrido, Ll.; Mattison, T.; Pacheco, A.; Padilla, C.; Pascual, A.; Creanza, D.; de Palma, M.; Farilla, A.; Iaselli, G.; Maggi, G.; Natali, S.; Nuzzo, S.; Quattromini, M.; Ranieri, A.; Raso, G.; Romano, F.; Ruggieri, F.; Selvaggi, G.; Silvestris, L.; Tempesta, P.; Zito, G.; Chai, Y.; Hu, H.; Huang, D.; Huang, X.; Lin, J.; Wang, T.; Xie, Y.; Xu, D.; Xu, R.; Zhang, J.; Zhang, L.; Zhao, W.; Blucher, E.; Bonvicini, G.; Boudreau, J.; Casper, D.; Drevermann, H.; Forty, R. W.; Ganis, G.; Gay, C.; Hagelberg, R.; Harvey, J.; Haywood, S.; Hilgart, J.; Jacobsen, R.; Jost, B.; Knobloch, J.; Lehraus, I.; Lohse, T.; Maggi, M.; Markou, C.; Martinez, M.; Mato, P.; Meinhard, H.; Minten, A.; Miotto, A.; Miquel, R.; Moser, H.-G.; Palazzi, P.; Pater, J. R.; Perlas, J. A.; Pusztaszeri, J.-F.; Ranjard, F.; Redlinger, G.; Rolandi, L.; Rothberg, J.; Ruan, T.; Saich, M.; Schlatter, D.; Schmelling, M.; Sefkow, F.; Tejessy, W.; Veenhof, R.; Wachsmuth, H.; Wiedenmann, W.; Wildish, T.; Witzeling, W.; Wotschack, J.; Ajaltouni, Z.; Badaud, F.; Bardadin-Otwinowska, M.; El Fellous, R.; Falvard, A.; Gay, P.; Guicheney, C.; Henrard, P.; Jousset, J.; Michel, B.; Montret, J.-C.; Pallin, D.; Perret, P.; Podlyski, F.; Proriol, J.; Prulhière, F.; Saadi, F.; Fearnley, T.; Hansen, J. D.; Hansen, J. R.; Hansen, P. H.; Møllerud, R.; Nilsson, B. S.; Kyriakis, A.; Simopoulou, E.; Vayaki, A.; Zachariadou, K.; Badier, J.; Blondel, A.; Bonneaud, G.; Brient, J. C.; Fouque, G.; Orteu, S.; Rougé, A.; Rumpf, M.; Tanaka, R.; Verderi, M.; Videau, H.; Candlin, D. J.; Parsons, M. I.; Veitch, E.; Focardi, E.; Moneta, L.; Parrini, G.; Corden, M.; Georgiopoulos, C.; Ikeda, M.; Lannutti, J.; Levinthal, D.; Sawyer, L.; Wasserbaech, S.; Antonelli, A.; Baldini, R.; Bencivenni, G.; Bologna, G.; Bossi, F.; Campana, P.; Capon, G.; Cerutti, F.; Chiarella, V.; D'Ettorre-Piazzoli, B.; Felici, G.; Laurelli, P.; Mannocchi, G.; Murtas, F.; Murtas, G. P.; Passalacqua, L.; Pepe-Altarelli, M.; Picchi, P.; Colrain, P.; ten Have, I.; Lynch, J. G.; Maitland, W.; Morton, W. T.; Raine, C.; Reeves, P.; Scarr, J. M.; Smith, K.; Smith, M. G.; Thompson, A. S.; Turnbull, R. M.; Brandl, B.; Braun, O.; Geweniger, C.; Hanke, P.; Hepp, V.; Kluge, E. E.; Maumary, Y.; Putzer, A.; Rensch, B.; Stahl, A.; Tittel, K.; Wunsch, M.; Beuselinck, R.; Binnie, D. M.; Cameron, W.; Cattaneo, M.; Colling, D. J.; Dornan, P. J.; Greene, A. M.; Hassard, J. F.; Lieske, N. M.; Moutoussi, A.; Nash, J.; Patton, S.; Payne, D. G.; Phillips, M. J.; San Martin, G.; Sedgbeer, J. K.; Tomalin, I. R.; Wright, A. G.; Girtler, P.; Kneringer, E.; Kuhn, D.; Rudolph, G.; Bowdery, C. K.; Brodbeck, T. J.; Finch, A. J.; Foster, F.; Hughes, G.; Jackson, D.; Keemer, N. R.; Nuttall, M.; Patel, A.; Sloan, T.; Snow, S. W.; Whelan, E. P.; Kleinknecht, K.; Raab, J.; Renk, B.; Sander, H.-G.; Schmidt, H.; Steeg, F.; Walther, S. M.; Wanke, R.; Wolf, B.; Bencheikh, A. M.; Benchouk, C.; Bonissent, A.; Carr, J.; Coyle, P.; Drinkard, J.; Etienne, F.; Nicod, D.; Papalexiou, S.; Payre, P.; Roos, L.; Rousseau, D.; Schwemling, P.; Talby, M.; Adlung, S.; Assmann, R.; Bauer, C.; Blum, W.; Brown, D.; Cattaneo, P.; Dehning, B.; Dietl, H.; Dydak, F.; Frank, M.; Halley, A. W.; Jacobs, K.; Lauber, J.; Lütjens, G.; Lutz, G.; Männer, W.; Richter, R.; Schröder, J.; Schwarz, A. S.; Settles, R.; Seywerd, H.; Stierlin, U.; Stiegler, U.; St. Denis, R.; Wolf, G.; Alemany, R.; Boucrot, J.; Callot, O.; Cordier, A.; Davier, M.; Duflot, L.; Grivaz, J.-F.; Heusse, Ph.; Jaffe, D. E.; Janot, P.; Kim, D. W.; Le Diberder, F.; Lefrançois, J.; Lutz, A.-M.; Schune, M.-H.; Veillet, J.-J.; Videau, I.; Zhang, Z.; Abbaneo, D.; Bagliesi, G.; Batignani, G.; Bottigli, U.; Bozzi, C.; Calderini, G.; Carpinelli, M.; Ciocci, M. A.; Dell'Orso, R.; Ferrante, I.; Fidecaro, F.; Foà, L.; Forti, F.; Giassi, A.; Giorgi, M. A.; Gregorio, A.; Ligabue, F.; Lusiani, A.; Mannelli, E. B.; Marrocchesi, P. S.; Messineo, A.; Palla, F.; Rizzo, G.; Sanguinetti, G.; Spagnolo, P.; Steinberger, J.; Tenchini, R.; Tonelli, G.; Triggiani, G.; Vannini, C.; Venturi, A.; Verdini, P. G.; Walsh, J.; Betteridge, A. P.; Carter, J. M.; Gao, Y.; Green, M. G.; March, P. V.; Mir, Ll. M.; Medcalf, T.; Quazi, I. S.; Strong, J. A.; West, L. R.; Botterill, D. R.; Clifft, R. W.; Edgecock, T. R.; Norton, P. R.; Thompson, J. C.; Bloch-Devaux, B.; Colas, P.; Duarte, H.; Emery, S.; Kozanecki, W.; Lançon, E.; Lemaire, M. C.; Locci, E.; Marx, B.; Perez, P.; Rander, J.; Renardy, J.-F.; Rosowsky, A.; Roussarie, A.; Schuller, J.-P.; Schwindling, J.; Si Mohand, D.; Vallage, B.; Johnson, R. P.; Litke, A. M.; Taylor, G.; Wear, J.; Ashman, J. G.; Babbage, W.; Booth, C. N.; Buttar, C.; Cartwright, S.; Combley, F.; Dawson, I.; Thompson, L. F.; Barberio, E.; Böhrer, A.; Brandt, S.; Cowan, G.; Grupen, C.; Lutters, G.; Rivera, F.; Schäfer, U.; Smolik, L.; Bosisio, L.; Della Marina, R.; Giannini, G.; Gobbo, B.; Ragusa, F.; Bellantoni, L.; Chen, W.; Cinabro, D.; Conway, J. S.; Feng, Z.; Ferguson, D. P. S.; Gao, Y. S.; Grahl, J.; Harton, J. L.; LeClaire, B. W.; Lishka, C.; Pan, Y. B.; Saadi, Y.; Schmitt, M.; Sharma, V.; Shi, Z. H.; Walsh, A. M.; Weber, F. V.; Wu, Sau Lan; Wu, X.; Zheng, M.; Zobernig, G.

    1993-07-01

    In a sample of about 1.1 million hadronic Z decays recorded with the ALEPH detector during the 1990-1992 running of LEP, two unambiguous B S meson candidates were observed. From these events the mass of the B S meson has been measured to be 5.3686 ± 0.0056 (stat.) ± 0.0015 (syst.) GeV.

  2. THE ETA-MESON PHOTOPRODUCTION ON PROTON

    Czech Academy of Sciences Publication Activity Database

    Donoval, Jan; Bydžovský, Petr

    2011-01-01

    Roč. 26, 3-4 (2011), s. 645-646 ISSN 0217-751X. [11th International Workshop on Meson Production , Properties and Interaction. Krakow, 10.06.2010-15.06.2010] R&D Projects: GA ČR GA202/08/0984 Institutional research plan: CEZ:AV0Z10480505 Keywords : Eta-meson photoproduction * form factors * nucleon resonances Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.053, year: 2011

  3. Hybrid mesons with auxiliary fields

    International Nuclear Information System (INIS)

    Buisseret, F.; Mathieu, V.

    2006-01-01

    Hybrid mesons are exotic mesons in which the color field is not in the ground state. Their understanding deserves interest from a theoretical point of view, because it is intimately related to nonperturbative aspects of QCD. Moreover, it seems that some recently detected particles, such as the π 1 (1600) and the Y(4260), are serious hybrid candidates. In this work, we investigate the description of such exotic hadrons by applying the auxiliary fields technique (also known as the einbein field method) to the widely used spinless Salpeter Hamiltonian with appropriate linear confinement. Instead of the usual numerical resolution, this technique allows to find simplified analytical mass spectra and wave functions of the Hamiltonian, which still lead to reliable qualitative predictions. We analyse and compare two different descriptions of hybrid mesons, namely a two-body q system with an excited flux tube, or a three-body qg system. We also compute the masses of the 1 -+ hybrids. Our results are shown to be in satisfactory agreement with lattice QCD and other effective models. (orig.)

  4. On meson resonances and chiral symmetry

    International Nuclear Information System (INIS)

    Lutz, M.F.M.

    2003-07-01

    We study meson resonances with quantum numbers J P = 1 + in terms of the chiral SU(3) Lagrangian. At leading order a parameter-free prediction is obtained for the scattering of Goldstone bosons off vector mesons with J P = 1 - once we insist on approximate crossing symmetry of the unitarized scattering amplitude. A resonance spectrum arises that is remarkably close to the empirical pattern. In particular, we find that the strangeness-zero resonances h 1 (1380), f 1 (1285) and b 1 (1235) are formed due to strong K anti K μ and K K μ channels. This leads to large coupling constants of those resonances to the latter states. (orig.)

  5. About direct CP violation in the system of K0 mesons

    International Nuclear Information System (INIS)

    Beshtoev, Kh.M.

    2012-01-01

    This work is devoted to computation of the parameter of direct CP violation by the weak interactions in the system of K 0 mesons at K 1 0 -, K 2 0 -meson mixings and oscillations via K S -, K L -meson states

  6. Measurement of the D± meson cross section in DIS with the H1 detector at HERA

    International Nuclear Information System (INIS)

    Pahl, Philipp

    2014-04-01

    The inclusive production of D ± mesons in deep inelastic scattering at √(s)=318 GeV at HERA is studied using data taken with the Hl detector during the high energy measurement period in the years 2006 and 2007 corresponding to an integrated luminosity of 202.6 pb -1 . The visible phase space is defined by 5 2 2 , 0.05 T (D ± ) and -1.5 ± ) 2 is the photon virtuality, y is the inelasticity and p T (D ± ) and η(D ± ) are the transverse momentum and rapidity of the D ± meson. Charm production events are identified by the reconstruction of the D ± →K -+ π ± π ± decay channel. The sample is enhanced by the application of a multi-variate analysis technique using a multilayer perceptron. The input variables of the classifier are based on the specific energy loss of the kaon decay particle candidate and the reconstructed decay length of the D ± meson. The single and double differential cross sections are compared to leading and next-to-leading order QCD predictions.

  7. Meson spectroscopy at the Serpukhov accelerator

    International Nuclear Information System (INIS)

    Prokoshkin, Yu.D.

    1987-01-01

    At present meson spectroscopy is a dominating direction of experimental studies at the IHEP accelerator. The main attention is paid to the search and study of exotic meson states. This report presents some new results obtained recently at the IHEP accelerator. First, observation is made of a narrow 1750 MeV meson decays into ηη. Above |t| ∼ 0.2 (GeV-c) 2 (t: a square of 4-momentum transferred to a neutron), a clear narrow peak appears in Mηη mass spectrum at a mass of 1750 MeV. Second, 2.22 GeV narrow meson decaying into η'η is described. At present only premature conclusions have been obtained in this area and the situation with ζ is not clear. Third, a study is made on new exotic tensor meson χ(1810) decaying into 4π deg and ηη channels. The decay M deg → 4π deg is a very promissing instrument in search for exotic mesons. Next, G(1590)-meson as a scalar glueball is discussed. BR(G → 4π deg) has a large value, an independent evidence of the exotic nature of G(1590)-meson. Experimental data obtained on all essential decay channels of G(1590)-meson allows to give a selfconsistent description of its production and decay as the scalar glueball, a particle with the dominating gluon component. The final two parts deal with exotic vector meson C(1480) decaying into ψπ deg and observation of D(1285) → ψγ decay. (Nogami, K.)

  8. Short-distance matrix elements for $D$-meson mixing for 2+1 lattice QCD

    Energy Technology Data Exchange (ETDEWEB)

    Chang, Chia Cheng [Univ. of Illinois, Champaign, IL (United States)

    2015-01-01

    We study the short-distance hadronic matrix elements for D-meson mixing with partially quenched Nf = 2+1 lattice QCD. We use a large set of the MIMD Lattice Computation Collaboration's gauge configurations with a2 tadpole-improved staggered sea quarks and tadpole-improved Lüscher-Weisz gluons. We use the a2 tadpole-improved action for valence light quarks and the Sheikoleslami-Wohlert action with the Fermilab interpretation for the valence charm quark. Our calculation covers the complete set of five operators needed to constrain new physics models for D-meson mixing. We match our matrix elements to the MS-NDR scheme evaluated at 3 GeV. We report values for the Beneke-Buchalla-Greub-Lenz-Nierste choice of evanescent operators.

  9. Study of light mesons with WASA-at-COSY

    Science.gov (United States)

    Prencipe, Elisabetta

    2014-06-01

    The WASA detector, operating at the COSY facility in Jülich (Germany) has been collecting data since 2007. The experiment allows to perform studies of light mesons, such as π0, η and ω rare decay processes, in order to perform precise measurements of branching ratios, determine Dalitz plot parameters, test symmetry and symmetry breaking, and evaluate transition form factors. In the experiments a proton or deuteron beam impinged on a pellet target of hydrogen or deuterium, which allows the reactions proton-proton (pp) or proton-deuteron (pd). A high-statistics sample of η mesons has been collected: in the reaction pd →3He η, 3×107η mesons were tagged at a beam energy of 1.0 GeV, while 5×108η mesons were produced in the reaction pp → ppη at 1.4 GeV. This corresponds to the production of 10 η/s and 100 η/s, respectively, for the two reaction processes. In the pp dataset a higher background level is found compared to the pd data set. In both cases, we identify the η mesons by means of the missing mass derived from the recoil particles. A kinematic fit largely rejects the background in our analysis. The advantage in using the pp dataset is that the production of η mesons is almost a factor of 10 higher than in the pd fusion to 3He. As we plan to measure the branching ratios of very rare processes, high statistics is needed. A summary of the recent activity on the study of light mesons with WASA-at-COSY here is given.

  10. Study of light mesons with WASA-at-COSY

    Directory of Open Access Journals (Sweden)

    Prencipe Elisabetta

    2014-06-01

    Full Text Available The WASA detector, operating at the COSY facility in Jülich (Germany has been collecting data since 2007. The experiment allows to perform studies of light mesons, such as π0, η and ω rare decay processes, in order to perform precise measurements of branching ratios, determine Dalitz plot parameters, test symmetry and symmetry breaking, and evaluate transition form factors. In the experiments a proton or deuteron beam impinged on a pellet target of hydrogen or deuterium, which allows the reactions proton-proton (pp or proton-deuteron (pd. A high-statistics sample of η mesons has been collected: in the reaction pd →3He η, 3×107η mesons were tagged at a beam energy of 1.0 GeV, while 5×108η mesons were produced in the reaction pp → ppη at 1.4 GeV. This corresponds to the production of 10 η/s and 100 η/s, respectively, for the two reaction processes. In the pp dataset a higher background level is found compared to the pd data set. In both cases, we identify the η mesons by means of the missing mass derived from the recoil particles. A kinematic fit largely rejects the background in our analysis. The advantage in using the pp dataset is that the production of η mesons is almost a factor of 10 higher than in the pd fusion to 3He. As we plan to measure the branching ratios of very rare processes, high statistics is needed. A summary of the recent activity on the study of light mesons with WASA-at-COSY here is given.

  11. Measurement of Charm Meson Lifetimes

    International Nuclear Information System (INIS)

    Bonvicini, G.; Cinabro, D.; Greene, R.; Perera, L.P.; Zhou, G.J.; Chan, S.; Eigen, G.; Lipeles, E.; Schmidtler, M.; Shapiro, A.; Sun, W.M.; Urheim, J.; Weinstein, A.J.; Wuerthwein, F.; Jaffe, D.E.; Masek, G.; Paar, H.P.; Potter, E.M.; Prell, S.; Sharma, V.; Asner, D.M.; Eppich, A.; Gronberg, J.; Hill, T.S.; Korte, C.M.; Lange, D.J.; Morrison, R.J.; Nelson, H.N.; Nelson, T.K.; Roberts, D.; Tajima, H.; Behrens, B.H.; Ford, W.T.; Gritsan, A.; Krieg, H.; Roy, J.; Smith, J.G.; Alexander, J.P.; Baker, R.; Bebek, C.; Berger, B.E.; Berkelman, K.; Boisvert, V.; Cassel, D.G.; Crowcroft, D.S.; Dickson, M.; Dombrowski, S. von; Drell, P.S.; Dumas, D.J.; Ecklund, K.M.; Ehrlich, R.; Foland, A.D.; Gaidarev, P.; Gibbons, L.; Gittelman, B.; Gray, S.W.; Hartill, D.L.; Heltsley, B.K.; Henderson, S.; Hopman, P.I.; Katayama, N.; Kreinick, D.L.; Lee, T.; Liu, Y.; Meyer, T.O.; Mistry, N.B.; Ng, C.R.; Nordberg, E.; Ogg, M.; Patterson, J.R.; Peterson, D.; Riley, D.; Soffer, A.; Thayer, J.G.; Thies, P.G.; Valant-Spaight, B.; Warburton, A.; Ward, C.; Athanas, M.; Avery, P.; Jones, C.D.; Lohner, M.; Prescott, C.; Rubiera, A.I.; Yelton, J.; Zheng, J.; Brandenburg, G.; Briere, R.A.; Ershov, A.; Gao, Y.S.; Kim, D.Y.; Wilson, R.; Browder, T.E.; Li, Y.; Rodriguez, J.L.; Yamamoto, H.; Bergfeld, T.; Eisenstein, B.I.; Ernst, J.; Gladding, G.E.; Gollin, G.D

    1999-01-01

    We report measurements of the D 0 , D + , and D + s meson lifetimes using 3.7 fb -1 of e + e - annihilation data collected near the Υ(4S) resonance with the CLEO detector. The measured lifetimes of the D 0 , D + , and D + s mesons are 408.5±4.1 +3.5 -3.4 fs , 1033.6±22.1 +9.9 -12.7 fs , and 486.3±15.0 +4.9 -5.1 fs . The precision of these lifetimes are comparable to those of the best previous measurements, and the systematic errors are very different. In a single experiment we find that the ratio of the D + s and D 0 lifetimes is 1.19±0.04 . copyright 1999 The American Physical Society

  12. Deep electroproduction of exotic hybrid mesons

    International Nuclear Information System (INIS)

    Anikin, I.V.; Pire, B.; Szymanowski, L.; Teryaev, O.V.; Wallon, S.

    2004-01-01

    We evaluate the leading order amplitude for the deep exclusive electroproduction of an exotic hybrid meson in the Bjorken regime. We show that, contrarily to naive expectation, this amplitude factorizes at the twist 2 level and thus scales like usual meson electroproduction when the virtual photon and the hybrid meson are longitudinally polarized. Exotic hybrid mesons may thus be studied in electroproduction experiments at JLAB, HERA (HERMES) or CERN (Compass)

  13. Neutral and charged scalar mesons, pseudoscalar mesons, and diquarks in magnetic fields

    Science.gov (United States)

    Liu, Hao; Wang, Xinyang; Yu, Lang; Huang, Mei

    2018-04-01

    We investigate both (pseudo)scalar mesons and diquarks in the presence of external magnetic field in the framework of the two-flavored Nambu-Jona-Lasinio (NJL) model, where mesons and diquarks are constructed by infinite sum of quark-loop chains by using random phase approximation. The polarization function of the quark-loop is calculated to the leading order of 1 /Nc expansion by taking the quark propagator in the Landau level representation. We systematically investigate the masses behaviors of scalar σ meson, neutral and charged pions as well as the scalar diquarks, with respect to the magnetic field strength at finite temperature and chemical potential. It is shown that the numerical results of both neutral and charged pions are consistent with the lattice QCD simulations. The mass of the charge neutral pion keeps almost a constant under the magnetic field, which is preserved by the remnant symmetry of QCD ×QED in the vacuum. The mass of the charge neutral scalar σ is around two times quark mass and increases with the magnetic field due to the magnetic catalysis effect, which is an typical example showing that the polarized internal quark structure cannot be neglected when we consider the meson properties under magnetic field. For the charged particles, the one quark-antiquark loop contribution to the charged π± increases essentially with the increase of magnetic fields due to the magnetic catalysis of the polarized quarks. However, the one quark-quark loop contribution to the scalar diquark mass is negative comparing with the point-particle result and the loop effect is small.

  14. Polarization of J / psi and psi(2S) mesons produced in p anti-p collisions at s**(1/2) = 1.96-TeV

    Energy Technology Data Exchange (ETDEWEB)

    Abulencia, A.; /Illinois U., Urbana; Adelman, J.; /Chicago U.; Affolder, T.; /UC, Santa Barbara; Akimoto, T.; /Tsukuba U.; Albrow, M.G.; /Fermilab; Amerio, S.; /Padua U.; Amidei, D.; /Michigan U.; Anastassov, A.; /Rutgers U., Piscataway; Anikeev, K.; /Fermilab; Annovi, A.; /Frascati; Antos, J.; /Comenius U. /Tsukuba U.

    2007-04-01

    The authors have measured the polarizations of J/{psi} and {psi}(2S) mesons as functions of their transverse momentum p{sub T} when they are produced promptly in the rapidity range |y| < 0.6 with p{sub T} {ge} 5 GeV/c. The analysis is performed using a data sample with an integrated luminosity of about 800 pb{sup -1} collected by the CDF II detector. For both vector mesons, they find that the polarizations become increasingly longitudinal as p{sub T} increases from 5 to 30 GeV/c. These results are compared to the predictions of non-relativistic quantum chromo-dynamics and other contemporary models. The polarizations of J/{psi} and {psi}(2S) mesons from B-hadron decays are also reported.

  15. D{sub s1}{sup *}(2860) and D{sub s3}{sup *}(2860): candidates for 1D charmed-strange mesons

    Energy Technology Data Exchange (ETDEWEB)

    Song, Qin-Tao [Chinese Academy of Sciences, Nuclear Theory Group, Institute of Modern Physics, Lanzhou (China); Lanzhou University and Institute of Modern Physics of CAS, Research Center for Hadron and CSR Physics, Lanzhou (China); University of Chinese Academy of Sciences, Beijing (China); Chen, Dian-Yong [Chinese Academy of Sciences, Nuclear Theory Group, Institute of Modern Physics, Lanzhou (China); Lanzhou University and Institute of Modern Physics of CAS, Research Center for Hadron and CSR Physics, Lanzhou (China); Liu, Xiang [Lanzhou University and Institute of Modern Physics of CAS, Research Center for Hadron and CSR Physics, Lanzhou (China); Lanzhou University, School of Physical Science and Technology, Lanzhou (China); Matsuki, Takayuki [Tokyo Kasei University, Tokyo (Japan); RIKEN, Theoretical Research Division, Nishina Center, Saitama (Japan)

    2015-01-01

    Newly observed two charmed-strange resonances, D{sub s1}{sup *}(2860) and D{sub s3}{sup *}(2860), are investigated by calculating their Okubo-Zweig-Iizuka-allowed strong decays, which shows that they are suitable candidates for the 1{sup 3}D{sub 1} and 1{sup 3}D{sub 3} states in the charmed-strange meson family. Our study also predicts other main decay modes of D{sub s1}{sup *}(2860) and D{sub s3}{sup *}(2860), which can be accessible at the future experiment. In addition, the decay behaviors of the spin partners of D{sub s1}{sup *}(2860) and D{sub s3}{sup *}(2860), i.e., 1D(2{sup -}) and 1D'(2{sup -}), are predicted in this work, which are still missing at present. The experimental search for the missing 1D(2{sup -}) and 1D'(2{sup -}) charmed-strange mesons is an intriguing and challenging task for further experiments. (orig.)

  16. Measurement of the B+ and B0 meson lifetimes

    International Nuclear Information System (INIS)

    Abe, F.; Albrow, M.; Amidei, D.; Anway-Wiese, C.; Apollinari, G.; Areti, H.; Auchincloss, P.; Azfar, F.; Azzi, P.; Bacchetta, N.; Badgett, W.; Bailey, M.W.; Bao, J.; de Barbaro, P.; Barbaro-Galtieri, A.; Barnes, V.E.; Barnett, B.A.; Bartalini, P.; Bauer, G.; Baumann, T.; Bedeschi, F.; Behrends, S.; Belforte, S.; Bellettini, G.; Bellinger, J.; Benjamin, D.; Benlloch, J.; Benton, D.; Beretvas, A.; Berge, J.P.; Bertolucci, S.; Bhatti, A.; Biery, K.; Binkley, M.; Bird, F.; Bisello, D.; Blair, R.E.; Blocker, C.; Bodek, A.; Bolognesi, V.; Bortoletto, D.; Boswell, C.; Boulos, T.; Brandenburg, G.; Buckley-Geer, E.; Budd, H.S.; Burkett, K.; Busetto, G.; Byon-Wagner, A.; Byrum, K.L.; Campagnari, C.; Campbell, M.; Caner, A.; Carithers, W.; Carlsmith, D.; Castro, A.; Cen, Y.; Cervelli, F.; Chapman, J.; Chiarelli, G.; Chikamatsu, T.; Cihangir, S.; Clark, A.G.; Cobal, M.; Contreras, M.; Cooper, J.; Cordelli, M.; Coupal, D.P.; Crane, D.; Cunningham, J.D.; Daniels, T.; DeJongh, F.; Dell'Agnello, S.; Dell'Orso, M.; Demortier, L.; Denby, B.; Deninno, M.; Derwent, P.F.; Devlin, T.; Dickson, M.; Donati, S.; Done, J.P.; Drucker, R.B.; Dunn, A.; Einsweiler, K.; Elias, J.E.; Ely, R.; Engels, E. Jr.; Eno, S.; Errede, D.; Errede, S.; Etchegoyen, A.; Fan, Q.; Farhat, B.; Fiori, I.; Flaugher, B.; Foster, G.W.; Franklin, M.; Frautschi, M.; Freeman, J.; Friedman, J.; Frisch, H.; Fry, A.; Fuess, T.A.; Fukui, Y.; Funaki, S.; Gagliardi, G.; Gallinaro, M.; Garfinkel, A.F.; Geer, S.; Gerdes, D.W.; Giannetti, P.; Giokaris, N.; Giromini, P.; Gladney, L.; Glenzinski, D.; Gold, M.; Gonzalez, J.; Gordon, A.; Goshaw, A.T.; Goulianos, K.; Grassmann, H.; Grewal, A.; Grieco, G.; Groer, L.; Grosso-Pilcher, C.; Haber, C.; Hahn, S.R.; Hamilton, R.; Handler, R.; Hans, R.M.; Hara, K.; Harral, B.; Harris, R.M.; Hauger, S.A.; Hauser, J.; Hawk, C.; Heinrich, J.; Hennessy, D.; Hollebeek, R.; Holloway, L.; Hoelscher, A.; Hong, S.; Houk, G.; Hu, P.; Huffman, B.T.; Hughes, R.; Hurst, P.; Huston, J.; Huth, J.

    1994-01-01

    The lifetimes of the B + and B 0 mesons have been measured using fully reconstructed decays. In a sample of ∼49 600J/ψ→μ + μ - decays recorded with the Collider Detector at Fermilab, 148±16 B + and 121±16B 0 mesons have been reconstructed using the silicon vertex detector. Unbinned likelihood fits to the proper lifetime distributions of these B mesons give τ + =1.61±0.16 (stat)±0.05 (syst) ps, τ 0 =1.57±0.18 (stat) ±0.08 (syst) ps, and τ + /τ 0 =1.02±0.16 (stat) ±0.05 (syst)

  17. Nature of the light scalar mesons

    International Nuclear Information System (INIS)

    Vijande, J.; Valcarce, A.; Fernandez, F.; Silvestre-Brac, B.

    2005-01-01

    Despite the apparent simplicity of meson spectroscopy, light scalar mesons cannot be accommodated in the usual qq structure. We study the description of the scalar mesons below 2 GeV in terms of the mixing of a chiral nonet of tetraquarks with conventional qq states. A strong diquark-antidiquark component is found for several states. The consideration of a glueball as dictated by quenched lattice QCD drives a coherent picture of the isoscalar mesons

  18. Strange mesonic transition form factor

    International Nuclear Information System (INIS)

    Goity, J.L.; Musolf, M.J.

    1996-01-01

    The strange-quark vector current ρ-to-π meson transition form factor is computed at one-loop order using strange meson intermediate states. A comparison is made with a φ-meson dominance model estimate. We find that one-loop contributions are comparable in magnitude to those predicted by φ-meson dominance. It is possible that the one-loop contribution can make the matrix element as large as those of the electromagnetic current mediating vector meson radiative decays. However, due to the quadratic dependence of the one-loop results on the hadronic form factor cutoff mass, a large uncertainty in the estimate of the loops is unavoidable. These results indicate that non-nucleonic strange quarks could contribute appreciable in moderate-parallel Q 2 parallel parity-violating electron-nucleus scattering measurements aimed at probing the strange-quark content of the nucleon. copyright 1996 The American Physical Society

  19. Simplified Tai Chi Program Training versus Traditional Tai Chi on the Functional Movement Screening in Older Adults

    Directory of Open Access Journals (Sweden)

    Huiru Wang

    2016-01-01

    Full Text Available Background. The present study aimed to evaluate and compare the effect of two different types of Tai Chi programs on the Functional Movement Screening (FMS in older adults. Methods. Ninety older adults (65.5 ± 4.6 years old who met the eligibility criteria were randomized into three different groups based on a ratio of 1 : 1 : 1: a traditional Tai Chi exercise (TTC, a simplified Tai Chi exercise (TCRT, or a control group (routine activity. The FMS consisted of the deep squat, hurdle step, in-line lunge, shoulder mobility, active straight leg rise, trunk stability push-up, and rotatory stability, which was used to measure physical function before the present study and after six months of Tai Chi interventions. Results. Seventy-nine participants completed the present study (control = 27, TTC = 23, and TCRT = 29. Significant improvement on the FMS tests between the baseline and after the six-month intervention was observed in both Tai Chi programs, whereas no significant improvement was observed in the control group. In addition, participants in the TCRT group demonstrated greater improvement than those in the TTC group. Conclusions. The TCRT is more effective in improving the physical function in older adults when compared to the traditional Tai Chi modality, particularly for improving balance.

  20. The meson spectrum between 1 and 2 GeV: Gluonic states and other exotica

    International Nuclear Information System (INIS)

    Chanowitz, M.S.

    1990-01-01

    Present understanding of the meson spectrum is reviewed, with special attention on the search for gluonic states. Experimental progress has resulted in several paradoxes indicating states outside the bar qq spectrum of the nonrelativistic quark model. 59 refs., 1 fig., 2 tabs

  1. Improved measurement of the B 0 and B + meson lifetimes

    Science.gov (United States)

    Buskulic, D.; de Bonis, I.; Decamp, D.; Ghez, P.; Goy, C.; Lees, J. P.; Lucotte, A.; Minard, M. N.; Odier, P.; Pietrzyk, B.; Casado, M. P.; Chmeissani, M.; Crespo, J. M.; Delfino, M.; Efthymiopoulos, I.; Fernandez, E.; Fernandez-Bosman, M.; Garrido, L.; Juste, A.; Martinez, M.; Orteu, S.; Pacheco, A.; Padilla, C.; Pascual, A.; Perlas, J. A.; Riu, I.; Sanchez, F.; Teubert, F.; Colaleo, A.; Creanza, D.; de Palma, M.; Gelao, G.; Girone, M.; Iaselli, G.; Maggi, G.; Maggi, M.; Marinelli, N.; Nuzzo, S.; Ranieri, A.; Raso, G.; Ruggieri, F.; Selvaggi, G.; Silvestris, L.; Tempesta, P.; Zito, G.; Huang, X.; Lin, J.; Ouyang, Q.; Wang, T.; Xie, Y.; Xu, R.; Xue, S.; Zhang, J.; Zhang, L.; Zhao, W.; Alemany, R.; Bazarko, A. O.; Bonvicini, G.; Cattaneo, M.; Comas, P.; Coyle, P.; Drevermann, H.; Forty, R. W.; Frank, M.; Hagelberg, R.; Harvey, J.; Janot, P.; Jost, B.; Kneringer, E.; Knobloch, J.; Lehraus, I.; Martin, E. B.; Mato, P.; Minten, A.; Miquel, R.; Mir, Ll. M.; Moneta, L.; Oest, T.; Palla, F.; Pater, J. R.; Pusztaszeri, J. F.; Ranjard, F.; Rensing, P.; Rolandi, L.; Schlatter, D.; Schmelling, M.; Schneider, O.; Tejessy, W.; Tomalin, I. R.; Venturi, A.; Wachsmuth, H.; Wagner, A.; Wildish, T.; Ajaltouni, Z.; Barrès, A.; Boyer, C.; Falvard, A.; Gay, P.; Guicheney, C.; Henrard, P.; Jousset, J.; Michel, B.; Monteil, S.; Montret, J.-C.; Pallin, D.; Perret, P.; Podlyski, F.; Proriol, J.; Rossignol, J. M.; Fearnley, T.; Hansen, J. B.; Hansen, J. D.; Hansen, J. R.; Hansen, P. H.; Nilsson, B. S.; Wäänänen, A.; Kyriakis, A.; Markou, C.; Simopoulou, E.; Siotis, I.; Vayaki, A.; Zachariadou, K.; Blondel, A.; Bonneaud, G.; Brient, J. C.; Bourdon, P.; Rougé, A.; Rumpf, M.; Valassi, A.; Verderi, M.; Videau, H.; Candlin, D. J.; Parsons, M. I.; Focardi, E.; Parrini, G.; Corden, M.; Georgiopoulos, C.; Jaffe, D. E.; Antonelli, A.; Bencivenni, G.; Bologna, G.; Bossi, F.; Campana, P.; Capon, G.; Casper, D.; Chiarella, V.; Felici, G.; Laurelli, P.; Mannocchi, G.; Murtas, F.; Murtas, G. P.; Passalacqua, L.; Pepe-Altarelli, M.; Curtis, L.; Dorris, S. J.; Halley, A. W.; Knowles, I. G.; Lynch, J. G.; O'Shea, V.; Raine, C.; Reeves, P.; Scarr, J. M.; Smith, K.; Thompson, A. S.; Thomson, F.; Thorn, S.; Turnbull, R. M.; Becker, U.; Geweniger, C.; Graefe, G.; Hanke, P.; Hansper, G.; Hepp, V.; Kluge, E. E.; Putzer, A.; Rensch, B.; Schmidt, M.; Sommer, J.; Stenzel, H.; Tittel, K.; Werner, S.; Wunsch, M.; Abbaneo, D.; Beuselinck, R.; Binnie, D. M.; Cameron, W.; Dornan, P. J.; Moutoussi, A.; Nash, J.; Sedgbeer, J. K.; Stacey, A. M.; Williams, M. D.; Dissertori, G.; Girtler, P.; Kuhn, D.; Rudolph, G.; Betteridge, A. P.; Bowdery, C. K.; Colrain, P.; Crawford, G.; Finch, A. J.; Foster, F.; Hughes, G.; Sloan, T.; Williams, M. I.; Galla, A.; Greene, A. M.; Kleinknecht, K.; Quast, G.; Renk, B.; Rohne, E.; Sander, H. G.; van Gemmeren, P.; Zeitnitz, C.; Aubert, J. J.; Bencheikh, A. M.; Benchouk, C.; Bonissent, A.; Bujosa, G.; Calvet, D.; Carr, J.; Diaconu, C.; Etienne, F.; Konstantinidis, N.; Payre, P.; Rousseau, D.; Talby, M.; Sadouki, A.; Thulasidas, M.; Trabelsi, K.; Aleppo, M.; Ragusa, F.; Abt, I.; Assmann, R.; Bauer, C.; Blum, W.; Dietl, H.; Dydak, F.; Ganis, G.; Gotzhein, C.; Jakobs, K.; Kroha, H.; Lütjens, G.; Lutz, G.; Männer, W.; Moser, H. G.; Richter, R.; Rosado-Schlosser, A.; Schael, S.; Settles, R.; Seywerd, H.; St. Denis, R.; Wiedenmann, W.; Wolf, G.; Boucrot, J.; Callot, O.; Cordier, A.; Davier, M.; Duflot, L.; Grivaz, J. F.; Heusse, Ph.; Jacquet, M.; Kim, D. W.; Le Diberder, F.; Lefrançois, J.; Lutz, A. M.; Nikolic, I.; Park, H. J.; Park, I. C.; Schune, M. H.; Simion, S.; Veillet, J. J.; Videau, I.; Azzurri, P.; Bagliesi, G.; Batignani, G.; Bettarini, S.; Bozzi, C.; Calderini, G.; Carpinelli, M.; Ciocci, M. A.; Ciulli, V.; Dell'Orso, R.; Fantechi, R.; Ferrante, I.; Foà, L.; Forti, F.; Giassi, A.; Giorgi, M. A.; Gregorio, A.; Ligabue, F.; Lusiani, A.; Marrocchesi, P. S.; Messineo, A.; Rizzo, G.; Sanguinetti, G.; Sciabà, A.; Spagnolo, P.; Steinberger, J.; Tenchini, R.; Tonelli, G.; Vannini, C.; Verdini, P. G.; Walsh, J.; Blair, G. A.; Bryant, L. M.; Cerutti, F.; Chambers, J. T.; Gao, Y.; Green, M. G.; Medcalf, T.; Perrodo, P.; Strong, J. A.; von Wimmersperg-Toeller, J. H.; Botterill, D. R.; Clifft, R. W.; Edgecock, T. R.; Haywood, S.; Maley, P.; Norton, P. R.; Thompson, J. C.; Wright, A. E.; Bloch-Devaux, B.; Colas, P.; Emery, S.; Kozanecki, W.; Lançon, E.; Lemaire, M. C.; Locci, E.; Marx, B.; Perez, P.; Rander, J.; Renardy, J. F.; Roussarie, A.; Schuller, J. P.; Schwindling, J.; Trabelsi, A.; Vallage, B.; Black, S. N.; Dann, J. H.; Johnson, R. P.; Kim, H. Y.; Litke, A. M.; McNeil, M. A.; Taylor, G.; Booth, C. N.; Boswell, R.; Brew, C. A. J.; Cartwright, S.; Combley, F.; Koksal, A.; Letho, M.; Newton, W. M.; Reeve, J.; Thompson, L. F.; Böhrer, A.; Brandt, S.; Büscher, V.; Cowan, G.; Grupen, C.; Lutters, G.; Minguet-Rodriguez, J.; Rivera, F.; Saraiva, P.; Smolik, L.; Stephan, F.; Apollonio, M.; Bosisio, L.; Della Marina, R.; Giannini, G.; Gobbo, B.; Musolino, G.; Rothberg, J.; Wasserbaech, S.; Armstrong, S. R.; Bellantoni, L.; Elmer, P.; Feng, Z.; Ferguson, D. P. S.; Gao, Y. S.; González, S.; Grahl, J.; Greening, T. C.; Harton, J. L.; Hayes, O. J.; Hu, H.; McNamara, P. A.; Nachtman, J. M.; Orejudos, W.; Pan, Y. B.; Saadi, Y.; Schmitt, M.; Scott, I. J.; Sharma, V.; Walsh, A. M.; Wu, Sau Lan; Wu, X.; Yamartino, J. M.; Zheng, M.; Zobernig, G.

    1996-03-01

    The lifetimes of the B 0 and B + mesons have been measured with the Aleph detector at LEP, using approximately 3 million hadronic Z decays collected in the period 1991 1994. In the first of three methods, semileptonic decays of B 0 and B + mesons were partially reconstructed by identifying events containing a lepton with an associated D*- orbar D^0 meson. The second method used fully reconstructed B 0 and B + mesons. The third method, used to measure the B 0 lifetime, employed a partial reconstruction technique to identify B 0→ D*- π + X decays. The combined results are begin{gathered} tau _0 = 1.55 ± 0.06 ± 0.03 ps, \\ tau _ + = 1.58 ± 0.09 ± 0.03 ps, \\ tfrac{{tau _ + }}{{tau _0 }} = 1.03 ± 0.08 ± 0.02. \\ .

  2. Chi-Nu Level 2 Review

    Energy Technology Data Exchange (ETDEWEB)

    Haight, Robert Cameron [Los Alamos National Laboratory; Lee, Hye Young [Los Alamos National Laboratory; Mosby, Shea Morgan [Los Alamos National Laboratory; O' Donnell, John M. [Los Alamos National Laboratory; Solomon, Clell Jeffrey Jr. [Los Alamos National Laboratory; Taddeucci, Terry Nicholas [Los Alamos National Laboratory; Fotiadis, Nikolaos [Los Alamos National Laboratory; Devlin, Matthew James [Los Alamos National Laboratory; Ullmann, John Leonard [Los Alamos National Laboratory; Bredeweg, Todd Allen [Los Alamos National Laboratory; Jandel, Marian [Los Alamos National Laboratory; Nelson, Ronald Owen [Los Alamos National Laboratory; Wender, Stephen Arthur [Los Alamos National Laboratory; Neudecker, Denise [Los Alamos National Laboratory; Rising, Michael Evan [Los Alamos National Laboratory; White, Morgan Curtis [Los Alamos National Laboratory; Wu, Ching-Yen [Los Alamos National Laboratory; Bucher, Brian Michael [Los Alamos National Laboratory; Buckner, Matthew Quinn [Los Alamos National Laboratory; Henderson, Roger Alan [Los Alamos National Laboratory

    2015-09-18

    This series of slides presents information on Chi-Nu measurements and analysis of prompt fission neutron spectra (PFNS) for neutron energy below 1 MeV for 235U. A key focus of the Chi-Nu measurement is to address the energy dependence of the low-energy emissions. The 235U PFNS evaluation is in progress. Chi-Nu delivered preliminary experimental data and input for part of the old experimental data base. The 239Pu PFNS evaluation is finalized and submitted for testing. Data from 252Cf spontaneous fission will also be obtained.

  3. Study of {chi}{sub c} production using HERA-B data

    Energy Technology Data Exchange (ETDEWEB)

    Aleksandrov, Aleksandar

    2010-07-15

    In this thesis the production of the charmonium states {chi}{sub c1} and {chi}{sub c2} in protonnucleus collisions at a proton-nucleon center-of-mass energy {radical}(s)=41.6 GeV was studied. The data used for the analysis have been taken by the fixed-target experiment HERA-B that uses the HERA proton beam to scatter protons off the nuclei of different wire targets. About 122.10{sup 3} recorded muonic J/{psi} decays, J/{psi}{yields}{mu}{sup +}{mu}{sup -}, resulted in almost 10000 reconstructed {chi}{sub c}{yields}J/{psi}{gamma}. The ratio R{sub {chi}{sub c}}= sum {sub i=1,2}{sigma}({chi}{sub ci})Br({chi}{sub ci}{yields}J/{psi}{gamma})/{sigma}(J/{psi}), which is the ratio of J/{psi} from {chi}{sub c} decays to all produced J/{psi}, was measured in the kinematical range -0.35chi}{sub c}}=0.190{sub -0.029}{sup +0.030}. Despite the small separation of the masses of the two {chi}{sub c} states, comparable to the detector resolution, the ratio R{sub 12}=R{sub {chi}{sub c}{sub 1}}/R{sub {chi}{sub c}{sub 2}} was measured yielding R{sub 12}=1.30{sub -0.37}{sup +0.59} which corresponds to a production cross section ratio ({sigma}({chi}{sub c1}))/({sigma}({chi}{sub c2}))=0.74{sub -0.22}{sup +0.34}. By using the known J/{psi} production cross section, the {chi}{sub c1} and {chi}{sub c2} production cross sections are calculated to be {sigma}({chi}{sub c1})=(153{+-}27) nb/nucleon and {sigma}({chi}{sub c2})=(207{+-}39) nb/nucleon, respectively. All results were obtained under the assumption that both the J/{psi} and {chi}{sub c} states are produced without polarization. In addition a study of possible deviations of R{sub {chi}{sub c}} and R{sub 12} due to the polarization of J/{psi} and {chi}{sub c} was performed. By varying the polarization parameter, {lambda}{sub obs}, of all produced J/{psi} by 2{sigma} around the value measured by HERA-B, and assuming fully

  4. Hard production of exotic hybrid mesons

    Energy Technology Data Exchange (ETDEWEB)

    Anikin, I.; Teryaev, O.V. [Bogoliubov Lab. of Theoretical Physics, JINR, Dubna (Russian Federation); Pire, B.; Anikin, I. [Ecole Polytechnique, CPHT, 91 - Palaiseau (France); Szymanowski, I. [Soltan Institute for Nuclear Studies, Warsaw (Poland); Liege Univ. (Belgium); Anikin, I.; Wallon, S. [Paris-11 Univ., Lab. de Physique Theorique, 91 - Orsay (France)

    2005-07-01

    Exotic hybrid mesons H, with quantum numbers J{sup PC} = 1{sup -+} may be copiously produced in the hard exclusive processes {gamma}{sup *}(Q{sup 2}){gamma} {yields} H and {gamma}{sup *}(Q{sup 2})P(p) {yields} HP(p') because they have a leading twist distribution amplitude with a sizable coupling constant f{sub H}, which may be estimated through QCD sum rules. The reaction rates scale in the same way as the corresponding rates for usual mesons. (authors)

  5. QCD bosonization and the meson effective action

    International Nuclear Information System (INIS)

    Praschifka, J.; Roberts, C.D.; Cahill, R.T.

    1987-01-01

    A bosonization of quantum chromodynamics (QCD) is employed to derive a meson effective action, thus providing a direct link between QCD and meson phenomenology. As an example of this approach expressions are obtained for the meson parameters associated with the analysis of ω→3π decay. The bosonization also directly motivates a divergence-free, global color-symmetry model for mesons, which is seen to be a generalization of various phenomenological models. Good estimates are obtained for the values of several of the meson parameters

  6. Chiral symmetry breaking and the spin content of the {rho} and {rho}{sup '} mesons

    Energy Technology Data Exchange (ETDEWEB)

    Glozman, L.Ya., E-mail: leonid.glozman@uni-graz.at [Institut fuer Physik, FB Theoretische Physik, Universitaet Graz, A-8010 Graz (Austria); Lang, C.B., E-mail: christian.lang@uni-graz.at [Institut fuer Physik, FB Theoretische Physik, Universitaet Graz, A-8010 Graz (Austria); Limmer, M., E-mail: markus.limmer@uni-graz.at [Institut fuer Physik, FB Theoretische Physik, Universitaet Graz, A-8010 Graz (Austria)

    2011-11-03

    Using interpolators with different SU(2){sub L}xSU(2){sub R} transformation properties we study the chiral symmetry and spin contents of the {rho} and {rho}{sup '} mesons in lattice simulations with dynamical quarks. A ratio of couplings of the q-bar {gamma}{sup i}{tau}q and q-bar {sigma}{sup 0}i{tau}q interpolators to a given meson state at different resolution scales tells one about the degree of chiral symmetry breaking in the meson wave function at these scales. Using a Gaussian gauge invariant smearing of the quark fields in the interpolators, we are able to extract the chiral content of mesons up to the infrared resolution of {approx}1 fm. In the ground state {rho} meson the chiral symmetry is strongly broken with comparable contributions of both the (0,1)+(1,0) and (1/2,1/2){sub b} chiral representations with the former being the leading contribution. In contrast, in the {rho}{sup '} meson the degree of chiral symmetry breaking is manifestly smaller and the leading representation is (1/2,1/2){sub b}. Using a unitary transformation from the chiral basis to the {sup 2S+1}L{sub J} basis, we are able to define and measure the angular momentum content of mesons in the rest frame. This definition is different from the traditional one which uses parton distributions in the infinite momentum frame. The {rho} meson is practically a {sup 3}S{sub 1} state with no obvious trace of a 'spin crisis'. The {rho}{sup '} meson has a sizeable contribution of the {sup 3}D{sub 1} wave, which implies that the {rho}{sup '} meson cannot be considered as a pure radial excitation of the {rho} meson.

  7. Composite vector mesons and string models

    International Nuclear Information System (INIS)

    Mandelstam, S.

    1985-01-01

    The author discusses the general question of gauge mesons in extended supergravities, and whether such theories can produce the gauge mesons corresponding to a group at least as large as SU(3) x SU(2) x U(1). An exciting conjecture in this direction was made a few years ago by previous authors, who suggested that there might be composite SU(8) gauge mesons in a supergravity model known as the N=8 model. Until we have a consistent, renormalizable theory of supergravity we cannot really obtain any indication of the truth or falseness of that conjecture. One form of the Neveu-Schwarz string model has been shown to be a theory of supergravity; it is finite at the one-loop level and probably in any order of perturbation theory. The discussion is within the framework of this model. The author questions whether massive vector mesons can possibly lose their mass due to interactions. Arguments have been given on both sides of this question, and the author believes that this can occur under certain circumstances. Our conclusions is that the FNNS mechanism will create a gauge symmetry in addition to the rigid symmetry

  8. Observations and Measurements of Orbitally Excited L=1 B Mesons at the D0 Experiment

    Energy Technology Data Exchange (ETDEWEB)

    Williams, Mark Richard James [Lancaster Univ. (United Kingdom)

    2008-09-01

    This thesis describes investigations of the first set of orbitally excited (L = 1) states for both the Bd0 and Bs0 meson systems (B**d and B**s). The data sample corresponds to 1.35 fb-1 of integrated luminosity, collected in 2002-2006 by the D0 detector, during the Run IIa operation of the Tevatron p$\\bar{p}$ colliding beam accelerator. The B**d states are fully reconstructed in decays to B(*)+ π-, with B(*)+ → γ J/ΨK+, J/Ψ → μ+μ-, yielding 662 ± 91 events, and providing the first strong evidence for the resolution of two narrow resonances, B1 and B*2. The masses are extracted from a binned Χ2 fit to the invariant mass distribution, giving M(B1) = 5720.7 ± 2.4(stat.) ± 1.3(syst.) ± 0.5 (PDG) MeV/c2 and M(B*2) = 5746.9 ± 2.4(stat.) ± 1.0(syst.) ± 0.5(PDG) MeV/c2. The production rate of narrow B**d → Bπ resonances relative to the B+ meson is determined to be [13.9 ± 1.9(stat.) ± 3.2(syst.)]%. The same B+ sample is also used to reconstruct the analogous states in the Bs0 system, in decays B**s → B(*)+ K-. A single resonance in the invariant mass distribution is found with a statistical significance of 5σ, interpreted as the B*s2 state. The mass is determined to be M(B*s2) = 5839.6 ± 1.1(stat.) ± 0.4(syst.) ± 0.5(PDG) MeV/c 2, and the production rate of B*s2 → BK resonances is measured to be a fraction (2.14 ± 0.43 ± 0.24)% of the corresponding rate for B+ mesons. Alternative fitting hypotheses give inconclusive evidence for the presence of the lighter Bs1 meson.

  9. Active site-dependent initiation at 1/sup 0/C by Chymase (CHY) of rat serosal mast cell (RSMC) exocytosis

    Energy Technology Data Exchange (ETDEWEB)

    Schick, B.; Austen, K.F.

    1986-03-01

    Exposure of RSMC (> 95% purity) to isolated CHY (0.5-1.5 U/ml), the major secretory granule protease, at 37/sup 0/C results in exocytosis, determined by the release of a soluble secretory granule enzyme, ..beta..-hexosaminidase. CHY-mediated RSMC exocytosis does not occur at 1/sup 0/C. Exposure of RSMC to CHY or ..cap alpha..-chymotrypsin (CT) at 1/sup 0/C, removal of buffer and resuspension of RSMC in buffer alone at 37/sup 0/C, yields the same exocytosis as direct exposure of RSMC to those chymotryptic enzymes at 37/sup 0/C. Differences in the interaction of CHY and CT with RSMC at 1/sup 0/C and 37/sup 0/C are dose-dependent, not qualitative. Binding to (< 0.5% of input) and dissociation of /sup 125/I-labeled CT (3-8 x 10/sup 8/ cpm/mg) from RSMC, as determined by spinning through oil, was time independent and saturation of specific binding was not achieved, indicating that the observed binding is nonspecific. Diisopropyl fluorophosphate (DFP) and lima bean trypsin inhibitor (LBTI) prevent subsequent exocytosis at 37/sup 0/C only if added within the first 10 min of the interaction of RSMC and CHY at 1/sup 0/C. Maximal CHY-mediated RSMC activation at 1/sup 0/C is achieved within 10 min and addition of DFP and LBTI after this period does not affect subsequent exocytosis. The dose- and time-dependent inhibition by DFP and LBTI at 1/sup 0/C of CHY initiation of RSMC exocytosis suggest that an enzymatic action of CHY on RSMC at 1/sup 0/C, not a binding reaction, commits RSMC to exocytosis at 37/sup 0/C.

  10. In-medium QCD sum rules for {omega} meson, nucleon and D meson

    Energy Technology Data Exchange (ETDEWEB)

    Thomas, Ronny

    2008-07-01

    The modifications of hadronic properties caused by an ambient nuclear medium are investigated within the scope of QCD sum rules. This is exemplified for the cases of the {omega} meson, the nucleon and the D meson. By virtue of the sum rules, integrated spectral densities of these hadrons are linked to properties of the QCD ground state, quantified in condensates. For the cases of the {omega} meson and the nucleon it is discussed how the sum rules allow a restriction of the parameter range of poorly known four-quark condensates by a comparison of experimental and theoretical knowledge. The catalog of independent four-quark condensates is covered and relations among these condensates are revealed. The behavior of four-quark condensates under the chiral symmetry group and the relation to order parameters of spontaneous chiral symmetry breaking are outlined. In this respect, also the QCD condensates appearing in differences of sum rules of chiral partners are investigated. Finally, the effects of an ambient nuclear medium on the D meson are discussed and relevant condensates are identified. (orig.)

  11. Measurement of the $\\bar{B}^{0}$ and $B^{-}$ Meson Lifetimes

    CERN Document Server

    Barate, R.; Ghez, Philippe; Goy, C.; Lees, J.P.; Merle, E.; Minard, M.N.; Pietrzyk, B.; Bravo, S.; Casado, M.P.; Chmeissani, M.; Crespo, J.M.; Fernandez, E.; Fernandez-Bosman, M.; Garrido, Ll.; Grauges, E.; Martinez, M.; Merino, G.; Miquel, R.; Mir, Ll.M.; Pacheco, A.; Ruiz, H.; Colaleo, A.; Creanza, D.; de Palma, M.; Iaselli, G.; Maggi, G.; Maggi, M.; Nuzzo, S.; Ranieri, A.; Raso, G.; Ruggieri, F.; Selvaggi, G.; Silvestris, L.; Tempesta, P.; Tricomi, A.; Zito, G.; Huang, X.; Lin, J.; Ouyang, Q.; Wang, T.; Xie, Y.; Xu, R.; Xue, S.; Zhang, J.; Zhang, L.; Zhao, W.; Abbaneo, D.; Boix, G.; Buchmuller, O.; Cattaneo, M.; Cerutti, F.; Dissertori, G.; Drevermann, H.; Forty, R.W.; Frank, M.; Greening, T.C.; Hansen, J.B.; Harvey, John; Janot, P.; Jost, B.; Lehraus, I.; Mato, P.; Minten, A.; Moutoussi, A.; Ranjard, F.; Rolandi, Gigi; Schlatter, D.; Schmitt, M.; Schneider, O.; Spagnolo, P.; Tejessy, W.; Teubert, F.; Tournefier, E.; Wright, A.E.; Ajaltouni, Z.; Badaud, F.; Chazelle, G.; Deschamps, O.; Falvard, A.; Gay, P.; Guicheney, C.; Henrard, P.; Jousset, J.; Michel, B.; Monteil, S.; Montret, J.C.; Pallin, D.; Perret, P.; Podlyski, F.; Hansen, J.D.; Hansen, J.R.; Hansen, P.H.; Nilsson, B.S.; Waananen, A.; Daskalakis, G.; Kyriakis, A.; Markou, C.; Simopoulou, E.; Vayaki, A.; Blondel, A.; Bonneaud, G.; Brient, J.C.; Rouge, A.; Rumpf, M.; Swynghedauw, M.; Verderi, M.; Videau, H.; Focardi, E.; Parrini, G.; Zachariadou, K.; Antonelli, A.; Antonelli, M.; Bencivenni, G.; Bologna, G.; Bossi, F.; Campana, P.; Capon, G.; Chiarella, V.; Laurelli, P.; Mannocchi, G.; Murtas, F.; Murtas, G.P.; Passalacqua, L.; Pepe-Altarelli, M.; Halley, A.W.; Lynch, J.G.; Negus, P.; O'Shea, V.; Raine, C.; Teixeira-Dias, P.; Thompson, A.S.; Cavanaugh, R.; Dhamotharan, S.; Geweniger, C.; Hanke, P.; Hansper, G.; Hepp, V.; Kluge, E.E.; Putzer, A.; Sommer, J.; Tittel, K.; Werner, S.; Wunsch, M.; Beuselinck, R.; Binnie, D.M.; Cameron, W.; Dornan, P.J.; Girone, M.; Marinelli, N.; Sedgbeer, J.K.; Thompson, J.C.; Thomson, Evelyn J.; Ghete, V.M.; Girtler, P.; Kneringer, E.; Kuhn, D.; Rudolph, G.; Bowdery, C.K.; Buck, P.G.; Finch, A.J.; Foster, F.; Hughes, G.; Jones, R.W.L.; Robertson, N.A.; Giehl, I.; Jakobs, K.; Kleinknecht, K.; Quast, G.; Renk, B.; Rohne, E.; Sander, H.G.; Wachsmuth, H.; Zeitnitz, C.; Bonissent, A.; Carr, J.; Coyle, P.; Leroy, O.; Payre, P.; Rousseau, D.; Talby, M.; Aleppo, M.; Ragusa, F.; Dietl, H.; Ganis, G.; Heister, A.; Huttmann, K.; Lutjens, G.; Mannert, C.; Manner, W.; Moser, H.G.; Schael, S.; Settles, R.; Stenzel, H.; Wiedenmann, W.; Wolf, G.; Azzurri, P.; Boucrot, J.; Callot, O.; Chen, S.; Cordier, A.; Davier, M.; Duflot, L.; Grivaz, J.F.; Heusse, Ph.; Jacholkowska, A.; Le Diberder, F.; Lefrancois, J.; Lutz, A.M.; Schune, M.H.; Veillet, J.J.; Videau, I.; Yuan, C.; Zerwas, D.; Bagliesi, Giuseppe; Boccali, T.; Calderini, G.; Ciulli, V.; Foa, L.; Giassi, A.; Ligabue, F.; Messineo, A.; Palla, F.; Rizzo, G.; Sanguinetti, G.; Sciaba, A.; Sguazzoni, G.; Tenchini, R.; Venturi, A.; Verdini, P.G.; Blair, G.A.; Cowan, G.; Green, M.G.; Medcalf, T.; Strong, J.A.; von Wimmersperg-Toeller, J.H.; Clifft, R.W.; Edgecock, T.R.; Norton, P.R.; Tomalin, I.R.; Bloch-Devaux, Brigitte; Colas, P.; Emery, S.; Kozanecki, W.; Lancon, E.; Lemaire, M.C.; Locci, E.; Perez, P.; Rander, J.; Renardy, J.F.; Roussarie, A.; Schuller, J.P.; Schwindling, J.; Trabelsi, A.; Vallage, B.; Black, S.N.; Dann, J.H.; Johnson, R.P.; Kim, H.Y.; Konstantinidis, N.; Litke, A.M.; McNeil, M.A.; Taylor, G.; Booth, C.N.; Cartwright, S.; Combley, F.; Lehto, M.; Thompson, L.F.; Affholderbach, K.; Boehrer, Armin; Brandt, S.; Grupen, C.; Misiejuk, A.; Prange, G.; Sieler, U.; Giannini, G.; Gobbo, B.; Rothberg, J.; Wasserbaech, S.; Armstrong, S.R.; Cranmer, K.; Elmer, P.; Ferguson, D.P.S.; Gao, Y.; Gonzalez, S.; Hayes, O.J.; Hu, H.; Jin, S.; Kile, J.; McNamara, P.A., III; Nielsen, J.; Orejudos, W.; Pan, Y.B.; Saadi, Y.; Scott, I.J.; Walsh, J.; Wu, Sau Lan; Wu, X.; Zobernig, G.

    2000-01-01

    The lifetimes of the B0 and B- mesons are measured using a sample of about four million hadronic Z decays collected from 1991 to 19 95 with the ALEPH detector at LEP. The data sample has been recently reprocessed, achieving a substantial improvement in the tracking performance. Semileptonic decays of B0 and B- mesons are partially reconstructed by identifying events containing a lepton with an associated D* or D0 meson. The proper time of the B meson is estimated from the measured decay length and the momentum of the D-lepton system. A fit to the proper time of 1880 D* l- and 2856 D0 l- candidates yields the following results: tau B0 = 1.518 +- 0.053 +- 0.034 ps, tau B- = 1.648 +- 0.049 +- 0.035 ps, tau B- / tau B0 = 1.085 +- 0.059 +- 0.018.

  12. Spontaneous symmetry breaking and vector-meson dominance

    International Nuclear Information System (INIS)

    Caldi, D.G.; Pagels, H.

    1977-01-01

    This article is a continuation of our previous work on the rho-π puzzle. It examines further consequences of the unification of partial conservation of axial-vector current (PCAC) and vector-meson dominance (VMD) in which the pion is a Goldstone state and the rho is a ''dormant'' Goldstone state. Our new picture of the vector mesons does not require an A 1 meson although such a state is not ruled out. The Weinberg sum rules which provide the raison d'etre for the A 1 are reexamined. The first Weinberg sum rule can be accommodated without a narrow A 1 state although some enhancement seems required. Examining the J/sup P C/ = 1 +- nonet we conclude that a new state, the isoscalar octet partner of the B (1235) should exist around 1.7 GeV assuming ideal mixing. Without a detailed assumption on the mixing angle, its mass should be in the range 1.4 to 1.7 GeV. We also discuss the photon-rho interactions. In the standard VMD picture the predicted rate for rho → π + γ fails by five standard deviations, while in our picture this undesired result is averted

  13. YKL-40 and genetic status of CHI3L1 in a large group of asthmatics

    DEFF Research Database (Denmark)

    Hansen, Jakob W; Thomsen, Simon F; Porsbjerg, Celeste

    2015-01-01

    BACKGROUND: Studies have shown a relationship between asthma, serum YKL-40, and the single nucleotide polymorphism (SNP) (-131 C/G, rs4950928) in the CHI3L1 gene that codes for YKL-40. However, the findings differ. We studied the relationship between clinical asthma phenotypes, serum YKL-40...... to clarify the relationship between different asthma phenotypes, YKL-40, and CHI3L1....

  14. Mesons and quarks in nuclei

    International Nuclear Information System (INIS)

    Oset, E.

    1980-01-01

    A short review of the topic of mesons in nuclei is exposed paying particular attention to the relationship between several mesonic processes. Special emphasis is put into the microscopic pictures that can ultimately relate all these processes with the elementary coupling of mesons to the nuclear hadronic components. The importance of the short range part of the nuclear interaction opens the doors to a more basic understanding in terms of the quark components of nucleons and isobars. (orig.)

  15. Towers of hybrid mesons

    International Nuclear Information System (INIS)

    Semay, Claude; Buisseret, Fabien; Silvestre-Brac, Bernard

    2009-01-01

    A hybrid meson is a quark-antiquark pair in which, contrary to ordinary mesons, the gluon field is in an excited state. In the framework of constituent models, the interaction potential is assumed to be the energy of an excited string. An approximate, but accurate, analytical solution of the Schroedinger equation with such a potential is presented. When applied to hybrid charmonia and bottomonia, towers of states are predicted in which the masses are a linear function of a harmonic oscillator band number for the quark-antiquark pair. Such a formula could be a reliable guide for the experimental detection of heavy hybrid mesons.

  16. CHI Research on NSTX-U

    Science.gov (United States)

    Lay, W.-S.; Raman, R.; Jarboe, T. R.; Nelson, B. A.; Mueller, D.; Ebrahimi, F.; Ono, M.; Jardin, S. C.; Taylor, G.

    2017-10-01

    At present about 20% of the total plasma current required for sustained operation has been generated by transient CHI. The present understanding suggests that it may be possible to generate all of the needed current in a ST / tokamak using transient CHI. In such a scenario, one could transition directly from a CHI produced plasma to a non-inductively sustained plasma, without the difficult intermediate step that involves non-inductive current ramp-up. STs based on this new configuration would take advantage of evolving developments in high-temperature superconductor technology to develop a simpler design ST that relies primarily on CHI for plasma current generation. Motivated by the very good results from NSTX and HIT-II, we are examining the potential application of transient CHI for reactor configurations through these studies. (1) Study of the maximum levels of start-up currents that could be generated on NSTX-U, (2) application of a single biased electrode configuration on QUEST to protect the insulator from neutron damage in a CHI reactor installation, and (3) QUEST-like, but a double biased electrode configuration for PEGASUS and NSTX-U. Results from these on-going studies will be described. This work is supported by U.S. DOE Contracts: DE-AC02-09CH11466, DE-FG02-99ER54519 AM08, and DE-SC0006757.

  17. Improved measurement of the $\\overline{B}^{0}$ and B$^{-}$ meson lifetimes

    CERN Document Server

    Buskulic, Damir; Décamp, D; Ghez, P; Goy, C; Lees, J P; Lucotte, A; Minard, M N; Odier, P; Pietrzyk, B; Casado, M P; Chmeissani, M; Crespo, J M; Delfino, M C; Efthymiopoulos, I; Fernández, E; Fernández-Bosman, M; Garrido, L; Juste, A; Martínez, M; Orteu, S; Pacheco, A; Padilla, C; Pascual, A; Perlas, J A; Riu, I; Sánchez, F; Teubert, F; Colaleo, A; Creanza, D; De Palma, M; Gelao, G; Girone, M; Iaselli, Giuseppe; Maggi, G; Maggi, M; Marinelli, N; Nuzzo, S; Ranieri, A; Raso, G; Ruggieri, F; Selvaggi, G; Silvestris, L; Tempesta, P; Zito, G; Huang, X; Lin, J; Ouyang, Q; Wang, T; Xie, Y; Xu, R; Xue, S; Zhang, J; Zhang, L; Zhao, W; Alemany, R; Bazarko, A O; Bonvicini, G; Cattaneo, M; Comas, P; Coyle, P; Drevermann, H; Forty, Roger W; Frank, M; Hagelberg, R; Harvey, J; Janot, P; Jost, B; Kneringer, E; Knobloch, J; Lehraus, Ivan; Martin, E B; Mato, P; Minten, Adolf G; Miquel, R; Mir, L M; Moneta, L; Oest, T; Palla, Fabrizio; Pater, J R; Pusztaszeri, J F; Ranjard, F; Rensing, P E; Rolandi, Luigi; Schlatter, W D; Schmelling, M; Schneider, O; Tejessy, W; Tomalin, I R; Venturi, A; Wachsmuth, H W; Wagner, A; Wildish, T; Ajaltouni, Ziad J; Barrès, A; Boyer, C; Falvard, A; Gay, P; Guicheney, C; Henrard, P; Jousset, J; Michel, B; Monteil, S; Montret, J C; Pallin, D; Perret, P; Podlyski, F; Proriol, J; Rossignol, J M; Fearnley, Tom; Hansen, J B; Hansen, J D; Hansen, J R; Hansen, P H; Nilsson, B S; Wäänänen, A; Kyriakis, A; Markou, C; Simopoulou, Errietta; Siotis, I; Vayaki, Anna; Zachariadou, K; Blondel, A; Bonneaud, G R; Brient, J C; Bourdon, P; Rougé, A; Rumpf, M; Valassi, Andrea; Verderi, M; Videau, H L; Candlin, D J; Parsons, M I; Focardi, E; Parrini, G; Corden, M; Georgiopoulos, C H; Jaffe, D E; Antonelli, A; Bencivenni, G; Bologna, G; Bossi, F; Campana, P; Capon, G; Casper, David William; Chiarella, V; Felici, G; Laurelli, P; Mannocchi, G; Murtas, F; Murtas, G P; Passalacqua, L; Pepé-Altarelli, M; Curtis, L; Dorris, S J; Halley, A W; Knowles, I G; Lynch, J G; O'Shea, V; Raine, C; Reeves, P; Scarr, J M; Smith, K; Thompson, A S; Thomson, F; Thorn, S; Turnbull, R M; Becker, U; Geweniger, C; Graefe, G; Hanke, P; Hansper, G; Hepp, V; Kluge, E E; Putzer, A; Rensch, B; Schmidt, M; Sommer, J; Stenzel, H; Tittel, K; Werner, S; Wunsch, M; Abbaneo, D; Beuselinck, R; Binnie, David M; Cameron, W; Dornan, Peter J; Moutoussi, A; Nash, J; Sedgbeer, J K; Stacey, A M; Williams, M D; Dissertori, G; Girtler, P; Kuhn, D; Rudolph, G; Betteridge, A P; Bowdery, C K; Colrain, P; Crawford, G; Finch, A J; Foster, F; Hughes, G; Sloan, Terence; Williams, M I; Galla, A; Greene, A M; Kleinknecht, K; Quast, G; Renk, B; Rohne, E; Sander, H G; Van Gemmeren, P; Zeitnitz, C; Aubert, Jean-Jacques; Bencheikh, A M; Benchouk, C; Bonissent, A; Bujosa, G; Calvet, D; Carr, J; Diaconu, C A; Etienne, F; Konstantinidis, N P; Payre, P; Rousseau, D; Talby, M; Sadouki, A; Thulasidas, M; Trabelsi, K; Aleppo, M; Ragusa, F; Abt, I; Assmann, R W; Bauer, C; Blum, Walter; Dietl, H; Dydak, Friedrich; Ganis, G; Gotzhein, C; Jakobs, K; Kroha, H; Lütjens, G; Lutz, Gerhard; Männer, W; Moser, H G; Richter, R H; Rosado-Schlosser, A; Schael, S; Settles, Ronald; Seywerd, H C J; Saint-Denis, R; Wiedenmann, W; Wolf, G; Boucrot, J; Callot, O; Cordier, A; Davier, M; Duflot, L; Grivaz, J F; Heusse, P; Jacquet, M; Kim, D W; Le Diberder, F R; Lefrançois, J; Lutz, A M; Nikolic, I A; Park, H J; Park, I C; Schune, M H; Simion, S; Veillet, J J; Videau, I; Azzurri, P; Bagliesi, G; Batignani, G; Bettarini, S; Bozzi, C; Calderini, G; Carpinelli, M; Ciocci, M A; Ciulli, V; Dell'Orso, R; Fantechi, R; Ferrante, I; Foà, L; Forti, F; Giassi, A; Giorgi, M A; Gregorio, A; Ligabue, F; Lusiani, A; Marrocchesi, P S; Messineo, A; Rizzo, G; Sanguinetti, G; Sciabà, A; Spagnolo, P; Steinberger, Jack; Tenchini, Roberto; Tonelli, G; Vannini, C; Verdini, P G; Walsh, J; Blair, G A; Bryant, L M; Cerutti, F; Chambers, J T; Gao, Y; Green, M G; Medcalf, T; Perrodo, P; Strong, J A; Von Wimmersperg-Töller, J H; Botterill, David R; Clifft, R W; Edgecock, T R; Haywood, S; Maley, P; Norton, P R; Thompson, J C; Wright, A E; Bloch-Devaux, B; Colas, P; Emery, S; Kozanecki, Witold; Lançon, E; Lemaire, M C; Locci, E; Marx, B; Pérez, P; Rander, J; Renardy, J F; Roussarie, A; Schuller, J P; Schwindling, J; Trabelsi, A; Vallage, B; Black, S N; Dann, J H; Johnson, R P; Kim, H Y; Litke, A M; McNeil, M A; Taylor, G; Booth, C N; Boswell, R; Brew, C A J; Cartwright, S L; Combley, F; Köksal, A; Letho, M; Newton, W M; Reeve, J; Thompson, L F; Böhrer, A; Brandt, S; Büscher, V; Cowan, G D; Grupen, Claus; Lutters, G; Minguet-Rodríguez, J A; Rivera, F; Saraiva, P; Smolik, L; Stephan, F; Apollonio, M; Bosisio, L; Della Marina, R; Giannini, G; Gobbo, B; Musolino, G; Rothberg, J E; Wasserbaech, S R; Armstrong, S R; Bellantoni, L; Elmer, P; Feng, Z; Ferguson, D P S; Gao, Y S; González, S; Grahl, J; Greening, T C; Harton, J L; Hayes, O J; Hu, H; McNamara, P A; Nachtman, J M; Orejudos, W; Pan, Y B; Saadi, Y; Schmitt, M; Scott, I J; Sharma, V; Walsh, A M; Wu Sau Lan; Wu, X; Yamartino, J M; Zheng, M; Zobernig, G

    1996-01-01

    The lifetimes of the \\b0 \\ and \\bp\\ mesons have been measured with the \\aleph\\ detector at LEP, using approximately 3 million hadronic Z decays collected in the period 1991--1994. In the first of three methods, semileptonic decays of \\b0 \\ and \\bp\\ mesons were partially reconstructed by identifying events containing a lepton with an associated \\ds\\ or \\d0 \\ meson. The second method used fully reconstructed \\bz\\ and \\bp\\ mesons. The third method, used to measure the \\bz\\ lifetime, employed a partial reconstruction technique to identify \\bz\\to D^{*+}\\pi^- X decays. The combined results are \\begin{eqnarray*} \\t0 & = & 1.55\\pm 0.06\\pm 0.03 \\mathrm{\\ ps}, \\\\ \\tp & = & 1.58\\pm 0.09\\pm 0.03 \\mathrm{\\ ps}, \\\\ \\trat & = & 1.03\\pm 0.08\\pm 0.02.

  18. Studies of Excited $D$ mesons in $B$ meson decays

    CERN Document Server

    AUTHOR|(CDS)2082679

    This thesis documents the studies of several three-body B + meson decays, each with a charged charmed meson in the final state. All analyses presented use a data sample recorded by the LHCb detector in 2011 and 2012, corresponding to an integrated luminosity of 3.0 $fb^{-1}$ of $pp$ collision data. The $B^{+} \\to D^{-}K^{+}\\pi^{+}$ and $B^{+} \\to D^{+}K^{+}\\pi^{-}$ decay modes are observed for the first time. The branching fraction of the favoured $B^{+} \\to D^{-}K^{+}\\pi^{+}$ decay mode is measured relative to the topologically similar $B^{+} \\to D^{-}\\pi^{+}\\pi^{+}$ decay and the $B^{+} \\to D^{-}K^{+}\\pi^{+}$ final state is used as a normalisation channel for the suppressed $B^{+} \\to D^{+}K^{+}\\pi^{-}$ decay branching fraction measurement. Searches are performed for the quasi-two-body decays $B^{+} \\to D^{+}K^{*}(892)^{0}$ and $B^{+} \\to D_{2}^{*}(2460)^{0}K^{+}$, using the sample of $B^{+} \\to D^{+}K^{+}\\pi^{-}$ candidate decays. No significant signals are observed for either decay mode and upper limits a...

  19. Electroweak production of hybrid mesons in a flux-tube simulation of lattice QCD

    International Nuclear Information System (INIS)

    Close, F.E.; Dudek, J.J.

    2003-01-01

    We make the first calculation of the electroweak couplings of hybrid mesons to conventional mesons appropriate to photoproduction and to the decays of B or D mesons. E1 amplitudes are found to be large and may contribute in charge exchange γp→nH + allowing production of (among others) the charged 1 -+ exotic hybrid off a 2 exchange. Axial hybrid meson photoproduction is predicted to be large courtesy of π exchange, and its strange hybrid counterpart is predicted in B→ψK H (1 + ) with branching ratio B∼10 -4 . Higher multipoles and some implications for hybrid charmonium are briefly discussed

  20. Spin information from vector-meson decay in photoproduction

    International Nuclear Information System (INIS)

    Kloet, W.M.; Chiang, W.; Tabakin, F.

    1998-01-01

    For the photoproduction of vector mesons, all single and double spin observables involving vector-meson two-body decays are defined consistently in the γN center-of-mass frame. These definitions yield a procedure for extracting physically meaningful single and double spin observables that are subject to known rules concerning their angle and energy evolution. As part of this analysis, we show that measuring the two-meson decay of a photo produced ρ or φ does not determine the vector meson's vector polarization, but only its tensor polarization. The vector meson decay into lepton pairs is also insensitive to the vector meson's vector polarization, unless one measures the spin of one of the leptons. Similar results are found for all double spin observables which involve observation of vector-meson decay. To access the vector meson's vector polarization, one therefore needs to either measure the spin of the decay leptons, make an analysis of the background interference effects, or relate the vector meson's vector polarization to other accessible spin observables. copyright 1998 The American Physical Society

  1. Production of excited charm and charm-strange mesons at HERA

    International Nuclear Information System (INIS)

    Chekanov, S.; Derrick, M.; Magill, S.; Musgrave, B.; Nicholass, D.; Repond, J.; Yoshida, R.; Mattingly, M.C.K.; Antonioli, P.; Bari, G.; Bellagamba, L.; Boscherini, D.; Bruni, A.; Bruni, G.; Cindolo, F.; Corradi, M.; Iacobucci, G.; Margotti, A.; Nania, R.; Polini, A.; Antonelli, S.; Basile, M.; Bindi, M.; Cifarelli, L.; Contin, A.; De Pasquale, S.; Sartorelli, G.; Zichichi, A.; Bartsch, D.; Brock, I.; Hartmann, H.; Hilger, E.; Jakob, H.P.; Juengst, M.; Nuncio-Quiroz, A.E.; Paul, E.; Samson, U.; Schoenberg, V.; Shehzadi, R.; Wlasenko, M.; Brook, N.H.; Heath, G.P.; Morris, J.D.; Capua, M.; Fazio, S.; Mastroberardino, A.; Schioppa, M.; Susinno, G.; Tassi, E.; Kim, J.Y.; Ibrahim, Z.A.; Kamaluddin, B.; Wan Abdullah, W.A.T.; Ning, Y.; Ren, Z.; Sciulli, F.; Chwastowski, J.; Eskreys, A.; Figiel, J.; Galas, A.; Gil, M.; Olkiewicz, K.; Stopa, P.; Zawiejski, L.; Adamczyk, L.; Bold, T.; Grabowska-Bold, I.; Kisielewska, D.; Lukasik, J.; Przybycien, M.; Suszycki, L.; Kotanski, A.; Slominski, W.; Behrens, U.; Blohm, C.; Bonato, A.; Borras, K.; Ciesielski, R.; Coppola, N.; Fang, S.; Fourletova, J.; Geiser, A.; Goettlicher, P.; Grebenyuk, J.; Gregor, I.; Haas, T.; Hain, W.; Huettmann, A.; Januschek, F.; Kahle, B.; Katkov, I.I.; Klein, U.; Koetz, U.; Kowalski, H.; Lobodzinska, E.; Loehr, B.; Mankel, R.; Melzer-Pellmann, I.A.; Miglioranzi, S.; Montanari, A.; Namsoo, T.; Notz, D.; Parenti, A.; Rinaldi, L.; Roloff, P.; Rubinsky, I.; Santamarta, R.; Schneekloth, U.; Spiridonov, A.; Szuba, D.; Szuba, J.; Theedt, T.; Wolf, G.; Wrona, K.; Yaguees Molina, A.G.; Youngman, C.; Zeuner, W.; Drugakov, V.; Lohmann, W.; Schlenstedt, S.; Barbagli, G.; Gallo, E.; Pelfer, P.G.; Bamberger, A.; Dobur, D.; Karstens, F.; Vlasov, N.N.; Bussey, P.J.; Doyle, A.T.; Dunne, W.; Forrest, M.; Rosin, M.; Saxon, D.H.; Skillicorn, I.O.; Gialas, I.; Papageorgiu, K.; Holm, U.; Klanner, R.; Lohrmann, E.; Schleper, P.; Schoerner-Sadenius, T.; Sztuk, J.; Stadie, H.; Turcato, M.; Foudas, C.; Fry, C.; Long, K.R.; Tapper, A.D.; Matsumoto, T.; Nagano, K.; Tokushuku, K.; Yamada, S.; Yamazaki, Y.; Barakbaev, A.N.; Boos, E.G.; Pokrovskiy, N.S.; Zhautykov, B.O.; Aushev, V.; Bachynska, O.; Borodin, M.; Kadenko, I.; Kozulia, A.; Libov, V.; Lisovyi, M.; Lontkovskyi, D.; Makarenko, I.; Sorokin, I.; Verbytskyi, A.; Volynets, O.; Son, D.; Favereau, J. de; Piotrzkowski, K.; Barreiro, F.; Glasman, C.; Jimenez, M.; Labarga, L.; Peso, J. del; Ron, E.; Soares, M.; Terron, J.; Zambrana, M.; Corriveau, F.; Liu, C.; Schwartz, J.; Walsh, R.; Zhou, C.; Tsurugai, T.; Antonov, A.; Dolgoshein, B.A.; Gladkov, D.; Sosnovtsev, V.; Stifutkin, A.; Suchkov, S.; Dementiev, R.K.; Ermolov, P.F.; Gladilin, L.K.; Golubkov, Yu.A.; Khein, L.A.; Korzhavina, I.A.; Kuzmin, V.A.; Levchenko, B.B.; Lukina, O.Yu.; Proskuryakov, A.S.; Shcheglova, L.M.; Zotkin, D.S.; Abt, I.; Caldwell, A.; Kollar, D.; Reisert, B.; Schmidke, W.B.; Grigorescu, G.; Keramidas, A.; Koffeman, E.; Kooijman, P.; Pellegrino, A.; Tiecke, H.; Vazquez, M.; Wiggers, L.; Bruemmer, N.; Bylsma, B.; Durkin, L.S.; Lee, A.; Ling, T.Y.; Allfrey, P.D.; Bell, M.A.; Cooper-Sarkar, A.M.; Devenish, R.C.E.; Ferrando, J.; Foster, B.; Korcsak-Gorzo, K.; Oliver, K.; Robertson, A.; Uribe-Estrada, C.; Walczak, R.; Bertolin, A.; Dal Corso, F.; Dusini, S.; Longhin, A.; Stanco, L.; Bellan, P.; Brugnera, R.; Carlin, R.; Garfagnini, A.; Limentani, S.; Oh, B.Y.; Raval, A.; Ukleja, J.; Whitmore, J.J.; Iga, Y.; D'Agostini, G.; Marini, G.; Nigro, A.; Cole, J.E.; Hart, J.C.

    2009-01-01

    The production of excited charm, D 1 (2420) 0 and D 2 * (2460) 0 , and charm-strange, D s 1(2536) ± , mesons in ep collisions was measured with the ZEUS detector at HERA using an integrated luminosity of 126 pb -1 . Masses, widths and helicity parameters were determined. The measured yields were converted to the rates of c quarks hadronising as a given excited charm meson and to the ratios of the dominant D 2 * (2460) 0 and D s1 (2536) ± branching fractions. A search for the radially excited charm meson, D *' (2640) ± , was also performed. The results are compared with those measured previously and with theoretical expectations. (orig.)

  2. Production of excited charm and charm-strange mesons at HERA

    International Nuclear Information System (INIS)

    Chekanov, S.; Derrick, M.; Magill, S.

    2008-07-01

    The production of excited charm, D 1 (2420) 0 and D * 2 (2460) 0 , and charm-strange, D s1 (2536) ± , mesons in ep collisions was measured with the ZEUS detector at HERA using an integrated luminosity of 126 pb -1 . Masses, widths and helicity parameters were determined. The measured yields were converted to the rates of c quarks hadronising as a given excited charm meson and to the ratios of the dominant D * 2 (2460) 0 and D s1 (2536) ± branching fractions. A search for the radially excited charm meson, D *' (2640) ± , was also performed. The results are compared with those measured previously and with theoretical expectations. (orig.)

  3. Nucleon and meson beams of the JINR phasotron for fundamental and applied investigations

    International Nuclear Information System (INIS)

    Abazov, V.M.; Andreev, G.A.; Bragin, A.N.

    1990-01-01

    The paper throughly describes the medical beam lines and reports the results obtained in measurement of the physical and dosimetric characteristics of high energy neutron, meson and proton beams obtained at the JINR phasotron in the last three years. It is pointed out that for the present intensity of the extracted proton beam of the JINR phasotron 2.0-2.5 μA the meson beam intensities 10 3 s- 1 (π + -mesons) and 3x10 7 s -1 (π - -mesons) have been achieved with a wide-angle magnetic lens. These values correspond to the designed parameters of the facility 'F' meson beams for the extracted proton beam intensity planned to be 25 μA. Besides, a beam of so-called 'surface μ-muons (energy about 4 MeV) with the intensity 10 4 s -1 has been obtained. The achieved meason beam intensities make the possibilities of the JINR phasotron as high as those of small meson factories with the equivalent extracted proton beam current 20-25 μA and ensures progress both in meson physics studies and in fulfilment of some applied tasks. 20 refs.; 7 figs.; 8 tabs

  4. SU(N)-QCD2 meson equation in next-to-leading order

    International Nuclear Information System (INIS)

    Durgut, M.; Pak, N.K.

    1982-08-01

    We compute the 1/N corrections to the meson equation in the regular cut-off scheme. We illustrate that although the quark and gluon self energy and vertex corrections do not vanish explicitly as in the singular cut-off scheme, their contributions to the meson Bethe-Salpeter equation get cancelled within the whole set of contributing diagrams. We also argue that 0(1/N) corrections to the meson equation remove the massless boson from the spectrum in accordance with the Coleman theorem. (author)

  5. A search for unconventional mesons

    International Nuclear Information System (INIS)

    Turnau, J.

    1984-01-01

    Selected problems of the fixed target meson spectroscopy connected with the issue of unconventional states glueballs, hybrides and four-quarks are discussed. The experimental basis of the dissertation consists of some results of the WA3 experiment performed by ACCMOR collaboration (Π - p→(3Π) - p, K - p→K - Π + Π - p, Π - p→K s o K s o n) and of the S136 experiment performed by CCM collaborations (Π - p↑→Π + Π - n, Π - p↑→K + K - n). Mesons with spin parities J PC = 0 -+ , 0 ++ , 1 ++ and 2 ++ are discussed from the point of view of the phenomenology of unconventional states. (author)

  6. From meson- and photon-nucleon scattering to vector mesons in nuclear matter

    International Nuclear Information System (INIS)

    Wolf, Gy.; Lutz, M.F.M.; Friman, B.

    2003-01-01

    A relativistic and unitary approach to pion- and photon-nucleon scattering taking into account the πN, ρN, ωN, ηN, πΔ, KΛ and KΣ channels is presented. The scheme dynamically generates the s- and d-wave baryon resonances N(1535), N(1650), N(1520) and N(1700) and as well as Δ(1620) and Δ(1700) in terms of quasi-local two-body interaction terms. A fair description of the experimental data relevant to the properties of slow vector mesons in nuclear matter is obtained. The resulting s-wave ρ- and ω-meson-nucleon scattering amplitudes which define the leading density modification of the ρ- and ω-meson spectral functions in nuclear matter are presented. (author)

  7. Meson production in the 1 GeV/c2 mass region in the pd → 3He X reaction

    International Nuclear Information System (INIS)

    Wurzinger, R.; Plouin, F.; Spang, W.; Duval, M.A.; Frascaria, R.; Roudot, F.; Siebert, R.; Warde, E.; Bisplinghoff, J.; Ernst, J.; Hinterberger, F.; Jahn, R.; Joosten, R.; Kozela, A.; Lippert, C.; Von Oepen, T.

    1995-01-01

    Meson production near threshold has been studied at the SPES4 spectrometer at SATURNE using the pd → 3HeX missing mass reaction. Differential cross sections in the CM system for ω, η ' and φ are less than 1 nb/sr. The observed φ cross section is surprisingly large at threshold and clearly violates the naive OZI rule. No clear signals were obtained at the K anti K thresholds. The measurements can be extended to study broader mesons like f 0 and a 0 . (authors). 8 refs., 2 figs., 1 tab

  8. Mesons above the deconfining transition

    International Nuclear Information System (INIS)

    De Forcrand, P.; Garcia Perez, M.; Hashimoto, T.

    1999-01-01

    We analyze temporal and spatial meson correlators in quenched lattice QCD at T > 0. Above T c we find different masses and (spatial) 'screening masses', signals of plasma formation, and indication of persisting 'mesonic' excitations. (author)

  9. Study of the decay $B^0 \\to \\chi_{c1} K^+ \\pi^-$ and search of exotic resonances at LHCb

    CERN Document Server

    Sbordone, Francesco; Alves Junior, Antonio Augusto

    In 2008 the Belle Collaboration reported the observation of two charged resonance-like structures in the ${\\chi_c}_1 \\pi^-$ mass spectrum produced in the decay $B^0 \\to {\\chi_c}_1 K^+ \\pi^-$. These were labelled as $Z_1(4050)^-$ and $Z_2(4250)^-$. Alternatively, a single wider resonance hypothesis was also pursued by Belle, and labelled as $Z(4150)^-$. The fact that these are charged states would be a clear sample, if they really exist, of four quark bound systems; for this reason this observation has given rise to a great deal of interest. In 2012 the BABAR Collaboration has searched for these resonances in the channels $B^{0,+} \\to {\\chi_c}_1 K^{+,0} \\pi^-$ and did not find any evidence of them. In this thesis a search for these claimed exotic charmonium-like states $Z_1(4050)^-$ and $Z_2(4250)^-$ is presented, in the decay $B^0 \\to {\\chi_c}_1 K^+ \\pi^-$, where ${\\chi_c}_1 \\to J/\\psi \\gamma$ and $J/\\psi \\to \\mu^+ \\mu^-$. Charged conjugate are implied throughout the whole thesis. The analysis is performed us...

  10. Observation of orbitally excited B(s) mesons.

    Science.gov (United States)

    Aaltonen, T; Abulencia, A; Adelman, J; Akimoto, T; Albrow, M G; Alvarez González, B; Amerio, S; Amidei, D; Anastassov, A; Annovi, A; Antos, J; Apollinari, G; Apresyan, A; Arisawa, T; Artikov, A; Ashmanskas, W; Attal, A; Aurisano, A; Azfar, F; Azzi-Bacchetta, P; Azzurri, P; Bacchetta, N; Badgett, W; Barbaro-Galtieri, A; Barnes, V E; Barnett, B A; Baroiant, S; Bartsch, V; Bauer, G; Beauchemin, P-H; Bedeschi, F; Bednar, P; Behari, S; Bellettini, G; Bellinger, J; Belloni, A; Benjamin, D; Beretvas, A; Beringer, J; Berry, T; Bhatti, A; Binkley, M; Bisello, D; Bizjak, I; Blair, R E; Blocker, C; Blumenfeld, B; Bocci, A; Bodek, A; Boisvert, V; Bolla, G; Bolshov, A; Bortoletto, D; Boudreau, J; Boveia, A; Brau, B; Brigliadori, L; Bromberg, C; Brubaker, E; Budagov, J; Budd, H S; Budd, S; Burkett, K; Busetto, G; Bussey, P; Buzatu, A; Byrum, K L; Cabrera, S; Campanelli, M; Campbell, M; Canelli, F; Canepa, A; Carlsmith, D; Carosi, R; Carrillo, S; Carron, S; Casal, B; Casarsa, M; Castro, A; Catastini, P; Cauz, D; Cavalli-Sforza, M; Cerri, A; Cerrito, L; Chang, S H; Chen, Y C; Chertok, M; Chiarelli, G; Chlachidze, G; Chlebana, F; Cho, K; Chokheli, D; Chou, J P; Choudalakis, G; Chuang, S H; Chung, K; Chung, W H; Chung, Y S; Ciobanu, C I; Ciocci, M A; Clark, A; Clark, D; Compostella, G; Convery, M E; Conway, J; Cooper, B; Copic, K; Cordelli, M; Cortiana, G; Crescioli, F; Cuenca Almenar, C; Cuevas, J; Culbertson, R; Cully, J C; Dagenhart, D; Datta, M; Davies, T; de Barbaro, P; De Cecco, S; Deisher, A; De Lentdecker, G; De Lorenzo, G; Dell'orso, M; Demortier, L; Deng, J; Deninno, M; De Pedis, D; Derwent, P F; Di Giovanni, G P; Dionisi, C; Di Ruzza, B; Dittmann, J R; D'Onofrio, M; Donati, S; Dong, P; Donini, J; Dorigo, T; Dube, S; Efron, J; Erbacher, R; Errede, D; Errede, S; Eusebi, R; Fang, H C; Farrington, S; Fedorko, W T; Feild, R G; Feindt, M; Fernandez, J P; Ferrazza, C; Field, R; Flanagan, G; Forrest, R; Forrester, S; Franklin, M; Freeman, J C; Furic, I; Gallinaro, M; Galyardt, J; Garberson, F; Garcia, J E; Garfinkel, A F; Gerberich, H; Gerdes, D; Giagu, S; Giannetti, P; Gibson, K; Gimmell, J L; Ginsburg, C M; Giokaris, N; Giordani, M; Giromini, P; Giunta, M; Glagolev, V; Glenzinski, D; Gold, M; Goldschmidt, N; Golossanov, A; Gomez, G; Gomez-Ceballos, G; Goncharov, M; González, O; Gorelov, I; Goshaw, A T; Goulianos, K; Gresele, A; Grinstein, S; Grosso-Pilcher, C; Grundler, U; Guimaraes da Costa, J; Gunay-Unalan, Z; Haber, C; Hahn, K; Hahn, S R; Halkiadakis, E; Hamilton, A; Han, B-Y; Han, J Y; Handler, R; Happacher, F; Hara, K; Hare, D; Hare, M; Harper, S; Harr, R F; Harris, R M; Hartz, M; Hatakeyama, K; Hauser, J; Hays, C; Heck, M; Heijboer, A; Heinemann, B; Heinrich, J; Henderson, C; Herndon, M; Heuser, J; Hewamanage, S; Hidas, D; Hill, C S; Hirschbuehl, D; Hocker, A; Hou, S; Houlden, M; Hsu, S-C; Huffman, B T; Hughes, R E; Husemann, U; Huston, J; Incandela, J; Introzzi, G; Iori, M; Ivanov, A; Iyutin, B; James, E; Jayatilaka, B; Jeans, D; Jeon, E J; Jindariani, S; Johnson, W; Jones, M; Joo, K K; Jun, S Y; Jung, J E; Junk, T R; Kamon, T; Kar, D; Karchin, P E; Kato, Y; Kephart, R; Kerzel, U; Khotilovich, V; Kilminster, B; Kim, D H; Kim, H S; Kim, J E; Kim, M J; Kim, S B; Kim, S H; Kim, Y K; Kimura, N; Kirsch, L; Klimenko, S; Klute, M; Knuteson, B; Ko, B R; Koay, S A; Kondo, K; Kong, D J; Konigsberg, J; Korytov, A; Kotwal, A V; Kraus, J; Kreps, M; Kroll, J; Krumnack, N; Kruse, M; Krutelyov, V; Kubo, T; Kuhlmann, S E; Kuhr, T; Kulkarni, N P; Kusakabe, Y; Kwang, S; Laasanen, A T; Lai, S; Lami, S; Lammel, S; Lancaster, M; Lander, R L; Lannon, K; Lath, A; Latino, G; Lazzizzera, I; Lecompte, T; Lee, J; Lee, J; Lee, Y J; Lee, S W; Lefèvre, R; Leonardo, N; Leone, S; Levy, S; Lewis, J D; Lin, C; Lin, C S; Lindgren, M; Lipeles, E; Lister, A; Litvintsev, D O; Liu, T; Lockyer, N S; Loginov, A; Loreti, M; Lovas, L; Lu, R-S; Lucchesi, D; Lueck, J; Luci, C; Lujan, P; Lukens, P; Lungu, G; Lyons, L; Lys, J; Lysak, R; Lytken, E; Mack, P; Macqueen, D; Madrak, R; Maeshima, K; Makhoul, K; Maki, T; Maksimovic, P; Malde, S; Malik, S; Manca, G; Manousakis, A; Margaroli, F; Marino, C; Marino, C P; Martin, A; Martin, M; Martin, V; Martínez, M; Martínez-Ballarín, R; Maruyama, T; Mastrandrea, P; Masubuchi, T; Mattson, M E; Mazzanti, P; McFarland, K S; McIntyre, P; McNulty, R; Mehta, A; Mehtala, P; Menzemer, S; Menzione, A; Merkel, P; Mesropian, C; Messina, A; Miao, T; Miladinovic, N; Miles, J; Miller, R; Mills, C; Milnik, M; Mitra, A; Mitselmakher, G; Miyake, H; Moed, S; Moggi, N; Moon, C S; Moore, R; Morello, M; Movilla Fernandez, P; Mülmenstädt, J; Mukherjee, A; Muller, Th; Mumford, R; Murat, P; Mussini, M; Nachtman, J; Nagai, Y; Nagano, A; Naganoma, J; Nakamura, K; Nakano, I; Napier, A; Necula, V; Neu, C; Neubauer, M S; Nielsen, J; Nodulman, L; Norman, M; Norniella, O; Nurse, E; Oh, S H; Oh, Y D; Oksuzian, I; Okusawa, T; Oldeman, R; Orava, R; Osterberg, K; Pagan Griso, S; Pagliarone, C; Palencia, E; Papadimitriou, V; Papaikonomou, A; Paramonov, A A; Parks, B; Pashapour, S; Patrick, J; Pauletta, G; Paulini, M; Paus, C; Pellett, D E; Penzo, A; Phillips, T J; Piacentino, G; Piedra, J; Pinera, L; Pitts, K; Plager, C; Pondrom, L; Portell, X; Poukhov, O; Pounder, N; Prakoshyn, F; Pronko, A; Proudfoot, J; Ptohos, F; Punzi, G; Pursley, J; Rademacker, J; Rahaman, A; Ramakrishnan, V; Ranjan, N; Redondo, I; Reisert, B; Rekovic, V; Renton, P; Rescigno, M; Richter, S; Rimondi, F; Ristori, L; Robson, A; Rodrigo, T; Rogers, E; Rolli, S; Roser, R; Rossi, M; Rossin, R; Roy, P; Ruiz, A; Russ, J; Rusu, V; Saarikko, H; Safonov, A; Sakumoto, W K; Salamanna, G; Saltó, O; Santi, L; Sarkar, S; Sartori, L; Sato, K; Savard, P; Savoy-Navarro, A; Scheidle, T; Schlabach, P; Schmidt, E E; Schmidt, M A; Schmidt, M P; Schmitt, M; Schwarz, T; Scodellaro, L; Scott, A L; Scribano, A; Scuri, F; Sedov, A; Seidel, S; Seiya, Y; Semenov, A; Sexton-Kennedy, L; Sfyrla, A; Shalhout, S Z; Shapiro, M D; Shears, T; Shepard, P F; Sherman, D; Shimojima, M; Shochet, M; Shon, Y; Shreyber, I; Sidoti, A; Sinervo, P; Sisakyan, A; Slaughter, A J; Slaunwhite, J; Sliwa, K; Smith, J R; Snider, F D; Snihur, R; Soderberg, M; Soha, A; Somalwar, S; Sorin, V; Spalding, J; Spinella, F; Spreitzer, T; Squillacioti, P; Stanitzki, M; St Denis, R; Stelzer, B; Stelzer-Chilton, O; Stentz, D; Strologas, J; Stuart, D; Suh, J S; Sukhanov, A; Sun, H; Suslov, I; Suzuki, T; Taffard, A; Takashima, R; Takeuchi, Y; Tanaka, R; Tecchio, M; Teng, P K; Terashi, K; Thom, J; Thompson, A S; Thompson, G A; Thomson, E; Tipton, P; Tiwari, V; Tkaczyk, S; Toback, D; Tokar, S; Tollefson, K; Tomura, T; Tonelli, D; Torre, S; Torretta, D; Tourneur, S; Trischuk, W; Tu, Y; Turini, N; Ukegawa, F; Uozumi, S; Vallecorsa, S; van Remortel, N; Varganov, A; Vataga, E; Vázquez, F; Velev, G; Vellidis, C; Veszpremi, V; Vidal, M; Vidal, R; Vila, I; Vilar, R; Vine, T; Vogel, M; Volobouev, I; Volpi, G; Würthwein, F; Wagner, P; Wagner, R G; Wagner, R L; Wagner, J; Wagner, W; Wakisaka, T; Wallny, R; Wang, S M; Warburton, A; Waters, D; Weinberger, M; Wester, W C; Whitehouse, B; Whiteson, D; Wicklund, A B; Wicklund, E; Williams, G; Williams, H H; Wilson, P; Winer, B L; Wittich, P; Wolbers, S; Wolfe, C; Wright, T; Wu, X; Wynne, S M; Yagil, A; Yamamoto, K; Yamaoka, J; Yamashita, T; Yang, C; Yang, U K; Yang, Y C; Yao, W M; Yeh, G P; Yoh, J; Yorita, K; Yoshida, T; Yu, G B; Yu, I; Yu, S S; Yun, J C; Zanello, L; Zanetti, A; Zaw, I; Zhang, X; Zheng, Y; Zucchelli, S

    2008-02-29

    We report the observation of two narrow resonances consistent with states of orbitally excited (L=1) B_(s) mesons using 1 fb;(-1) of pp[over ] collisions at sqrt[s]=1.96 TeV collected with the Collider Detector at Fermilab II detector at the Fermilab Tevatron. We use two-body decays into K- and B+ mesons reconstructed as B(+)-->J/psiK(+), J/psi-->mu(+)mu(-) or B(+)-->D[over ](0)pi(+), D[over ](0)-->K(+)pi(-). We deduce the masses of the two states to be m(B_(s1))=5829.4+/-0.7 MeV/c(2) and m(B_(s2);(*))=5839.6+/-0.7 MeV/c;(2).

  11. Study of the neutral meson spectrum near 1000 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Leeper, R.J.

    1975-12-01

    The nonstrange neutral meson spectrum from 0.75 to 1.23 GeV/c was studied in the reaction negative pion plus proton goes to neutron plus missing mass at incident beam momenta of 1.98 and 2.41 GeV/c. Neutrons produced by beam interactions in the liquid hydrogen target were detected in the near forward direction in an array of plastic scintillation counters. The missing mass of the remaining particles produced in the final state was determined by a measurement of the neutron time-of-flight. In the case of genuine two-body processes, ..pi../sup -/p ..-->.. n + meson, the observed neutron corresponded to mesons produced forward in the center of mass system. Forward going secondary charge particles produced in the hydrogen target were detected and momentum analyzed by the Argonne Effective Mass Spectrometer. This allowed the isolation of several constrained final states. Arrays of scintillation detectors surrounding the target gave charged particle information and enabled the data to be differentiated into various topological subsamples. The well established ..omega../sup 0/ meson was detected. In addition, a sharp break in the ..pi../sup +/..pi../sup -/n mass spectrum and a rapid rise of the K/sup +/K/sup -/n spectrum just above threshold was observed. Both of these effects were associated with the S* meson. Finally, the absence of four previously observed narrow mesons is discussed.

  12. MicroRNA-24 Modulates Staphylococcus aureus-Induced Macrophage Polarization by Suppressing CHI3L1.

    Science.gov (United States)

    Jingjing, Zhang; Nan, Zhang; Wei, Wu; Qinghe, Guo; Weijuan, Wang; Peng, Wang; Xiangpeng, Wang

    2017-06-01

    Macrophages play a crucial role in host innate anti-Staphylococcus aureus defense, which is tightly regulated by multiple factors, including microRNAs. A recent study showed that miR-24 plays an important role in macrophage polarization. Here, we investigated the biological function of miR-24 in S. aureus-stimulated macrophages. The results revealed that miR-24 expression was significantly decreased in both human and mouse macrophage cell lines with S. aureus stimulation in a time-dependent manner. Moreover, miR-24 overexpression significantly decreased the production of M1 phenotype markers, such as IL-6, iNOS, TNF-α, CD86, and CD80, whereas it increased the production of M2 markers, such as Arg1, CCL17, CCL22, CD163, and CD206, in S. aureus-stimulated macrophages. Conversely, knockdown of miR-24 promoted M1 macrophage polarization but diminished M2 macrophage polarization in S. aureus-stimulated macrophages. Furthermore, CHI3L1 was predicted as a target gene of miR-24 using bioinformatics software and identified by luciferase reporter assay. Additionally, miR-24 overexpression inhibited CHI3L1 expression and downregulated the downstream MAPK pathway in S. aureus-stimulated macrophages. Finally, CHI3L1 overexpression rescued macrophage polarization and MAPK pathway inhibition induced by miR-24 mimic transfection in S. aureus-stimulated macrophages. In conclusion, the data suggest that miR-24 serves as a molecular regulator in S. aureus-induced macrophage polarization through targeting of CHI3L1 and regulation of the MAPK pathway, which may provide a promising therapeutic target for S. aureus-related infections and inflammatory diseases.

  13. Studies on inclusive meson resonance and particle production

    International Nuclear Information System (INIS)

    Saarikko, Heimo

    1978-01-01

    Production and decay of meson resonances are studied in medium energy meson-proton collisions. Strong evidence is found that hadronic collisions are dominated by resonance production. Especially the vector mesons have often large inclusive cross sections, typically of the order of few millibarns at the present energies. In all, a majority of pions and kaons appear to be decay products of resonances or other unstable particles. The detailed kinematics of the parent resonance's decays is found to play an important role in determining inclusive pion spectra. The squared transverse momentum distributions of hadrons heavier than the pion appear to have in common an exponential behaviour, with a universal slope for the esponential fall-off. The observed vector meson yields suggest that only a small fraction of the direct lepton production observed at large transverse momentum in nucleon-nucleon interactions is accounted for by the ''old'' vector mesons. An attempt has been made to separate out the central production and fragmentation components of the meson production. Both the central production and the fragmentation of the incoming meson are found to be important mechanisms in the non-strange meson production whereas the central production of strange meson resonances is rare at our energies. The ratios of the observed meson yields are found to be generally in good agreement with a simple quark-counting model. (author)

  14. Single spin asymmetry for charm mesons

    Energy Technology Data Exchange (ETDEWEB)

    Dominguez Zacarias, G. [PIMAyC, Eje Central Lazaro Cardenas No. 152, Apdo. Postal 14-805, D.F. (Mexico); Herrera, G.; Mercado, J. [Centro de Investigacion y de Estudios Avanzados, Apdo. Postal 14-740, D.F. (Mexico)

    2007-08-15

    We study single spin asymmetries of D{sup 0} and D{sup -} mesons in polarized proton-proton collisions. A two component model is used to describe charm meson production. The production of D mesons occurs by recombination of the constituents present in the initial state as well as by fragmentation of quarks in the final state. This model has proved to describe the production of charm. The recombination component involves a mechanism of spin alignment that ends up in a single spin asymmetry. Experimental measurements of single spin asymmetry for pions at RHIC are compared with the model. Predictions for the asymmetry in D mesons are presented. (orig.)

  15. Single spin asymmetry for charm mesons

    International Nuclear Information System (INIS)

    Dominguez Zacarias, G.; Herrera, G.; Mercado, J.

    2007-01-01

    We study single spin asymmetries of D 0 and D - mesons in polarized proton-proton collisions. A two component model is used to describe charm meson production. The production of D mesons occurs by recombination of the constituents present in the initial state as well as by fragmentation of quarks in the final state. This model has proved to describe the production of charm. The recombination component involves a mechanism of spin alignment that ends up in a single spin asymmetry. Experimental measurements of single spin asymmetry for pions at RHIC are compared with the model. Predictions for the asymmetry in D mesons are presented. (orig.)

  16. Production of excited charm and charm-strange mesons at HERA

    Energy Technology Data Exchange (ETDEWEB)

    Chekanov, S.; Derrick, M.; Magill, S. [Argonne National Laboratory, Argonne, IL (US)] (and others)

    2008-07-15

    The production of excited charm, D{sub 1}(2420){sup 0} and D{sup *}{sub 2}(2460){sup 0}, and charm-strange, D{sub s1}(2536){sup {+-}}, mesons in ep collisions was measured with the ZEUS detector at HERA using an integrated luminosity of 126 pb{sup -1}. Masses, widths and helicity parameters were determined. The measured yields were converted to the rates of c quarks hadronising as a given excited charm meson and to the ratios of the dominant D{sup *}{sub 2}(2460){sup 0} and D{sub s1}(2536){sup {+-}} branching fractions. A search for the radially excited charm meson, D{sup *'}(2640){sup {+-}}, was also performed. The results are compared with those measured previously and with theoretical expectations. (orig.)

  17. Quantum field theory approaches to meson structure

    International Nuclear Information System (INIS)

    Branz, Tanja

    2011-01-01

    Meson spectroscopy became one of the most interesting topics in particle physics in the last ten years. In particular, the discovery of new unexpected states in the charmonium spectrum which cannot be simply explained by the constituent quark model attracted the interest of many theoretical efforts. In the present thesis we discuss different meson structures ranging from light and heavy quark-antiquark states to bound states of hadrons-hadronic molecules. Here we consider the light scalar mesons f 0 (980) and a 0 (980) and the charmonium-like Y(3940), Y(4140) and Z ± (4430) states. In the discussion of the meson properties like mass spectrum, total and partial decay widths and production rates we introduce three different theoretical methods for the treatment and description of hadronic structure. For the study of bound states of mesons we apply a coupled channel approach which allows for the dynamical generation of meson-meson resonances. The decay properties of meson molecules are further on studied within a second model based on effective Lagrangians describing the interaction of the bound state and its constituents. Besides hadronic molecules the effective Lagrangian approach is also used to study the radiative and strong decay properties of ordinary quark-antiquark (q anti q) states. The AdS/QCD model forms the completion of the three theoretical methods introduced in the present thesis. This holographic model provides a completely different ansatz and is based on extra dimensions and string theory. Within this framework we calculate the mass spectrum of light and heavy mesons and their decay constants.

  18. Angular Momentum Content of the ρ Meson in Lattice QCD

    International Nuclear Information System (INIS)

    Glozman, Leonid Ya.; Lang, C. B.; Limmer, Markus

    2009-01-01

    The variational method allows one to study the mixing of interpolators with different chiral transformation properties in the nonperturbatively determined physical state. It is then possible to define and calculate in a gauge-invariant manner the chiral as well as the partial wave content of the quark-antiquark component of a meson in the infrared, where mass is generated. Using a unitary transformation from the chiral basis to the 2S+1 L J basis one may extract a partial wave content of a meson. We present results for the ground state of the ρ meson using quenched simulations as well as simulations with n f =2 dynamical quarks, all for lattice spacings close to 0.15 fm. We point out that these results indicate a simple 3 S 1 -wave composition of the ρ meson in the infrared, like in the SU(6) flavor-spin quark model.

  19. Heavy meson observables and Dyson-Schwinger equations

    International Nuclear Information System (INIS)

    Ivanov, M. A.

    1998-01-01

    Dyson-Schwinger equation (DSE) studies show that the b-quark mass-function is approximately constant, and that this is true to a lesser extent for the c-quark. This observation provides the basis for a study of the leptonic and semileptonic decays of heavy pseudoscalar mesons using a ''heavy-quark'' limit of the DSES, which, when exact, reduces the number of independent form factors. Semileptonic decays with light mesons in the final state are also accessible because the DSES provide a description of light-quark propagation characteristics and light-meson structure. A description of B-meson decays is straightforward, however, the study of decays involving the D-meson indicates that c-quark mass-corrections are quantitatively important

  20. Parity violating nuclear force by meson mixing

    International Nuclear Information System (INIS)

    Iqbal, M.J.; Niskanen, J.A.

    1990-01-01

    We study a mechanism for parity violation in the two nucleon meson-exchange interaction by way of the mixing of mesons of opposite parities. This mixing arises from parity violating W ± and Z exchange between the q bar q pair in the meson. Numerically its effect turns out to be as important as vector meson exchange with a weak meson-nucleon vertex and may partly be used to model this vertex. The calculation is performed using both the standard Born approximation adding the amplitude phases by Watson's theorem and also using the exact correlated two-nucleon wave functions. The effect of correlations and form factors is found to be crucially important at intermediate energies

  1. Heavy Scalar, Vector, and Axial-Vector Mesons in Hot and Dense Nuclear Medium

    Directory of Open Access Journals (Sweden)

    Arvind Kumar

    2014-01-01

    Full Text Available In this work we shall investigate the mass modifications of scalar mesons (D0; B0, vector mesons (D*; B*, and axial-vector mesons (D1; B1 at finite density and temperature of the nuclear medium. The above mesons are modified in the nuclear medium through the modification of quark and gluon condensates. We will find the medium modification of quark and gluon condensates within chiral SU(3 model through the medium modification of scalar-isoscalar fields σ and ζ at finite density and temperature. These medium modified quark and gluon condensates will further be used through QCD sum rules for the evaluation of in-medium properties of the above mentioned scalar, vector, and axial vector mesons. We will also discuss the effects of density and temperature of the nuclear medium on the scattering lengths of the above scalar, vector, and axial-vector mesons. The study of the medium modifications of the above mesons may be helpful for understanding their production rates in heavy-ion collision experiments. The results of present investigations of medium modifications of scalar, vector, and axial-vector mesons at finite density and temperature can be verified in the compressed baryonic matter (CBM experiment of FAIR facility at GSI, Germany.

  2. Exotic meson spectroscopy with CLAS

    Energy Technology Data Exchange (ETDEWEB)

    Adams, G.; Napolitano, J. [Rensselaer Polytechnic Inst., Troy, NY (United States)

    1994-04-01

    The identification and study of mesons with explicit gluonic degrees of freedom will provide major constraints on nonperturbative QCD and models thereof. CLAS will provide a unique opportunity for studying these resonances by measuring photoproduction of multi-meson final states.

  3. Relative rates of B meson decays into psi(2S) and J/psi mesons

    OpenAIRE

    Abazov, V. M.; Abbott, B.; Abolins, M.; Acharya, B. S.; Adams, M.; Adams, T.; Aguilo, E.; Ahn, S. H.; Ahsan, M.; Alexeev, G. D.; Alkhazov, G.; Alton, A.; Alverson, G.; Alves, G. A.; Anastasoaie, M.

    2009-01-01

    We report on a study of the relative rates of B meson decays into ψ(2S) and J/ψ mesons using 1.3  fb-1 of pp̅ collisions at √s=1.96  TeV recorded by the D0 detector operating at the Fermilab Tevatron Collider. We observe the channels Bs0→ψ(2S)ϕ, Bs0→J/ψϕ, B±→ψ(2S)K±, and B±→J/ψK± and we measure the relative branching fractions for these channels to be B(Bs0→ψ(2S)ϕ)/B(Bs0→J/ψϕ)=0.53±0.10(stat)±0.07(syst)±0.06(B), B(B±→ψ(2S)K±)/B(B±→J/ψK±)=0.63±0.05(stat)±0.03(syst)±0.07(B),where the final erro...

  4. Charged-particle multiplicities in B-meson decay

    International Nuclear Information System (INIS)

    Alam, M.S.; Csorna, S.E.; Fridman, A.; Hicks, R.G.; Panvini, R.S.; Andrews, D.; Avery, P.; Berkelman, K.; Cabenda, R.; Cassel, D.G.; DeWire, J.W.; Ehrlich, R.; Ferguson, T.; Gilchriese, M.G.D.; Gittelman, B.; Hartill, D.L.; Herrup, D.; Herzlinger, M.; Holzner, S.; Kandaswamy, J.; Kreinick, D.L.; Mistry, N.B.; Morrow, F.; Nordberg, E.; Perchonok, R.; Plunkett, R.; Silverman, A.; Stein, P.C.; Stone, S.; Weber, D.; Wilcke, R.; Sadoff, A.J.; Bebek, C.; Haggerty, J.; Hempstead, M.; Izen, J.M.; Loomis, W.A.; MacKay, W.W.; Pipkin, F.M.; Rohlf, J.; Tanenbaum, W.; Wilson, R.; Chadwick, K.; Chauveau, J.; Ganci, P.; Gentile, T.; Kagan, H.; Kass, R.; Melissinos, A.C.; Olsen, S.L.; Poling, R.; Rosenfeld, C.; Rucinski, G.; Thorndike, E.H.; Green, J.; Sannes, F.; Skubic, P.; Snyder, A.; Stone, R.; Brody, A.; Chen, A.; Goldberg, M.; Horwitz, N.; Lipari, P.; Kooy, H.; Moneti, G.C.; Pistilli, P.

    1982-01-01

    The charged multiplicity has been measured at the UPSILON(4S) and a value of 5.75 +- 0.1 +- 0.2 has been obtained for the mean charged multiplicity in B-meson decay. Combining this result with the measurement of prompt letpons from B decay, the values 4.1 +- 0.35 +- 0.2 and 6.3 +- 0.2 +- 0.2 are found for the semileptonic and nonleptonic charged multiplicities, respectively. If b→c dominance is assumed for the weak decay of the B meson, then the semileptonic multiplicity is consistent with the recoil mass determined from the lepton momentum spectrum

  5. Meson Spectroscopy at COMPASS

    CERN Document Server

    Grube, Boris

    2016-11-29

    The goal of the COMPASS experiment at CERN is to study the structure and dynamics of hadrons. The two-stage spectrometer used by the experiment has large acceptance and covers a wide kinematic range for charged as well as neutral particles and can therefore measure a wide range of reactions. The spectroscopy of light mesons is performed with negative (mostly $\\pi^-$) and positive ($p$, $\\pi^+$) hadron beams with a momentum of 190 GeV/$c$. The light-meson spectrum is measured in different final states produced in diffractive dissociation reactions with squared four-momentum transfer $t$ to the target between 0.1 and 1.0 $(\\text{GeV}/c)^2$. The flagship channel is the $\\pi^-\\pi^-\\pi^+$ final state, for which COMPASS has recorded the currently world's largest data sample. These data not only allow to measure the properties of known resonances with high precision, but also to observe new states. Among these is a new axial-vector signal, the $a_1(1420)$, with unusual properties. Novel analysis techniques have been...

  6. Mesonic and baryonic Regge trajectories with quantized masses

    International Nuclear Information System (INIS)

    Hothi, N.; Bisht, S.

    2011-01-01

    We have constructed some Regge trajectories for mesons and baryons by taking the 70 MeV spinless mass quanta as the ultimate building block for the light hadrons. In order to make masses integral multiples of seventy, small changes in masses has been made with due explanation. We have shown how a linear relationship between J and M 2 is maintained by considering quantized hadron masses, which is a direct consequence of the string model and gives a strong clue for quark confinement. It has also been established that mesons and baryons have different slopes and the slopes of baryons is less than the slope of the mesons. This clearly defies the concept of universality of slopes (α ≅ 1.1 GeV 2 ) of hadrons, which can only be achieved if the strings joining the quarks have constant string tension α 1/(2πω) (where ω is the string tension). (author)

  7. Semileptonic decays of strange beauty mesons at Belle

    International Nuclear Information System (INIS)

    Oswald, Christian

    2015-01-01

    Semileptonic decays of b-flavoured mesons are an important tool for the determination of the CKM matrix element vertical stroke V cb vertical stroke. In this thesis, measurements of semileptonic B s meson decays are presented. They provide complementary information to the precision measurements of B meson decays and serve as a test of QCD-calculations predicting SU(3) flavour symmetry for the partial decay widths and form factors. The semi-inclusive and inclusive analyses of semileptonic B s decays are based on the 121.4 fb -1 dataset collected by the Belle detector at the KEKB asymmetric-energy e + e - collider in Tsukuba, Japan. The sample recorded at a centre-of-mass energy √(s)=10.86 GeV, which corresponds to the Y(5S) resonance, contains (7.1±1.3) million B s pair events. To measure the semi-inclusive B s → D s Xlν and B s → D s * Xlν branching fractions, D s and D s * candidates are reconstructed and are paired with an oppositely charged lepton, l + =e + ,μ + . The yields of correctly reconstructed D s and D s * mesons are determined by fits to their respective invariant mass distributions. The signal yield and the yields of the remaining backgrounds are extracted using kinematic distributions of the reconstructed decay products and the constraint from the known initial state of the e + e - collision. The measured branching fractions are: B(B s → D s Xlν)=(8.2±0.2(stat)±0.6(syst)±1.4(ext)) % and B(B s → D s * lν)=(5.4±0.4(stat)±0.4(syst)±0.9 (ext)) %, where the first two uncertainties are the statistical and systematic uncertainties of the measurement and the last uncertainty is due to external parameters. Making an assumption about the B s → D s Xlν branching fraction, the measurement of the B s → D s Xlν yield is also used to obtain the current best estimate of the B s pair production cross-section at a centre-of-mass energy √(s)=10.86 GeV: σ(e + e - → B s pairs)=(57.1±1.5(stat)±4.3(syst)±4.2(ext)) pb. The semi

  8. Discussion of the 3P0 model applied to the decay of mesons into two mesons

    International Nuclear Information System (INIS)

    Bonnaz, R.; Silvestre-Brac, B.

    1999-01-01

    The 3 P 0 model for the decay of a meson into two mesons is revisited. In particular, the formalism is extended in order to deal with an arbitrary form for the creation vertex and with the exact meson wave functions. A careful analysis of both effects is performed and discussed. The model is then applied to a large class of transitions known experimentally. Two types of quark-antiquark potentials have been tested and compared. (author)

  9. Bottomonium spectroscopy and radiative transitions involving the chi(bJ)(1P, 2P) states at BABAR

    NARCIS (Netherlands)

    Lees, J. P.; Poireau, V.; Tisserand, V.; Grauges, E.; Palano, A.; Eigen, G.; Stugu, B.; Brown, D. N.; Kerth, L. T.; Kolomensky, Yu. G.; Lynch, G.; Schroeder, T.; Hearty, C.; Mattison, T. S.; McKenna, J. A.; So, R. Y.; Khan, A.; Blinov, V. E.; Buzykaev, A. R.; Druzhinin, V. P.; Golubev, V. B.; Kravchenko, E. A.; Onuchin, A. P.; Serednyakov, S. I.; Skovpen, Yu. I.; Solodov, E. P.; Todyshev, K. Yu.; Lankford, A. J.; Mandelkern, M.; Dey, B.; Gary, J. W.; Long, O.; Campagnari, C.; Sevilla, M. Franco; Hong, T. M.; Kovalskyi, D.; Richman, J. D.; West, C. A.; Eisner, A. M.; Lockman, W. S.; Vazquez, W. Panduro; Schumm, B. A.; Seiden, A.; Chao, D. S.; Echenard, B.; Flood, K. T.; Hitlin, D. G.; Miyashita, T. S.; Ongmongkolkul, P.; Roehrken, M.; Andreassen, R.; Huard, Z.; Meadows, B. T.; Pushpawela, B. G.; Sokoloff, M. D.; Sun, L.; Bloom, P. C.; Ford, W. T.; Gaz, A.; Smith, J. G.; Wagner, S. R.; Ayad, R.; Toki, W. H.; Spaan, B.; Bernard, D.; Verderi, M.; Playfer, S.; Bettoni, D.; Bozzi, C.; Calabrese, R.; Cibinetto, G.; Fioravanti, E.; Garzia, I.; Luppi, E.; Piemontese, L.; Santoro, V.; Calcaterra, A.; de Sangro, R.; Finocchiaro, G.; Martellotti, S.; Patteri, P.; Peruzzi, I. M.; Piccolo, M.; Rama, M.; Zallo, A.; Contri, R.; Lo Vetere, M.; Monge, M. R.; Passaggio, S.; Patrignani, C.; Robutti, E.; Bhuyan, B.; Prasad, V.; Adametz, A.; Uwer, U.; Lacker, M.; Dauncey, P. D.; Mallik, U.; Cochran, J.; Prell, S.; Ahmed, H.; Gritsan, A. V.; Arnaud, N.; Davier, M.; Derkach, D.; Grosdidier, G.; Le Diberder, F.; Lutz, A. M.; Malaescu, B.; Roudeau, P.; Stocchi, A.; Wormser, G.; Lange, D. J.; Wright, D. M.; Coleman, J. P.; Fry, J. R.; Gabathuler, E.; Hutchcroft, D. E.; Payne, D. J.; Touramanis, C.; Bevan, A. J.; Di Lodovico, F.; Sacco, R.; Cowan, G.; Bougher, J.; Brown, D. N.; Davis, C. L.; Denig, A. G.; Fritsch, M.; Gradl, W.; Griessinger, K.; Hafner, A.; Schubert, K. R.; Barlow, R. J.; Lafferty, G. D.; Cenci, R.; Hamilton, B.; Jawahery, A.; Roberts, D. A.; Cowan, R.; Sciolla, G.; Cheaib, R.; Patel, P. M.; Robertson, S. H.; Neri, N.; Palombo, F.; Cremaldi, L.; Godang, R.; Sonnek, P.; Summers, D. J.; Simard, M.; Taras, P.; De Nardo, G.; Onorato, G.; Sciacca, C.; Martinelli, M.; Raven, G.; Jessop, C. P.; LoSecco, J. M.; Honscheid, K.; Kass, R.; Feltresi, E.; Margoni, M.; Morandin, M.; Posocco, M.; Rotondo, M.; Simi, G.; Simonetto, F.; Stroili, R.; Akar, S.; Ben-Haim, E.; Bomben, M.; Bonneaud, G. R.; Briand, H.; Calderini, G.; Chauveau, J.; Leruste, Ph.; Marchiori, G.; Ocariz, J.; Biasini, M.; Manoni, E.; Pacetti, S.; Rossi, A.; Angelini, C.; Batignani, G.; Bettarini, S.; Carpinelli, M.; Casarosa, G.; Cervelli, A.; Chrzaszcz, M.; Forti, F.; Giorgi, M. A.; Lusiani, A.; Oberhof, B.; Paoloni, E.; Perez, A.; Rizzo, G.; Walsh, J. J.; Pegna, D. Lopes; Olsen, J.; Smith, A. J. S.; Faccini, R.; Ferrarotto, F.; Ferroni, F.; Gaspero, M.; Gioi, L. Li; Pilloni, A.; Piredda, G.; Buenger, C.; Dittrich, S.; Gruenber, O.; Hess, M.; Leddig, T.; Voss, C.; Waldi, R.; Adye, T.; Olaiya, E. O.; Wilson, F. F.; Emery, S.; Vasseur, G.; Anulli, F.; Aston, D.; Bard, D. J.; Cartaro, C.; Convery, M. R.; Dorfan, J.; Dubois-Felsmann, G. P.; Dunwoodie, W.; Ebert, M.; Field, R. C.; Fulsom, B. G.; Graham, M. T.; Hast, C.; Innes, W. R.; Kim, P.; Leith, D. W. G. S.; Lewis, P.; Lindemann, D.; Luitz, S.; Luth, V.; Lynch, H. L.; MacFarlane, D. B.; Muller, D. R.; Neal, H.; Perl, M.; Pulliam, T.; Ratcliff, B. N.; Roodman, A.; Salnikov, A. A.; Schindler, R. H.; Snyder, A.; Su, D.; Sullivan, M. K.; Va'vra, J.; Wisniewski, W. J.; Wulsin, H. W.; Purohit, M. V.; White, R. M.; Wilson, J. R.; Randle-Conde, A.; Sekula, S. J.; Bellis, M.; Burchat, P. R.; Puccio, E. M. T.; Alam, M. S.; Ernst, J. A.; Gorodeisky, R.; Guttman, N.; Peimer, D. R.; Soffer, A.; Spanier, S. M.; Ritchie, J. L.; Ruland, A. M.; Schwitters, R. F.; Wray, B. C.; Izen, J. M.; Lou, X. C.; Bianchi, F.; De Mori, F.; Filippi, A.; Gamba, D.; Lanceri, L.; Vitale, L.; Martinez-Vidal, F.; Oyanguren, A.; Villanueva-Perez, P.; Albert, J.; Banerjee, Sw.; Beaulieu, A.; Bernlochner, F. U.; Choi, H. H. F.; Kowalewski, R.; Lewczuk, M. J.; Lueck, T.; Nugent, I. M.; Roney, J. M.; Sobie, R. J.; Tasneem, N.; Gershon, T. J.; Harrison, P. F.; Latham, T. E.; Band, H. R.; Dasu, S.; Pan, Y.; Prepost, R.

    2014-01-01

    We use (121±1) million Υ(3S) and (98±1) million Υ(2S) mesons recorded by the BABAR detector at the PEP-II e+e− collider at SLAC to perform a study of radiative transitions involving the χbJ(1P,2P) states in exclusive decays with μ+μ−γγ final states. We reconstruct twelve channels in four cascades

  10. Non-leptonic decays of the B{sub c} into tensor mesons

    Energy Technology Data Exchange (ETDEWEB)

    Lopez Castro, G. [Departamento de Fisica, Centro de Investigacion y de Estudios, Avanzados del IPN, Mexico DF (Mexico); Mayorga, H.P.; Munoz, J.H. [Departamento de Fisica, Universidad del Tolima, Ibague (Colombia)

    2002-08-01

    We have computed the branching ratios of the exclusive pseudoscalar (vector) + tensor modes that are allowed in the decays of the B{sub c} meson. The dominant spectator and annihilation contributions in those decays are evaluated using the factorization hypothesis. We find that some of these decay channels, such as B{sub c}{sup -}{yields}({rho}{sup -}, D{sub s*}{sup -}, D{sub s}{sup -}){chi}{sub c{sup 2}} and B{sub c}{sup -}{yields}{pi}{sup -}x, have branching ratios of the order of 10{sup -4}, which seems to be within the reach of forthcoming experiments at the LHC. The inclusive branching fraction of the two-body B{sub c} decays involving tensor particles is approximately 1.28x10{sup -3}. At the dynamical level, it is interesting to observe that the exclusive decays B{sub c}{sup -}{yields} K{sup -}({pi}{sup -})x, {pi}{sup 0} D{sub 2*{sup -}}, {eta}'D{sub s2*{sup -}} are dominated by the annihilation contributions. (author)

  11. A unitarized meson model including color Coulomb interaction

    International Nuclear Information System (INIS)

    Metzger, Kees.

    1990-01-01

    Ch. 1 gives a general introduction into the problem field of the thesis. It discusses in how far the internal structure of mesons is understood theoretically and which models exist. It discusses from a phenomenological point of view the problem of confinement indicates how quark models of mesons may provide insight in this phenomenon. In ch. 2 the formal theory of scattering in a system with confinement is given. It is shown how a coupled channel (CC) description and the work of other authors fit into this general framework. Explicit examples and arguments are given to support the CC treatment of such a system. In ch. 3 the full coupled-channel model as is employed in this thesis is presented. On the basis of arguments from the former chapters and the observed regularities in the experimental data, the choices underlying the model are supported. In this model confinement is described with a mass-dependent harmonic-oscillator potential and the presence of open (meson-meson) channels plays an essential role. In ch. 4 the unitarized model is applied to light scalar meson resonances. In this regime the contribution of the open channels is considerable. It is demonstrated that the model parameters as used for the description of the pseudo-scalar and vector mesons, unchanged can be used for the description of these mesons. Ch. 5 treats the color-Coulomb interaction. There the effect of the Coulomb interaction is studied in simple models without decay. The results of incorporating the color-Coulomb interaction into the full CC model are given in ch.6. Ch. 7 discusses the results of the previous chapters and the present status of the model. (author). 182 refs.; 16 figs.; 33 tabs

  12. Investigation of Semileptonic {ital B} Meson Decays to {ital p} -Wave Charm Mesons

    Energy Technology Data Exchange (ETDEWEB)

    Anastassov, A.; Duboscq, J.E.; Fujino, D.; Gan, K.K.; Hart, T.; Honscheid, K.; Kagan, H.; Kass, R.; Lee, J.; Spencer, M.B.; Sung, M.; Undrus, A.; Wanke, R.; Wolf, A.; Zoeller, M.M. [Ohio State University, Columbus, Ohio 43210 (United States); Nemati, B.; Richichi, S.J.; Ross, W.R.; Skubic, P. [University of Oklahoma, Norman, Oklahoma 73019 (United States); Bishai, M.; Fast, J.; Hinson, J.W.; Menon, N.; Miller, D.H.; Shibata, E.I.; Shipsey, I.P.; Yurko, M. [Purdue University, West Lafayette, Indiana 47907 (United States); Glenn, S.; Johnson, S.D.; Kwon, Y.; Roberts, S.; Thorndike, E.H. [University of Rochester, Rochester, New York 14627 (United States); Jessop, C.P.; Lingel, K.; Marsiske, H.; Perl, M.L.; Savinov, V.; Ugolini, D.; Wang, R.; Zhou, X. [Stanford Linear Accelerator Center, Stanford University, Stanford, California 94309 (United States); Coan, T.E.; Fadeyev, V.; Korolkov, I.; Maravin, Y.; Narsky, I.; Shelkov, V.; Staeck, J.; Stroynowski, R.; Volobouev, I.; Ye, J. [Southern Methodist University, Dallas, Texas 75275 (United States); Artuso, M.; Efimov, A.; Goldberg, M.; He, D.; Kopp, S.; Moneti, G.C.; Mountain, R.; Schuh, S.; Skwarnicki, T.; Stone, S.; Viehhauser, G.; Xing, X. [Syracuse University, Syracuse, New York 13244 (United States); Bartelt, J.; Csorna, S.E.; Jain, V.; McLean, K.W.; Marka, S. [Vanderbilt University, Nashville, Tennessee 37235 (United States); Godang, R.; Kinoshita, K.; Lai, I.C.; Pomianowski, P.; Schrenk, S. [Virginia Polytechnic Institute and State University, Blacksburg, Virginia 24061 (United States); Bonvicini, G.; Cinabro, D.; Greene, R.; Perera, L.P.; Zhou, G.J. [Wayne State University, Detroit, Michigan 48202 (United States); Barish, B.; Chadha, M.; Chan, S.; Eigen, G.; Miller, J.S.; OGrady, C.; Schmidtler, M.; Urheim, J.; Weinstein, A.J.; Wuerthwein, F. [California Institute of Technology, Pasadena, California 91125 (United States); Bliss, D.W.; Masek, G.; Paar, H.P.; Prell, S.; Sharma, V. and others

    1998-05-01

    We have studied semileptonic B meson decays with a p -wave charm meson in the final state using 3.29{times}10{sup 6} B{ovr B} events collected with the CLEOII detector at the Cornell Electron-Positron Storage Ring. We find a value for the exclusive semileptonic product branching fraction B(B{sup {minus}}{r_arrow}D{sup 0}{sub 1} {ell}{sup {minus}}{ovr {nu}}{sub {ell}}) B(D{sup 0}{sub 1}{r_arrow}D{sup {asterisk}+} {pi}{sup {minus}})=(0.373{plus_minus}0.085{plus_minus} 0.052{plus_minus}0.024){percent} and an upper limit for B(B{sup {minus}}{r_arrow}D{sup {asterisk}0}{sub 2} {ell}{sup {minus}}{ovr {nu}}{sub {ell}}) B(D{sup {asterisk}0}{sub 2}{r_arrow}D{sup {asterisk}+ }{pi}{sup {minus}}){lt}0.16{percent} (90{percent} C.L.). Furthermore, we present the first measurement of the q{sup 2} spectrum for B{sup {minus}}{r_arrow}D{sup 0}{sub 1}{ell}{sup {minus}} {ovr {nu}}{sub {ell}} . {copyright} {ital 1998} {ital The American Physical Society}

  13. Production of excited charmed mesons at LEP

    CERN Document Server

    Abbaneo, D

    2000-01-01

    Studies od the production of orbitally excited charmed and charmed strange mesons in e+e- collisions, performed by the LEP collaborations are reviewed. Measurements of the production rates of orbitally excited charmed mesons in semileptonic b decays are presented. Searches for charmed meson radial excitations are also briefly discussed.

  14. S-wave spectroscopy and Hyperne splitting of Bc meson

    International Nuclear Information System (INIS)

    Shah, Manan; Bhavsar, Tanvi; Vinodkumar, P.C.

    2017-01-01

    B c meson is the only heavy meson with two open flavours. This system is also interesting because they cannot annihilate into gluons. The mass spectra and hyperfine splitting of the B c meson are investigated in the Dirac framework with the help of linear + constant potential. The spin-spin interactions are also included in the calculation of the pseudoscalar and vector meson masses. Our computed result for the B c meson are in very good agreement with experimental results as well as other available theoretical result. Decay properties are also interesting because it is expected that decay of B c meson occur in to neutral meson. We hope our theoretical results are helpful for future experimental observations

  15. Measurement of the overlineB0 and B- meson lifetimes

    Science.gov (United States)

    Buskulic, D.; Decamp, D.; Goy, C.; Lees, J.-P.; Minard, M.-N.; Mours, B.; Pietrzyk, B.; Alemany, R.; Ariztizabal, F.; Comas, P.; Crespo, J. M.; Delfino, M.; Fernandez, E.; Fernandez-Bosman, M.; Gaitan, V.; Garrido, Ll.; Mattison, T.; Pacheco, A.; Padilla, C.; Pascual, A.; Creanza, D.; de Palma, M.; Farilla, A.; Iaselli, G.; Maggi, G.; Maggi, M.; Natali, S.; Nuzzo, S.; Quattromini, M.; Ranieri, A.; Raso, G.; Romano, F.; Ruggieri, F.; Selvaggi, G.; Silvestris, L.; Tempesta, P.; Zito, G.; Chai, Y.; Hu, H.; Huang, D.; Huang, X.; Lin, J.; Wang, T.; Xie, Y.; Xu, D.; Xu, R.; Zhang, J.; Zhang, L.; Zhao, W.; Bauerdick, L. A. T.; Blucher, E.; Bonvicini, G.; Boudreau, J.; Casper, D.; Drevermann, H.; Forty, R. W.; Ganis, G.; Gay, C.; Hagelberg, R.; Harvey, J.; Haywood, S.; Hilgart, J.; Jacobsen, R.; Jost, B.; Knobloch, J.; Lehraus, I.; Lohse, T.; Lusiani, A.; Martinez, M.; Mato, P.; Meinhard, H.; Minten, A.; Miotto, A.; Miquel, R.; Moser, H.-G.; Palazzi, P.; Perlas, J. A.; Pusztaszeri, J.-F.; Ranjard, F.; Redlinger, G.; Rolandi, L.; Rothberg, J.; Ruan, T.; Saich, M.; Schlatter, D.; Schmelling, M.; Sefkow, F.; Tejessy, W.; Wachsmuth, H.; Wiedenmann, W.; Wildish, T.; Witzeling, W.; Wotschack, J.; Ajaltouni, Z.; Badaud, F.; Bardadin-Otwinowska, M.; El Fellous, R.; Falvard, A.; Gay, P.; Guicheney, C.; Henrard, P.; Jousset, J.; Michel, B.; Montret, J.-C.; Pallin, D.; Perret, P.; Podlyski, F.; Proriol, J.; Prulhière, F.; Saadi, F.; Fearnley, T.; Hansen, J. D.; Hansen, J. R.; Hansen, P. H.; Møllerud, R.; Nilsson, B. S.; Efthymiopoulos, I.; Kyriakis, A.; Simopoulou, E.; Vayaki, A.; Zachariadou, K.; Badier, J.; Blondel, A.; Bonneaud, G.; Brient, J. C.; Fouque, G.; Orteu, S.; Rougé, A.; Rumpf, M.; Tanaka, R.; Verderi, M.; Videau, H.; Candlin, D. J.; Parsons, M. I.; Veitch, E.; Moneta, L.; Parrini, G.; Corden, M.; Georgiopoulos, C.; Ikeda, M.; Lannutti, J.; Levinthal, D.; Mermikides, M.; Sawyer, L.; Wasserbaech, S.; Antonelli, A.; Baldini, R.; Bencivenni, G.; Bologna, G.; Bossi, F.; Campana, P.; Capon, G.; Cerutti, F.; Chiarella, V.; D'Ettorre-Piazzoli, B.; Felici, G.; Laurelli, P.; Mannocchi, G.; Murtas, F.; Murtas, G. P.; Passalacqua, L.; Pepe-Altarelli, M.; Picchi, P.; Colrain, P.; Ten Have, I.; Lynch, J. G.; Maitland, W.; Morton, W. T.; Raine, C.; Reeves, P.; Scarr, J. M.; Smith, K.; Smith, M. G.; Thompson, A. S.; Turnbull, R. M.; Brandl, B.; Braun, O.; Geweniger, C.; Hanke, P.; Hepp, V.; Kluge, E. E.; Maumary, Y.; Putzer, A.; Rensch, B.; Stahl, A.; Tittel, K.; Wunsch, M.; Belk, A. T.; Beuselinck, R.; Binnie, D. M.; Cameron, W.; Cattaneo, M.; Colling, D. J.; Dornan, P. J.; Dugeay, S.; Greene, A. M.; Hassard, J. F.; Lieske, N. M.; Nash, J.; Payne, D. G.; Phillips, M. J.; Sedgbeer, J. K.; Tomalin, I. R.; Wright, A. G.; Girtler, P.; Kneringer, E.; Kuhn, D.; Rudolph, G.; Bowdery, C. K.; Brodbeck, T. J.; Finch, A. J.; Foster, F.; Hughes, G.; Jackson, D.; Keemer, N. R.; Nuttall, M.; Patel, A.; Sloan, T.; Snow, S. W.; Whelan, E. P.; Kleinknecht, K.; Raab, J.; Renk, B.; Sander, H.-G.; Schmidt, H.; Steeg, F.; Walther, S. M.; Wanke, R.; Wolf, B.; Aubert, J.-J.; Bencheikh, A. M.; Benchouk, C.; Bonissent, A.; Carr, J.; Coyle, P.; Drinkard, J.; Etienne, F.; Nicod, D.; Papalexiou, S.; Payre, P.; Roos, L.; Rousseau, D.; Schwemling, P.; Talby, M.; Adlung, S.; Assmann, R.; Bauer, C.; Blum, W.; Brown, D.; Cattaneo, P.; Dehning, B.; Dietl, H.; Dydak, F.; Frank, M.; Halley, A. W.; Lauber, J.; Lütjens, G.; Lutz, G.; Männer, W.; Richter, R.; Rotscheidt, H.; Schröder, J.; Schwarz, A. S.; Settles, R.; Seywerd, H.; Stierlin, U.; Stiegler, U.; Denis, R. St.; Wolf, G.; Boucrot, J.; Callot, O.; Cordier, A.; Davier, M.; Duflot, L.; Grivaz, J.-F.; Heusse, Ph.; Jaffe, D. E.; Janot, P.; Kim, D. W.; Le Diberder, F.; Lefrançois, J.; Lutz, A.-M.; Schune, M.-H.; Veillet, J.-J.; Videau, I.; Zhang, Z.; Abbaneo, D.; Bagliesi, G.; Batignani, G.; Bosisio, L.; Bottigli, U.; Bozzi, C.; Calderini, G.; Carpinelli, M.; Ciocci, M. A.; Dell'Orso, R.; Ferrante, I.; Fidecaro, F.; Foà, L.; Focardi, E.; Forti, F.; Giassi, A.; Giorgi, M. A.; Gregorio, A.; Ligabue, F.; Mannelli, E. B.; Marrocchesi, P. S.; Messineo, A.; Palla, F.; Rizzo, G.; Sanguinetti, G.; Spagnolo, P.; Steinberger, J.; Tenchini, R.; Tonelli, G.; Triggiani, G.; Vannini, C.; Venturi, A.; Verdini, P. G.; Walsh, J.; Betteridge, A. P.; Carter, J. M.; Green, M. G.; March, P. V.; Mir, Ll. M.; Medcalf, T.; Quazi, I. S.; Strong, J. A.; West, L. R.; Botterill, D. R.; Clifft, R. W.; Edgecock, T. R.; Edwards, M.; Fisher, S. M.; Jones, T. J.; Norton, P. R.; Salmon, D. P.; Thompson, J. C.; Bloch-Devaux, B.; Colas, P.; Duarte, H.; Kozanecki, W.; Lançon, E.; Lemaire, M. C.; Locci, E.; Perez, P.; Perrier, F.; Rander, J.; Renardy, J.-F.; Rosowsky, A.; Roussarie, A.; Schuller, J.-P.; Schwindling, J.; Si Mohand, D.; Vallage, B.; Johnson, R. P.; Litke, A. M.; Taylor, G.; Wear, J.; Ashman, J. G.; Babbage, W.; Booth, C. N.; Buttar, C.; Carney, R. E.; Cartwright, S.; Combley, F.; Hatfield, F.; Thompson, L. F.; Barberio, E.; Böhrer, A.; Brandt, S.; Cowan, G.; Grupen, C.; Lutters, G.; Rivera, F.; Schäfer, U.; Smolik, L.; Della Marina, R.; Giannini, G.; Gobbo, B.; Ragusa, F.; Bellantoni, L.; Chen, W.; Cinabro, D.; Conway, J. S.; Cowen, D. F.; Feng, Z.; Ferguson, D. P. S.; Gao, Y. S.; Grahl, J.; Harton, J. L.; Jared, R. C.; Leclaire, B. W.; Lishka, C.; Pan, Y. B.; Pater, J. R.; Saadi, Y.; Sharma, V.; Schmitt, M.; Shi, Z. H.; Walsh, A. M.; Weber, F. V.; Sau Lan Wu; Wu, X.; Zheng, M.; Zobernig, G.; Aleph Collaboration

    1993-06-01

    The lifetimes of the overlineB0 and B- mesons have been measured with the ALEPH detector at LEP. Semileptonic decays of overlineB0 and B- mesons were partially reconstructed by identifying events containing a lepton with an associated D ∗+or D 0 meson. The proper time of the B meson was estimated from the measured decay length and the momentum and mass of the D-lepton system. A fit to the proper time of 77 D ∗+ℓ - and 77 D0ℓ - candidates, combined with a constraint on the lifetime ratio ( {τ -}/{τ 0}) arising from the relative rates of observed D ∗+ℓ - and D0ℓ - events, yielded the following lifetimes: τ 0=1.52 -0.18+0.20( stat.) -0.13+0.07( syst.) ps, τ - = 1.47 -0.19+0.22( stat.) -0.14+0.15( syst.) ps, {τ -}/{τ 0} = 0.96 -0.15+0.19( stat.) -0.12+0.18( syst.) .

  16. Light Meson Distribution Amplitudes

    CERN Document Server

    Arthur, R.; Brommel, D.; Donnellan, M.A.; Flynn, J.M.; Juttner, A.; de Lima, H.Pedroso; Rae, T.D.; Sachrajda, C.T.; Samways, B.

    2010-01-01

    We calculated the first two moments of the light-cone distribution amplitudes for the pseudoscalar mesons ($\\pi$ and $K$) and the longitudinally polarised vector mesons ($\\rho$, $K^*$ and $\\phi$) as part of the UKQCD and RBC collaborations' $N_f=2+1$ domain-wall fermion phenomenology programme. These quantities were obtained with a good precision and, in particular, the expected effects of $SU(3)$-flavour symmetry breaking were observed. Operators were renormalised non-perturbatively and extrapolations to the physical point were made, guided by leading order chiral perturbation theory. The main results presented are for two volumes, $16^3\\times 32$ and $24^3\\times 64$, with a common lattice spacing. Preliminary results for a lattice with a finer lattice spacing, $32^3\\times64$, are discussed and a first look is taken at the use of twisted boundary conditions to extract distribution amplitudes.

  17. Properties of pseudoscalar flavour-singlet mesons from 2+1+1 twisted mass lattice QCD

    International Nuclear Information System (INIS)

    Cichy, Krzysztof; Poznan Univ.; Drach, Vincent; Garcia Ramos, Elena; Jansen, Karl; Michael, Chris; Ottnad, Konstantin; Urbach, Carsten; Zimmermann, Falk

    2012-11-01

    We study properties of pseudoscalar flavour-singlet mesons from Wilson twisted mass lattice QCD with N f =2+1+1 dynamical quark flavors. Results for masses are presented at three values of the lattice spacing and light quark masses corresponding to values of the pion mass from 230 MeV to 500 MeV. We briefly discuss scaling effects and the light and strange quark mass dependence of M η . In addition we present an exploratory study using Osterwalder-Seiler type strange and charm valence quarks. This approach avoids some of the complications of the twisted mass heavy doublet. We present first results for matching valence and unitary actions and a comparison of statistical uncertainties.

  18. Properties of pseudoscalar flavour-singlet mesons from 2+1+1 twisted mass lattice QCD

    Energy Technology Data Exchange (ETDEWEB)

    Cichy, Krzysztof [Deutsches Elektronen-Synchrotron (DESY), Zeuthen (Germany). John von Neumann-Inst. fuer Computing NIC; Poznan Univ. (Poland). Faculty of Physics; Drach, Vincent; Garcia Ramos, Elena; Jansen, Karl [Deutsches Elektronen-Synchrotron (DESY), Zeuthen (Germany). John von Neumann-Inst. fuer Computing NIC; Michael, Chris [Liverpool Univ. (United Kingdom). Dept. of Mathematical Sciences; Ottnad, Konstantin; Urbach, Carsten; Zimmermann, Falk [Bonn Univ. (Germany). Inst. fuer Strahlen- und Kernphysik

    2012-11-15

    We study properties of pseudoscalar flavour-singlet mesons from Wilson twisted mass lattice QCD with N{sub f}=2+1+1 dynamical quark flavors. Results for masses are presented at three values of the lattice spacing and light quark masses corresponding to values of the pion mass from 230 MeV to 500 MeV. We briefly discuss scaling effects and the light and strange quark mass dependence of M{sub {eta}}. In addition we present an exploratory study using Osterwalder-Seiler type strange and charm valence quarks. This approach avoids some of the complications of the twisted mass heavy doublet. We present first results for matching valence and unitary actions and a comparison of statistical uncertainties.

  19. Vector mesons in reactions with colliding electron-positron beams

    International Nuclear Information System (INIS)

    Rekalo, M.P.; Gakh, G.I.

    1980-01-01

    Polarization phenomena in the processes of vector meson production in reactions with colliding electron-positron beams e + e - → V+X, where V is a vector meson, X is a nondetected set of particles are investigated. For the one-photon mechanism of the process, where V and X are hadrons, the mutually unambiguous correspondence between the structural functions is found. The dependence of the e + e - → VX differential cross section upon the electron and positron polarizations is calculated using the virtual photon density matrix in the helicity basis. This formalism permits to take explicitly into account the P-invariance consequences for the angular distribution of the V-meson decay products. For the processes e + e - → πA 1 , and e + e - → rho + rho - the structural functions are calculated in terms of the corresponding electromagnetic form factors. It is noted that six functions out ten real structural functions describing the e + e - → VX reaction can be determined by means of investigation of the angular distribution of the V-meson decay products which is produced in collisions of unpolarized leptons. To study the collision of polarized leptons one more structural function can be determined. The formation of the X system with definite values of parity and spin is characterized by seven structural functions, five of which can be found while studying the angular distribution of the V-meson decay products produced in e + e - collisions with unpolarized (polarized) particles. If the spin of the X state is 1, in experiments with polarized beams all structural functions can be determined while investigating the angular distribution of the V-meson decay products

  20. Experiments on eta-meson production

    International Nuclear Information System (INIS)

    Peng, J.C.

    1985-01-01

    Following a review of some highlights of eta-meson characteristics, the status of eta-meson production experiments is reviewed. The physics motivations and first results of two LAMPF experiments on (π,eta) reactions are discussed. Possible future experiments are also discussed. 42 refs., 12 figs., 4 tabs

  1. Production of η, η' and f1(1285)-mesons in tagged and untagged two-photon reactions

    International Nuclear Information System (INIS)

    Peters, J.H.

    1990-08-01

    In this thesis the formation of the pseudoscalar mesons η η' and of the axial vector meson f 1 (1285) has been studied in tagged and untagged two-photon reactions with the CELLO detector. In the untagged mode the production of the pseudoscalar meson η' was studied in the π + π - γ final state. The radiative width was determined to be Γ γγ (η') = 3.62 ± 0.15 ± 0.47 keV. One major source of background in the π + π - γ-final state in the incompletely reconstructed decay of the a 2 (1320) into π + π - π 0 . A combined fit to the η' and a 2 mass spectrum yields a radiative width for the a 2 (1320) of Γ γγ (a 2 (1320)) = 0.97 ± 0.09 ± 0.20 keV. In the single tag mode the Q 2 -development of the pseudoscalar-γγ * -transition form factor was measured. For the η' this measurement was performed in the decay modes η' → ργ, η' → η →γγ π + π - and η' → ηsub(→π + π - -(π 0 /γ))π + π - . The Q 2 -developed of the form factor is described by a pole-form 1/(1+Q 2 /Λ 2 ) with a mass of Λsub(η') = 0.794 ± 0.044 GeV. The coresponding measurement for the η was performed in the decay modes η → π + π - π 0 and π + π - γ. Here as well the Q 2 -dependence can be described with a pole form for the form factor. The pole mass obtained by a fit is Λ η = 0.839 ± 0.063 GeV. The coupling of spin-1 mesons to two photons cannot be measured in the untagged mode. Their radiative width is zero at Q 2 = 0. Instead , a Q 2 -independent coupling strength Γ can be determined in the single tag mode. This quantity was measured for the f 1 (1285) in the ηπ + π - -final state to be Γsub(γγ * ) Cahn (f 1 (1285)) = 4.4 ± 2.1 ± 1.2 keV in the frame-work of the Cahn-model which relates the two possible independent cross sections σ LT and σ TT governing this process. (orig./HSI)

  2. Importance of Nonperturbative QCD Parameters for Bottom Mesons

    Directory of Open Access Journals (Sweden)

    A. Upadhyay

    2014-01-01

    Full Text Available The importance of nonperturbative quantum chromodynamics (QCD parameters is discussed in context to the predicting power for bottom meson masses and isospin splitting. In the framework of heavy quark effective theory, the work presented here focuses on the different allowed values of the two nonperturbative QCD parameters used in heavy quark effective theory formula, and using the best fitted parameter, masses of the excited bottom meson states in jp=1/2+ doublet in strange and nonstrange sectors are calculated here. The calculated masses are found to be matching well with experiments and other phenomenological models. The mass splitting and hyperfine splitting have also been analyzed for both strange and nonstrange heavy mesons with respect to spin and flavor symmetries.

  3. Measurement of the lifetimes of the neutral and charged D mesons

    International Nuclear Information System (INIS)

    Gladney, L.D.

    1985-03-01

    Results are presented on the use of a high-resolution drift chamber in the Mark II Detector at PEP to measure the lifetimes of D 0 and D +- mesons produced in e + e - annihilations at 29 GeV. Based on a sample of 74 events for the D 0 mesons and 23 events for the D +- mesons, the lifetimes are found to be tau/sub D 0 = 4.7/sub -0.8//sup +0.9/ +- 0.5 x 10 -13 s; tau/sub D +- / = 8.9/sub -2.7//sup +3.8/ +- 1.3 x 10 -13 s. The ratio of these lifetimes, tau/sub D 0 //tau/sub D +- / = 1.9/sub -0.7//sup +0.9/ +- 0.3, indicates that the decays of these mesons cannot be explained by the simple spectator model of charmed particle decay

  4. On exotic hybrid meson production in γ*γ collisions

    International Nuclear Information System (INIS)

    Anikin, I.V.; Teryaev, O.V.; Pire, B.; Szymanowski, L.; Universite de Liege; Paris-11 Univ., 91 - Orsay; Wallon, S.

    2006-01-01

    We present a theoretical study of exotic hybrid meson (J PC =1 -+ ) production in photon-photon collisions where one of the photons is deeply virtual, including twist two and twist three contributions. We calculate the cross section of this process, which turns out to be large enough to imply sizeable counting rates in the present high luminosity electron-positron colliders. We emphasize the importance of the πη decay channel for the detection of the hybrid meson candidate π 1 (1400) and calculate the cross section and the angular distribution for πη pair production in the unpolarized case. This angular distribution is a useful tool for disentangling the hybrid meson signal from the background. Finally, we calculate the single spin asymmetry associated with one initial longitudinally polarized lepton. (orig.)

  5. Relativistic mean-field approximation with density-dependent screening meson masses in nuclear matter

    International Nuclear Information System (INIS)

    Sun, Baoxi; Lu, Xiaofu; Shen, Pengnian; Zhao, Enguang

    2003-01-01

    The Debye screening masses of the σ, ω and neutral ρ mesons and the photon are calculated in the relativistic mean-field approximation. As the density of the nucleon increases, all the screening masses of mesons increase. A different result with Brown–Rho scaling is shown, which implies a reduction in the mass of all the mesons in the nuclear matter, except the pion. Replacing the masses of the mesons with their corresponding screening masses in the Walecka-1 model, five saturation properties of the nuclear matter are fixed reasonably, and then a density-dependent relativistic mean-field model is proposed without introducing the nonlinear self-coupling terms of mesons. (author)

  6. Polarizations of J/psi and psi(2S) mesons produced in pp collisions at square root s = 1.96 TeV.

    Science.gov (United States)

    Abulencia, A; Adelman, J; Affolder, T; Akimoto, T; Albrow, M G; Amerio, S; Amidei, D; Anastassov, A; Anikeev, K; Annovi, A; Antos, J; Aoki, M; Apollinari, G; Arisawa, T; Artikov, A; Ashmanskas, W; Attal, A; Aurisano, A; Azfar, F; Azzi-Bacchetta, P; Azzurri, P; Bacchetta, N; Badgett, W; Barbaro-Galtieri, A; Barnes, V E; Barnett, B A; Baroiant, S; Bartsch, V; Bauer, G; Beauchemin, P-H; Bedeschi, F; Behari, S; Bellettini, G; Bellinger, J; Belloni, A; Benjamin, D; Beretvas, A; Beringer, J; Berry, T; Bhatti, A; Binkley, M; Bisello, D; Bizjak, I; Blair, R E; Blocker, C; Blumenfeld, B; Bocci, A; Bodek, A; Boisvert, V; Bolla, G; Bolshov, A; Bortoletto, D; Boudreau, J; Boveia, A; Brau, B; Brigliadori, L; Bromberg, C; Brubaker, E; Budagov, J; Budd, H S; Budd, S; Burkett, K; Busetto, G; Bussey, P; Buzatu, A; Byrum, K L; Cabrera, S; Campanelli, M; Campbell, M; Canelli, F; Canepa, A; Carillo, S; Carlsmith, D; Carosi, R; Carron, S; Casal, B; Casarsa, M; Castro, A; Catastini, P; Cauz, D; Cavalli-Sforza, M; Cerri, A; Cerrito, L; Chang, S H; Chen, Y C; Chertok, M; Chiarelli, G; Chlachidze, G; Chlebana, F; Cho, I; Cho, K; Chokheli, D; Chou, J P; Choudalakis, G; Chuang, S H; Chung, K; Chung, W H; Chung, Y S; Cilijak, M; Ciobanu, C I; Ciocci, M A; Clark, A; Clark, D; Coca, M; Compostella, G; Convery, M E; Conway, J; Cooper, B; Copic, K; Cordelli, M; Cortiana, G; Crescioli, F; Cuenca Almenar, C; Cuevas, J; Culbertson, R; Cully, J C; Daronco, S; Datta, M; D'Auria, S; Davies, T; Dagenhart, D; de Barbaro, P; De Cecco, S; Deisher, A; De Lentdecker, G; De Lorenzo, G; Dell'orso, M; Delli Paoli, F; Demortier, L; Deng, J; Deninno, M; De Pedis, D; Derwent, P F; Di Giovanni, G P; Dionisi, C; Di Ruzza, B; Dittmann, J R; D'Onofrio, M; Dörr, C; Donati, S; Dong, P; Donini, J; Dorigo, T; Dube, S; Efron, J; Erbacher, R; Errede, D; Errede, S; Eusebi, R; Fang, H C; Farrington, S; Fedorko, I; Fedorko, W T; Feild, R G; Feindt, M; Fernandez, J P; Field, R; Flanagan, G; Forrest, R; Forrester, S; Franklin, M; Freeman, J C; Furic, I; Gallinaro, M; Galyardt, J; Garcia, J E; Garberson, F; Garfinkel, A F; Gay, C; Gerberich, H; Gerdes, D; Giagu, S; Giannetti, P; Gibson, K; Gimmell, J L; Ginsburg, C; Giokaris, N; Giordani, M; Giromini, P; Giunta, M; Giurgiu, G; Glagolev, V; Glenzinski, D; Gold, M; Goldschmidt, N; Goldstein, J; Golossanov, A; Gomez, G; Gomez-Ceballos, G; Goncharov, M; González, O; Gorelov, I; Goshaw, A T; Goulianos, K; Gresele, A; Grinstein, S; Grosso-Pilcher, C; Grundler, U; Guimaraes da Costa, J; Gunay-Unalan, Z; Haber, C; Hahn, K; Hahn, S R; Halkiadakis, E; Hamilton, A; Han, B-Y; Han, J Y; Handler, R; Happacher, F; Hara, K; Hare, D; Hare, M; Harper, S; Harr, R F; Harris, R M; Hartz, M; Hatakeyama, K; Hauser, J; Hays, C; Heck, M; Heijboer, A; Heinemann, B; Heinrich, J; Henderson, C; Herndon, M; Heuser, J; Hidas, D; Hill, C S; Hirschbuehl, D; Hocker, A; Holloway, A; Hou, S; Houlden, M; Hsu, S-C; Huffman, B T; Hughes, R E; Husemann, U; Huston, J; Incandela, J; Introzzi, G; Iori, M; Ivanov, A; Iyutin, B; James, E; Jang, D; Jayatilaka, B; Jeans, D; Jeon, E J; Jindariani, S; Johnson, W; Jones, M; Joo, K K; Jun, S Y; Jung, J E; Junk, T R; Kamon, T; Karchin, P E; Kato, Y; Kemp, Y; Kephart, R; Kerzel, U; Khotilovich, V; Kilminster, B; Kim, D H; Kim, H S; Kim, J E; Kim, M J; Kim, S B; Kim, S H; Kim, Y K; Kimura, N; Kirsch, L; Klimenko, S; Klute, M; Knuteson, B; Ko, B R; Kondo, K; Kong, D J; Konigsberg, J; Korytov, A; Kotwal, A V; Kraan, A C; Kraus, J; Kreps, M; Kroll, J; Krumnack, N; Kruse, M; Krutelyov, V; Kubo, T; Kuhlmann, S E; Kuhr, T; Kulkarni, N P; Kusakabe, Y; Kwang, S; Laasanen, A T; Lai, S; Lami, S; Lammel, S; Lancaster, M; Lander, R L; Lannon, K; Lath, A; Latino, G; Lazzizzera, I; Lecompte, T; Lee, J; Lee, J; Lee, Y J; Lee, S W; Lefèvre, R; Leonardo, N; Leone, S; Levy, S; Lewis, J D; Lin, C; Lin, C S; Lindgren, M; Lipeles, E; Lister, A; Litvintsev, D O; Liu, T; Lockyer, N S; Loginov, A; Loreti, M; Lu, R-S; Lucchesi, D; Lujan, P; Lukens, P; Lungu, G; Lyons, L; Lys, J; Lysak, R; Lytken, E; Mack, P; Macqueen, D; Madrak, R; Maeshima, K; Makhoul, K; Maki, T; Maksimovic, P; Malde, S; Malik, S; Manca, G; Margaroli, F; Marginean, R; Marino, C; Marino, C P; Martin, A; Martin, M; Martin, V; Martínez, M; Martínez-Ballarín, R; Maruyama, T; Mastrandrea, P; Masubuchi, T; Matsunaga, H; Mattson, M E; Mazini, R; Mazzanti, P; McFarland, K S; McIntyre, P; McNulty, R; Mehta, A; Mehtala, P; Menzemer, S; Menzione, A; Merkel, P; Mesropian, C; Messina, A; Miao, T; Miladinovic, N; Miles, J; Miller, R; Mills, C; Milnik, M; Mitra, A; Mitselmakher, G; Miyamoto, A; Moed, S; Moggi, N; Mohr, B; Moon, C S; Moore, R; Morello, M; Movilla Fernandez, P; Mülmenstädt, J; Mukherjee, A; Muller, Th; Mumford, R; Murat, P; Mussini, M; Nachtman, J; Nagano, A; Naganoma, J; Nakamura, K; Nakano, I; Napier, A; Necula, V; Neu, C; Neubauer, M S; Nielsen, J; Nodulman, L; Norniella, O; Nurse, E; Oh, S H; Oh, Y D; Oksuzian, I; Okusawa, T; Oldeman, R; Orava, R; Osterberg, K; Pagliarone, C; Palencia, E; Papadimitriou, V; Papaikonomou, A; Paramonov, A A; Parks, B; Pashapour, S; Patrick, J; Pauletta, G; Paulini, M; Paus, C; Pellett, D E; Penzo, A; Phillips, T J; Piacentino, G; Piedra, J; Pinera, L; Pitts, K; Plager, C; Pondrom, L; Portell, X; Poukhov, O; Pounder, N; Prakoshyn, F; Pronko, A; Proudfoot, J; Ptohos, F; Punzi, G; Pursley, J; Rademacker, J; Rahaman, A; Ramakrishnan, V; Ranjan, N; Redondo, I; Reisert, B; Rekovic, V; Renton, P; Rescigno, M; Richter, S; Rimondi, F; Ristori, L; Robson, A; Rodrigo, T; Rogers, E; Rolli, S; Roser, R; Rossi, M; Rossin, R; Roy, P; Ruiz, A; Russ, J; Rusu, V; Saarikko, H; Safonov, A; Sakumoto, W K; Salamanna, G; Saltó, O; Santi, L; Sarkar, S; Sartori, L; Sato, K; Savard, P; Savoy-Navarro, A; Scheidle, T; Schlabach, P; Schmidt, E E; Schmidt, M P; Schmitt, M; Schwarz, T; Scodellaro, L; Scott, A L; Scribano, A; Scuri, F; Sedov, A; Seidel, S; Seiya, Y; Semenov, A; Sexton-Kennedy, L; Sfyrla, A; Shalhout, S Z; Shapiro, M D; Shears, T; Shepard, P F; Sherman, D; Shimojima, M; Shochet, M; Shon, Y; Shreyber, I; Sidoti, A; Sinervo, P; Sisakyan, A; Slaughter, A J; Slaunwhite, J; Sliwa, K; Smith, J R; Snider, F D; Snihur, R; Soderberg, M; Soha, A; Somalwar, S; Sorin, V; Spalding, J; Spinella, F; Spreitzer, T; Squillacioti, P; Stanitzki, M; Staveris-Polykalas, A; St Denis, R; Stelzer, B; Stelzer-Chilton, O; Stentz, D; Strologas, J; Stuart, D; Suh, J S; Sukhanov, A; Sun, H; Suslov, I; Suzuki, T; Taffard, A; Takashima, R; Takeuchi, Y; Tanaka, R; Tecchio, M; Teng, P K; Terashi, K; Thom, J; Thompson, A S; Thomson, E; Tipton, P; Tiwari, V; Tkaczyk, S; Toback, D; Tokar, S; Tollefson, K; Tomura, T; Tonelli, D; Torre, S; Torretta, D; Tourneur, S; Trischuk, W; Tsuchiya, R; Tsuno, S; Tu, Y; Turini, N; Ukegawa, F; Uozumi, S; Vallecorsa, S; van Remortel, N; Varganov, A; Vataga, E; Vázquez, F; Velev, G; Veramendi, G; Veszpremi, V; Vidal, M; Vidal, R; Vila, I; Vilar, R; Vine, T; Vollrath, I; Volobouev, I; Volpi, G; Würthwein, F; Wagner, P; Wagner, R G; Wagner, R L; Wagner, J; Wagner, W; Wallny, R; Wang, S M; Warburton, A; Waters, D; Weinberger, M; Wester, W C; Whitehouse, B; Whiteson, D; Wicklund, A B; Wicklund, E; Williams, G; Williams, H H; Wilson, P; Winer, B L; Wittich, P; Wolbers, S; Wolfe, C; Wright, T; Wu, X; Wynne, S M; Yagil, A; Yamamoto, K; Yamaoka, J; Yamashita, T; Yang, C; Yang, U K; Yang, Y C; Yao, W M; Yeh, G P; Yoh, J; Yorita, K; Yoshida, T; Yu, G B; Yu, I; Yu, S S; Yun, J C; Zanello, L; Zanetti, A; Zaw, I; Zhang, X; Zhou, J; Zucchelli, S

    2007-09-28

    We have measured the polarizations of J/psi and psi(2S) mesons as functions of their transverse momentum p(T) when they are produced promptly in the rapidity range |y| or =5 GeV/c. The analysis is performed using a data sample with an integrated luminosity of about 800 pb(-1) collected by the CDF II detector. For both vector mesons, we find that the polarizations become increasingly longitudinal as p(T) increases from 5 to 30 GeV/c. These results are compared to the predictions of nonrelativistic quantum chromodynamics and other contemporary models. The effective polarizations of J/psi and psi(2S) mesons from B-hadron decays are also reported.

  7. The Chiral and Angular Momentum Content of the ρ-Meson

    Science.gov (United States)

    Glozman, L. Ya.; Lang, C. B.; Limmer, M.

    2010-01-01

    It is possible to define and calculate in a gauge-invariant manner the chiral as well as the partial wave content of the quark-antiquark Fock component of a meson in the infrared, where mass is generated. Using the variational method and a set of interpolators that span a complete chiral basis we extract in a lattice QCD Monte Carlo simulation with n f = 2 dynamical light quarks the orbital angular momentum and spin content of the ρ-meson. We obtain in the infrared a simple 3 S 1 component as a leading component of the ρ-meson with a small admixture of the 3 D 1 partial wave, in agreement with the SU(6) flavor-spin symmetry.

  8. CD11c(hi) Dendritic Cells Regulate Ly-6C(hi) Monocyte Differentiation to Preserve Immune-privileged CNS in Lethal Neuroinflammation.

    Science.gov (United States)

    Kim, Jin Hyoung; Choi, Jin Young; Kim, Seong Bum; Uyangaa, Erdenebelig; Patil, Ajit Mahadev; Han, Young Woo; Park, Sang-Youel; Lee, John Hwa; Kim, Koanhoi; Eo, Seong Kug

    2015-12-02

    Although the roles of dendritic cells (DCs) in adaptive defense have been defined well, the contribution of DCs to T cell-independent innate defense and subsequent neuroimmunopathology in immune-privileged CNS upon infection with neurotropic viruses has not been completely defined. Notably, DC roles in regulating innate CD11b(+)Ly-6C(hi) monocyte functions during neuroinflammation have not yet been addressed. Using selective ablation of CD11c(hi)PDCA-1(int/lo) DCs without alteration in CD11c(int)PDCA-1(hi) plasmacytoid DC number, we found that CD11c(hi) DCs are essential to control neuroinflammation caused by infection with neurotropic Japanese encephalitis virus, through early and increased infiltration of CD11b(+)Ly-6C(hi) monocytes and higher expression of CC chemokines. More interestingly, selective CD11c(hi) DC ablation provided altered differentiation and function of infiltrated CD11b(+)Ly-6C(hi) monocytes in the CNS through Flt3-L and GM-CSF, which was closely associated with severely enhanced neuroinflammation. Furthermore, CD11b(+)Ly-6C(hi) monocytes generated in CD11c(hi) DC-ablated environment had a deleterious rather than protective role during neuroinflammation, and were more quickly recruited into inflamed CNS, depending on CCR2, thereby exacerbating neuroinflammation via enhanced supply of virus from the periphery. Therefore, our data demonstrate that CD11c(hi) DCs provide a critical and unexpected role to preserve the immune-privileged CNS in lethal neuroinflammation via regulating the differentiation, function, and trafficking of CD11b(+)Ly-6C(hi) monocytes.

  9. Antiproton-proton annihilation into light neutral meson pairs within an effective meson theory

    Science.gov (United States)

    Wang, Ying; Bystritskiy, Yury M.; Ahmadov, Azad I.; Tomasi-Gustafsson, Egle

    2017-08-01

    Antiproton-proton annihilation into light neutral mesons in the few GeV energy domain is investigated in view of a global description of the existing data and predictions for future work at the Antiproton Annihilation at Darmstadt (PANDA) experiment at the Facility for Antiproton and Ion Research (FAIR). An effective meson model earlier developed, with mesonic and baryonic degrees of freedom in s , t , and u channels, is applied here to π0π0 production. Form factors with logarithmic s and t (u ) dependencies are applied. A fair agreement with the existing angular distributions is obtained. Applying SU(3) symmetry, it is straightforward to recover the angular distributions for π0η and η η production in the same energy range. A good agreement is generally obtained with all existing data.

  10. A precursory ULF signature for the Chi-Chi earthquake in Taiwan

    Directory of Open Access Journals (Sweden)

    Y. Akinaga

    2001-01-01

    Full Text Available ULF emission data at Lunping (epicentral distance, 120 km have been analysed for the Chi-Chi earthquake (with magnitude 7.6 and depth of 11 km in Taiwan which occurred on 21 September 1999. Simple intensity analyses have not yielded any significant results but we have found, based on the analysis of polarization (the ratio of vertical magnetic field component Z to the horizontal component G, that the polarization (Z/G showed a significant enhancement for two months before the earthquake. This kind of temporal evolution of polarization seems to be very similar to previous results, so that it is highly likely that this phenomenon may be associated with the Chi-Chi earthquake. Also, the comparison of the results of polarization analyses, by changing the signal threshold, has given us an approximate intensity of the seismogenic emission of the order of the monthly mean value.

  11. D{sub s1}{sup ∗}(2860) and D{sub s3}{sup ∗}(2860): candidates for 1D charmed-strange mesons

    Energy Technology Data Exchange (ETDEWEB)

    Song, Qin-Tao [Nuclear Theory Group, Institute of Modern Physics, Chinese Academy of Sciences, 730000, Lanzhou (China); Research Center for Hadron and CSR Physics, Lanzhou University & Institute of Modern Physics of CAS, 730000, Lanzhou (China); University of Chinese Academy of Sciences, 100049, Beijing (China); Chen, Dian-Yong, E-mail: chendy@impcas.ac.cn [Nuclear Theory Group, Institute of Modern Physics, Chinese Academy of Sciences, 730000, Lanzhou (China); Research Center for Hadron and CSR Physics, Lanzhou University & Institute of Modern Physics of CAS, 730000, Lanzhou (China); Liu, Xiang, E-mail: xiangliu@lzu.edu.cn [Research Center for Hadron and CSR Physics, Lanzhou University & Institute of Modern Physics of CAS, 730000, Lanzhou (China); School of Physical Science and Technology, Lanzhou University, 730000, Lanzhou (China); Matsuki, Takayuki, E-mail: matsuki@tokyo-kasei.ac.jp [Tokyo Kasei University, 1-18-1 Kaga, Itabashi, 173-8602, Tokyo (Japan); Theoretical Research Division, Nishina Center, RIKEN, 351-0198, Saitama (Japan)

    2015-01-27

    Newly observed two charmed-strange resonances, D{sub s1}{sup ∗}(2860) and D{sub s3}{sup ∗}(2860), are investigated by calculating their Okubo–Zweig–Iizuka-allowed strong decays, which shows that they are suitable candidates for the 1{sup 3}D{sub 1} and 1{sup 3}D{sub 3} states in the charmed-strange meson family. Our study also predicts other main decay modes of D{sub s1}{sup ∗}(2860) and D{sub s3}{sup ∗}(2860), which can be accessible at the future experiment. In addition, the decay behaviors of the spin partners of D{sub s1}{sup ∗}(2860) and D{sub s3}{sup ∗}(2860), i.e., 1D(2{sup -}) and 1D{sup ′}(2{sup -}), are predicted in this work, which are still missing at present. The experimental search for the missing 1D(2{sup -}) and 1D{sup ′}(2{sup -}) charmed-strange mesons is an intriguing and challenging task for further experiments.

  12. Meson 2000 Conference Summary lite

    International Nuclear Information System (INIS)

    Barnes, T.

    2000-01-01

    This short contribution is a late MESON2000 conference summary. As appropriate for the 600th anniversary of the Jagiellonian University, it begins with a brief summary of the last 600 years of European history and its place in hadron physics. Next a ''physicist chirality'' order parameter PC is introduced. When applied to MESON2000 plenary speakers this order parameter illustrates the separation of hadron physicists into disjoint communities. The individual plenary talks in MESON2000 are next sorted according to the subconference associated with each of the 36 plenary speakers. Finally, I conclude with a previously unreported Feynman story regarding the use of models in hadron physics. (author)

  13. Effective chiral restoration in the ρ' meson in lattice QCD

    International Nuclear Information System (INIS)

    Glozman, L. Ya.; Lang, C. B.; Limmer, Markus

    2010-01-01

    In simulations with dynamical quarks it has been established that the ground state ρ in the infrared is a strong mixture of the two chiral representations (0,1)+(1,0) and (1/2,1/2) b . Its angular momentum content is approximately the 3 S 1 partial wave. Effective chiral restoration in an excited ρ-meson would require that in the infrared this meson couples predominantly to one of the two representations. The variational method allows one to study the mixing of interpolators with different chiral transformation properties in the nonperturbatively determined excited state at different resolution scales. We present results for the first excited state of the ρ-meson using simulations with n f =2 dynamical quarks. We point out, that in the infrared a leading contribution to ρ ' =ρ(1450) comes from (1/2,1/2) b , in contrast to the ρ. The ρ ' wave function contains a significant contribution of the 3 D 1 wave which is not consistent with the quark model prediction.

  14. Meson Spectroscopy at COMPASS

    CERN Document Server

    Grube, Boris

    2015-01-01

    The COmmon Muon and Proton Apparatus for Structure and Spectroscopy (COMPASS) is a multi-purpose fixed-target experiment at the CERN Super Proton Synchrotron (SPS) aimed at studying the structure and spectrum of hadrons. The two-stage spectrometer has a good acceptance for charged as well as neutral particles over a wide kinematic range and thus allows to access a wide range of reactions. Light mesons are studied with negative (mostly $\\pi^-$) and positive ($p$, $\\pi^+$) hadron beams with a momentum of 190 GeV/$c$. The spectrum of light mesons is investigated in various final states produced in diffractive dissociation reactions at squared four-momentum transfers to the target between 0.1 and 1.0 $(\\text{GeV}/c)^2$. The flagship channel is the $\\pi^-\\pi^+\\pi^-$ final state, for which COMPASS has recorded the currently largest data sample. These data not only allow to measure the properties of known resonances with high precision, but also to search for new states. Among these is a new resonance-like signal, t...

  15. Magnetic monopole interactions: shell structure of meson and baryon states

    International Nuclear Information System (INIS)

    Akers, D.

    1986-01-01

    It is suggested that a low-mass magnetic monopole of Dirac charge g = (137/2)e may be interacting with a c-quark's magnetic dipole moment to produce Zeeman splitting of meson states. The mass M 0 = 2397 MeV of the monopole is in contrast to the 10 16 -GeV monopoles of grand unification theories (GUT). It is shown that shell structure of energy E/sub n/ = M 0 + 1/4nM 0 ... exists for meson states. The presence of symmetric meson states leads to the identification of the shell structure. The possible existence of the 2397-MeV magnetic monopole is shown to quantize quark masses in agreement with calculations of quantum chromodynamics (QCD). From the shell structure of meson states, the existence of two new mesons is predicted: eta(1814 +/- 50 MeV) with I/sup G/(J/sup PC/) = 0 + (0 -+ ) and eta/sub c/ (3907 +/- 100 MeV) with J/sup PC/ = 0 -+ . The presence of shell structure for baryon states is shown

  16. Photoproduction of the f1(1285)/η(1295) Mesons using CLAS at Jefferson Lab

    Energy Technology Data Exchange (ETDEWEB)

    Dickson, Ryan [Carnegie Mellon Univ., Pittsburgh, PA (United States)

    2011-07-18

    This work presents the results of analysis of a meson mass mx =1281.0 ± 0.8 MeV/ c2 and a FWHM of Γx = 18.4 ± 1.4 MeV/ c2 seen in CLAS at Jefferson Lab in photoproduction off the proton, γp → xp.

  17. Doubly charmed exotic mesons: A gift of nature?

    Energy Technology Data Exchange (ETDEWEB)

    Carames, T.F. [Departamento de Fisica Fundamental, Universidad de Salamanca, E-37008 Salamanca (Spain); Valcarce, A., E-mail: valcarce@usal.e [Departamento de Fisica Fundamental, Universidad de Salamanca, E-37008 Salamanca (Spain); Vijande, J. [Departamento de Fisica Atomica, Molecular y Nuclear, Universidad de Valencia (UV) and IFIC (UV-CSIC), Valencia (Spain)

    2011-05-16

    We study doubly charmed exotic states by solving the scattering problem of two D mesons. Our results point to the existence of a stable isoscalar doubly charmed meson with quantum numbers (I)J{sup P}=(0)1{sup +}. We perform a thorough comparison to the results obtained within the hyperspherical harmonic formalism. Such exotic states could be measured at LHC and RHIC. Their experimental observation would, for the first time, confirm the contribution of multiquark structures to hadron spectroscopy.

  18. The phi-meson and Chiral-mass-meson production in heavy-ion collisions as potential probes of quark-gluon-plasma and Chiral symmetry transitions

    Science.gov (United States)

    Takahashi, Y.; Eby, P. B.

    1985-01-01

    Possibilities of observing abundances of phi mesons and narrow hadronic pairs, as results of QGP and Chiral transitions, are considered for nucleus-nucleus interactions. Kinematical requirements in forming close pairs are satisfied in K+K decays of S(975) and delta (980) mesons with small phi, and phi (91020) mesons with large PT, and in pi-pi decays of familiar resonance mesons only in a partially restored chiral symmetry. Gluon-gluon dominance in QGP can enhance phi meson production. High hadronization rates of primordial resonance mesons which form narrow hadronic pairs are not implausible. Past cosmic ray evidences of anomalous phi production and narrow pair abundances are considered.

  19. Decay of heavy mesons into possible spin 3/2 leptons

    International Nuclear Information System (INIS)

    Carvalho, H.F. de; Antunes, A.C.B.

    1982-01-01

    The recent interest in the study of possible spin 3/2 leptons motivated our calculation of the decay rate of heavy mesons into these leptons. The mesons be upsilon UPSILON particles (bb sup(-) systems) or any other system of the qq sup(-) (quark-antiquark) kind with mass larger than those of the upsilon particles, for example, tt sup(-) bound states (not yet detected). The decay rate of these mesons is calculated as a function of the mass of the spin 3/2 leptons. The results obtained are compared with those of the spin 1/2 leptons. (Author) [pt

  20. The η' meson from lattice QCD

    International Nuclear Information System (INIS)

    Jansen, K.; Michael, C.; Urbach, C.

    2008-04-01

    We study the flavour singlet pseudoscalar mesons from first principles using lattice QCD. With N f =2 flavours of light quark, this is the so-called η 2 meson and we discuss the phenomenological status of this. Using maximally twisted-mass lattice QCD, we extract the mass of the η 2 meson at two values of the lattice spacing for lighter quarks than previously discussed in the literature. We are able to estimate the mass value in the limit of light quarks with their physical masses. (orig.)

  1. Photoproduction of vector mesons off nucleons near threshold

    International Nuclear Information System (INIS)

    Friman, B.

    1995-01-01

    A simple meson-exchange model is proposed for the photoproduction of ρ- and ω-mesons off protons near threshold. This model provides a good description of the available data and implies a large ρ-nucleon interaction in the scalar channel (σ-exchange). This phenomenological interaction is applied to estimate the leading contribution to the self-energy of ρ-mesons in matter. The implications of our calculation for experimental studies of the ρ-meson mass in nuclei are discussed. (author)

  2. Building Bridges: Psi Chi and International Psychology

    Directory of Open Access Journals (Sweden)

    Mercedes A McCormick

    2014-12-01

    Full Text Available “How can Psi Chi best partner with international psychologists to expand the honor society world-wide?” This has been an important question since 2009, when the 1,100 chapters of Psi Chi in the United States voted to become “The International Honor Society in Psychology”. This report updates and expands on a unique symposium offered at the 120th meeting of the American Psychological Association in Orlando, Florida, in August of 2012 - the first symposium on the Presidential theme of “Building Bridges” between Psi Chi and international psychology [8]. Here, seven leaders in international psychology in North and South America join to address different aspects of this timely question--with many suggestions on how to “build bridges” to expand Psi Chi globally. It was in part due to this historic symposium that in 2013 Guatemala became the first nation in Latin America, and Russia the first nation in mainland Europe to launch a chapter of Psi Chi.

  3. Temperature, chemical potential and the ρ meson

    International Nuclear Information System (INIS)

    Roberts, C. D.; Schmidt, S. M.

    2000-01-01

    Models of QCD must confront nonperturbative phenomena such as confinement, dynamical chiral symmetry breaking (DCSB) and the formation of bound states. In addition, a unified approach should describe the deconfinement and chiral symmetry restoring phase transition exhibited by strongly-interacting matter under extreme conditions of temperature and density. Nonperturbative Dyson-Schwinger equation (DSE) models provide insight into a wide range of zero temperature hadronic phenomena; e.g., non-hadronic electroweak interactions of light- and heavy-mesons, and diverse meson-meson and meson-nucleon form factors. This is the foundation for their application at nonzero-(T, μ). Herein the authors describe the calculation of the reconfinement and chiral symmetry restoring phase boundary, and the medium dependence of ρ-meson properties. They also introduce an extension to describe the time-evolution in the plasma of the quark's scalar and vector self energies based on a Vlasov equation

  4. Effective chiral restoration in the ρ' meson in lattice QCD

    Science.gov (United States)

    Glozman, L. Ya.; Lang, C. B.; Limmer, Markus

    2010-11-01

    In simulations with dynamical quarks it has been established that the ground state ρ in the infrared is a strong mixture of the two chiral representations (0,1)+(1,0) and (1/2,1/2)b. Its angular momentum content is approximately the S13 partial wave. Effective chiral restoration in an excited ρ-meson would require that in the infrared this meson couples predominantly to one of the two representations. The variational method allows one to study the mixing of interpolators with different chiral transformation properties in the nonperturbatively determined excited state at different resolution scales. We present results for the first excited state of the ρ-meson using simulations with nf=2 dynamical quarks. We point out, that in the infrared a leading contribution to ρ'=ρ(1450) comes from (1/2,1/2)b, in contrast to the ρ. The ρ' wave function contains a significant contribution of the D13 wave which is not consistent with the quark model prediction.

  5. LHCb: LHCb results on $B$ meson mixing

    CERN Multimedia

    Eitschberger, U

    2013-01-01

    On the poster three LHCb results on B meson mixing using a datasample of 1 fb$^{-1}$ of $pp$ collisions at $\\sqrt{s} =$ 7 TeV are presented. The B meson oscillation frequencies are measured as $\\Delta m_d = 0.5156 \\pm 0.0051 (\\text{stat}) \\pm 0.0033 (\\text{syst}) \\text{ps}^{-1}$ and $\\Delta m_s = 17.768 \\pm 0.023 (\\text{stat}) \\pm 0.006 (\\text{syst}) \\text{ps}^{-1}$. The CP violation observables in the decay channel $B^0 \\rightarrow J/\\psi K^0_S$ are determined as $S_{J/\\psi K^0_S} = 0.73 \\pm 0.07 (\\text{stat})\\pm 0.04 (\\text{syst})$ and $C_{J/\\psi K^0_S} = 0.03 \\pm 0.09 (\\text{stat})\\pm 0.01 (\\text{syst})$.

  6. Properties of rho and eta mesons in nuclear matter

    International Nuclear Information System (INIS)

    Herrmann, M.; Sauermann, C.; Friman, B.L.; Technische Hochschule Darmstadt; Noerenberg, W.; Technische Hochschule Darmstadt

    1993-10-01

    The properties of ρ- and η-mesons in nuclear matter are studied within the scope of hadronic models. Unknown model parameters are obtained from fits to scattering data. - The treatment of the ρ-meson includes the coupling to two pions which, in matter, are strongly mixed with delta-particle-nucleon-hole states. The ρ-meson self-energy is evaluated in a current conserving approximation with in-medium pion propagators and vertex corrections. While the position of the original peak in the spectral function remains almost unchanged, its width grows rapidly with increasing density. Consequently, the ρ-meson strength function is strongly dispersed at high densities. Due to vertex corrections a new peak at a mass around 3m π emerges with increasing density, while the spectral function around the two-pion threshold is found to be smooth at all densities. The η-meson is strongly mixed with N * (1535)-particle-nucleon-hole states in nuclear matter. The corresponding dispersion relations with an upper and a lower branch look similar to those of the (π, ΔN -1 )-modes. However, since the N * is an S-wave resonance in the ηN-channel, the repulsion of the two branches survives at zero momentum. (orig.)

  7. The light scalar mesons as tetraquarks

    Directory of Open Access Journals (Sweden)

    Gernot Eichmann

    2016-02-01

    Full Text Available We present a numerical solution of the four-quark Bethe–Salpeter equation for ground-state scalar tetraquarks with JPC=0++. We find that the four-body equation dynamically generates pseudoscalar-meson poles in the Bethe–Salpeter amplitude. The resulting tetraquarks are genuine four-quark states that are dominated by pseudoscalar meson–meson correlations. Diquark–antidiquark contributions are subleading because of their larger mass scale. In the light quark sector, the sensitivity of the tetraquark wave function to the pion poles leads to an isoscalar tetraquark mass Mσ∼350 MeV which is comparable to that of the σ/f0(500. The masses of its multiplet partners κ and a0/f0 follow a similar pattern. This provides support for a tetraquark interpretation of the light scalar meson nonet in terms of ‘meson molecules’.

  8. Tai chi and chronic pain.

    Science.gov (United States)

    Peng, Philip W H

    2012-01-01

    In the last 2 decades, a growing body of research aimed at investigating the health benefits of Tai Chi in various chronic health conditions has been recognized in the literature. This article reviewed the history, the philosophy, and the evidence for the role of Tai Chi in a few selected chronic pain conditions. The ancient health art of Tai Chi contributes to chronic pain management in 3 major areas: adaptive exercise, mind-body interaction, and meditation. Trials examining the health benefit of Tai Chi in chronic pain conditions are mostly low quality. Only 5 pain conditions were reviewed: osteoarthritis, fibromyalgia, rheumatoid arthritis, low back pain, and headache. Of these, Tai Chi seems to be an effective intervention in osteoarthritis, low back pain, and fibromyalgia. The limitations of the Tai Chi study design and suggestions for the direction of future research are also discussed.

  9. High-level expression and characterization of two chitinases, ChiCH and ChiCW, of Bacillus cereus 28-9 in Escherichia coli

    International Nuclear Information System (INIS)

    Huang, C.-J.; Chen, C.-Y.

    2005-01-01

    Many chitinase genes have been cloned and sequenced from prokaryotes and eukaryotes but overexpression of chitinases in Escherichia coli cells was less reported. ChiCH and ChiCW of Bacillus cereus 28-9 belong to two distinct groups based on their amino acid sequences of catalytic domains, and in addition, domain structures of two enzymes are different. In this study, we established an ideal method for high-level expression of chitinases in E. coli as glutathione-S-transferase fusion proteins using pGEX-6P-1 vector. Both ChiCH and ChiCW were successfully highly expressed in E. coli cells as soluble GST-chitinase fusion proteins, and recombinant native ChiCH and ChiCW could be purified after cleavage with PreScission protease to remove GST tag. Purified chitinases were used for biochemical characterization of kinetics, hydrolysis products, and binding activities. The results indicate that ChiCW is an endo-chitinase and effectively hydrolyzes chitin and chito-multimers to chito-oligomers and the end product chitobiose, and ChiCH is an exo-chitinase and degrades chito-oligomers to produce chitobiose. Furthermore, due to higher affinity of ChiCW toward colloidal chitin than Avicel, C-terminal domain of ChiCW should be classified as a chitin-binding domain not a cellulose-binding domain although that was revealed as a cellulose-binding domain by conserved domain analysis. Therefore, the method of high-level expression of chitinases is helpful to studies and applications of chitinases

  10. Semileptonic decays of strange beauty mesons at Belle

    Energy Technology Data Exchange (ETDEWEB)

    Oswald, Christian

    2015-06-19

    Semileptonic decays of b-flavoured mesons are an important tool for the determination of the CKM matrix element vertical stroke V{sub cb} vertical stroke. In this thesis, measurements of semileptonic B{sub s} meson decays are presented. They provide complementary information to the precision measurements of B meson decays and serve as a test of QCD-calculations predicting SU(3) flavour symmetry for the partial decay widths and form factors. The semi-inclusive and inclusive analyses of semileptonic B{sub s} decays are based on the 121.4 fb{sup -1} dataset collected by the Belle detector at the KEKB asymmetric-energy e{sup +}e{sup -} collider in Tsukuba, Japan. The sample recorded at a centre-of-mass energy √(s)=10.86 GeV, which corresponds to the Y(5S) resonance, contains (7.1±1.3) million B{sub s} pair events. To measure the semi-inclusive B{sub s} → D{sub s}Xlν and B{sub s} → D{sub s}{sup *}Xlν branching fractions, D{sub s} and D{sub s}{sup *} candidates are reconstructed and are paired with an oppositely charged lepton, l{sup +}=e{sup +},μ{sup +}. The yields of correctly reconstructed D{sub s} and D{sub s}{sup *} mesons are determined by fits to their respective invariant mass distributions. The signal yield and the yields of the remaining backgrounds are extracted using kinematic distributions of the reconstructed decay products and the constraint from the known initial state of the e{sup +}e{sup -} collision. The measured branching fractions are: B(B{sub s} → D{sub s}Xlν)=(8.2±0.2(stat)±0.6(syst)±1.4(ext)) % and B(B{sub s} → D{sub s}{sup *}lν)=(5.4±0.4(stat)±0.4(syst)±0.9 (ext)) %, where the first two uncertainties are the statistical and systematic uncertainties of the measurement and the last uncertainty is due to external parameters. Making an assumption about the B{sub s} → D{sub s}Xlν branching fraction, the measurement of the B{sub s} → D{sub s}Xlν yield is also used to obtain the current best estimate of the B{sub s} pair

  11. Strong decays of sc-bar mesons in the covariant oscillator quark model with the U tilde (4)DS x O(3, 1)L-classification scheme

    International Nuclear Information System (INIS)

    Maeda, Tomohito; Yamada, Kenji; Oda, Masuho; Ishida, Shin

    2010-01-01

    We investigate the strong decays with one pseudoscalar emission of charmed strange mesons in the covariant oscillator quark model. The wave functions of composite sc-bar mesons are constructed as the irreducible representations of the U tilde (4) DS xO(3,1) L . Through the observed mass and results of decay study we discuss a novel assignment of observed charmed strange mesons from the viewpoint of the U tilde (4) DS x O(3,1) L -classification scheme. It is shown that D s0 * (2317) and D s1 (2460) are consistently explained as ground state chiralons, appeared in the U tilde (4) DS xO(3,1) L scheme. Furthermore, it is also found that recently-observed D s1 * (2710) could be described as first excited state chiralon. (author)

  12. Light Vector Mesons in the Nuclear Medium

    Energy Technology Data Exchange (ETDEWEB)

    Wood, Michael; Nasseripour, Rakhsha; Weygand, Dennis; Djalali, Chaden; Tur, Clarisse; Mosel, Ulrich; Muehlich, Pascal; Adams, Gary; Amaryan, Moscov; Amaryan, Moskov; Ambrozewicz, Pawel; Anghinolfi, Marco; Asryan, Gegham; Avagyan, Harutyun; Baghdasaryan, Hovhannes; Baillie, Nathan; Ball, James; Baltzell, Nathan; Barrow, Steve; Battaglieri, Marco; Bedlinskiy, Ivan; Bektasoglu, Mehmet; Bellis, Matthew; Benmouna, Nawal; Berman, Barry; Biselli, Angela; Blaszczyk, Lukasz; Bouchigny, Sylvain; Boyarinov, Sergey; Bradford, Robert; Branford, Derek; Briscoe, William; Brooks, William; Burkert, Volker; Butuceanu, Cornel; Calarco, John; Careccia, Sharon; Carman, Daniel; Carnahan, Bryan; Casey, Liam; Chen, Shifeng; Cheng, Lu; Cole, Philip; Collins, Patrick; Coltharp, Philip; Crabb, Donald; Crannell, Hall; Crede, Volker; Cummings, John; Dashyan, Natalya; De Vita, Raffaella; De Sanctis, Enzo; Degtiarenko, Pavel; Denizli, Haluk; Dennis, Lawrence; Deur, Alexandre; Dharmawardane, Kahanawita; Dickson, Richard; Dodge, Gail; Doughty, David; Dugger, Michael; Dytman, Steven; Dzyubak, Oleksandr; Egiyan, Hovanes; Egiyan, Kim; Elfassi, Lamiaa; Elouadrhiri, Latifa; Eugenio, Paul; Fedotov, Gleb; Feldman, Gerald; Feuerbach, Robert; Fradi, Ahmed; Funsten, Herbert; Garcon, Michel; Gavalian, Gagik; Gilfoyle, Gerard; Giovanetti, Kevin; Girod, Francois-Xavier; Goetz, John; Gordon, Christopher; Gothe, Ralf; Griffioen, Keith; Guidal, Michel; Guler, Nevzat; Guo, Lei; Gyurjyan, Vardan; Hadjidakis, Cynthia; Hafidi, Kawtar; Hakobyan, Hayk; Hakobyan, Rafael; Hanretty, Charles; Hardie, John; Hassall, Neil; Hersman, F.; Hicks, Kenneth; Hleiqawi, Ishaq; Holtrop, Maurik; Hyde, Charles; Ilieva, Yordanka; Ireland, David; Ishkhanov, Boris; Isupov, Evgeny; Ito, Mark; Jenkins, David; Jo, Hyon-Suk; Johnstone, John; Joo, Kyungseon; Juengst, Henry; Kalantarians, Narbe; Kellie, James; Khandaker, Mahbubul; Khetarpal, Puneet; Kim, Wooyoung; Klein, Andreas; Klein, Franz; Klimenko, Alexei; Kossov, Mikhail; Krahn, Zebulun; Kramer, Laird; Kubarovsky, Valery; Kuhn, Joachim; Kuhn, Sebastian; Kuleshov, Sergey; Lachniet, Jeff; Laget, Jean; Langheinrich, Jorn; Lawrence, David; Li, Ji; Livingston, Kenneth; Lu, Haiyun; MacCormick, Marion; Markov, Nikolai; Mattione, Paul; McAleer, Simeon; McKinnon, Bryan; McNabb, John; Mecking, Bernhard; Mehrabyan, Surik; Melone, Joseph; Mestayer, Mac; Meyer, Curtis; Mibe, Tsutomu; Mikhaylov, Konstantin; Minehart, Ralph; Mirazita, Marco; Miskimen, Rory; Mokeev, Viktor; Moriya, Kei; Morrow, Steven; Moteabbed, Maryam; Mueller, James; Munevar Espitia, Edwin; Mutchler, Gordon; Nadel-Turonski, Pawel; Niccolai, Silvia; Niculescu, Gabriel; Niculescu, Maria-Ioana; Niczyporuk, Bogdan; Niroula, Megh; Niyazov, Rustam; Nozar, Mina; Osipenko, Mikhail; Ostrovidov, Alexander; Park, Kijun; Pasyuk, Evgueni; Paterson, Craig; Pereira, Sergio; Pierce, Joshua; Pivnyuk, Nikolay; Pocanic, Dinko; Pogorelko, Oleg; Pozdnyakov, Sergey; Preedom, Barry; Price, John; Prok, Yelena; Protopopescu, Dan; Raue, Brian; Riccardi, Gregory; Ricco, Giovanni; Ripani, Marco; Ritchie, Barry; Ronchetti, Federico; Rosner, Guenther; Rossi, Patrizia; Sabatie, Franck; Salamanca, Julian; Salgado, Carlos; Santoro, Joseph; Sapunenko, Vladimir; Schumacher, Reinhard; Serov, Vladimir; Sharabian, Youri; Sharov, Dmitri; Shvedunov, Nikolay; Smith, Elton; Smith, Lee; Sober, Daniel; Sokhan, Daria; Stavinsky, Aleksey; Stepanyan, Stepan; Stepanyan, Samuel; Stokes, Burnham; Stoler, Paul; Strakovski, Igor; Strauch, Steffen; Taiuti, Mauro; Tedeschi, David; Tkabladze, Avtandil; Tkachenko, Svyatoslav; Todor, Luminita; Ungaro, Maurizio; Vineyard, Michael; Vlassov, Alexander; Watts, Daniel; Weinstein, Lawrence; Williams, Michael; Wolin, Elliott; Yegneswaran, Amrit; Zana, Lorenzo; Zhang, Bin; Zhang, Jixie; Zhao, Bo; Zhao, Zhiwen

    2008-07-01

    The light vector mesons ($\\rho$, $\\omega$, and $\\phi$) were produced in deuterium, carbon, titanium, and iron targets in a search for possible in-medium modifications to the properties of the $\\rho$ meson at normal nuclear densities and zero temperature. The vector mesons were detected with the CEBAF Large Acceptance Spectrometer (CLAS) via their decays to $e^{+}e^{-}$. The rare leptonic decay was chosen to reduce final-state interactions. A combinatorial background was subtracted from the invariant mass spectra using a well-established event-mixing technique. The $\\rho$ meson mass spectrum was extracted after the $\\omega$ and $\\phi$ signals were removed in a nearly model-independent way. Comparisons were made between the $\\rho$ mass spectra from the heavy targets ($A > 2$) with the mass spectrum extracted from the deuterium target. With respect to the $\\rho$-meson mass, we obtain a small shift compatible with zero. Also, we measure widths consistent with standard nuclear many-body eff

  13. Meson spectroscopy, quark mixing and quantum chromodynamics

    International Nuclear Information System (INIS)

    Filippov, A.T.

    1979-01-01

    A semiphenomenological theory of mass spectrum for mesons, consisting of a quark-antiquark pair, is presented. Relativistic kinematical effects of the quark mass differences, the SU(3)-symmetry breaking in slopes of the Regge trajectories and in radially excited states are taken into account. The OZI-rule breaking is taken into account by means of the mixing matrix for the quark wave functions, whose form is suggested by the quantum chromodynamics. A simple extrapolation of expression, given by the quantum chromodynamics from the ''asymptotic freedom'' region to the ''infrared slavery'' region is proposed to describe the dependence of the mixing parameters on the meson masses. To calculate masses and mixing angles for pseudoscalar mesons a condition is proposed that the pion mass is minimal. In this situation the eta-meson mass is near the maximal value. The predictions of the theory for masses and mixing angles of the mesons are in good agreement with the experiment

  14. Rapidity resummation for B-meson wave functions

    Directory of Open Access Journals (Sweden)

    Shen Yue-Long

    2014-01-01

    Full Text Available Transverse-momentum dependent (TMD hadronic wave functions develop light-cone divergences under QCD corrections, which are commonly regularized by the rapidity ζ of gauge vector defining the non-light-like Wilson lines. The yielding rapidity logarithms from infrared enhancement need to be resummed for both hadronic wave functions and short-distance functions, to achieve scheme-independent calculations of physical quantities. We briefly review the recent progress on the rapidity resummation for B-meson wave functions which are the key ingredients of TMD factorization formulae for radiative-leptonic, semi-leptonic and non-leptonic B-meson decays. The crucial observation is that rapidity resummation induces a strong suppression of B-meson wave functions at small light-quark momentum, strengthening the applicability of TMD factorization in exclusive B-meson decays. The phenomenological consequence of rapidity-resummation improved B-meson wave functions is further discussed in the context of B → π transition form factors at large hadronic recoil.

  15. Cabibbo-Kobayashi-Maskawa-favored B decays to a scalar meson and a D meson

    Energy Technology Data Exchange (ETDEWEB)

    Zou, Zhi-Tian; Li, Ying [Yantai University, Department of Physics, Yantai (China); Liu, Xin [Jiangsu Normal University, School of Physics and Electronic Engineering, Xuzhou (China)

    2017-12-15

    In this work, we attempt to study the Cabibbo-Kobayashi-Maskawa-favored B → anti DS (''S'' denoting the scalar meson) decays within the perturbative QCD approach at the leading order and the leading power. Although the light scalar mesons are widely perceived as primarily the four-quark bound states, in practice it is hard for us to make quantitative predictions based on the four-quark picture for light scalars. Hence, we calculate the decays with light scalars in the two-quark model. For the decays with scalar mesons above 1 GeV, we have explored two possible scenarios, depending on whether the light scalars are treated as the lowest lying q anti q states or four-quark particles. In total, we calculated the branching fractions of 72 decay modes, and most of them are in the range 10{sup -4}-10{sup -7}, which are measurable in the on-going LHCb experiment and the forthcoming Belle-II experiment. Moreover, since in the standard model these decays occur only through tree operators and have no CP asymmetries, any deviation will be a signal of new physics beyond the standard model. Despite large uncertainties induced by nonperturbative parameters and corrections of high order and high power, our results and discussions will be useful for the on-going LHCb and the forthcoming Belle-II experiments. (orig.)

  16. Measurement of the D*± meson production cross section at low and medium Q2 with the H1 detector at HERA

    International Nuclear Information System (INIS)

    Dobre, Monica

    2012-11-01

    The inclusive production of D ± (2010) mesons in deep inelastic scattering is studied using data recorded by the H1 experiment in the years 1999 to 2000 and corresponding to an integrated luminosity of 47.66 pb -1 . The measurement covers the region 2 2 2 in photon virtuality and the region 0.02 *± meson production is restricted in transverse momentum to p T (D * )>1.25 GeV and in pseudorapidity to vertical stroke η(D * ) vertical stroke <1.8. Single and double differential cross sections are compared to leading order and next-to-leading order perturbative QCD predictions.

  17. Light-Meson Spectroscopy at COMPASS

    CERN Document Server

    Krinner, Fabian

    2017-01-01

    The goal of the COMPASS experiment at CERN is to study the structure and spectroscopy of hadrons. The two-stage spectrometer has large acceptance and covers a wide kinematic range for charged as well as neutral particles allowing to access a wide range of reactions. Light mesons are studied with negative (mostly $\\pi^-$) and positive ($p$, $\\pi^+$) hadron beams with a momentum of $190\\,\\text{GeV}/c$. The light-meson spectrum is measured in different final states produced in diffractive dissociation reactions with squared four-momentum transfer $t$ to the target between $0.1$ and $1.0\\,(\\text{GeV}/c)^2$. The flagship channel is the $\\pi^-\\pi^+\\pi^-$ final state, for which COMPASS has recorded the currently world's largest data sample. These data not only allow us to measure the properties of known resonances with high precision, but also to search for new states. Among these is a new axial-vector signal, the $a_1(1420)$, with unusual properties. The findings are confirmed by the analysis of the $\\pi^-\\pi^0\\pi^...

  18. Angular Momentum Content of the ρ Meson in Lattice QCD

    Science.gov (United States)

    Glozman, Leonid Ya.; Lang, C. B.; Limmer, Markus

    2009-09-01

    The variational method allows one to study the mixing of interpolators with different chiral transformation properties in the nonperturbatively determined physical state. It is then possible to define and calculate in a gauge-invariant manner the chiral as well as the partial wave content of the quark-antiquark component of a meson in the infrared, where mass is generated. Using a unitary transformation from the chiral basis to the LJ2S+1 basis one may extract a partial wave content of a meson. We present results for the ground state of the ρ meson using quenched simulations as well as simulations with nf=2 dynamical quarks, all for lattice spacings close to 0.15 fm. We point out that these results indicate a simple S13-wave composition of the ρ meson in the infrared, like in the SU(6) flavor-spin quark model.

  19. Further evidence for magnetic charge from meson spectroscopy

    International Nuclear Information System (INIS)

    Akers, D.

    1987-01-01

    Recently evidence was presented for the existence of magnetic charge from Zeeman splitting in meson states. The model by Akers predicted the existence of a new eta meson at 1814 MeV with I/sup G/ (J/sup PC/) = O + (O -+ ). Experimental evidence for this new meson is cited and discussed

  20. On exotic hybrid meson production in {gamma}{sup *}{gamma} collisions

    Energy Technology Data Exchange (ETDEWEB)

    Anikin, I.V.; Teryaev, O.V. [Bogoliubov Laboratory of Theoretical Physics, Dubna (Russian Federation); Pire, B. [Ecole Polytechnique, 91 - Palaiseau (France). CPHT; Szymanowski, L. [Soltan Inst. for Nuclear Studies, Warsaw (Poland); Universite de Liege (Belgium); Paris-11 Univ., 91 - Orsay (France). LPT; Wallon, S. [Paris-11 Univ., 91 - Orsay (France). LPT

    2006-07-15

    We present a theoretical study of exotic hybrid meson (J{sup PC}=1{sup -+}) production in photon-photon collisions where one of the photons is deeply virtual, including twist two and twist three contributions. We calculate the cross section of this process, which turns out to be large enough to imply sizeable counting rates in the present high luminosity electron-positron colliders. We emphasize the importance of the {pi}{eta} decay channel for the detection of the hybrid meson candidate {pi}{sub 1}(1400) and calculate the cross section and the angular distribution for {pi}{eta} pair production in the unpolarized case. This angular distribution is a useful tool for disentangling the hybrid meson signal from the background. Finally, we calculate the single spin asymmetry associated with one initial longitudinally polarized lepton. (orig.)

  1. Hybrid mesons (Q anti Qg) in N anti N annihilation

    International Nuclear Information System (INIS)

    Dover, C.B.; Gutsche, T.; Faessler, A.

    1993-09-01

    N anti N annihilation reactions provide exciting possibilities to study mesonic resonances beyond the usual Q anti Q spectrum. Particularly the search for Q anti Qg mesons containing an explicit dynamical excitation of the gluon field is not promising, since hybrids are predicted to display unique features: exotic quantum numbers (J πC ) and dynamical selection rules for their decay modes. The authors have investigated the possibility of producing hybrids from p anti p atomic states in reactions of the type N anti N(L= 0,1) → π + Q anti Qg. Production rates for hybrid mesons are found to display a strong dependence on the quantum numbers and kinematical factors associated with the transition. The dependence on the orbital angular momentum L of the p anti p atomic state, accessible in p anti p annihilation at rest, would provide a striking signature for the production of hybrids. In estimating branching ratios for the formation of Q anti Qg hybrid mesons in N anti N annihilation reactions at rest, the authors have employed a microscopic model with constituent quarks and gluons in analogy to the annihilation model for the production of Q anti Q mesons

  2. A phenomenological analysis of non-resonant charm meson decays

    International Nuclear Information System (INIS)

    Bediaga, I.; Goebel, C.; Mendez-Galain, R.

    1997-07-01

    We analyse the consequences of the usual assumption of a constant function to fit non-resonant decays from experimental Dalitz plot describing charmed meson decays. We first show, using the D + -> K 0 π + π 0 decay channel as an example, how an inadequate extraction of the non-resonant contribution could yield incorrect measurements for the resonant channels. We analyse how the correct study of this decay will provide a test for the validity of factorization in D meson decays. Finally, we show how form factors that can be measured from the D + s -> π - π + π + decay. We emphasize its relevance for the study of the decay τ -> v t 3π and the extraction of the α 1 meson width. (author)

  3. General characteristics of Bc-mesons. Production mechanisms and decays

    International Nuclear Information System (INIS)

    Gershtein, S.S.; Likhoded, A.K.; Slabospitsky, S.R.

    1989-01-01

    Using Martin potential, independent of b- and c-quark flavour, the mass spectrum of B c (bc-bar)-mesons and widths of electromagnetic transition between them are calculated. The estimations of the production cross section at e + e - colliders, in hadronic and neutrino interactions are obtained. A real possibility to observed B c mesons at LEP and also at hadron colliders (σ(B c )/σ(bb-bar)∼10 -3 ) has been pointed out. The importance of observing the annihilation decay channels of B c -mesons: B c →τν τ (Br(B c →τν τ )=1.5-2%), and B c →ΦD s , B C →DK etc, has been emphasized. 25 refs.; 16 figs.; 5 tabs

  4. Study of D(1285) → K+K-π0 decay and D(1285)- and E(1420)-mesons production in exclusive reactions, induced by π-- and K--mesons at 32.5 GeV/c

    International Nuclear Information System (INIS)

    Bitukov, S.I.; Viktorov, V.A.; Golovkin, S.V.

    1985-01-01

    D(1285) and E(1420)-mesons production in charge-exchange reactions induced by π - and K - -mesons at 32.5 GeV/c has been studied. The measured cross sections allowed one to derive limitations for the mixing angle in the axial-vector meson nonet. This means that E(1420)-meson consists mainly of strange quarks. The invariant mass distribution for the kaon pair in D(1285) → K + K - π 0 decay with statistics by an order of magnitude higher than the available data was obtained. The differential spectrum dN/dmsub(Ksup(+)Ksub(-)) analysis carried out in the delta-dominance model shows that delta(980)-meson cannot be described as a Breit-Wigner resonance with small width. The effective width for delta-meson at the point of √s=1 GeV/c 2 GITAsub(delta) is greater than 180 MeV/c 2 . It points to a strong coupling of delta-meson to hadrons

  5. Photoproduction of vector mesons off nucleons near threshold

    International Nuclear Information System (INIS)

    Friman, B.; Soyeur, M.

    1995-11-01

    We propose a simple meson-exchange model of the photoproduction of ρ-and ω-mesons off protons near threshold (E γ < or∼2 GeV). We show that this model provides a good description of the available data and implies a large ρ-nucleon interaction in the scalar channel (σ-exchange). We use this phenomenological interaction to estimate the leading contribution to the self-energy of ρ-mesons in matter. We discuss the implications of our calculation for experimental studies of the ρ-meson mass in nuclei. (orig.)

  6. Stress Management: Tai Chi

    Science.gov (United States)

    ... in constant motion. Tai chi has many different styles. Each style may subtly emphasize various tai chi principles and methods. There are variations within each style. Some styles may focus on health maintenance, while ...

  7. Search for radiative B meson decays

    International Nuclear Information System (INIS)

    Lesiak, T.; Muryn, B.; Nowak, G.; Antreasyan, D.; Irion, J.; McBride, P.; Strauch, K.; Bartels, H.W.; Bienlein, J.K.; Brockmueller, K.; Jakubowski, Z.; Karch, K.; Kloiber, T.; Koch, W.; Maschmann, W.; Meyer, H.; Skwarnicki, T.; Trost, H.J.; Voigt, A.; Wachs, K.; Zschorsch, P.; Besset, D.; Cabenda, R.; Cowan, R.; Bieler, C.; Graaf, K.; Heinsius, F.H.; Kiel, T.; Krueger, S.; Lekebusch, R.; Nernst, R.; Sievers, D.; Stock, V.; Strohbusch, U.; Bloom, E.D.; Clare, R.; Cooper, S.; Fairfield, K.; Fridman, A.; Gaiser, J.; Gelphman, D.; Godfrey, G.; Hofstadter, R.; Kirkbride, I.; Lee, R.; Leffler, S.; Litke, A.M.; Lockman, W.; Lowe, S.; Niczyporuk, B.; Pollock, B.; Schwarz, A.; Tompkins, J.; Van Uitert, B.; Wacker, K.; Brock, I.; Engler, A.; Kraemer, R.W.; Marlow, D.; Messing, F.; Prindle, D.; Renger, B.; Rippich, C.; Vogel, H.; Cavalli-Sforza, M.; Coyne, D.; Folger, G.; Glaser, G.; Kobel, M.; Lurz, B.; Schuette, J.; Volland, U.; Wegener, H.; Janssen, H.; Koenig, A.C.; Metzger, W.J.; Reidenbach, M.; Schotanus, J.; Walle, R.T. van de; Walk, W.; Keh, S.; Kilian, H.; Koenigsmann, K.; Scheer, M.; Schmitt, P.; Marsiske, H.; Williams, D.A.

    1992-01-01

    The Crystal Ball detector at the e + e - storage ring DORIS-II has been used to search for radiative B meson decays, especially of the type b→sγ. No mono-energetic γ-lines have been found in the inclusive photon spectrum from Υ(4S) decays, and upper limits are obtained for radiative decays of B mesons to various strange mesons and to the D*. Integrating the photon spectrum over the corresponding energy range, we find BR(B→γX) -3 , at 90% confidence level for the mass range 892 MeV≤M X ≤2045 MeV. (orig.)

  8. Search for radiative B meson decays

    International Nuclear Information System (INIS)

    Lesiak, T.; Muryn, B.; Nowak, G.; Antreasyan, D.; Irion, J.; McBride, P.; Strauch, K.; Bartels, H.W.; Bienlein, J.K.; Brockmueller, K.; Jakubowski, Z.; Karch, K.; Kloiber, T.; Koch, W.; Maschmann, W.; Meyer, H.; Skwarnicki, T.; Trost, H.J.; Voigt, A.; Wachs, K.; Zschorsch, P.; Besset, D.; Cabenda, R.; Cowan, R.; Bieler, C.; Graaf, K.; Heinsius, F.H.; Kiel, T.; Krueger, S.; Lekebusch, R.; Nernst, R.; Sievers, D.; Stock, V.; Strohbusch, U.; Bloom, E.D.; Clare, R.; Cooper, S.; Fairfield, K.; Fridman, A.; Gaiser, J.; Gelphman, D.; Godfrey, G.; Hofstadter, R.; Kirkbride, I.; Lee, R.; Leffler, S.; Litke, A.M.; Lockman, W.; Lowe, S.; Niczyporuk, B.; Pollock, B.; Schwarz, A.; Tompkins, J.; Van Uitert, B.; Wacker, K.; Brock, I.; Engler, A.; Kraemer, R.W.; Marlow, D.; Messing, F.; Prindle, D.; Renger, B.; Rippich, C.; Vogel, H.; Cavalli-Sforza, M.; Coyne, D.; Folger, G.; Glaser, G.; Kobel, M.; Lurz, B.; Schuette, J.; Volland, U.; Wegener, H.; Janssen, H.; Koenig, A.C.; Metzger, W.J.; Reidenbach, M.; Schotanus, J.; Walle, R.T. van de; Walk, W.; Keh, S.; Kilian, H.; Koenigsmann, K.; Scheer, M.; Schmitt, P.; Marsiske, H.; Peck, C.; Porter, F.C.; Ratoff, P.; Williams, D.A.

    1991-07-01

    The Crystal Ball detector at the ε + ε - storage ring DORIS-II has been used to search for radiative B meson decays, especially of the type b→sγ. No mono-energetic γ-lines have been found in the inclusive photon spectrum from Υ(4S) decays, and upper limits are obtained for radiative decays of B mesons to various strange mesons and to the D*. Integrating the photon spectrum over the corresponding energy range, we find BR(B→γX) -3 at 90% confidence level for the mass range 892 MeV≤M X ≤2045 MeV. (orig.)

  9. D*± meson production at low Q2 with the H1 detector and determination of unintegrated gluon densities

    International Nuclear Information System (INIS)

    Cholewa, Axel

    2011-02-01

    A study of inclusive D *± meson production in deep inelastic electron-proton scattering at the H1 detector is presented for low photon virtualities. The results of these measurements have been used to determine unintegrated gluon densities with the Monte Carlo generator CASCADE. The phase space of the measurement is defined by photon virtualities inside 2 GeV 2 2 2 , and inelasticities inside 0.02 *± mesons is restricted to pseudo rapidities of vertical stroke η D * vertical stroke t D * >1.5 GeV and complements D *± meson production measurements at higher photon virtualities. Data taken in the years 2004-2007 during the HERA II running period have been analyzed yielding an integrated luminosity of 348 pb -1 . This significant increase in statistics compared to HERA I was exploited in the single and double differential cross sections which have been measured more differentiated than in previous measurements at H1. The single differential cross sections have been used in parameter fits of unintegrated gluon densities. For this purpose scattering events in electron-proton collisions were simulated with the Monte Carlo generator CASCADE and the deviation of the prediction of the simulation from the measured data was then minimized with the χ 2 method. Three different parametrizations of unintegrated gluon distributions have been used and compared. (orig.)

  10. About absence of oscillations at CP violation and presence of interference between KS-, KL-meson states in the system of K0 mesons

    International Nuclear Information System (INIS)

    Beshtoev, Kh.M.

    2014-01-01

    Two approaches to the description of K 0 -, K 0 -bar-meson transitions into K 1 0 mesons at CP violation in weak interactions are considered. The first approach uses the standard theory of oscillations and the second approach supposes that (K S , K L ) states which arise at CP violation are normalized but not orthogonal state functions, then there arise interferences between these states but not oscillations. It is necessary to remark that the available experimental data are in good agreement with the second approach. So, we come to the conclusion that oscillations do not arise at CP violation in weak interactions in the system of K 0 mesons. Only interference between K S and K L states takes place here.

  11. Rare B-meson decays in SU(2)LxSU(2)RxU(1) model

    International Nuclear Information System (INIS)

    Asatryan, H.M.; Ioannissian, A.N.

    1989-01-01

    Rare B-meson decays are investigated in the left-right synmmetric models. The scalar particle contribution to the amplitude of the b → s γ decay is calculated. It is shown that this contribution can be essential even for the scalar particles masses of about several TeV. The effects due to the left-right symmetry and scalar particles can be detected by measuring the photon polarization in the decay B → K * γ. 9 refs.; 1 fig.; 1 tab

  12. Heavy quarks fragmentation in charmed mesons in DELPHI experiment at LEP

    International Nuclear Information System (INIS)

    Levy, J.M.

    1994-04-01

    With the big statistics expected at LEP, the electroweak sector of the Standard Model can be tested as well as the theory of strong interactions. Quantum Chromo-Dynamics is indeed predictive for quarks properties, but does not explain how quarks fragment into hadrons. So far the hadronization can only be described with phenomenological models. The work presented in this thesis was performed on the DELPHI experiment at LEP and concerns the production and the fragmentation of heavy quarks into charmed mesons D , D* and D**. With the whole statistics of 1991 and 1992 (1 013 300 hadronic decays of the Z), more than 4500 charmed mesons decays have been reconstructed in the channels D 0 → K - π + , D + → K - π + π+ and D * +→ D 0 π + followed by D 0 → K - π + . Using also 1993 data and the channel D 0 → K - π + π + π - , evidence for D** production is presented. For the first time, the production rate is measured for each D meson separately for cc and bb contributions. In fact, D mesons can be produced either directly from the fragmentation of c quark or un-directly from the fragmentation of b quark into B mesons which decay into D mesons. (authors). 120 refs

  13. The mixing of scalar mesons and the baryon-baryon interaction

    International Nuclear Information System (INIS)

    Dai, L.R.

    2011-01-01

    By introducing the mixing of scalar mesons in the chiral SU(3) quark model, we dynamically investigate the baryon-baryon interaction. The hyperon-nucleon and nucleon-nucleon interactions are studied by solving the resonating group method (RGM) equation in a coupled-channel calculation. In our present work, the experimental lightest pseudoscalar π, K, η, η' mesons correspond exactly to the chiral nonet pseudoscalar fields π, K, η, η' in the chiral SU(3) quark model. The η, η' mesons are considered as the mixing of singlet and octet mesons, and the mixing angle θ ps is taken to be -23 . For scalar nonet mesons, we suppose that there exists a correspondence between the experimental lightest scalar f 0 (600), κ, a 0 (980), f 0 (980) mesons and the theoretical scalar nonet σ, κ, σ', ε fields in the chiral SU(3) quark model. For scalar mesons, we consider two different mixing cases: one is the ideal mixing and another is the θ s = 19 mixing. The masses of the σ' and ε mesons are taken to be 980MeV, which are just the masses of the experimental a 0 (980), f 0 (980) mesons. The mass of the σ meson is an adjustable parameter and is decided by fitting the binding energy of the deuteron, the masses of 560MeV and 644MeV are obtained for the ideal mixing and the θ s = 19 mixing, respectively. We find that, in order to reasonably describe the YN interactions, the mass of the κ meson is near 780MeV for the ideal mixing. However, we must enhance the mass of the κ meson for the θ s = 19 mixing, the 1050MeV is favorably used in the present work. The experimental σ and κ scalar mesons are very strange, both have larger widths. Hence, no matter what kind of mixing is considered, all the masses of scalar mesons we used in the present work seem to be consistent with the present PDG information. (orig.)

  14. The lightest hybrid meson supermultiplet in QCD

    Energy Technology Data Exchange (ETDEWEB)

    Dudek, Jozef J

    2011-10-01

    We interpret the spectrum of meson states recently obtained in non-perturbative lattice QCD calculations in terms of constituent quark-antiquark bound states and states, called 'hybrids', in which the q{bar q} pair is supplemented by an excitation of the gluonic field. We identify a lightest supermultiplet of hybrid mesons with J{sup PC} = (0,1,2){sup {-+}}, 1{sup -} built from a gluonic excitation of chromomagnetic character coupled to q{bar q} in an S-wave. The next lightest hybrids are suggested to be quark orbital excitations with the same gluonic excitation, while the next distinct gluonic excitation is significantly heavier. Existing models of gluonic excitations are compared to these findings and possible phenomenological consequences explored.

  15. Summary of Meson'98 Workshop

    International Nuclear Information System (INIS)

    Henley, E.M.

    1998-01-01

    One never quite knows what to say in a summary. If you were at the sessions, you heard the same talks I did. Perhaps the purpose is to summarize the parallel sessions, but like you, I can only attend one of these sessions. In addition, the time is short, so that this cannot be a real summary. What I will present are impressions of the past two days, and these will certainly be colored by my own views. Thus at the outset, let me apologize for any and all omissions and distortions. I will cover primarily the plenary session talks, but will organize this summary along the following lines: 1. vector (V) mesons; 2. pseudoscalar mesons, and 3. other subjects, notably with electrons. This afternoon's talks are so close in time to this summary that I shall omit them. (author)

  16. Nuclear photo-meson productions in the 1 GeV energy region

    International Nuclear Information System (INIS)

    Maeda, Kazushige

    1991-01-01

    Experimental studies of nuclear photomeson productions in the 1 GeV energy region are discussed. In this energy region, π ± , K + and (η) mesons whose life time (or widths) are enough long (narrow) to use spectroscopic study can be produced. This report focuses a possibility of electro-magnetic K + . productions on nuclei. A preliminary result of a photo-kaon test experiment carried out at electron synchrotron laboratory, Institute for Nuclear Study, University of Tokyo are presented. In this experiment, the particle identification method to select Kaon events has been established. We have performed a first measurement of nuclear photo-kaon cross section. (author)

  17. Fock exchange in meson theories of nuclei

    International Nuclear Information System (INIS)

    Bolsterli, M.

    1986-01-01

    The Fock exchange term in meson field theories of nuclear systems is shown to arise from a two-loop ground-state self-energy diagram. Evaluation of this diagram gives the relativistic or semirelativistic analog of the Fock exchange energy; it differs from the nucleon-nucleon Fock energy in including retardation effects. In finite meson-field theories of nuclear systems, the variational nature of the meson-field analog of the Hartree-Fock energy functional can be further elucidated. 4 refs

  18. On some rare weak decays of vector mesons

    International Nuclear Information System (INIS)

    Kurdadze, L.M.; Silagadze, Z.K.

    2000-01-01

    Some semileptonic weak decays of vector mesons are considered in the framework of the most popular quark models. Two the most popular models go give more elaborated estimates for the vector meson semileptonic decay rates are used. Unfortunately the predicted branching ratios are too small to make a study of these decays realistic at meson factories under construction [ru

  19. Lifetime of rho meson in correlation with magnetic-dimensional reduction

    Energy Technology Data Exchange (ETDEWEB)

    Kawaguchi, Mamiya [Nagoya University, Department of Physics, Nagoya (Japan); Matsuzaki, Shinya [Nagoya University, Department of Physics, Nagoya (Japan); Nagoya University, Institute for Advanced Research, Nagoya (Japan)

    2017-04-15

    It is naively expected that in a strong magnetic configuration, the Landau quantization ceases the neutral rho meson to decay to the charged pion pair, so the neutral rho meson will be long-lived. To closely access this naive observation, we explicitly compute the charged pion loop in the magnetic field at the one-loop level, to evaluate the magnetic dependence of the lifetime for the neutral rho meson as well as its mass. Due to the dimensional reduction induced by the magnetic field (violation of the Lorentz invariance), the polarization (spin s{sub z} = 0, ±1) modes of the rho meson, as well as the corresponding pole mass and width, are decomposed in a nontrivial manner compared to the vacuum case. To see the significance of the reduction effect, we simply take the lowest Landau level approximation to analyze the spin-dependent rho masses and widths. We find that the ''fate'' of the rho meson may be more complicated because of the magnetic-dimensional reduction: as the magnetic field increases, the rho width for the spin s{sub z} = 0 starts to develop, reaches a peak, then vanishes at the critical magnetic field to which the folklore refers. On the other side, the decay rates of the other rhos for s{sub z} = ±1 monotonically increase as the magnetic field develops. The correlation between the polarization dependence and the Landau level truncation is also addressed. (orig.)

  20. Measurement of the production of K{sup +} mesons by protons in nuclei (1960); Mesure de la production des mesons K{sup +} par des protons dans les noyaux (1960)

    Energy Technology Data Exchange (ETDEWEB)

    Teiger, J [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

    1960-07-01

    K{sup +} mesons produced by the internal proton beam of Saturne have been identified by means of scintillation and Cerenkov counters. The production cross sections are given per target nucleus measured at a laboratory angle of 35 deg. as well as the cross section relative to {pi}{sup +} mesons of the same momentum for: - incident protons of kinetic energy between 1.3 and 2.8 GeV, - targets of C, Cu and Pb, - K{sup +} produced with kinetic energies between 0.45 and 0.65 GeV. From these results we have tried to deduce the importance of indirect production by intermediate {pi} mesons with respect to direct production by proton-nucleon collisions. (author) [French] Au moyen de detecteurs a scintillations et a rayonnement Cerenkov, on a identifie les mesons lourds K{sup +} produits par les protons du faisceau interne de 'Saturne'. On donne les sections efficaces de production, par noyau cible, mesurees a 35 deg. dans le laboratoire, ainsi que les sections efficaces relatives par rapport aux mesons {pi}{sup +} de meme impulsion pour: - des protons incidents d'energie cinetique entre 1,3 GeV et 2,8 GeV, - des cibles de C, de Cu et de Pb, - des K{sup +} produits avec des energies cinetiques entre 0,45 et 0,65 GeV. De ces resultats, on a essaye de deduire l'importance de la production indirecte, par mesons {pi} intermediaires, par rapport a la production directe dans un choc proton-nucleon. (auteur)

  1. Rare meson decays into very light neutralinos

    Energy Technology Data Exchange (ETDEWEB)

    Dreiner, H.K.; Grab, S. [Bonn Univ. (Germany). Bethe Center for Theoretical Physics und Physikalisches Inst.; Koschade, D. [RWTH Aachen Univ. (Germany). Inst. fuer Theoretische Physik; London Univ. (United Kingdom). Centre for Reserach in String Theory; Kraemer, M.; O' Leary, B. [RWTH Aachen Univ. (Germany). Inst. fuer Theoretische Physik; Langenfeld, U. [Deutsches Elektronen-Synchrotron (DESY), Zeuthen (Germany)

    2009-05-15

    We investigate the bounds on the mass of the lightest neutralino from rare meson decays within the MSSM with and without minimal flavor violation. We present explicit formulae for the two-body decays of mesons into light neutralinos and perform the first complete calculation of the loop-induced decays of kaons to pions and light neutralinos and B mesons to kaons and light neutralinos. We find that the supersymmetric branching ratios are strongly suppressed within the MSSM with minimal flavor violation, and that no bounds on the neutralino mass can be inferred from experimental data, i.e. a massless neutralino is allowed. The branching ratios for kaon and B meson decays into light neutralinos may, however, be enhanced when one allows for non-minimal flavor violation. We find new constraints on the MSSM parameter space for such scenarios and discuss prospects for future kaon and B meson experiments. Finally, we comment on the search for light neutralinos in monojet signatures at the Tevatron and at the LHC. (orig.)

  2. Meson exchange corrections in deep inelastic scattering on deuteron

    International Nuclear Information System (INIS)

    Kaptari, L.P.; Titov, A.I.

    1989-01-01

    Starting with the general equations of motion of the nucleons interacting with the mesons the one-particle Schroedinger-like equation for the nucleon wave function and the deep inelastic scattering amplitude with the meson-exchange currents are obtained. Effective pion-, sigma-, and omega-meson exchanges are considered. It is found that the mesonic corrections only partially (about 60%) restore the energy sum rule breaking because of the nucleon off-mass-shell effects in nuclei. This results contradicts with the prediction based on the calculation of the energy sum rule limited by the second order of the nucleon-meson vertex and static approximation. 17 refs.; 3 figs

  3. Unified Chiral models of mesons and baryons

    International Nuclear Information System (INIS)

    Mendez-Galain, R.; Ripka, G.

    1990-01-01

    Unified Chiral models of mesons and baryons are presented. Emphasis is placed on the underlying quark structure of hadrons including the Skyrmion. The Nambu Jona-Lasinio model with vector mesons is discussed

  4. Search for gluonic excitations in light unconventional mesons

    Energy Technology Data Exchange (ETDEWEB)

    Paul Eugenio

    2007-07-01

    Studies of meson spectra via strong decays provide insight regarding QCD at the confinement scale. These studies have led to phenomenologicalmodels for QCD such as the constituent quark model. However, QCD allows for a much richer spectrum of meson states which include extra states such as exotics, hybrids, multi-quarks, and glueballs. First discussion of the status of exotic meson searches is given followed by a discussion of plans at Jefferson Lab to double the energy of the machine to 12 GeV, which will allow us to access photoproduction of mesons in search for gluonic excited states.

  5. D-meson production by muons in the COMPASS experiment at CERN

    Energy Technology Data Exchange (ETDEWEB)

    Zvyagin, Alexander

    2011-01-21

    One of the physics goals of the COMPASS experiment at CERN was to measure the contribution of gluons to the nucleon spin. To achieve this, it was proposed to scatter polarized 160 GeV/c muons on a polarized deuteron target and to detect D mesons in the final state. The underlying process in this D meson production is supposed to be the Photon-Gluon Fusion (PGF), where a virtual photon emitted by the muon interacts with a gluon from the target nucleon, producing a charm-anticharm quark pair. Fragmentation of a charm (anticharm) quark leads with high probability to the creation of a D{sup 0} or D{sup *} meson, which COMPASS detects via the D{sup 0}{yields}K{pi} and D{sup *}{yields}D{sup 0}{pi}{yields}K{pi}{pi} decay modes. From the longitudinal cross section spin asymmetries of the D meson production and theoretical predictions for the PGF cross section, the gluon contribution to the nucleon spin has been measured by the COMPASS experiment. The results presented in the thesis are the following. Based on data from the year 2004 a total visible cross section of 1.8{+-}0.4 nb, for the D{sup *} meson production, has been measured, with the error being dominated by systematic effects. It is validated that the D mesons are indeed produced through the PGF process, by comparison of measured D meson kinematic distributions to the ones predicted by a theory (AROMA generator). A good agreement was found for the distribution shapes, which confirms that PGF plays a major role. However, a 20% difference was found in the number of produced D{sup 0} and D{sup 0} mesons (and for the D{sup *+} and D{sup *-} mesons as well) which is significantly larger than predicted by AROMA. Kinematic distributions of D{sup 0} and D{sup *} mesons were compared with the background and also with the nearby K{sup *}{sub 2}(1430){sup 0} resonance, using all longitudinal data taken in 2002-2006. The particle-antiparticle asymmetry has been studied as a function of several kinematic variables. The 20

  6. B decays to wrong sign charm mesons at the DELPHI experiment

    International Nuclear Information System (INIS)

    Schwanda, C.

    2001-05-01

    In the present work, b hadron decays to 'wrong sign charm' mesons, b → D-bar 0 X, b → D - X and b → D s - X, are studied using the data collected by the DELPHI experiment in the years 1994 and 1995, and the corresponding branching fractions are extracted. Decays b → c-bar are expected to occur through the Cabibbo favored transitions b → cW - and W - → cbar s, and hence wrong sign charm decays are in fact double charm transitions. The interest in this type of b decays is triggered by different motivations. At first, wrong sign charm decays provide evidence for an alternative mechanism leading to the production of charmed mesons in b decay ('upper vertex charm'), and, second, the double charm rate is related to n c , the mean number of charm quarks (and anti-quarks) produced per b decay, n c =1 + Br(b → c c-bar s). Predictions of the semileptonic B meson branching fraction, based on the heavy quark effective theory (HQET) and the heavy quark expansion (HQE), also fix the value of n c . By measuring the double charm rate, we can thus probe these predictions. The measurement of the inclusive wrong sign branching fractions proceeds through the following steps: At first, the charmed meson decays D 0 → K - π + , D + → K - π + π + and D s + → φ π + → K + K - π + are exclusively reconstructed in the DELPHI data. The charge of the c quark confined inside the charmed meson is determined by the charge of the kaon (D 0 , D + ) or by the charge of the pion (D s + ). The b quark charge at decay time in the charmed meson hemisphere is estimated by using identified particles. A neural network approach is adopted. By correlating both charge informations, we obtain the main discriminant variable for selecting wrong sign mesons. We measure the following branching ratios: Br(b → D-bar X)=(9.3 ± 1.7(stat) ± 1.3(syst))% and Br(b → D s - X)=(10.3 ± 1.1(stat) ± 2.9(syst))% (the first error is statistical, the second one systematic). This result is

  7. Sigma meson in heavy ion collision

    International Nuclear Information System (INIS)

    Cristian, Ivan; Fuchs, Christian

    2004-01-01

    We want to present a short theoretical prediction of the behaviour of the sigma meson in heavy ion collisions. It is considered that the sigma meson is a pion-pion correlation, resulting from the decay of the N*(1440) resonance. There will be presented some QMD simulations. (authors)

  8. Search for Neutrinoless τ Decays Involving π0 or η Mesons

    International Nuclear Information System (INIS)

    Bonvicini, G.; Cinabro, D.; Greene, R.; Perera, L.P.; Zhou, G.J.; Barish, B.; Chadha, M.; Chan, S.; Eigen, G.; Miller, J.S.; OGrady, C.; Schmidtler, M.; Urheim, J.; Weinstein, A.J.; Wuerthwein, F.; Asner, D.M.; Bliss, D.W.; Brower, W.S.; Masek, G.; Paar, H.P.; Prell, S.; Sharma, V.; Gronberg, J.; Hill, T.S.; Kutschke, R.; Lange, D.J.; Menary, S.; Morrison, R.J.; Nelson, H.N.; Nelson, T.K.; Qiao, C.; Richman, J.D.; Roberts, D.; Ryd, A.; Witherell, M.S.; Balest, R.; Behrens, B.H.; Cho, K.; Ford, W.T.; Park, H.; Rankin, P.; Roy, J.; Smith, J.G.; Alexander, J.P.; Bebek, C.; Berger, B.E.; Berkelman, K.; Bloom, K.; Cassel, D.G.; Cho, H.A.; Coffman, D.M.; Crowcroft, D.S.; Dickson, M.; Drell, P.S.; Ecklund, K.M.; Ehrlich, R.; Elia, R.; Foland, A.D.; Gaidarev, P.; Galik, R.S.; Gittelman, B.; Gray, S.W.; Hartill, D.L.; Heltsley, B.K.; Hopman, P.I.; Kandaswamy, J.; Kim, P.C.; Kreinick, D.L.; Lee, T.; Liu, Y.; Ludwig, G.S.; Masui, J.; Mevissen, J.; Mistry, N.B.; Ng, C.R.; Nordberg, E.; Ogg, M.; Patterson, J.R.; Peterson, D.; Riley, D.; Soffer, A.; Valant-Spaight, B.; Ward, C.; Athanas, M.; Avery, P.; Jones, C.D.; Lohner, M.; Prescott, C.; Yelton, J.; Zheng, J.; Brandenburg, G.; Briere, R.A.; Gao, Y.S.; Kim, D.Y.; Wilson, R.; Yamamoto, H.; Browder, T.E.; Li, F.; Li, Y.; Rodriguez, J.L.; Bergfeld, T.; Eisenstein, B.I.; Ernst, J.

    1997-01-01

    We have searched for lepton flavor violating decays of the τ lepton using final states with an electron or a muon and one or two π 0 or η mesons but no neutrinos. The data used in the search were collected with the CLEO II detector at the Cornell Electron Storage Ring (CESR) and correspond to an integrated luminosity of 4.68 fb -1 . No evidence for signals was found, resulting in much improved limits on the branching fractions for the one-meson modes and the first upper limits for the two-meson modes. copyright 1997 The American Physical Society

  9. {eta} meson photoproduction on deuterium; Photoproduction du meson {eta} sur le deuterium

    Energy Technology Data Exchange (ETDEWEB)

    Hoffmann-Rothe, P.

    1996-05-30

    Measurements of the total and differential cross sections for {eta}-meson photoproduction on a D{sub 2} liquid target from threshold to 1.2 GeV, have been taken using the tagged Bremsstrahlung photon beam produced by the electrons extracted from the ELSA storage ring at Bonn. The reaction was identified by detecting the eta decay products in the neutral meson spectrometer SPES0-2{pi}, while the recoil baryons (proton, neutron or deuteron) were detected by a variety of large angle scintillator detectors. We succeeded to identify completely the final states corresponding to the production of an {eta} meson on a Quasi-Free (QF) proton, a QF neutron and the coherent deuteron. The differential cross sections corresponding to the production of a coherent deuteron n the final state have been measured, from threshold to 800 MeV; they are 6 times smaller the only previous measurement reported by Anderson and Prepost in 1969. This is consistent with an Isoscalar part of the Amplitude much smaller than the Isovector one. The differential cross sections are in good agreement with the theoretical prediction on the impulse approximation mechanism; indicating in particular, fairly small contributions from rescattering terms. A direct measurement of the neutron to proton cross section ratios has been obtained by integrating the counting rates on the corresponding QF peaks and is 0.70 {+-} 0.03, from 700 MeV to 900 MeV, with a small angular dependence. These two results by comparison to the measured free proton data should allow to reconstruct the free neutron cross sections in a rather model-independent way. (authors). 56 refs., 90 figs., 13 tabs.

  10. Old tensor mesons in QCD sum rules

    International Nuclear Information System (INIS)

    Aliev, T.M.; Shifman, M.A.

    1981-01-01

    Tensor mesons f, A 2 and A 3 are analyzed within the framework of QCD sum rules. The effects of gluon and quark condensate is accounted for phenomenologically. Accurate estimates of meson masses and coupling constants of the lowest-lying states are obtained. It is shown that the masses are reproduced within theoretical uncertainty of about 80 MeV. The coupling of f meson to the corresponding quark current is determined. The results are in good aqreement with experimental data [ru

  11. CHI: A General Agent Communication Framework

    Energy Technology Data Exchange (ETDEWEB)

    Goldsmith, S.Y.; Phillips, L.R.; Spires, S.V.

    1998-12-17

    We have completed and exercised a communication framework called CHI (CLOS to HTML Interface) by which agents can communicate with humans. CHI follows HTTP (HyperText Transfer Protocol) and produces HTML (HyperText Markup Language) for use by WWW (World-Wide Web) browsers. CHI enables the rapid and dynamic construction of interface mechanisms. The essence of CHI is automatic registration of dynamically generated interface elements to named objects in the agent's internal environment. The agent can access information in these objects at will. State is preserved, so an agent can pursue branching interaction sequences, activate failure recovery behaviors, and otherwise act opportunistically to maintain a conversation. The CHI mechanism remains transparent in multi-agent, multi-user environments because of automatically generated unique identifiers built into the CHI mechanism. In this paper we discuss design, language, implementation, and extension issues, and, by way of illustration, examine the use of the general CHI/HCHI mechanism in a specific international electronic commerce system. We conclude that the CHI mechanism is an effective, efficient, and extensible means of the agent/human communication.

  12. Why do nucleons cling. [Meson theory

    Energy Technology Data Exchange (ETDEWEB)

    Kumar, N [Hindu Coll., Delhi (India)

    1976-10-01

    The nature of the forces which bind nucleons together within the nucleus of an atom have been discussed in detail. The characteristic properties of the nucleons, such as spin, interaction range etc. and the meson theory of nuclear forces are described. The present researches indicate that the force between two nucleons in a many-nucleon system is not very different from the force between two free nucleons. Researches related to the origin of nuclear forces based on the meson theory are now mainly concerned with the role played by the heavier mesons and the two pion exchanges in the middle region around 0.7 fm. (10/sup -13/ cm).

  13. Single meson photoproduction and IR renormalons

    International Nuclear Information System (INIS)

    Agaev, S.S.

    1996-10-01

    Single pseudoscalar and vector mesons inclusive photoproduction γh → MX via higher twist mechanism is calculated using the QCD running coupling constant method. It is proved that in the context of this method a higher twist contribution to the photoproduction cross section cannot be normalized in terms of the meson electromagnetic form factor. The structure of infrared renormalon singularities of the higher twist subprocess cross section and the resumed expression (the Borel sum) for it are found. Comparisons are made with earlier results, as well as with leading twist cross section. Phenomenological effects of studied contributions for π, K, ρ-meson photoproduction are discussed. (author). 21 refs, 8 figs

  14. Evidence base of clinical studies on Tai Chi: a bibliometric analysis.

    Directory of Open Access Journals (Sweden)

    Guo-Yan Yang

    Full Text Available BACKGROUND: The safety and health benefits of Tai Chi mind-body exercise has been documented in a large number of clinical studies focused on specific diseases and health conditions. The objective of this systematic review is to more comprehensively summarize the evidence base of clinical studies of Tai Chi for healthcare. METHODS AND FINDINGS: We searched for all types of clinical studies on Tai chi in PubMed, the Cochrane Library and four major Chinese electronic databases from their inception to July 2013. Data were analyzed using SPSS17.0 software. A total of 507 studies published between 1958 and 2013 were identified, including 43 (8.3% systematic reviews of clinical studies, 255 (50.3% randomized clinical trials, 90 (17.8% non-randomized controlled clinical studies, 115 (22.7% case series and 4 (0.8% case reports. The top 10 diseases/conditions was hypertension, diabetes, osteoarthritis, osteoporosis or osteopenia, breast cancer, heart failure, chronic obstructive pulmonary disease, coronary heart disease, schizophrenia, and depression. Many healthy participants practiced Tai Chi for the purpose of health promotion or preservation. Yang style Tai Chi was the most popular, and Tai Chi was frequently practiced two to three 1-hour sessions per week for 12 weeks. Tai Chi was used alone in more than half of the studies (58.6%, while in other studies Tai Chi was applied in combination with other therapies including medications, health education and other physical therapies. The majority of studies (94.1% reported positive effects of Tai Chi, 5.1% studies reported uncertain effects and 0.8% studies reported negative effects. No serious adverse events related to Tai Chi were reported. CONCLUSIONS: The quantity and evidence base of clinical studies on Tai Chi is substantial. However, there is a wide variation in Tai Chi intervention studied and the reporting of Tai Chi intervention needs to be improved. Further well-designed and reported studies

  15. Biomedical wellness by tai chi and sports

    Science.gov (United States)

    Chin, Daniel C.; Chin, Amita G.

    2011-06-01

    Tai-chi chuan is popular worldwide especially in China. People practice tai-chi chuan daily with faith believing that they will be rewarded with health and varieties of other rewords. The Tai Chi Chuan Theory by Master Chang and the Tai Chi Chuan Theory by Master Wang are translated to be the baseline of the tai-chi chuan. The theory described in these two papers clearly shows that the tai-chi power source is the combination of the two antigravity forces distinction by each foot. The ying, yang and hollowed, solid discussed in the papers are the properties and body relationship of the two antigravity forces. The antigravity forces presented inside of body are as air to the balloon termed chi. However chi could be generated by any muscle pressing; only the antigravity forces from feet are called nature chi that has the maximum strength of the person. When a person is soft, as an infant the nature chi will fulfill entire body with no time and effort. The sequence forms were designed for deploying the nature chi in speed and power. The combination of chi and tai-chi form make tai chi chuan supreme than other kinds of martial art. In the training process chi massages whole body many time for a sequence form practice that stimulate all organs and could lead to cure body diseases, lose weight, postpone aging process, and remove the aging symptoms. For the people practicing in the park daily with proper guidance they will fulfill their wishes. Tai chi exercise could also apply to other sports as in dancing and golfing they are discussed at the end of the paper.

  16. A precise measurement of the $B^0$ meson oscillation frequency

    CERN Document Server

    Aaij, Roel; Adeva, Bernardo; Adinolfi, Marco; Affolder, Anthony; Ajaltouni, Ziad; Akar, Simon; Albrecht, Johannes; Alessio, Federico; Alexander, Michael; Ali, Suvayu; Alkhazov, Georgy; Alvarez Cartelle, Paula; Alves Jr, Antonio Augusto; Amato, Sandra; Amerio, Silvia; Amhis, Yasmine; An, Liupan; Anderlini, Lucio; Anderson, Jonathan; Andreassi, Guido; Andreotti, Mirco; Andrews, Jason; Appleby, Robert; Aquines Gutierrez, Osvaldo; Archilli, Flavio; d'Argent, Philippe; Artamonov, Alexander; Artuso, Marina; Aslanides, Elie; Auriemma, Giulio; Baalouch, Marouen; Bachmann, Sebastian; Back, John; Badalov, Alexey; Baesso, Clarissa; Baldini, Wander; Barlow, Roger; Barschel, Colin; Barsuk, Sergey; Barter, William; Batozskaya, Varvara; Battista, Vincenzo; Bay, Aurelio; Beaucourt, Leo; Beddow, John; Bedeschi, Franco; Bediaga, Ignacio; Bel, Lennaert; Bellee, Violaine; Belloli, Nicoletta; Belyaev, Ivan; Ben-Haim, Eli; Bencivenni, Giovanni; Benson, Sean; Benton, Jack; Berezhnoy, Alexander; Bernet, Roland; Bertolin, Alessandro; Bettler, Marc-Olivier; van Beuzekom, Martinus; Bien, Alexander; Bifani, Simone; Billoir, Pierre; Bird, Thomas; Birnkraut, Alex; Bizzeti, Andrea; Blake, Thomas; Blanc, Frédéric; Blouw, Johan; Blusk, Steven; Bocci, Valerio; Bondar, Alexander; Bondar, Nikolay; Bonivento, Walter; Borghi, Silvia; Borsato, Martino; Bowcock, Themistocles; Bowen, Espen Eie; Bozzi, Concezio; Braun, Svende; Britsch, Markward; Britton, Thomas; Brodzicka, Jolanta; Brook, Nicholas; Buchanan, Emma; Bursche, Albert; Buytaert, Jan; Cadeddu, Sandro; Calabrese, Roberto; Calvi, Marta; Calvo Gomez, Miriam; Campana, Pierluigi; Campora Perez, Daniel; Capriotti, Lorenzo; Carbone, Angelo; Carboni, Giovanni; Cardinale, Roberta; Cardini, Alessandro; Carniti, Paolo; Carson, Laurence; Carvalho Akiba, Kazuyoshi; Casse, Gianluigi; Cassina, Lorenzo; Castillo Garcia, Lucia; Cattaneo, Marco; Cauet, Christophe; Cavallero, Giovanni; Cenci, Riccardo; Charles, Matthew; Charpentier, Philippe; Chefdeville, Maximilien; Chen, Shanzhen; Cheung, Shu-Faye; Chiapolini, Nicola; Chrzaszcz, Marcin; Cid Vidal, Xabier; Ciezarek, Gregory; Clarke, Peter; Clemencic, Marco; Cliff, Harry; Closier, Joel; Coco, Victor; Cogan, Julien; Cogneras, Eric; Cogoni, Violetta; Cojocariu, Lucian; Collazuol, Gianmaria; Collins, Paula; Comerma-Montells, Albert; Contu, Andrea; Cook, Andrew; Coombes, Matthew; Coquereau, Samuel; Corti, Gloria; Corvo, Marco; Couturier, Benjamin; Cowan, Greig; Craik, Daniel Charles; Crocombe, Andrew; Cruz Torres, Melissa Maria; Cunliffe, Samuel; Currie, Robert; D'Ambrosio, Carmelo; Dall'Occo, Elena; Dalseno, Jeremy; David, Pieter; Davis, Adam; De Aguiar Francisco, Oscar; De Bruyn, Kristof; De Capua, Stefano; De Cian, Michel; De Miranda, Jussara; De Paula, Leandro; De Simone, Patrizia; Dean, Cameron Thomas; Decamp, Daniel; Deckenhoff, Mirko; Del Buono, Luigi; Déléage, Nicolas; Demmer, Moritz; Derkach, Denis; Deschamps, Olivier; Dettori, Francesco; Dey, Biplab; Di Canto, Angelo; Di Ruscio, Francesco; Dijkstra, Hans; Donleavy, Stephanie; Dordei, Francesca; Dorigo, Mirco; Dosil Suárez, Alvaro; Dossett, David; Dovbnya, Anatoliy; Dreimanis, Karlis; Dufour, Laurent; Dujany, Giulio; Dupertuis, Frederic; Durante, Paolo; Dzhelyadin, Rustem; Dziurda, Agnieszka; Dzyuba, Alexey; Easo, Sajan; Egede, Ulrik; Egorychev, Victor; Eidelman, Semen; Eisenhardt, Stephan; Eitschberger, Ulrich; Ekelhof, Robert; Eklund, Lars; El Rifai, Ibrahim; Elsasser, Christian; Ely, Scott; Esen, Sevda; Evans, Hannah Mary; Evans, Timothy; Falabella, Antonio; Färber, Christian; Farley, Nathanael; Farry, Stephen; Fay, Robert; Ferguson, Dianne; Fernandez Albor, Victor; Ferrari, Fabio; Ferreira Rodrigues, Fernando; Ferro-Luzzi, Massimiliano; Filippov, Sergey; Fiore, Marco; Fiorini, Massimiliano; Firlej, Miroslaw; Fitzpatrick, Conor; Fiutowski, Tomasz; Fohl, Klaus; Fol, Philip; Fontana, Marianna; Fontanelli, Flavio; Forshaw, Dean Charles; Forty, Roger; Frank, Markus; Frei, Christoph; Frosini, Maddalena; Fu, Jinlin; Furfaro, Emiliano; Gallas Torreira, Abraham; Galli, Domenico; Gallorini, Stefano; Gambetta, Silvia; Gandelman, Miriam; Gandini, Paolo; Gao, Yuanning; García Pardiñas, Julián; Garra Tico, Jordi; Garrido, Lluis; Gascon, David; Gaspar, Clara; Gauld, Rhorry; Gavardi, Laura; Gazzoni, Giulio; Gerick, David; Gersabeck, Evelina; Gersabeck, Marco; Gershon, Timothy; Ghez, Philippe; Gianì, Sebastiana; Gibson, Valerie; Girard, Olivier Göran; Giubega, Lavinia-Helena; Gligorov, V.V.; Göbel, Carla; Golubkov, Dmitry; Golutvin, Andrey; Gomes, Alvaro; Gotti, Claudio; Grabalosa Gándara, Marc; Graciani Diaz, Ricardo; Granado Cardoso, Luis Alberto; Graugés, Eugeni; Graverini, Elena; Graziani, Giacomo; Grecu, Alexandru; Greening, Edward; Gregson, Sam; Griffith, Peter; Grillo, Lucia; Grünberg, Oliver; Gui, Bin; Gushchin, Evgeny; Guz, Yury; Gys, Thierry; Hadavizadeh, Thomas; Hadjivasiliou, Christos; Haefeli, Guido; Haen, Christophe; Haines, Susan; Hall, Samuel; Hamilton, Brian; Han, Xiaoxue; Hansmann-Menzemer, Stephanie; Harnew, Neville; Harnew, Samuel; Harrison, Jonathan; He, Jibo; Head, Timothy; Heijne, Veerle; Heister, Arno; Hennessy, Karol; Henrard, Pierre; Henry, Louis; Hernando Morata, Jose Angel; van Herwijnen, Eric; Heß, Miriam; Hicheur, Adlène; Hill, Donal; Hoballah, Mostafa; Hombach, Christoph; Hulsbergen, Wouter; Humair, Thibaud; Hussain, Nazim; Hutchcroft, David; Hynds, Daniel; Idzik, Marek; Ilten, Philip; Jacobsson, Richard; Jaeger, Andreas; Jalocha, Pawel; Jans, Eddy; Jawahery, Abolhassan; Jing, Fanfan; John, Malcolm; Johnson, Daniel; Jones, Christopher; Joram, Christian; Jost, Beat; Jurik, Nathan; Kandybei, Sergii; Kanso, Walaa; Karacson, Matthias; Karbach, Moritz; Karodia, Sarah; Kecke, Matthieu; Kelsey, Matthew; Kenyon, Ian; Kenzie, Matthew; Ketel, Tjeerd; Khanji, Basem; Khurewathanakul, Chitsanu; Kirn, Thomas; Klaver, Suzanne; Klimaszewski, Konrad; Kochebina, Olga; Kolpin, Michael; Komarov, Ilya; Koopman, Rose; Koppenburg, Patrick; Kozeiha, Mohamad; Kravchuk, Leonid; Kreplin, Katharina; Kreps, Michal; Krocker, Georg; Krokovny, Pavel; Kruse, Florian; Krzemien, Wojciech; Kucewicz, Wojciech; Kucharczyk, Marcin; Kudryavtsev, Vasily; Kuonen, Axel Kevin; Kurek, Krzysztof; Kvaratskheliya, Tengiz; Lacarrere, Daniel; Lafferty, George; Lai, Adriano; Lambert, Dean; Lanfranchi, Gaia; Langenbruch, Christoph; Langhans, Benedikt; Latham, Thomas; Lazzeroni, Cristina; Le Gac, Renaud; van Leerdam, Jeroen; Lees, Jean-Pierre; Lefèvre, Regis; Leflat, Alexander; Lefrançois, Jacques; Lemos Cid, Edgar; Leroy, Olivier; Lesiak, Tadeusz; Leverington, Blake; Li, Yiming; Likhomanenko, Tatiana; Liles, Myfanwy; Lindner, Rolf; Linn, Christian; Lionetto, Federica; Liu, Bo; Liu, Xuesong; Loh, David; Longstaff, Iain; Lopes, Jose; Lucchesi, Donatella; Lucio Martinez, Miriam; Luo, Haofei; Lupato, Anna; Luppi, Eleonora; Lupton, Oliver; Lusardi, Nicola; Lusiani, Alberto; Machefert, Frederic; Maciuc, Florin; Maev, Oleg; Maguire, Kevin; Malde, Sneha; Malinin, Alexander; Manca, Giulia; Mancinelli, Giampiero; Manning, Peter Michael; Mapelli, Alessandro; Maratas, Jan; Marchand, Jean François; Marconi, Umberto; Marin Benito, Carla; Marino, Pietro; Marks, Jörg; Martellotti, Giuseppe; Martin, Morgan; Martinelli, Maurizio; Martinez Santos, Diego; Martinez Vidal, Fernando; Martins Tostes, Danielle; Massafferri, André; Matev, Rosen; Mathad, Abhijit; Mathe, Zoltan; Matteuzzi, Clara; Mauri, Andrea; Maurin, Brice; Mazurov, Alexander; McCann, Michael; McCarthy, James; McNab, Andrew; McNulty, Ronan; Meadows, Brian; Meier, Frank; Meissner, Marco; Melnychuk, Dmytro; Merk, Marcel; Michielin, Emanuele; Milanes, Diego Alejandro; Minard, Marie-Noelle; Mitzel, Dominik Stefan; Molina Rodriguez, Josue; Monroy, Ignacio Alberto; Monteil, Stephane; Morandin, Mauro; Morawski, Piotr; Mordà, Alessandro; Morello, Michael Joseph; Moron, Jakub; Morris, Adam Benjamin; Mountain, Raymond; Muheim, Franz; Müller, Dominik; Müller, Janine; Müller, Katharina; Müller, Vanessa; Mussini, Manuel; Muster, Bastien; Naik, Paras; Nakada, Tatsuya; Nandakumar, Raja; Nandi, Anita; Nasteva, Irina; Needham, Matthew; Neri, Nicola; Neubert, Sebastian; Neufeld, Niko; Neuner, Max; Nguyen, Anh Duc; Nguyen, Thi-Dung; Nguyen-Mau, Chung; Niess, Valentin; Niet, Ramon; Nikitin, Nikolay; Nikodem, Thomas; Novoselov, Alexey; O'Hanlon, Daniel Patrick; Oblakowska-Mucha, Agnieszka; Obraztsov, Vladimir; Ogilvy, Stephen; Okhrimenko, Oleksandr; Oldeman, Rudolf; Onderwater, Gerco; Osorio Rodrigues, Bruno; Otalora Goicochea, Juan Martin; Otto, Adam; Owen, Patrick; Oyanguren, Maria Aranzazu; Palano, Antimo; Palombo, Fernando; Palutan, Matteo; Panman, Jacob; Papanestis, Antonios; Pappagallo, Marco; Pappalardo, Luciano; Pappenheimer, Cheryl; Parkes, Christopher; Passaleva, Giovanni; Patel, Girish; Patel, Mitesh; Patrignani, Claudia; Pearce, Alex; Pellegrino, Antonio; Penso, Gianni; Pepe Altarelli, Monica; Perazzini, Stefano; Perret, Pascal; Pescatore, Luca; Petridis, Konstantinos; Petrolini, Alessandro; Petruzzo, Marco; Picatoste Olloqui, Eduardo; Pietrzyk, Boleslaw; Pilař, Tomas; Pinci, Davide; Pistone, Alessandro; Piucci, Alessio; Playfer, Stephen; Plo Casasus, Maximo; Poikela, Tuomas; Polci, Francesco; Poluektov, Anton; Polyakov, Ivan; Polycarpo, Erica; Popov, Alexander; Popov, Dmitry; Popovici, Bogdan; Potterat, Cédric; Price, Eugenia; Price, Joseph David; Prisciandaro, Jessica; Pritchard, Adrian; Prouve, Claire; Pugatch, Valery; Puig Navarro, Albert; Punzi, Giovanni; Qian, Wenbin; Quagliani, Renato; Rachwal, Bartolomiej; Rademacker, Jonas; Rama, Matteo; Rangel, Murilo; Raniuk, Iurii; Rauschmayr, Nathalie; Raven, Gerhard; Redi, Federico; Reichert, Stefanie; Reid, Matthew; dos Reis, Alberto; Ricciardi, Stefania; Richards, Sophie; Rihl, Mariana; Rinnert, Kurt; Rives Molina, Vincente; Robbe, Patrick; Rodrigues, Ana Barbara; Rodrigues, Eduardo; Rodriguez Lopez, Jairo Alexis; Rodriguez Perez, Pablo; Roiser, Stefan; Romanovsky, Vladimir; Romero Vidal, Antonio; Ronayne, John William; Rotondo, Marcello; Rouvinet, Julien; Ruf, Thomas; Ruiz Valls, Pablo; Saborido Silva, Juan Jose; Sagidova, Naylya; Sail, Paul; Saitta, Biagio; Salustino Guimaraes, Valdir; Sanchez Mayordomo, Carlos; Sanmartin Sedes, Brais; Santacesaria, Roberta; Santamarina Rios, Cibran; Santimaria, Marco; Santovetti, Emanuele; Sarti, Alessio; Satriano, Celestina; Satta, Alessia; Saunders, Daniel Martin; Savrina, Darya; Schael, Stefan; Schiller, Manuel; Schindler, Heinrich; Schlupp, Maximilian; Schmelling, Michael; Schmelzer, Timon; Schmidt, Burkhard; Schneider, Olivier; Schopper, Andreas; Schubiger, Maxime; Schune, Marie Helene; Schwemmer, Rainer; Sciascia, Barbara; Sciubba, Adalberto; Semennikov, Alexander; Sergi, Antonino; Serra, Nicola; Serrano, Justine; Sestini, Lorenzo; Seyfert, Paul; Shapkin, Mikhail; Shapoval, Illya; Shcheglov, Yury; Shears, Tara; Shekhtman, Lev; Shevchenko, Vladimir; Shires, Alexander; Siddi, Benedetto Gianluca; Silva Coutinho, Rafael; Silva de Oliveira, Luiz Gustavo; Simi, Gabriele; Sirendi, Marek; Skidmore, Nicola; Skwarnicki, Tomasz; Smith, Edmund; Smith, Eluned; Smith, Iwan Thomas; Smith, Jackson; Smith, Mark; Snoek, Hella; Sokoloff, Michael; Soler, Paul; Soomro, Fatima; Souza, Daniel; Souza De Paula, Bruno; Spaan, Bernhard; Spradlin, Patrick; Sridharan, Srikanth; Stagni, Federico; Stahl, Marian; Stahl, Sascha; Stefkova, Slavomira; Steinkamp, Olaf; Stenyakin, Oleg; Stevenson, Scott; Stoica, Sabin; Stone, Sheldon; Storaci, Barbara; Stracka, Simone; Straticiuc, Mihai; Straumann, Ulrich; Sun, Liang; Sutcliffe, William; Swientek, Krzysztof; Swientek, Stefan; Syropoulos, Vasileios; Szczekowski, Marek; Szczypka, Paul; Szumlak, Tomasz; T'Jampens, Stephane; Tayduganov, Andrey; Tekampe, Tobias; Teklishyn, Maksym; Tellarini, Giulia; Teubert, Frederic; Thomas, Christopher; Thomas, Eric; van Tilburg, Jeroen; Tisserand, Vincent; Tobin, Mark; Todd, Jacob; Tolk, Siim; Tomassetti, Luca; Tonelli, Diego; Topp-Joergensen, Stig; Torr, Nicholas; Tournefier, Edwige; Tourneur, Stephane; Trabelsi, Karim; Tran, Minh Tâm; Tresch, Marco; Trisovic, Ana; Tsaregorodtsev, Andrei; Tsopelas, Panagiotis; Tuning, Niels; Ukleja, Artur; Ustyuzhanin, Andrey; Uwer, Ulrich; Vacca, Claudia; Vagnoni, Vincenzo; Valenti, Giovanni; Vallier, Alexis; Vazquez Gomez, Ricardo; Vazquez Regueiro, Pablo; Vázquez Sierra, Carlos; Vecchi, Stefania; van Veghel, Maarten; Velthuis, Jaap; Veltri, Michele; Veneziano, Giovanni; Vesterinen, Mika; Viaud, Benoit; Vieira, Daniel; Vieites Diaz, Maria; Vilasis-Cardona, Xavier; Vollhardt, Achim; Volyanskyy, Dmytro; Voong, David; Vorobyev, Alexey; Vorobyev, Vitaly; Voß, Christian; de Vries, Jacco; Waldi, Roland; Wallace, Charlotte; Wallace, Ronan; Walsh, John; Wandernoth, Sebastian; Wang, Jianchun; Ward, David; Watson, Nigel; Websdale, David; Weiden, Andreas; Whitehead, Mark; Wilkinson, Guy; Wilkinson, Michael; Williams, Mark Richard James; Williams, Matthew; Williams, Mike; Williams, Timothy; Wilson, Fergus; Wimberley, Jack; Wishahi, Julian; Wislicki, Wojciech; Witek, Mariusz; Wormser, Guy; Wotton, Stephen; Wright, Simon; Wyllie, Kenneth; Xie, Yuehong; Xu, Zhirui; Yang, Zhenwei; Yu, Jiesheng; Yuan, Xuhao; Yushchenko, Oleg; Zangoli, Maria; Zavertyaev, Mikhail; Zhang, Liming; Zhang, Yanxi; Zhelezov, Alexey; Zhokhov, Anatoly; Zhong, Liang; Zhukov, Valery; Zucchelli, Stefano

    2016-07-21

    The oscillation frequency, $\\Delta m_d$, of $B^0$ mesons is measured using semileptonic decays with a $D^-$ or $D^{*-}$ meson in the final state, in a data sample of $pp$ collisions collected by the LHCb detector corresponding to an integrated luminosity of 3.0$\\mbox{fb}^{-1}$. A combination of the two decay modes gives $\\Delta m_d = (505.0 \\pm 2.1 \\pm 1.0) \\rm \\,ns^{-1}$, where the first uncertainty is statistical and the second is systematic. This is the most precise single measurement of this parameter. It is compatible with the current world average and has similar precision.

  17. Near-threshold photoproduction of {phi} mesons from deuterium

    Energy Technology Data Exchange (ETDEWEB)

    Qian, X., E-mail: xqian@caltech.ed [Duke University, Durham, NC 27708 (United States); Kellogg Radiation Laboratory, California Institute of Technology, CA 91125 (United States); Chen, W.; Gao, H. [Duke University, Durham, NC 27708 (United States); Hicks, K. [Ohio University, Athens, OH 45701 (United States); Kramer, K. [Duke University, Durham, NC 27708 (United States); Laget, J.M. [Thomas Jefferson National Accelerator Facility, Newport News, VA 23606 (United States); Mibe, T. [Ohio University, Athens, OH 45701 (United States); Qiang, Y. [Duke University, Durham, NC 27708 (United States); Stepanyan, S. [Thomas Jefferson National Accelerator Facility, Newport News, VA 23606 (United States); Tedeschi, D.J. [University of South Carolina, Columbia, SC 29208 (United States); Xu, W. [Massachusetts Institute of Technology, Cambridge, MA 02139-4307 (United States); Adhikari, K.P.; Amaryan, M. [Old Dominion University, Norfolk, VA 23529 (United States); Anghinolfi, M. [INFN, Sezione di Genova, 16146 Genova (Italy); Ball, J. [CEA, Centre de Saclay, Irfu/Service de Physique Nucleaire, 91191 Gif-sur-Yvette (France); Battaglieri, M. [INFN, Sezione di Genova, 16146 Genova (Italy); Batourine, V. [Thomas Jefferson National Accelerator Facility, Newport News, VA 23606 (United States); Bedlinskiy, I. [Institute of Theoretical and Experimental Physics, Moscow 117259 (Russian Federation); Bellis, M. [Carnegie Mellon University, Pittsburgh, PA 15213 (United States); Biselli, A.S. [Fairfield University, Fairfield, CT 06824 (United States); Carnegie Mellon University, Pittsburgh, PA 15213 (United States)

    2011-02-07

    We report the first, kinematically-complete measurement of the differential cross section of {phi}-meson photoproduction from deuterium near the production threshold for a proton using the CLAS detector and a tagged-photon beam in Hall B at Jefferson Lab. The measurement was carried out by a triple coincidence detection of a proton, K{sup +} and K{sup -} near the theoretical production threshold of 1.57 GeV. The extracted differential cross sections (d{sigma})/(dt) for the initial photon energy range of 1.65-1.75 GeV are consistent with predictions based on a quasifree mechanism. Our finding is different from recent LEPS results on {phi}-meson photoproduction from deuterium in a similar incident photon energy range, but in a different momentum transfer region.

  18. The mixing of scalar mesons and the baryon-baryon interaction

    Energy Technology Data Exchange (ETDEWEB)

    Dai, L.R. [Liaoning Normal University, Department of Physics, Dalian (China)

    2011-02-15

    By introducing the mixing of scalar mesons in the chiral SU(3) quark model, we dynamically investigate the baryon-baryon interaction. The hyperon-nucleon and nucleon-nucleon interactions are studied by solving the resonating group method (RGM) equation in a coupled-channel calculation. In our present work, the experimental lightest pseudoscalar {pi}, K, {eta}, {eta}' mesons correspond exactly to the chiral nonet pseudoscalar fields {pi}, K, {eta}, {eta}' in the chiral SU(3) quark model. The {eta}, {eta}' mesons are considered as the mixing of singlet and octet mesons, and the mixing angle {theta}{sub ps} is taken to be -23 . For scalar nonet mesons, we suppose that there exists a correspondence between the experimental lightest scalar f{sub 0}(600), {kappa}, a{sub 0}(980), f{sub 0}(980) mesons and the theoretical scalar nonet {sigma}, {kappa}, {sigma}', {epsilon} fields in the chiral SU(3) quark model. For scalar mesons, we consider two different mixing cases: one is the ideal mixing and another is the {theta}{sub s} = 19 mixing. The masses of the {sigma}' and {epsilon} mesons are taken to be 980MeV, which are just the masses of the experimental a{sub 0}(980), f{sub 0}(980) mesons. The mass of the {sigma} meson is an adjustable parameter and is decided by fitting the binding energy of the deuteron, the masses of 560MeV and 644MeV are obtained for the ideal mixing and the {theta}{sub s} = 19 mixing, respectively. We find that, in order to reasonably describe the YN interactions, the mass of the {kappa} meson is near 780MeV for the ideal mixing. However, we must enhance the mass of the {kappa} meson for the {theta}{sub s} = 19 mixing, the 1050MeV is favorably used in the present work. The experimental {sigma} and {kappa} scalar mesons are very strange, both have larger widths. Hence, no matter what kind of mixing is considered, all the masses of scalar mesons we used in the present work seem to be consistent with the present PDG information

  19. Pion-pion and pion-kaon interaction in the meson exchange picture

    International Nuclear Information System (INIS)

    Lohse, D.

    1989-10-01

    Following the general line of the Bonn NN-interaction, a model for pseudoscalar-pseudoscalar meson interaction has been constructed and applied consistently to ππ and Kπ scattering. The phases can be reproduced with vector meson t- and s-channel exchange up to 1 GeV. The bare masses of the vector mesons turn out to be in the range of 1.1 GeV, depending on the form factor. We use a coupled channel formalism, which is crucial to explain the S * (975) resonance as a bound anti KK state. Beyond 1 GeV the data require a pseudoscalar-pseudoscalar coupling to a scalar octet (J P =0 + ) to fit the s-wave phases in the isospin-0 π and isospin-1/2 Kπ channels. We apply both scalar coupling and derivative coupling. The latter avoids introducing additional degrees of freedom and produces an acceptable fit to the J=0 phase shift data. (orig.) [de

  20. Radiative decays of vector mesons in the chiral bag model

    International Nuclear Information System (INIS)

    Tabachenko, A.N.

    1988-01-01

    A new model of radiative π-meson decays of vector mesons in the chiral bag model is proposed. The quark-π-meson interaction has the form of a pseudoscalar coupling and is located on the bag surface. The vector meson decay width depends on the quark masses, the π-meson decay constant, the radius of the bag, and the free parameter Z 2 , which specifies the disappearance of the bag during the decay. The obtained results for the omega- and p-decay widths are in satisfactory agreement with the experiment

  1. Oxygen enhancement ratio for negative pi mesons

    International Nuclear Information System (INIS)

    Hall, E.J.; Astor, M.

    1979-01-01

    Experiments were performed at the Los Alamos Meson Physics Facility (LAMPF) to determine the oxygen enhancement ratio (OER) for the clinically used beam of negative pi mesons. V79 Chinese hamster cells, cultured in vitro, were used as the biological test system; hypoxia was produced by metabolic depletion as a result of sealing 2 million cells in 1 ml glass ampules. The Bragg peak of the pion depth dose curve was spread out to cover 10 cm by using a dynamic range shifter. Cells were irradiated at the center of the spead out Bragg peak, where the dose/rate was 0.1 Gy/min over a 6 x 6 cm field. The OER obtained was 2.2, compared with 3.8 obtained for γ rays under the same conditions

  2. Inclusive spectra of hadrons in B-meson decays

    International Nuclear Information System (INIS)

    Dobrovol'skaya, A.V.; Ter-Martirosyan, K.A.; Zoller, V.R.

    1989-01-01

    The inclusive spectra of hadrons (mainly pions) produced in the semileptonic and nonleptonic decays of B-mesons are calculated. Parameters of spectra for different types of hard qq-bar-strings, appearing in the B-meson decays, are determined using the data on e+e-annihilation. Numerical results for B-meson decay induced by both b→b and b→u transitions are presented. 10 refs.; 5 figs

  3. Observation of a new $\\chi_b$ state in radiative transitions to $\\Upsilon(1S)$ and $\\Upsilon(2S)$ at ATLAS

    CERN Document Server

    Aad, Georges; Abdallah, Jalal; Abdelalim, Ahmed Ali; Abdesselam, Abdelouahab; Abdinov, Ovsat; Abi, Babak; Abolins, Maris; AbouZeid, Ossama; Abramowicz, Halina; Abreu, Henso; Acerbi, Emilio; Acharya, Bobby Samir; Adamczyk, Leszek; Adams, David; Addy, Tetteh; Adelman, Jahred; Aderholz, Michael; Adomeit, Stefanie; Adragna, Paolo; Adye, Tim; Aefsky, Scott; Aguilar-Saavedra, Juan Antonio; Aharrouche, Mohamed; Ahlen, Steven; Ahles, Florian; Ahmad, Ashfaq; Ahsan, Mahsana; Aielli, Giulio; Akdogan, Taylan; Åkesson, Torsten Paul Ake; Akimoto, Ginga; Akimov, Andrei; Akiyama, Kunihiro; Alam, Mohammad; Alam, Muhammad Aftab; Albert, Justin; Albrand, Solveig; Aleksa, Martin; Aleksandrov, Igor; Alessandria, Franco; Alexa, Calin; Alexander, Gideon; Alexandre, Gauthier; Alexopoulos, Theodoros; Alhroob, Muhammad; Aliev, Malik; Alimonti, Gianluca; Alison, John; Aliyev, Magsud; Allbrooke, Benedict; Allport, Phillip; Allwood-Spiers, Sarah; Almond, John; Aloisio, Alberto; Alon, Raz; Alonso, Alejandro; Alvarez Gonzalez, Barbara; Alviggi, Mariagrazia; Amako, Katsuya; Amaral, Pedro; Amelung, Christoph; Ammosov, Vladimir; Amorim, Antonio; Amorós, Gabriel; Amram, Nir; Anastopoulos, Christos; Ancu, Lucian Stefan; Andari, Nansi; Andeen, Timothy; Anders, Christoph Falk; Anders, Gabriel; Anderson, Kelby; Andreazza, Attilio; Andrei, George Victor; Andrieux, Marie-Laure; Anduaga, Xabier; Angerami, Aaron; Anghinolfi, Francis; Anisenkov, Alexey; Anjos, Nuno; Annovi, Alberto; Antonaki, Ariadni; Antonelli, Mario; Antonov, Alexey; Antos, Jaroslav; Anulli, Fabio; Aoun, Sahar; Aperio Bella, Ludovica; Apolle, Rudi; Arabidze, Giorgi; Aracena, Ignacio; Arai, Yasuo; Arce, Ayana; Arfaoui, Samir; Arguin, Jean-Francois; Arik, Engin; Arik, Metin; Armbruster, Aaron James; Arnaez, Olivier; Arnault, Christian; Artamonov, Andrei; Artoni, Giacomo; Arutinov, David; Asai, Shoji; Asfandiyarov, Ruslan; Ask, Stefan; Åsman, Barbro; Asquith, Lily; Assamagan, Ketevi; Astbury, Alan; Astvatsatourov, Anatoli; Aubert, Bernard; Auge, Etienne; Augsten, Kamil; Aurousseau, Mathieu; Avolio, Giuseppe; Avramidou, Rachel Maria; Axen, David; Ay, Cano; Azuelos, Georges; Azuma, Yuya; Baak, Max; Baccaglioni, Giuseppe; Bacci, Cesare; Bach, Andre; Bachacou, Henri; Bachas, Konstantinos; Backes, Moritz; Backhaus, Malte; Badescu, Elisabeta; Bagnaia, Paolo; Bahinipati, Seema; Bai, Yu; Bailey, David; Bain, Travis; Baines, John; Baker, Oliver Keith; Baker, Mark; Baker, Sarah; Banas, Elzbieta; Banerjee, Piyali; Banerjee, Swagato; Banfi, Danilo; Bangert, Andrea Michelle; Bansal, Vikas; Bansil, Hardeep Singh; Barak, Liron; Baranov, Sergei; Barashkou, Andrei; Barbaro Galtieri, Angela; Barber, Tom; Barberio, Elisabetta Luigia; Barberis, Dario; Barbero, Marlon; Bardin, Dmitri; Barillari, Teresa; Barisonzi, Marcello; Barklow, Timothy; Barlow, Nick; Barnett, Bruce; Barnett, Michael; Baroncelli, Antonio; Barone, Gaetano; Barr, Alan; Barreiro, Fernando; Barreiro Guimarães da Costa, João; Barrillon, Pierre; Bartoldus, Rainer; Barton, Adam Edward; Bartsch, Valeria; Bates, Richard; Batkova, Lucia; Batley, Richard; Battaglia, Andreas; Battistin, Michele; Bauer, Florian; Bawa, Harinder Singh; Beale, Steven; Beau, Tristan; Beauchemin, Pierre-Hugues; Beccherle, Roberto; Bechtle, Philip; Beck, Hans Peter; Becker, Sebastian; Beckingham, Matthew; Becks, Karl-Heinz; Beddall, Andrew; Beddall, Ayda; Bedikian, Sourpouhi; Bednyakov, Vadim; Bee, Christopher; Begel, Michael; Behar Harpaz, Silvia; Behera, Prafulla; Beimforde, Michael; Belanger-Champagne, Camille; Bell, Paul; Bell, William; Bella, Gideon; Bellagamba, Lorenzo; Bellina, Francesco; Bellomo, Massimiliano; Belloni, Alberto; Beloborodova, Olga; Belotskiy, Konstantin; Beltramello, Olga; Ben Ami, Sagi; Benary, Odette; Benchekroun, Driss; Benchouk, Chafik; Bendel, Markus; Benekos, Nektarios; Benhammou, Yan; Benhar Noccioli, Eleonora; Benitez Garcia, Jorge-Armando; Benjamin, Douglas; Benoit, Mathieu; Bensinger, James; Benslama, Kamal; Bentvelsen, Stan; Berge, David; Bergeaas Kuutmann, Elin; Berger, Nicolas; Berghaus, Frank; Berglund, Elina; Beringer, Jürg; Bernat, Pauline; Bernhard, Ralf; Bernius, Catrin; Berry, Tracey; Bertella, Claudia; Bertin, Antonio; Bertinelli, Francesco; Bertolucci, Federico; Besana, Maria Ilaria; Besson, Nathalie; Bethke, Siegfried; Bhimji, Wahid; Bianchi, Riccardo-Maria; Bianco, Michele; Biebel, Otmar; Bieniek, Stephen Paul; Bierwagen, Katharina; Biesiada, Jed; Biglietti, Michela; Bilokon, Halina; Bindi, Marcello; Binet, Sebastien; Bingul, Ahmet; Bini, Cesare; Biscarat, Catherine; Bitenc, Urban; Black, Kevin; Blair, Robert; Blanchard, Jean-Baptiste; Blanchot, Georges; Blazek, Tomas; Blocker, Craig; Blocki, Jacek; Blondel, Alain; Blum, Walter; Blumenschein, Ulrike; Bobbink, Gerjan; Bobrovnikov, Victor; Bocchetta, Simona Serena; Bocci, Andrea; Boddy, Christopher Richard; Boehler, Michael; Boek, Jennifer; Boelaert, Nele; Bogaerts, Joannes Andreas; Bogdanchikov, Alexander; Bogouch, Andrei; Bohm, Christian; Boisvert, Veronique; Bold, Tomasz; Boldea, Venera; Bolnet, Nayanka Myriam; Bona, Marcella; Bondarenko, Valery; Bondioli, Mario; Boonekamp, Maarten; Booth, Chris; Bordoni, Stefania; Borer, Claudia; Borisov, Anatoly; Borissov, Guennadi; Borjanovic, Iris; Borri, Marcello; Borroni, Sara; Bortolotto, Valerio; Bos, Kors; Boscherini, Davide; Bosman, Martine; Boterenbrood, Hendrik; Botterill, David; Bouchami, Jihene; Boudreau, Joseph; Bouhova-Thacker, Evelina Vassileva; Boumediene, Djamel Eddine; Bourdarios, Claire; Bousson, Nicolas; Boveia, Antonio; Boyd, James; Boyko, Igor; Bozhko, Nikolay; Bozovic-Jelisavcic, Ivanka; Bracinik, Juraj; Braem, André; Branchini, Paolo; Brandenburg, George; Brandt, Andrew; Brandt, Gerhard; Brandt, Oleg; Bratzler, Uwe; Brau, Benjamin; Brau, James; Braun, Helmut; Brelier, Bertrand; Bremer, Johan; Brenner, Richard; Bressler, Shikma; Britton, Dave; Brochu, Frederic; Brock, Ian; Brock, Raymond; Brodbeck, Timothy; Brodet, Eyal; Broggi, Francesco; Bromberg, Carl; Bronner, Johanna; Brooijmans, Gustaaf; Brooks, William; Brown, Gareth; Brown, Heather; Bruckman de Renstrom, Pawel; Bruncko, Dusan; Bruneliere, Renaud; Brunet, Sylvie; Bruni, Alessia; Bruni, Graziano; Bruschi, Marco; Buanes, Trygve; Buat, Quentin; Bucci, Francesca; Buchanan, James; Buchanan, Norman; Buchholz, Peter; Buckingham, Ryan; Buckley, Andrew; Buda, Stelian Ioan; Budagov, Ioulian; Budick, Burton; Büscher, Volker; Bugge, Lars; Bulekov, Oleg; Bunse, Moritz; Buran, Torleiv; Burckhart, Helfried; Burdin, Sergey; Burgess, Thomas; Burke, Stephen; Busato, Emmanuel; Bussey, Peter; Buszello, Claus-Peter; Butin, François; Butler, Bart; Butler, John; Buttar, Craig; Butterworth, Jonathan; Buttinger, William; Cabrera Urbán, Susana; Caforio, Davide; Cakir, Orhan; Calafiura, Paolo; Calderini, Giovanni; Calfayan, Philippe; Calkins, Robert; Caloba, Luiz; Caloi, Rita; Calvet, David; Calvet, Samuel; Camacho Toro, Reina; Camarri, Paolo; Cambiaghi, Mario; Cameron, David; Caminada, Lea Michaela; Campana, Simone; Campanelli, Mario; Canale, Vincenzo; Canelli, Florencia; Canepa, Anadi; Cantero, Josu; Capasso, Luciano; Capeans Garrido, Maria Del Mar; Caprini, Irinel; Caprini, Mihai; Capriotti, Daniele; Capua, Marcella; Caputo, Regina; Caramarcu, Costin; Cardarelli, Roberto; Carli, Tancredi; Carlino, Gianpaolo; Carminati, Leonardo; Caron, Bryan; Caron, Sascha; Carrillo Montoya, German D; Carter, Antony; Carter, Janet; Carvalho, João; Casadei, Diego; Casado, Maria Pilar; Cascella, Michele; Caso, Carlo; Castaneda Hernandez, Alfredo Martin; Castaneda-Miranda, Elizabeth; Castillo Gimenez, Victoria; Castro, Nuno Filipe; Cataldi, Gabriella; Cataneo, Fernando; Catinaccio, Andrea; Catmore, James; Cattai, Ariella; Cattani, Giordano; Caughron, Seth; Cauz, Diego; Cavalleri, Pietro; Cavalli, Donatella; Cavalli-Sforza, Matteo; Cavasinni, Vincenzo; Ceradini, Filippo; Santiago Cerqueira, Augusto; Cerri, Alessandro; Cerrito, Lucio; Cerutti, Fabio; Cetin, Serkant Ali; Cevenini, Francesco; Chafaq, Aziz; Chakraborty, Dhiman; Chan, Kevin; Chapleau, Bertrand; Chapman, John Derek; Chapman, John Wehrley; Chareyre, Eve; Charlton, Dave; Chavda, Vikash; Chavez Barajas, Carlos Alberto; Cheatham, Susan; Chekanov, Sergei; Chekulaev, Sergey; Chelkov, Gueorgui; Chelstowska, Magda Anna; Chen, Chunhui; Chen, Hucheng; Chen, Shenjian; Chen, Tingyang; Chen, Xin; Cheng, Shaochen; Cheplakov, Alexander; Chepurnov, Vladimir; Cherkaoui El Moursli, Rajaa; Chernyatin, Valeriy; Cheu, Elliott; Cheung, Sing-Leung; Chevalier, Laurent; Chiefari, Giovanni; Chikovani, Leila; Childers, John Taylor; Chilingarov, Alexandre; Chiodini, Gabriele; Chisholm, Andrew; Chizhov, Mihail; Choudalakis, Georgios; Chouridou, Sofia; Christidi, Illectra-Athanasia; Christov, Asen; Chromek-Burckhart, Doris; Chu, Ming-Lee; Chudoba, Jiri; Ciapetti, Guido; Ciba, Krzysztof; Ciftci, Abbas Kenan; Ciftci, Rena; Cinca, Diane; Cindro, Vladimir; Ciobotaru, Matei Dan; Ciocca, Claudia; Ciocio, Alessandra; Cirilli, Manuela; Citterio, Mauro; Ciubancan, Mihai; Clark, Allan G; Clark, Philip James; Cleland, Bill; Clemens, Jean-Claude; Clement, Benoit; Clement, Christophe; Clifft, Roger; Coadou, Yann; Cobal, Marina; Coccaro, Andrea; Cochran, James H; Coe, Paul; Cogan, Joshua Godfrey; Coggeshall, James; Cogneras, Eric; Colas, Jacques; Colijn, Auke-Pieter; Collins, Neil; Collins-Tooth, Christopher; Collot, Johann; Colon, German; Conde Muiño, Patricia; Coniavitis, Elias; Conidi, Maria Chiara; Consonni, Michele; Consorti, Valerio; Constantinescu, Serban; Conta, Claudio; Conventi, Francesco; Cook, James; Cooke, Mark; Cooper, Ben; Cooper-Sarkar, Amanda; Copic, Katherine; Cornelissen, Thijs; Corradi, Massimo; Corriveau, Francois; Cortes-Gonzalez, Arely; Cortiana, Giorgio; Costa, Giuseppe; Costa, María José; Costanzo, Davide; Costin, Tudor; Côté, David; Coura Torres, Rodrigo; Courneyea, Lorraine; Cowan, Glen; Cowden, Christopher; Cox, Brian; Cranmer, Kyle; Crescioli, Francesco; Cristinziani, Markus; Crosetti, Giovanni; Crupi, Roberto; Crépé-Renaudin, Sabine; Cuciuc, Constantin-Mihai; Cuenca Almenar, Cristóbal; Cuhadar Donszelmann, Tulay; Curatolo, Maria; Curtis, Chris; Cuthbert, Cameron; Cwetanski, Peter; Czirr, Hendrik; Czodrowski, Patrick; Czyczula, Zofia; D'Auria, Saverio; D'Onofrio, Monica; D'Orazio, Alessia; Da Silva, Paulo Vitor; Da Via, Cinzia; Dabrowski, Wladyslaw; Dai, Tiesheng; Dallapiccola, Carlo; Dam, Mogens; Dameri, Mauro; Damiani, Daniel; Danielsson, Hans Olof; Dannheim, Dominik; Dao, Valerio; Darbo, Giovanni; Darlea, Georgiana Lavinia; Davey, Will; Davidek, Tomas; Davidson, Nadia; Davidson, Ruth; Davies, Eleanor; Davies, Merlin; Davison, Adam; Davygora, Yuriy; Dawe, Edmund; Dawson, Ian; Dawson, John; Daya-Ishmukhametova, Rozmin; De, Kaushik; de Asmundis, Riccardo; De Castro, Stefano; De Castro Faria Salgado, Pedro; De Cecco, Sandro; de Graat, Julien; De Groot, Nicolo; de Jong, Paul; De La Taille, Christophe; De la Torre, Hector; De Lotto, Barbara; de Mora, Lee; De Nooij, Lucie; De Pedis, Daniele; De Salvo, Alessandro; De Sanctis, Umberto; De Santo, Antonella; De Vivie De Regie, Jean-Baptiste; Dean, Simon; Dearnaley, William James; Debbe, Ramiro; Debenedetti, Chiara; Dedovich, Dmitri; Degenhardt, James; Dehchar, Mohamed; Del Papa, Carlo; Del Peso, Jose; Del Prete, Tarcisio; Delemontex, Thomas; Deliyergiyev, Maksym; Dell'Acqua, Andrea; Dell'Asta, Lidia; Della Pietra, Massimo; della Volpe, Domenico; Delmastro, Marco; Delruelle, Nicolas; Delsart, Pierre-Antoine; Deluca, Carolina; Demers, Sarah; Demichev, Mikhail; Demirkoz, Bilge; Deng, Jianrong; Denisov, Sergey; Derendarz, Dominik; Derkaoui, Jamal Eddine; Derue, Frederic; Dervan, Paul; Desch, Klaus Kurt; Devetak, Erik; Deviveiros, Pier-Olivier; Dewhurst, Alastair; DeWilde, Burton; Dhaliwal, Saminder; Dhullipudi, Ramasudhakar; Di Ciaccio, Anna; Di Ciaccio, Lucia; Di Girolamo, Alessandro; Di Girolamo, Beniamino; Di Luise, Silvestro; Di Mattia, Alessandro; Di Micco, Biagio; Di Nardo, Roberto; Di Simone, Andrea; Di Sipio, Riccardo; Diaz, Marco Aurelio; Diblen, Faruk; Diehl, Edward; Dietrich, Janet; Dietzsch, Thorsten; Diglio, Sara; Dindar Yagci, Kamile; Dingfelder, Jochen; Dionisi, Carlo; Dita, Petre; Dita, Sanda; Dittus, Fridolin; Djama, Fares; Djobava, Tamar; Barros do Vale, Maria Aline; Do Valle Wemans, André; Doan, Thi Kieu Oanh; Dobbs, Matt; Dobinson, Robert; Dobos, Daniel; Dobson, Ellie; Dodd, Jeremy; Doglioni, Caterina; Doherty, Tom; Doi, Yoshikuni; Dolejsi, Jiri; Dolenc, Irena; Dolezal, Zdenek; Dolgoshein, Boris; Dohmae, Takeshi; Donadelli, Marisilvia; Donega, Mauro; Donini, Julien; Dopke, Jens; Doria, Alessandra; Dos Anjos, Andre; Dosil, Mireia; Dotti, Andrea; Dova, Maria-Teresa; Dowell, John; Doxiadis, Alexander; Doyle, Tony; Drasal, Zbynek; Drees, Jürgen; Dressnandt, Nandor; Drevermann, Hans; Driouichi, Chafik; Dris, Manolis; Dubbert, Jörg; Dube, Sourabh; Duchovni, Ehud; Duckeck, Guenter; Dudarev, Alexey; Dudziak, Fanny; Dührssen, Michael; Duerdoth, Ian; Duflot, Laurent; Dufour, Marc-Andre; Dunford, Monica; Duran Yildiz, Hatice; Duxfield, Robert; Dwuznik, Michal; Dydak, Friedrich; Düren, Michael; Ebenstein, William; Ebke, Johannes; Eckweiler, Sebastian; Edmonds, Keith; Edwards, Clive; Edwards, Nicholas Charles; Ehrenfeld, Wolfgang; Ehrich, Thies; Eifert, Till; Eigen, Gerald; Einsweiler, Kevin; Eisenhandler, Eric; Ekelof, Tord; El Kacimi, Mohamed; Ellert, Mattias; Elles, Sabine; Ellinghaus, Frank; Ellis, Katherine; Ellis, Nicolas; Elmsheuser, Johannes; Elsing, Markus; Emeliyanov, Dmitry; Engelmann, Roderich; Engl, Albert; Epp, Brigitte; Eppig, Andrew; Erdmann, Johannes; Ereditato, Antonio; Eriksson, Daniel; Ernst, Jesse; Ernst, Michael; Ernwein, Jean; Errede, Deborah; Errede, Steven; Ertel, Eugen; Escalier, Marc; Escobar, Carlos; Espinal Curull, Xavier; Esposito, Bellisario; Etienne, Francois; Etienvre, Anne-Isabelle; Etzion, Erez; Evangelakou, Despoina; Evans, Hal; Fabbri, Laura; Fabre, Caroline; Fakhrutdinov, Rinat; Falciano, Speranza; Fang, Yaquan; Fanti, Marcello; Farbin, Amir; Farilla, Addolorata; Farley, Jason; Farooque, Trisha; Farrington, Sinead; Farthouat, Philippe; Fassnacht, Patrick; Fassouliotis, Dimitrios; Fatholahzadeh, Baharak; Favareto, Andrea; Fayard, Louis; Fazio, Salvatore; Febbraro, Renato; Federic, Pavol; Fedin, Oleg; Fedorko, Woiciech; Fehling-Kaschek, Mirjam; Feligioni, Lorenzo; Fellmann, Denis; Feng, Cunfeng; Feng, Eric; Fenyuk, Alexander; Ferencei, Jozef; Ferland, Jonathan; Fernando, Waruna; Ferrag, Samir; Ferrando, James; Ferrara, Valentina; Ferrari, Arnaud; Ferrari, Pamela; Ferrari, Roberto; Ferreira de Lima, Danilo Enoque; Ferrer, Antonio; Ferrer, Maria Lorenza; Ferrere, Didier; Ferretti, Claudio; Ferretto Parodi, Andrea; Fiascaris, Maria; Fiedler, Frank; Filipčič, Andrej; Filippas, Anastasios; Filthaut, Frank; Fincke-Keeler, Margret; Fiolhais, Miguel; Fiorini, Luca; Firan, Ana; Fischer, Gordon; Fischer, Peter; Fisher, Matthew; Flechl, Martin; Fleck, Ivor; Fleckner, Johanna; Fleischmann, Philipp; Fleischmann, Sebastian; Flick, Tobias; Floderus, Anders; Flores Castillo, Luis; Flowerdew, Michael; Fokitis, Manolis; Fonseca Martin, Teresa; Forbush, David Alan; Formica, Andrea; Forti, Alessandra; Fortin, Dominique; Foster, Joe; Fournier, Daniel; Foussat, Arnaud; Fowler, Andrew; Fowler, Ken; Fox, Harald; Francavilla, Paolo; Franchino, Silvia; Francis, David; Frank, Tal; Franklin, Melissa; Franz, Sebastien; Fraternali, Marco; Fratina, Sasa; French, Sky; Friedrich, Felix; Froeschl, Robert; Froidevaux, Daniel; Frost, James; Fukunaga, Chikara; Fullana Torregrosa, Esteban; Fuster, Juan; Gabaldon, Carolina; Gabizon, Ofir; Gadfort, Thomas; Gadomski, Szymon; Gagliardi, Guido; Gagnon, Pauline; Galea, Cristina; Gallas, Elizabeth; Gallo, Valentina Santina; Gallop, Bruce; Gallus, Petr; Gan, KK; Gao, Yongsheng; Gapienko, Vladimir; Gaponenko, Andrei; Garberson, Ford; Garcia-Sciveres, Maurice; García, Carmen; García Navarro, José Enrique; Gardner, Robert; Garelli, Nicoletta; Garitaonandia, Hegoi; Garonne, Vincent; Garvey, John; Gatti, Claudio; Gaudio, Gabriella; Gaur, Bakul; Gauthier, Lea; Gavrilenko, Igor; Gay, Colin; Gaycken, Goetz; Gayde, Jean-Christophe; Gazis, Evangelos; Ge, Peng; Gee, Norman; Geerts, Daniël Alphonsus Adrianus; Geich-Gimbel, Christoph; Gellerstedt, Karl; Gemme, Claudia; Gemmell, Alistair; Genest, Marie-Hélène; Gentile, Simonetta; George, Matthias; George, Simon; Gerlach, Peter; Gershon, Avi; Geweniger, Christoph; Ghazlane, Hamid; Ghodbane, Nabil; Giacobbe, Benedetto; Giagu, Stefano; Giakoumopoulou, Victoria; Giangiobbe, Vincent; Gianotti, Fabiola; Gibbard, Bruce; Gibson, Adam; Gibson, Stephen; Gilbert, Laura; Gilewsky, Valentin; Gillberg, Dag; Gillman, Tony; Gingrich, Douglas; Ginzburg, Jonatan; Giokaris, Nikos; Giordani, MarioPaolo; Giordano, Raffaele; Giorgi, Francesco Michelangelo; Giovannini, Paola; Giraud, Pierre-Francois; Giugni, Danilo; Giunta, Michele; Giusti, Paolo; Gjelsten, Børge Kile; Gladilin, Leonid; Glasman, Claudia; Glatzer, Julian; Glazov, Alexandre; Glitza, Karl-Walter; Glonti, George; Goddard, Jack Robert; Godfrey, Jennifer; Godlewski, Jan; Goebel, Martin; Göpfert, Thomas; Goeringer, Christian; Gössling, Claus; Göttfert, Tobias; Goldfarb, Steven; Golling, Tobias; Gomes, Agostinho; Gomez Fajardo, Luz Stella; Gonçalo, Ricardo; Goncalves Pinto Firmino Da Costa, Joao; Gonella, Laura; Gonidec, Allain; Gonzalez, Saul; González de la Hoz, Santiago; Gonzalez Parra, Garoe; Gonzalez Silva, Laura; Gonzalez-Sevilla, Sergio; Goodson, Jeremiah Jet; Goossens, Luc; Gorbounov, Petr Andreevich; Gordon, Howard; Gorelov, Igor; Gorfine, Grant; Gorini, Benedetto; Gorini, Edoardo; Gorišek, Andrej; Gornicki, Edward; Gorokhov, Serguei; Goryachev, Vladimir; Gosdzik, Bjoern; Gosselink, Martijn; Gostkin, Mikhail Ivanovitch; Gough Eschrich, Ivo; Gouighri, Mohamed; Goujdami, Driss; Goulette, Marc Phillippe; Goussiou, Anna; Goy, Corinne; Gozpinar, Serdar; Grabowska-Bold, Iwona; Grafström, Per; Grahn, Karl-Johan; Grancagnolo, Francesco; Grancagnolo, Sergio; Grassi, Valerio; Gratchev, Vadim; Grau, Nathan; Gray, Heather; Gray, Julia Ann; Graziani, Enrico; Grebenyuk, Oleg; Greenshaw, Timothy; Greenwood, Zeno Dixon; Gregersen, Kristian; Gregor, Ingrid-Maria; Grenier, Philippe; Griffiths, Justin; Grigalashvili, Nugzar; Grillo, Alexander; Grinstein, Sebastian; Grishkevich, Yaroslav; Grivaz, Jean-Francois; Groh, Manfred; Gross, Eilam; Grosse-Knetter, Joern; Groth-Jensen, Jacob; Grybel, Kai; Guarino, Victor; Guest, Daniel; Guicheney, Christophe; Guida, Angelo; Guindon, Stefan; Guler, Hulya; Gunther, Jaroslav; Guo, Bin; Guo, Jun; Gupta, Ambreesh; Gusakov, Yury; Gushchin, Vladimir; Gutierrez, Phillip; Guttman, Nir; Gutzwiller, Olivier; Guyot, Claude; Gwenlan, Claire; Gwilliam, Carl; Haas, Andy; Haas, Stefan; Haber, Carl; Hadavand, Haleh Khani; Hadley, David; Haefner, Petra; Hahn, Ferdinand; Haider, Stefan; Hajduk, Zbigniew; Hakobyan, Hrachya; Hall, David; Haller, Johannes; Hamacher, Klaus; Hamal, Petr; Hamer, Matthias; Hamilton, Andrew; Hamilton, Samuel; Han, Hongguang; Han, Liang; Hanagaki, Kazunori; Hanawa, Keita; Hance, Michael; Handel, Carsten; Hanke, Paul; Hansen, John Renner; Hansen, Jørgen Beck; Hansen, Jorn Dines; Hansen, Peter Henrik; Hansson, Per; Hara, Kazuhiko; Hare, Gabriel; Harenberg, Torsten; Harkusha, Siarhei; Harper, Devin; Harrington, Robert; Harris, Orin; Harrison, Karl; Hartert, Jochen; Hartjes, Fred; Haruyama, Tomiyoshi; Harvey, Alex; Hasegawa, Satoshi; Hasegawa, Yoji; Hassani, Samira; Hatch, Mark; Hauff, Dieter; Haug, Sigve; Hauschild, Michael; Hauser, Reiner; Havranek, Miroslav; Hawes, Brian; Hawkes, Christopher; Hawkings, Richard John; Hawkins, Anthony David; Hawkins, Donovan; Hayakawa, Takashi; Hayashi, Takayasu; Hayden, Daniel; Hayward, Helen; Haywood, Stephen; Hazen, Eric; He, Mao; Head, Simon; Hedberg, Vincent; Heelan, Louise; Heim, Sarah; Heinemann, Beate; Heisterkamp, Simon; Helary, Louis; Heller, Claudio; Heller, Matthieu; Hellman, Sten; Hellmich, Dennis; Helsens, Clement; Henderson, Robert; Henke, Michael; Henrichs, Anna; Henriques Correia, Ana Maria; Henrot-Versille, Sophie; Henry-Couannier, Frédéric; Hensel, Carsten; Henß, Tobias; Medina Hernandez, Carlos; Hernández Jiménez, Yesenia; Herrberg, Ruth; Hershenhorn, Alon David; Herten, Gregor; Hertenberger, Ralf; Hervas, Luis; Hesketh, Gavin Grant; Hessey, Nigel; Higón-Rodriguez, Emilio; Hill, Daniel; Hill, John; Hill, Norman; Hiller, Karl Heinz; Hillert, Sonja; Hillier, Stephen; Hinchliffe, Ian; Hines, Elizabeth; Hirose, Minoru; Hirsch, Florian; Hirschbuehl, Dominic; Hobbs, John; Hod, Noam; Hodgkinson, Mark; Hodgson, Paul; Hoecker, Andreas; Hoeferkamp, Martin; Hoffman, Julia; Hoffmann, Dirk; Hohlfeld, Marc; Holder, Martin; Holmgren, Sven-Olof; Holy, Tomas; Holzbauer, Jenny; Homma, Yasuhiro; Hong, Tae Min; Hooft van Huysduynen, Loek; Horazdovsky, Tomas; Horn, Claus; Horner, Stephan; Hostachy, Jean-Yves; Hou, Suen; Houlden, Michael; Hoummada, Abdeslam; Howarth, James; Howell, David; Hristova, Ivana; Hrivnac, Julius; Hruska, Ivan; Hryn'ova, Tetiana; Hsu, Pai-hsien Jennifer; Hsu, Shih-Chieh; Huang, Guang Shun; Hubacek, Zdenek; Hubaut, Fabrice; Huegging, Fabian; Huettmann, Antje; Huffman, Todd Brian; Hughes, Emlyn; Hughes, Gareth; Hughes-Jones, Richard; Huhtinen, Mika; Hurst, Peter; Hurwitz, Martina; Husemann, Ulrich; Huseynov, Nazim; Huston, Joey; Huth, John; Iacobucci, Giuseppe; Iakovidis, Georgios; Ibbotson, Michael; Ibragimov, Iskander; Ichimiya, Ryo; Iconomidou-Fayard, Lydia; Idarraga, John; Iengo, Paolo; Igonkina, Olga; Ikegami, Yoichi; Ikeno, Masahiro; Ilchenko, Yuri; Iliadis, Dimitrios; Ilic, Nikolina; Imori, Masatoshi; Ince, Tayfun; Inigo-Golfin, Joaquin; Ioannou, Pavlos; Iodice, Mauro; Ippolito, Valerio; Irles Quiles, Adrian; Isaksson, Charlie; Ishikawa, Akimasa; Ishino, Masaya; Ishmukhametov, Renat; Issever, Cigdem; Istin, Serhat; Ivashin, Anton; Iwanski, Wieslaw; Iwasaki, Hiroyuki; Izen, Joseph; Izzo, Vincenzo; Jackson, Brett; Jackson, John; Jackson, Paul; Jaekel, Martin; Jain, Vivek; Jakobs, Karl; Jakobsen, Sune; Jakubek, Jan; Jana, Dilip; Jankowski, Ernest; Jansen, Eric; Jansen, Hendrik; Jantsch, Andreas; Janus, Michel; Jarlskog, Göran; Jeanty, Laura; Jelen, Kazimierz; Jen-La Plante, Imai; Jenni, Peter; Jeremie, Andrea; Jež, Pavel; Jézéquel, Stéphane; Jha, Manoj Kumar; Ji, Haoshuang; Ji, Weina; Jia, Jiangyong; Jiang, Yi; Jimenez Belenguer, Marcos; Jin, Ge; Jin, Shan; Jinnouchi, Osamu; Joergensen, Morten Dam; Joffe, David; Johansen, Lars; Johansen, Marianne; Johansson, Erik; Johansson, Per; Johnert, Sebastian; Johns, Kenneth; Jon-And, Kerstin; Jones, Graham; Jones, Roger; Jones, Tegid; Jones, Tim; Jonsson, Ove; Joram, Christian; Jorge, Pedro; Joseph, John; Jovicevic, Jelena; Jovin, Tatjana; Ju, Xiangyang; Jung, Christian; Jungst, Ralph Markus; Juranek, Vojtech; Jussel, Patrick; Juste Rozas, Aurelio; Kabachenko, Vasily; Kabana, Sonja; Kaci, Mohammed; Kaczmarska, Anna; Kadlecik, Peter; Kado, Marumi; Kagan, Harris; Kagan, Michael; Kaiser, Steffen; Kajomovitz, Enrique; Kalinin, Sergey; Kalinovskaya, Lidia; Kama, Sami; Kanaya, Naoko; Kaneda, Michiru; Kaneti, Steven; Kanno, Takayuki; Kantserov, Vadim; Kanzaki, Junichi; Kaplan, Benjamin; Kapliy, Anton; Kaplon, Jan; Kar, Deepak; Karagounis, Michael; Karagoz, Muge; Karnevskiy, Mikhail; Karr, Kristo; Kartvelishvili, Vakhtang; Karyukhin, Andrey; Kashif, Lashkar; Kasieczka, Gregor; Kass, Richard; Kastanas, Alex; Kataoka, Mayuko; Kataoka, Yousuke; Katsoufis, Elias; Katzy, Judith; Kaushik, Venkatesh; Kawagoe, Kiyotomo; Kawamoto, Tatsuo; Kawamura, Gen; Kayl, Manuel; Kazanin, Vassili; Kazarinov, Makhail; Keeler, Richard; Kehoe, Robert; Keil, Markus; Kekelidze, George; Kennedy, John; Kenney, Christopher John; Kenyon, Mike; Kepka, Oldrich; Kerschen, Nicolas; Kerševan, Borut Paul; Kersten, Susanne; Kessoku, Kohei; Keung, Justin; Khalil-zada, Farkhad; Khandanyan, Hovhannes; Khanov, Alexander; Kharchenko, Dmitri; Khodinov, Alexander; Kholodenko, Anatoli; Khomich, Andrei; Khoo, Teng Jian; Khoriauli, Gia; Khoroshilov, Andrey; Khovanskiy, Nikolai; Khovanskiy, Valery; Khramov, Evgeniy; Khubua, Jemal; Kim, Hyeon Jin; Kim, Min Suk; Kim, Shinhong; Kimura, Naoki; Kind, Oliver; King, Barry; King, Matthew; King, Robert Steven Beaufoy; Kirk, Julie; Kirsch, Lawrence; Kiryunin, Andrey; Kishimoto, Tomoe; Kisielewska, Danuta; Kittelmann, Thomas; Kiver, Andrey; Kladiva, Eduard; Klaiber-Lodewigs, Jonas; Klein, Max; Klein, Uta; Kleinknecht, Konrad; Klemetti, Miika; Klier, Amit; Klimek, Pawel; Klimentov, Alexei; Klingenberg, Reiner; Klinger, Joel Alexander; Klinkby, Esben; Klioutchnikova, Tatiana; Klok, Peter; Klous, Sander; Kluge, Eike-Erik; Kluge, Thomas; Kluit, Peter; Kluth, Stefan; Knecht, Neil; Kneringer, Emmerich; Knobloch, Juergen; Knoops, Edith; Knue, Andrea; Ko, Byeong Rok; Kobayashi, Tomio; Kobel, Michael; Kocian, Martin; Kodys, Peter; Köneke, Karsten; König, Adriaan; Koenig, Sebastian; Köpke, Lutz; Koetsveld, Folkert; Koevesarki, Peter; Koffas, Thomas; Koffeman, Els; Kogan, Lucy Anne; Kohn, Fabian; Kohout, Zdenek; Kohriki, Takashi; Koi, Tatsumi; Kokott, Thomas; Kolachev, Guennady; Kolanoski, Hermann; Kolesnikov, Vladimir; Koletsou, Iro; Koll, James; Kollefrath, Michael; Kolya, Scott; Komar, Aston; Komori, Yuto; Kondo, Takahiko; Kono, Takanori; Kononov, Anatoly; Konoplich, Rostislav; Konstantinidis, Nikolaos; Kootz, Andreas; Koperny, Stefan; Korcyl, Krzysztof; Kordas, Kostantinos; Koreshev, Victor; Korn, Andreas; Korol, Aleksandr; Korolkov, Ilya; Korolkova, Elena; Korotkov, Vladislav; Kortner, Oliver; Kortner, Sandra; Kostyukhin, Vadim; Kotamäki, Miikka Juhani; Kotov, Sergey; Kotov, Vladislav; Kotwal, Ashutosh; Kourkoumelis, Christine; Kouskoura, Vasiliki; Koutsman, Alex; Kowalewski, Robert Victor; Kowalski, Tadeusz; Kozanecki, Witold; Kozhin, Anatoly; Kral, Vlastimil; Kramarenko, Viktor; Kramberger, Gregor; Krasny, Mieczyslaw Witold; Krasznahorkay, Attila; Kraus, James; Kraus, Jana; Kreisel, Arik; Krejci, Frantisek; Kretzschmar, Jan; Krieger, Nina; Krieger, Peter; Kroeninger, Kevin; Kroha, Hubert; Kroll, Joe; Kroseberg, Juergen; Krstic, Jelena; Kruchonak, Uladzimir; Krüger, Hans; Kruker, Tobias; Krumnack, Nils; Krumshteyn, Zinovii; Kruth, Andre; Kubota, Takashi; Kuday, Sinan; Kuehn, Susanne; Kugel, Andreas; Kuhl, Thorsten; Kuhn, Dietmar; Kukhtin, Victor; Kulchitsky, Yuri; Kuleshov, Sergey; Kummer, Christian; Kuna, Marine; Kundu, Nikhil; Kunkle, Joshua; Kupco, Alexander; Kurashige, Hisaya; Kurata, Masakazu; Kurochkin, Yurii; Kus, Vlastimil; Kuwertz, Emma Sian; Kuze, Masahiro; Kvita, Jiri; Kwee, Regina; La Rosa, Alessandro; La Rotonda, Laura; Labarga, Luis; Labbe, Julien; Lablak, Said; Lacasta, Carlos; Lacava, Francesco; Lacker, Heiko; Lacour, Didier; Lacuesta, Vicente Ramón; Ladygin, Evgueni; Lafaye, Remi; Laforge, Bertrand; Lagouri, Theodota; Lai, Stanley; Laisne, Emmanuel; Lamanna, Massimo; Lampen, Caleb; Lampl, Walter; Lancon, Eric; Landgraf, Ulrich; Landon, Murrough; Lane, Jenna; Lange, Clemens; Lankford, Andrew; Lanni, Francesco; Lantzsch, Kerstin; Laplace, Sandrine; Lapoire, Cecile; Laporte, Jean-Francois; Lari, Tommaso; Larionov, Anatoly; Larner, Aimee; Lasseur, Christian; Lassnig, Mario; Laurelli, Paolo; Lavorini, Vincenzo; Lavrijsen, Wim; Laycock, Paul; Lazarev, Alexandre; Le Dortz, Olivier; Le Guirriec, Emmanuel; Le Maner, Christophe; Le Menedeu, Eve; Lebel, Céline; LeCompte, Thomas; Ledroit-Guillon, Fabienne Agnes Marie; Lee, Hurng-Chun; Lee, Jason; Lee, Shih-Chang; Lee, Lawrence; Lefebvre, Michel; Legendre, Marie; Leger, Annie; LeGeyt, Benjamin; Legger, Federica; Leggett, Charles; Lehmacher, Marc; Lehmann Miotto, Giovanna; Lei, Xiaowen; Leite, Marco Aurelio Lisboa; Leitner, Rupert; Lellouch, Daniel; Leltchouk, Mikhail; Lemmer, Boris; Lendermann, Victor; Leney, Katharine; Lenz, Tatiana; Lenzen, Georg; Lenzi, Bruno; Leonhardt, Kathrin; Leontsinis, Stefanos; Leroy, Claude; Lessard, Jean-Raphael; Lesser, Jonas; Lester, Christopher; Leung Fook Cheong, Annabelle; Levêque, Jessica; Levin, Daniel; Levinson, Lorne; Levitski, Mikhail; Lewis, Adrian; Lewis, George; Leyko, Agnieszka; Leyton, Michael; Li, Bo; Li, Haifeng; Li, Shu; Li, Xuefei; Liang, Zhijun; Liao, Hongbo; Liberti, Barbara; Lichard, Peter; Lichtnecker, Markus; Lie, Ki; Liebig, Wolfgang; Lifshitz, Ronen; Limbach, Christian; Limosani, Antonio; Limper, Maaike; Lin, Simon; Linde, Frank; Linnemann, James; Lipeles, Elliot; Lipinsky, Lukas; Lipniacka, Anna; Liss, Tony; Lissauer, David; Lister, Alison; Litke, Alan; Liu, Chuanlei; Liu, Dong; Liu, Hao; Liu, Jianbei; Liu, Minghui; Liu, Yanwen; Livan, Michele; Livermore, Sarah; Lleres, Annick; Llorente Merino, Javier; Lloyd, Stephen; Lobodzinska, Ewelina; Loch, Peter; Lockman, William; Loddenkoetter, Thomas; Loebinger, Fred; Loginov, Andrey; Loh, Chang Wei; Lohse, Thomas; Lohwasser, Kristin; Lokajicek, Milos; Loken, James; Lombardo, Vincenzo Paolo; Long, Robin Eamonn; Lopes, Lourenco; Lopez Mateos, David; Lorenz, Jeanette; Lorenzo Martinez, Narei; Losada, Marta; Loscutoff, Peter; Lo Sterzo, Francesco; Losty, Michael; Lou, Xinchou; Lounis, Abdenour; Loureiro, Karina; Love, Jeremy; Love, Peter; Lowe, Andrew; Lu, Feng; Lubatti, Henry; Luci, Claudio; Lucotte, Arnaud; Ludwig, Andreas; Ludwig, Dörthe; Ludwig, Inga; Ludwig, Jens; Luehring, Frederick; Luijckx, Guy; Lumb, Debra; Luminari, Lamberto; Lund, Esben; Lund-Jensen, Bengt; Lundberg, Björn; Lundberg, Johan; Lundquist, Johan; Lungwitz, Matthias; Lutz, Gerhard; Lynn, David; Lys, Jeremy; Lytken, Else; Ma, Hong; Ma, Lian Liang; Macana Goia, Jorge Andres; Maccarrone, Giovanni; Macchiolo, Anna; Maček, Boštjan; Machado Miguens, Joana; Mackeprang, Rasmus; Madaras, Ronald; Mader, Wolfgang; Maenner, Reinhard; Maeno, Tadashi; Mättig, Peter; Mättig, Stefan; Magnoni, Luca; Magradze, Erekle; Mahalalel, Yair; Mahboubi, Kambiz; Mahout, Gilles; Maiani, Camilla; Maidantchik, Carmen; Maio, Amélia; Majewski, Stephanie; Makida, Yasuhiro; Makovec, Nikola; Mal, Prolay; Malaescu, Bogdan; Malecki, Pawel; Malecki, Piotr; Maleev, Victor; Malek, Fairouz; Mallik, Usha; Malon, David; Malone, Caitlin; Maltezos, Stavros; Malyshev, Vladimir; Malyukov, Sergei; Mameghani, Raphael; Mamuzic, Judita; Manabe, Atsushi; Mandelli, Luciano; Mandić, Igor; Mandrysch, Rocco; Maneira, José; Mangeard, Pierre-Simon; Manhaes de Andrade Filho, Luciano; Manjavidze, Ioseb; Mann, Alexander; Manning, Peter; Manousakis-Katsikakis, Arkadios; Mansoulie, Bruno; Manz, Andreas; Mapelli, Alessandro; Mapelli, Livio; March, Luis; Marchand, Jean-Francois; Marchese, Fabrizio; Marchiori, Giovanni; Marcisovsky, Michal; Marin, Alexandru; Marino, Christopher; Marroquim, Fernando; Marshall, Robin; Marshall, Zach; Martens, Kalen; Marti-Garcia, Salvador; Martin, Andrew; Martin, Brian; Martin, Brian Thomas; Martin, Franck Francois; Martin, Jean-Pierre; Martin, Philippe; Martin, Tim; Martin, Victoria Jane; Martin dit Latour, Bertrand; Martin-Haugh, Stewart; Martinez, Mario; Martinez Outschoorn, Verena; Martyniuk, Alex; Marx, Marilyn; Marzano, Francesco; Marzin, Antoine; Masetti, Lucia; Mashimo, Tetsuro; Mashinistov, Ruslan; Masik, Jiri; Maslennikov, Alexey; Massa, Ignazio; Massaro, Graziano; Massol, Nicolas; Mastrandrea, Paolo; Mastroberardino, Anna; Masubuchi, Tatsuya; Mathes, Markus; Matricon, Pierre; Matsumoto, Hiroshi; Matsunaga, Hiroyuki; Matsushita, Takashi; Mattravers, Carly; Maugain, Jean-Marie; Maurer, Julien; Maxfield, Stephen; Maximov, Dmitriy; May, Edward; Mayne, Anna; Mazini, Rachid; Mazur, Michael; Mazzanti, Marcello; Mazzoni, Enrico; Mc Kee, Shawn Patrick; McCarn, Allison; McCarthy, Robert; McCarthy, Tom; McCubbin, Norman; McFarlane, Kenneth; Mcfayden, Josh; McGlone, Helen; Mchedlidze, Gvantsa; McLaren, Robert Andrew; Mclaughlan, Tom; McMahon, Steve; McPherson, Robert; Meade, Andrew; Mechnich, Joerg; Mechtel, Markus; Medinnis, Mike; Meera-Lebbai, Razzak; Meguro, Tatsuma; Mehdiyev, Rashid; Mehlhase, Sascha; Mehta, Andrew; Meier, Karlheinz; Meirose, Bernhard; Melachrinos, Constantinos; Mellado Garcia, Bruce Rafael; Mendoza Navas, Luis; Meng, Zhaoxia; Mengarelli, Alberto; Menke, Sven; Menot, Claude; Meoni, Evelin; Mercurio, Kevin Michael; Mermod, Philippe; Merola, Leonardo; Meroni, Chiara; Merritt, Frank; Merritt, Hayes; Messina, Andrea; Metcalfe, Jessica; Mete, Alaettin Serhan; Meyer, Carsten; Meyer, Christopher; Meyer, Jean-Pierre; Meyer, Jochen; Meyer, Joerg; Meyer, Thomas Christian; Meyer, W Thomas; Miao, Jiayuan; Michal, Sebastien; Micu, Liliana; Middleton, Robin; Migas, Sylwia; Mijović, Liza; Mikenberg, Giora; Mikestikova, Marcela; Mikuž, Marko; Miller, David; Miller, Robert; Mills, Bill; Mills, Corrinne; Milov, Alexander; Milstead, David; Milstein, Dmitry; Minaenko, Andrey; Miñano Moya, Mercedes; Minashvili, Irakli; Mincer, Allen; Mindur, Bartosz; Mineev, Mikhail; Ming, Yao; Mir, Lluisa-Maria; Mirabelli, Giovanni; Miralles Verge, Lluis; Misiejuk, Andrzej; Mitrevski, Jovan; Mitrofanov, Gennady; Mitsou, Vasiliki A; Mitsui, Shingo; Miyagawa, Paul; Miyazaki, Kazuki; Mjörnmark, Jan-Ulf; Moa, Torbjoern; Mockett, Paul; Moed, Shulamit; Moeller, Victoria; Mönig, Klaus; Möser, Nicolas; Mohapatra, Soumya; Mohr, Wolfgang; Mohrdieck-Möck, Susanne; Moisseev, Artemy; Moles-Valls, Regina; Molina-Perez, Jorge; Monk, James; Monnier, Emmanuel; Montesano, Simone; Monticelli, Fernando; Monzani, Simone; Moore, Roger; Moorhead, Gareth; Mora Herrera, Clemencia; Moraes, Arthur; Morange, Nicolas; Morel, Julien; Morello, Gianfranco; Moreno, Deywis; Moreno Llácer, María; Morettini, Paolo; Morgenstern, Marcus; Morii, Masahiro; Morin, Jerome; Morley, Anthony Keith; Mornacchi, Giuseppe; Morozov, Sergey; Morris, John; Morvaj, Ljiljana; Moser, Hans-Guenther; Mosidze, Maia; Moss, Josh; Mount, Richard; Mountricha, Eleni; Mouraviev, Sergei; Moyse, Edward; Mudrinic, Mihajlo; Mueller, Felix; Mueller, James; Mueller, Klemens; Müller, Thomas; Mueller, Timo; Muenstermann, Daniel; Muir, Alex; Munwes, Yonathan; Murray, Bill; Mussche, Ido; Musto, Elisa; Myagkov, Alexey; Myska, Miroslav; Nadal, Jordi; Nagai, Koichi; Nagano, Kunihiro; Nagarkar, Advait; Nagasaka, Yasushi; Nagel, Martin; Nairz, Armin Michael; Nakahama, Yu; Nakamura, Koji; Nakamura, Tomoaki; Nakano, Itsuo; Nanava, Gizo; Napier, Austin; Narayan, Rohin; Nash, Michael; Nation, Nigel; Nattermann, Till; Naumann, Thomas; Navarro, Gabriela; Neal, Homer; Nebot, Eduardo; Nechaeva, Polina; Neep, Thomas James; Negri, Andrea; Negri, Guido; Nektarijevic, Snezana; Nelson, Andrew; Nelson, Silke; Nelson, Timothy Knight; Nemecek, Stanislav; Nemethy, Peter; Nepomuceno, Andre Asevedo; Nessi, Marzio; Neubauer, Mark; Neusiedl, Andrea; Neves, Ricardo; Nevski, Pavel; Newman, Paul; Nguyen Thi Hong, Van; Nickerson, Richard; Nicolaidou, Rosy; Nicolas, Ludovic; Nicquevert, Bertrand; Niedercorn, Francois; Nielsen, Jason; Niinikoski, Tapio; Nikiforou, Nikiforos; Nikiforov, Andriy; Nikolaenko, Vladimir; Nikolaev, Kirill; Nikolic-Audit, Irena; Nikolics, Katalin; Nikolopoulos, Konstantinos; Nilsen, Henrik; Nilsson, Paul; Ninomiya, Yoichi; Nisati, Aleandro; Nishiyama, Tomonori; Nisius, Richard; Nodulman, Lawrence; Nomachi, Masaharu; Nomidis, Ioannis; Nordberg, Markus; Nordkvist, Bjoern; Norton, Peter; Novakova, Jana; Nozaki, Mitsuaki; Nozka, Libor; Nugent, Ian Michael; Nuncio-Quiroz, Adriana-Elizabeth; Nunes Hanninger, Guilherme; Nunnemann, Thomas; Nurse, Emily; O'Brien, Brendan Joseph; O'Neale, Steve; O'Neil, Dugan; O'Shea, Val; Oakes, Louise Beth; Oakham, Gerald; Oberlack, Horst; Ocariz, Jose; Ochi, Atsuhiko; Oda, Susumu; Odaka, Shigeru; Odier, Jerome; Ogren, Harold; Oh, Alexander; Oh, Seog; Ohm, Christian; Ohshima, Takayoshi; Ohshita, Hidetoshi; Okada, Shogo; Okawa, Hideki; Okumura, Yasuyuki; Okuyama, Toyonobu; Olariu, Albert; Olcese, Marco; Olchevski, Alexander; Olivares Pino, Sebastian Andres; Oliveira, Miguel Alfonso; Oliveira Damazio, Denis; Oliver Garcia, Elena; Olivito, Dominick; Olszewski, Andrzej; Olszowska, Jolanta; Omachi, Chihiro; Onofre, António; Onyisi, Peter; Oram, Christopher; Oreglia, Mark; Oren, Yona; Orestano, Domizia; Orlov, Iliya; Oropeza Barrera, Cristina; Orr, Robert; Osculati, Bianca; Ospanov, Rustem; Osuna, Carlos; Otero y Garzon, Gustavo; Ottersbach, John; Ouchrif, Mohamed; Ouellette, Eric; Ould-Saada, Farid; Ouraou, Ahmimed; Ouyang, Qun; Ovcharova, Ana; Owen, Mark; Owen, Simon; Ozcan, Veysi Erkcan; Ozturk, Nurcan; Pacheco Pages, Andres; Padilla Aranda, Cristobal; Pagan Griso, Simone; Paganis, Efstathios; Paige, Frank; Pais, Preema; Pajchel, Katarina; Palacino, Gabriel; Paleari, Chiara; Palestini, Sandro; Pallin, Dominique; Palma, Alberto; Palmer, Jody; Pan, Yibin; Panagiotopoulou, Evgenia; Panes, Boris; Panikashvili, Natalia; Panitkin, Sergey; Pantea, Dan; Panuskova, Monika; Paolone, Vittorio; Papadelis, Aras; Papadopoulou, Theodora; Paramonov, Alexander; Paredes Hernandez, Daniela; Park, Woochun; Parker, Andy; Parodi, Fabrizio; Parsons, John; Parzefall, Ulrich; Pasqualucci, Enrico; Passaggio, Stefano; Passeri, Antonio; Pastore, Fernanda; Pastore, Francesca; Pásztor, Gabriella; Pataraia, Sophio; Patel, Nikhul; Pater, Joleen; Patricelli, Sergio; Pauly, Thilo; Pecsy, Martin; Pedraza Morales, Maria Isabel; Peleganchuk, Sergey; Peng, Haiping; Pengo, Ruggero; Penson, Alexander; Penwell, John; Perantoni, Marcelo; Perez, Kerstin; Perez Cavalcanti, Tiago; Perez Codina, Estel; Pérez García-Estañ, María Teresa; Perez Reale, Valeria; Perini, Laura; Pernegger, Heinz; Perrino, Roberto; Perrodo, Pascal; Persembe, Seda; Perus, Antoine; Peshekhonov, Vladimir; Peters, Krisztian; Petersen, Brian; Petersen, Jorgen; Petersen, Troels; Petit, Elisabeth; Petridis, Andreas; Petridou, Chariclia; Petrolo, Emilio; Petrucci, Fabrizio; Petschull, Dennis; Petteni, Michele; Pezoa, Raquel; Phan, Anna; Phillips, Peter William; Piacquadio, Giacinto; Piccaro, Elisa; Piccinini, Maurizio; Piec, Sebastian Marcin; Piegaia, Ricardo; Pignotti, David; Pilcher, James; Pilkington, Andrew; Pina, João Antonio; Pinamonti, Michele; Pinder, Alex; Pinfold, James; Ping, Jialun; Pinto, Belmiro; Pirotte, Olivier; Pizio, Caterina; Plamondon, Mathieu; Pleier, Marc-Andre; Pleskach, Anatoly; Poblaguev, Andrei; Poddar, Sahill; Podlyski, Fabrice; Poggioli, Luc; Poghosyan, Tatevik; Pohl, Martin; Polci, Francesco; Polesello, Giacomo; Policicchio, Antonio; Polini, Alessandro; Poll, James; Polychronakos, Venetios; Pomarede, Daniel Marc; Pomeroy, Daniel; Pommès, Kathy; Pontecorvo, Ludovico; Pope, Bernard; Popeneciu, Gabriel Alexandru; Popovic, Dragan; Poppleton, Alan; Portell Bueso, Xavier; Posch, Christoph; Pospelov, Guennady; Pospisil, Stanislav; Potrap, Igor; Potter, Christina; Potter, Christopher; Poulard, Gilbert; Poveda, Joaquin; Prabhu, Robindra; Pralavorio, Pascal; Pranko, Aliaksandr; Prasad, Srivas; Pravahan, Rishiraj; Prell, Soeren; Pretzl, Klaus Peter; Pribyl, Lukas; Price, Darren; Price, Joe; Price, Lawrence; Price, Michael John; Prieur, Damien; Primavera, Margherita; Prokofiev, Kirill; Prokoshin, Fedor; Protopopescu, Serban; Proudfoot, James; Prudent, Xavier; Przybycien, Mariusz; Przysiezniak, Helenka; Psoroulas, Serena; Ptacek, Elizabeth; Pueschel, Elisa; Purdham, John; Purohit, Milind; Puzo, Patrick; Pylypchenko, Yuriy; Qian, Jianming; Qian, Zuxuan; Qin, Zhonghua; Quadt, Arnulf; Quarrie, David; Quayle, William; Quinonez, Fernando; Raas, Marcel; Radescu, Voica; Radics, Balint; Radloff, Peter; Rador, Tonguc; Ragusa, Francesco; Rahal, Ghita; Rahimi, Amir; Rahm, David; Rajagopalan, Srinivasan; Rammensee, Michael; Rammes, Marcus; Randle-Conde, Aidan Sean; Randrianarivony, Koloina; Ratoff, Peter; Rauscher, Felix; Rave, Tobias Christian; Raymond, Michel; Read, Alexander Lincoln; Rebuzzi, Daniela; Redelbach, Andreas; Redlinger, George; Reece, Ryan; Reeves, Kendall; Reichold, Armin; Reinherz-Aronis, Erez; Reinsch, Andreas; Reisinger, Ingo; Rembser, Christoph; Ren, Zhongliang; Renaud, Adrien; Renkel, Peter; Rescigno, Marco; Resconi, Silvia; Resende, Bernardo; Reznicek, Pavel; Rezvani, Reyhaneh; Richards, Alexander; Richter, Robert; Richter-Was, Elzbieta; Ridel, Melissa; Rijpstra, Manouk; Rijssenbeek, Michael; Rimoldi, Adele; Rinaldi, Lorenzo; Rios, Ryan Randy; Riu, Imma; Rivoltella, Giancesare; Rizatdinova, Flera; Rizvi, Eram; Robertson, Steven; Robichaud-Veronneau, Andree; Robinson, Dave; Robinson, James; Robinson, Mary; Robson, Aidan; Rocha de Lima, Jose Guilherme; Roda, Chiara; Roda Dos Santos, Denis; Rodriguez, Diego; Roe, Adam; Roe, Shaun; Røhne, Ole; Rojo, Victoria; Rolli, Simona; Romaniouk, Anatoli; Romano, Marino; Romanov, Victor; Romeo, Gaston; Romero Adam, Elena; Roos, Lydia; Ros, Eduardo; Rosati, Stefano; Rosbach, Kilian; Rose, Anthony; Rose, Matthew; Rosenbaum, Gabriel; Rosenberg, Eli; Rosendahl, Peter Lundgaard; Rosenthal, Oliver; Rosselet, Laurent; Rossetti, Valerio; Rossi, Elvira; Rossi, Leonardo Paolo; Rotaru, Marina; Roth, Itamar; Rothberg, Joseph; Rousseau, David; Royon, Christophe; Rozanov, Alexander; Rozen, Yoram; Ruan, Xifeng; Rubinskiy, Igor; Ruckert, Benjamin; Ruckstuhl, Nicole; Rud, Viacheslav; Rudolph, Christian; Rudolph, Gerald; Rühr, Frederik; Ruggieri, Federico; Ruiz-Martinez, Aranzazu; Rumiantsev, Viktor; Rumyantsev, Leonid; Runge, Kay; Rurikova, Zuzana; Rusakovich, Nikolai; Rust, Dave; Rutherfoord, John; Ruwiedel, Christoph; Ruzicka, Pavel; Ryabov, Yury; Ryadovikov, Vasily; Ryan, Patrick; Rybar, Martin; Rybkin, Grigori; Ryder, Nick; Rzaeva, Sevda; Saavedra, Aldo; Sadeh, Iftach; Sadrozinski, Hartmut; Sadykov, Renat; Safai Tehrani, Francesco; Sakamoto, Hiroshi; Salamanna, Giuseppe; Salamon, Andrea; Saleem, Muhammad; Salihagic, Denis; Salnikov, Andrei; Salt, José; Salvachua Ferrando, Belén; Salvatore, Daniela; Salvatore, Pasquale Fabrizio; Salvucci, Antonio; Salzburger, Andreas; Sampsonidis, Dimitrios; Samset, Björn Hallvard; Sanchez, Arturo; Sanchez Martinez, Victoria; Sandaker, Heidi; Sander, Heinz Georg; Sanders, Michiel; Sandhoff, Marisa; Sandoval, Tanya; Sandoval, Carlos; Sandstroem, Rikard; Sandvoss, Stephan; Sankey, Dave; Sansoni, Andrea; Santamarina Rios, Cibran; Santoni, Claudio; Santonico, Rinaldo; Santos, Helena; Saraiva, João; Sarangi, Tapas; Sarkisyan-Grinbaum, Edward; Sarri, Francesca; Sartisohn, Georg; Sasaki, Osamu; Sasao, Noboru; Satsounkevitch, Igor; Sauvage, Gilles; Sauvan, Emmanuel; Sauvan, Jean-Baptiste; Savard, Pierre; Savinov, Vladimir; Savu, Dan Octavian; Sawyer, Lee; Saxon, David; Says, Louis-Pierre; Sbarra, Carla; Sbrizzi, Antonio; Scallon, Olivia; Scannicchio, Diana; Scarcella, Mark; Schaarschmidt, Jana; Schacht, Peter; Schäfer, Uli; Schaepe, Steffen; Schaetzel, Sebastian; Schaffer, Arthur; Schaile, Dorothee; Schamberger, R. Dean; Schamov, Andrey; Scharf, Veit; Schegelsky, Valery; Scheirich, Daniel; Schernau, Michael; Scherzer, Max; Schiavi, Carlo; Schieck, Jochen; Schioppa, Marco; Schlenker, Stefan; Schlereth, James; Schmidt, Evelyn; Schmieden, Kristof; Schmitt, Christian; Schmitt, Sebastian; Schmitz, Martin; Schöning, André; Schott, Matthias; Schouten, Doug; Schovancova, Jaroslava; Schram, Malachi; Schroeder, Christian; Schroer, Nicolai; Schuh, Silvia; Schuler, Georges; Schultens, Martin Johannes; Schultes, Joachim; Schultz-Coulon, Hans-Christian; Schulz, Holger; Schumacher, Jan; Schumacher, Markus; Schumm, Bruce; Schune, Philippe; Schwanenberger, Christian; Schwartzman, Ariel; Schwemling, Philippe; Schwienhorst, Reinhard; Schwierz, Rainer; Schwindling, Jerome; Schwindt, Thomas; Schwoerer, Maud; Scott, Bill; Searcy, Jacob; Sedov, George; Sedykh, Evgeny; Segura, Ester; Seidel, Sally; Seiden, Abraham; Seifert, Frank; Seixas, José; Sekhniaidze, Givi; Selbach, Karoline Elfriede; Seliverstov, Dmitry; Sellden, Bjoern; Sellers, Graham; Seman, Michal; Semprini-Cesari, Nicola; Serfon, Cedric; Serin, Laurent; Serkin, Leonid; Seuster, Rolf; Severini, Horst; Sevior, Martin; Sfyrla, Anna; Shabalina, Elizaveta; Shamim, Mansoora; Shan, Lianyou; Shank, James; Shao, Qi Tao; Shapiro, Marjorie; Shatalov, Pavel; Shaver, Leif; Shaw, Kate; Sherman, Daniel; Sherwood, Peter; Shibata, Akira; Shichi, Hideharu; Shimizu, Shima; Shimojima, Makoto; Shin, Taeksu; Shiyakova, Maria; Shmeleva, Alevtina; Shochet, Mel; Short, Daniel; Shrestha, Suyog; Shulga, Evgeny; Shupe, Michael; Sicho, Petr; Sidoti, Antonio; Siegert, Frank; Sijacki, Djordje; Silbert, Ohad; Silva, José; Silver, Yiftah; Silverstein, Daniel; Silverstein, Samuel; Simak, Vladislav; Simard, Olivier; Simic, Ljiljana; Simion, Stefan; Simmons, Brinick; Simonyan, Margar; Sinervo, Pekka; Sinev, Nikolai; Sipica, Valentin; Siragusa, Giovanni; Sircar, Anirvan; Sisakyan, Alexei; Sivoklokov, Serguei; Sjölin, Jörgen; Sjursen, Therese; Skinnari, Louise Anastasia; Skottowe, Hugh Philip; Skovpen, Kirill; Skubic, Patrick; Skvorodnev, Nikolai; Slater, Mark; Slavicek, Tomas; Sliwa, Krzysztof; Sloper, John erik; Smakhtin, Vladimir; Smart, Ben; Smirnov, Sergei; Smirnov, Yury; Smirnova, Lidia; Smirnova, Oxana; Smith, Ben Campbell; Smith, Douglas; Smith, Kenway; Smizanska, Maria; Smolek, Karel; Snesarev, Andrei; Snow, Steve; Snow, Joel; Snuverink, Jochem; Snyder, Scott; Soares, Mara; Sobie, Randall; Sodomka, Jaromir; Soffer, Abner; Solans, Carlos; Solar, Michael; Solc, Jaroslav; Soldatov, Evgeny; Soldevila, Urmila; Solfaroli Camillocci, Elena; Solodkov, Alexander; Solovyanov, Oleg; Soni, Nitesh; Sopko, Vit; Sopko, Bruno; Sosebee, Mark; Soualah, Rachik; Soukharev, Andrey; Spagnolo, Stefania; Spanò, Francesco; Spighi, Roberto; Spigo, Giancarlo; Spila, Federico; Spiwoks, Ralf; Spousta, Martin; Spreitzer, Teresa; Spurlock, Barry; St Denis, Richard Dante; Stahlman, Jonathan; Stamen, Rainer; Stanecka, Ewa; Stanek, Robert; Stanescu, Cristian; Stapnes, Steinar; Starchenko, Evgeny; Stark, Jan; Staroba, Pavel; Starovoitov, Pavel; Staude, Arnold; Stavina, Pavel; Stavropoulos, Georgios; Steele, Genevieve; Steinbach, Peter; Steinberg, Peter; Stekl, Ivan; Stelzer, Bernd; Stelzer, Harald Joerg; Stelzer-Chilton, Oliver; Stenzel, Hasko; Stern, Sebastian; Stevenson, Kyle; Stewart, Graeme; Stillings, Jan Andre; Stockton, Mark; Stoerig, Kathrin; Stoicea, Gabriel; Stonjek, Stefan; Strachota, Pavel; Stradling, Alden; Straessner, Arno; Strandberg, Jonas; Strandberg, Sara; Strandlie, Are; Strang, Michael; Strauss, Emanuel; Strauss, Michael; Strizenec, Pavol; Ströhmer, Raimund; Strom, David; Strong, John; Stroynowski, Ryszard; Strube, Jan; Stugu, Bjarne; Stumer, Iuliu; Stupak, John; Sturm, Philipp; Styles, Nicholas Adam; Soh, Dart-yin; Su, Dong; Subramania, Halasya Siva; Succurro, Antonella; Sugaya, Yorihito; Sugimoto, Takuya; Suhr, Chad; Suita, Koichi; Suk, Michal; Sulin, Vladimir; Sultansoy, Saleh; Sumida, Toshi; Sun, Xiaohu; Sundermann, Jan Erik; Suruliz, Kerim; Sushkov, Serge; Susinno, Giancarlo; Sutton, Mark; Suzuki, Yu; Suzuki, Yuta; Svatos, Michal; Sviridov, Yuri; Swedish, Stephen; Sykora, Ivan; Sykora, Tomas; Szeless, Balazs; Sánchez, Javier; Ta, Duc; Tackmann, Kerstin; Taffard, Anyes; Tafirout, Reda; Taiblum, Nimrod; Takahashi, Yuta; Takai, Helio; Takashima, Ryuichi; Takeda, Hiroshi; Takeshita, Tohru; Takubo, Yosuke; Talby, Mossadek; Talyshev, Alexey; Tamsett, Matthew; Tanaka, Junichi; Tanaka, Reisaburo; Tanaka, Satoshi; Tanaka, Shuji; Tanaka, Yoshito; Tanasijczuk, Andres Jorge; Tani, Kazutoshi; Tannoury, Nancy; Tappern, Geoffrey; Tapprogge, Stefan; Tardif, Dominique; Tarem, Shlomit; Tarrade, Fabien; Tartarelli, Giuseppe Francesco; Tas, Petr; Tasevsky, Marek; Tassi, Enrico; Tatarkhanov, Mous; Tayalati, Yahya; Taylor, Christopher; Taylor, Frank; Taylor, Geoffrey; Taylor, Wendy; Teinturier, Marthe; Teixeira Dias Castanheira, Matilde; Teixeira-Dias, Pedro; Temming, Kim Katrin; Ten Kate, Herman; Teng, Ping-Kun; Terada, Susumu; Terashi, Koji; Terron, Juan; Testa, Marianna; Teuscher, Richard; Thadome, Jocelyn; Therhaag, Jan; Theveneaux-Pelzer, Timothée; Thioye, Moustapha; Thoma, Sascha; Thomas, Juergen; Thompson, Emily; Thompson, Paul; Thompson, Peter; Thompson, Stan; Thomsen, Lotte Ansgaard; Thomson, Evelyn; Thomson, Mark; Thun, Rudolf; Tian, Feng; Tibbetts, Mark James; Tic, Tomáš; Tikhomirov, Vladimir; Tikhonov, Yury; Timoshenko, Sergey; Tipton, Paul; Tique Aires Viegas, Florbela De Jes; Tisserant, Sylvain; Toczek, Barbara; Todorov, Theodore; Todorova-Nova, Sharka; Toggerson, Brokk; Tojo, Junji; Tokár, Stanislav; Tokunaga, Kaoru; Tokushuku, Katsuo; Tollefson, Kirsten; Tomoto, Makoto; Tompkins, Lauren; Toms, Konstantin; Tong, Guoliang; Tonoyan, Arshak; Topfel, Cyril; Topilin, Nikolai; Torchiani, Ingo; Torrence, Eric; Torres, Heberth; Torró Pastor, Emma; Toth, Jozsef; Touchard, Francois; Tovey, Daniel; Trefzger, Thomas; Tremblet, Louis; Tricoli, Alesandro; Trigger, Isabel Marian; Trincaz-Duvoid, Sophie; Trinh, Thi Nguyet; Tripiana, Martin; Trischuk, William; Trivedi, Arjun; Trocmé, Benjamin; Troncon, Clara; Trottier-McDonald, Michel; Trzebinski, Maciej; Trzupek, Adam; Tsarouchas, Charilaos; Tseng, Jeffrey; Tsiakiris, Menelaos; Tsiareshka, Pavel; Tsionou, Dimitra; Tsipolitis, Georgios; Tsiskaridze, Vakhtang; Tskhadadze, Edisher; Tsukerman, Ilya; Tsulaia, Vakhtang; Tsung, Jieh-Wen; Tsuno, Soshi; Tsybychev, Dmitri; Tua, Alan; Tudorache, Alexandra; Tudorache, Valentina; Tuggle, Joseph; Turala, Michal; Turecek, Daniel; Turk Cakir, Ilkay; Turlay, Emmanuel; Turra, Ruggero; Tuts, Michael; Tykhonov, Andrii; Tylmad, Maja; Tyndel, Mike; Tzanakos, George; Uchida, Kirika; Ueda, Ikuo; Ueno, Ryuichi; Ugland, Maren; Uhlenbrock, Mathias; Uhrmacher, Michael; Ukegawa, Fumihiko; Unal, Guillaume; Underwood, David; Undrus, Alexander; Unel, Gokhan; Unno, Yoshinobu; Urbaniec, Dustin; Usai, Giulio; Uslenghi, Massimiliano; Vacavant, Laurent; Vacek, Vaclav; Vachon, Brigitte; Vahsen, Sven; Valenta, Jan; Valente, Paolo; Valentinetti, Sara; Valkar, Stefan; Valladolid Gallego, Eva; Vallecorsa, Sofia; Valls Ferrer, Juan Antonio; van der Graaf, Harry; van der Kraaij, Erik; Van Der Leeuw, Robin; van der Poel, Egge; van der Ster, Daniel; van Eldik, Niels; van Gemmeren, Peter; van Kesteren, Zdenko; van Vulpen, Ivo; Vanadia, Marco; Vandelli, Wainer; Vandoni, Giovanna; Vaniachine, Alexandre; Vankov, Peter; Vannucci, Francois; Varela Rodriguez, Fernando; Vari, Riccardo; Varnes, Erich; Varouchas, Dimitris; Vartapetian, Armen; Varvell, Kevin; Vassilakopoulos, Vassilios; Vazeille, Francois; Vegni, Guido; Veillet, Jean-Jacques; Vellidis, Constantine; Veloso, Filipe; Veness, Raymond; Veneziano, Stefano; Ventura, Andrea; Ventura, Daniel; Venturi, Manuela; Venturi, Nicola; Vercesi, Valerio; Verducci, Monica; Verkerke, Wouter; Vermeulen, Jos; Vest, Anja; Vetterli, Michel; Vichou, Irene; Vickey, Trevor; Vickey Boeriu, Oana Elena; Viehhauser, Georg; Viel, Simon; Villa, Mauro; Villaplana Perez, Miguel; Vilucchi, Elisabetta; Vincter, Manuella; Vinek, Elisabeth; Vinogradov, Vladimir; Virchaux, Marc; Virzi, Joseph; Vitells, Ofer; Viti, Michele; Vivarelli, Iacopo; Vives Vaque, Francesc; Vlachos, Sotirios; Vladoiu, Dan; Vlasak, Michal; Vlasov, Nikolai; Vogel, Adrian; Vokac, Petr; Volpi, Guido; Volpi, Matteo; Volpini, Giovanni; von der Schmitt, Hans; von Loeben, Joerg; von Radziewski, Holger; von Toerne, Eckhard; Vorobel, Vit; Vorobiev, Alexander; Vorwerk, Volker; Vos, Marcel; Voss, Rudiger; Voss, Thorsten Tobias; Vossebeld, Joost; Vranjes, Nenad; Vranjes Milosavljevic, Marija; Vrba, Vaclav; Vreeswijk, Marcel; Vu Anh, Tuan; Vuillermet, Raphael; Vukotic, Ilija; Wagner, Wolfgang; Wagner, Peter; Wahlen, Helmut; Wakabayashi, Jun; Walbersloh, Jorg; Walch, Shannon; Walder, James; Walker, Rodney; Walkowiak, Wolfgang; Wall, Richard; Waller, Peter; Wang, Chiho; Wang, Haichen; Wang, Hulin; Wang, Jike; Wang, Jin; Wang, Joshua C; Wang, Rui; Wang, Song-Ming; Warburton, Andreas; Ward, Patricia; Warsinsky, Markus; Watkins, Peter; Watson, Alan; Watson, Ian; Watson, Miriam; Watts, Gordon; Watts, Stephen; Waugh, Anthony; Waugh, Ben; Weber, Marc; Weber, Michele; Weber, Pavel; Weidberg, Anthony; Weigell, Philipp; Weingarten, Jens; Weiser, Christian; Wellenstein, Hermann; Wells, Phillippa; Wen, Mei; Wenaus, Torre; Wendler, Shanti; Weng, Zhili; Wengler, Thorsten; Wenig, Siegfried; Wermes, Norbert; Werner, Matthias; Werner, Per; Werth, Michael; Wessels, Martin; Weydert, Carole; Whalen, Kathleen; Wheeler-Ellis, Sarah Jane; Whitaker, Scott; White, Andrew; White, Martin; Whitehead, Samuel Robert; Whiteson, Daniel; Whittington, Denver; Wicek, Francois; Wicke, Daniel; Wickens, Fred; Wiedenmann, Werner; Wielers, Monika; Wienemann, Peter; Wiglesworth, Craig; Wiik-Fuchs, Liv Antje Mari; Wijeratne, Peter Alexander; Wildauer, Andreas; Wildt, Martin Andre; Wilhelm, Ivan; Wilkens, Henric George; Will, Jonas Zacharias; Williams, Eric; Williams, Hugh; Willis, William; Willocq, Stephane; Wilson, John; Wilson, Michael Galante; Wilson, Alan; Wingerter-Seez, Isabelle; Winkelmann, Stefan; Winklmeier, Frank; Wittgen, Matthias; Wolter, Marcin Wladyslaw; Wolters, Helmut; Wong, Wei-Cheng; Wooden, Gemma; Wosiek, Barbara; Wotschack, Jorg; Woudstra, Martin; Wozniak, Krzysztof; Wraight, Kenneth; Wright, Catherine; Wright, Michael; Wrona, Bozydar; Wu, Sau Lan; Wu, Xin; Wu, Yusheng; Wulf, Evan; Wunstorf, Renate; Wynne, Benjamin; Xella, Stefania; Xiao, Meng; Xie, Song; Xie, Yigang; Xu, Chao; Xu, Da; Xu, Guofa; Yabsley, Bruce; Yacoob, Sahal; Yamada, Miho; Yamaguchi, Hiroshi; Yamamoto, Akira; Yamamoto, Kyoko; Yamamoto, Shimpei; Yamamura, Taiki; Yamanaka, Takashi; Yamaoka, Jared; Yamazaki, Takayuki; Yamazaki, Yuji; Yan, Zhen; Yang, Haijun; Yang, Un-Ki; Yang, Yi; Yang, Yi; Yang, Zhaoyu; Yanush, Serguei; Yao, Yushu; Yasu, Yoshiji; Ybeles Smit, Gabriel Valentijn; Ye, Jingbo; Ye, Shuwei; Yilmaz, Metin; Yoosoofmiya, Reza; Yorita, Kohei; Yoshida, Riktura; Young, Charles; Youssef, Saul; Yu, Dantong; Yu, Jaehoon; Yu, Jie; Yuan, Li; Yurkewicz, Adam; Zabinski, Bartlomiej; Zaets, Vassilli; Zaidan, Remi; Zaitsev, Alexander; Zajacova, Zuzana; Zanello, Lucia; Zarzhitsky, Pavel; Zaytsev, Alexander; Zeitnitz, Christian; Zeller, Michael; Zeman, Martin; Zemla, Andrzej; Zendler, Carolin; Zenin, Oleg; Ženiš, Tibor; Zinonos, Zinonas; Zenz, Seth; Zerwas, Dirk; Zevi della Porta, Giovanni; Zhan, Zhichao; Zhang, Dongliang; Zhang, Huaqiao; Zhang, Jinlong; Zhang, Xueyao; Zhang, Zhiqing; Zhao, Long; Zhao, Tianchi; Zhao, Zhengguo; Zhemchugov, Alexey; Zheng, Shuchen; Zhong, Jiahang; Zhou, Bing; Zhou, Ning; Zhou, Yue; Zhu, Cheng Guang; Zhu, Hongbo; Zhu, Junjie; Zhu, Yingchun; Zhuang, Xuai; Zhuravlov, Vadym; Zieminska, Daria; Zimmermann, Robert; Zimmermann, Simone; Zimmermann, Stephanie; Ziolkowski, Michael; Zitoun, Robert; Živković, Lidija; Zmouchko, Viatcheslav; Zobernig, Georg; Zoccoli, Antonio; Zolnierowski, Yves; Zsenei, Andras; zur Nedden, Martin; Zutshi, Vishnu; Zwalinski, Lukasz

    2012-01-01

    The $\\chi_b$(nP) quarkonium states are produced in proton-proton collisions at the Large Hadron Collider (LHC) at $\\sqrt{s}$ = 7 TeV and recorded by the ATLAS detector. Using a data sample corresponding to an integrated luminosity of 4.4 fb$^{-1}$, these states are reconstructed through their radiative decays to $\\Upsilon$(1S,2S) with $\\Upsilon \\to \\mu^+ \\mu^-$. In addition to the mass peaks corresponding to the decay modes $\\chi_b(1P,2P) \\to \\Upsilon(1S)\\gamma$, a new structure centered at a mass of 10.539+/-0.004 (stat.)+/-0.008 (syst.) GeV is also observed, in both the $\\Upsilon(1S)\\gamma$ and $\\Upsilon(2S)\\gamma$ decay modes. This is interpreted as the $\\chi_b$(3P) system.

  4. Proton dissociative photoproduction of φ mesons in the H1-experiment

    International Nuclear Information System (INIS)

    Udluft, S.

    2000-05-01

    Proton-dissociative φ photoproduction (γp → φY) has been studied in ep interactions at HERA for photon-proton centre-of-mass energies in the range 35 2 , where t is the four-momentum transfer squared at the γφ vertex. The analysis is based upon data recorded in 1996 and 1999. An innovative neural-network second-level-trigger has been used to maintain high efficiency at acceptable background rate. The differential cross section dσ/dt has been measured at a mean centre-of-mass energy = 57 GeV by unfolding the observed p t 2 distribution of the φ-meson. It is in good agreement with an exponential fall off for vertical stroke t vertical stroke 2 . The slope parameter has been determined to b = 2.89 ± 0.10 (stat.) ± 0.29 (syst.) ± 0.29 (mod.) GeV -2 . The total cross section has been measured as σ = 0.46 ± 0.03 (stat.) ± 0.09 (sys.) ± 0.05 (mod.) μb. By splitting the data in three W bins and fitting a function b(W) = b 0 + 4α' ln W/W 0 , the slope of the Pomeron trajectory α' has been measured to 0.10 ± 0.08 GeV -2 , the intercept has been determined to α 0 = 1 + ε = 1.09 ± 0.08. A slow rise of the cross section with W has been observed. Fitting a function σ(W) ∝ W δ , δ results in 0.2 ± 0.2. The measurements establish the proton-dissociative production of φ-mesons to be a soft process. In the highest vertical stroke t vertical stroke range dσ/dt exceeds the exponential fall off and drops like dσ/dt ∝ vertical stroke t vertical stroke -3 , as predicted by pQCD. (orig.)

  5. Meson Spectroscopy in the Light Quark Sector

    Science.gov (United States)

    De Vita, R.

    2014-03-01

    Understanding the hadron spectrum is one of the fundamental issues in modern particle physics. We know that existing hadron configurations include baryons, made of three quarks, and mesons, made of quark-antiquark pairs. However most of the mass of the hadrons is not due to the mass of these elementary constituents but to their binding force. Studying the hadron spectrum is therefore a tool to understand one of the fundamental forces in nature, the strong force, and Quantum Chromo Dynamics (QCD), the theory that describes it. This investigation can provide an answer to fundamental questions as what is the origin of the mass of hadrons, what is the origin of quark confinement, what are the relevant degrees of freedom to describe these complex systems and how the transition between the elementary constituents, quarks and gluons, and baryons and mesons occurs. In this field a key tool is given by meson spectroscopy. Mesons, being made by a quark and an anti-quark, are the simplest quark bound system and therefore the ideal benchmark to study the interaction between quarks and understand what the role of gluons is. In this investigation, it is fundamental to precisely determine the spectrum and properties of mesons but also to search for possible unconventional states beyond the qbar q configuration as tetraquarks (qqoverline{qq}), hybrids (qbar qg) and glueballs. These states can be distinguished unambiguously from regular mesons when they have exotic quantum numbers, i.e. combinations of total angular momentum, spin and parity that are not allowed for qbar q states. These are called exotic quantum numbers and the corresponding states are referred to as exotics. The study of the meson spectrum and the search for exotics is among the goals of several experiments in the world that exploit different reaction processes, as e+e- annihilation, pbar p annihilation, pion scattering, proton-proton scattering and photo-production, to produce meson states. This intense effort is

  6. A randomized trial of tai chi for fibromyalgia.

    Science.gov (United States)

    Wang, Chenchen; Schmid, Christopher H; Rones, Ramel; Kalish, Robert; Yinh, Janeth; Goldenberg, Don L; Lee, Yoojin; McAlindon, Timothy

    2010-08-19

    Previous research has suggested that tai chi offers a therapeutic benefit in patients with fibromyalgia. We conducted a single-blind, randomized trial of classic Yang-style tai chi as compared with a control intervention consisting of wellness education and stretching for the treatment of fibromyalgia (defined by American College of Rheumatology 1990 criteria). Sessions lasted 60 minutes each and took place twice a week for 12 weeks for each of the study groups. The primary end point was a change in the Fibromyalgia Impact Questionnaire (FIQ) score (ranging from 0 to 100, with higher scores indicating more severe symptoms) at the end of 12 weeks. Secondary end points included summary scores on the physical and mental components of the Medical Outcomes Study 36-Item Short-Form Health Survey (SF-36). All assessments were repeated at 24 weeks to test the durability of the response. Of the 66 randomly assigned patients, the 33 in the tai chi group had clinically important improvements in the FIQ total score and quality of life. Mean (+/-SD) baseline and 12-week FIQ scores for the tai chi group were 62.9+/-15.5 and 35.1+/-18.8, respectively, versus 68.0+/-11 and 58.6+/-17.6, respectively, for the control group (change from baseline in the tai chi group vs. change from baseline in the control group, -18.4 points; Ptai chi group versus 28.0+/-7.8 and 29.4+/-7.4 for the control group (between-group difference, 7.1 points; P=0.001), and the mental-component scores were 42.6+/-12.2 and 50.3+/-10.2 for the tai chi group versus 37.8+/-10.5 and 39.4+/-11.9 for the control group (between-group difference, 6.1 points; P=0.03). Improvements were maintained at 24 weeks (between-group difference in the FIQ score, -18.3 points; PTai chi may be a useful treatment for fibromyalgia and merits long-term study in larger study populations. (Funded by the National Center for Complementary and Alternative Medicine and others; ClinicalTrials.gov number, NCT00515008.)

  7. New shapes of light-cone distributions of the transversely polarized ρ-mesons

    International Nuclear Information System (INIS)

    Bakulev, A.P.; Mikhajlov, S.V.

    2000-01-01

    The leading twist light-cone distributions for transversely polarized ρ-, ρ ' - and b 1 mesons are reanalyzed in the framework of QCD sum rules with nonlocal condensates. Using different kinds of sum rules to obtain reliable predictions, we estimate the 2-, 4-, 6- and 8-th moments for transversely polarized ρ- and ρ ' -meson distributions and reestimate tensor couplings f ρ,ρ ' ,b 1 T . It is stressed that the results of standard sum rules also support our estimation of the second moment of the transversely polarized ρ-meson distribution. New models for light-cone distributions are briefly discussed. Our results are compared with those found by Ball and Braun (1996), and the latter is shown to be incomplete

  8. Backward production of the B meson in K-p interactions at 4.2 GeV/c

    International Nuclear Information System (INIS)

    Gavillet, Ph.; Dionisi, C.; Gurtu, A.; Hemingway, R.J.; Losty, M.J.; Marin, J.C.; Mazzucato, M.; Montanet, L.; Pagiola, E.; Blokzijl, R.; Jongejans, B.; Kluyver, J.C.; Massaro, G.G.G.; Engelen, J.J.; Vergeest, J.S.M.; Zralek, M.; Foster, B.; Grossmann, P.; Wells, J.

    1978-01-01

    The backward production of the B(1235) meson is studied in the reaction K - p → Σ - π + ω. This reaction is observed in the final state Σ - π + π + π - π 0 . A π + ω mass enhancement is visible in the region of the B meson for events with small mod(u)(K - → Σ - ) squared four-momentum transfer. The properties of the enhancement agree with those of the B meson. The cross section for K - p → Σ - B + at 4.15 GeV/c incident K - momentum is (3.2 +- 0.5) μb. The backward production of the B meson is compared with similar baryon exchange productions of the A 1 and C(Q 1 ) axial vector mesons observed in the same experiment. (Auth.)

  9. Heavy quarks fragmentation in charmed mesons in DELPHI experiment at LEP; Etude de la fragmentation des quarks lourds en mesons charmes dans l`experience Delphi au LEP

    Energy Technology Data Exchange (ETDEWEB)

    Levy, J.M.

    1994-04-01

    With the big statistics expected at LEP, the electroweak sector of the Standard Model can be tested as well as the theory of strong interactions. Quantum Chromo-Dynamics is indeed predictive for quarks properties, but does not explain how quarks fragment into hadrons. So far the hadronization can only be described with phenomenological models. The work presented in this thesis was performed on the DELPHI experiment at LEP and concerns the production and the fragmentation of heavy quarks into charmed mesons D , D* and D**. With the whole statistics of 1991 and 1992 (1 013 300 hadronic decays of the Z), more than 4500 charmed mesons decays have been reconstructed in the channels D{sup 0}{yields} K{sup -} {pi}{sup +} , D{sup +}{yields} K{sup -} {pi}{sup +}{pi}+ and D{sup *}+{yields} D{sup 0}{pi}{sup +} followed by D{sup 0}{yields} K{sup -}{pi}{sup +} . Using also 1993 data and the channel D{sup 0}{yields} K{sup -}{pi}{sup +}{pi}{sup +}{pi}{sup -} , evidence for D** production is presented. For the first time, the production rate is measured for each D meson separately for cc and bb contributions. In fact, D mesons can be produced either directly from the fragmentation of c quark or un-directly from the fragmentation of b quark into B mesons which decay into D mesons. (authors). 120 refs.

  10. Relativistic meson spectroscopy in momentum space

    International Nuclear Information System (INIS)

    Hersbach, H.

    1994-01-01

    In this paper a relativistic constituent-quark model based on the Ruijgrok--de Groot formalism is presented. The quark model is not defined in configuration space, but in momentum space. The complete meson spectrum, with the exception of the self-conjugate light unflavored mesons, is calculated. The potential used consists of a one-gluon exchange (OGE) part and a confining part. For the confining part a relativistic generalization of the linear plus constant potential was used, which is well defined in momentum space without introducing any singularities. For the OGE part several potentials were investigated. Retardations were included at all places. By the use of a fitting procedure involving 52 well-established mesons, but results were obtained for a potential consisting of a purely vector Richardson potential and a purely scalar confining potential. Reasonable results were also obtained for a modified Richardson potential. Most meson masses, with the exception of the π, the K, and the K 0 * , were found to be quite well described by the model

  11. Tai chi and rheumatic diseases.

    Science.gov (United States)

    Wang, Chenchen

    2011-02-01

    Tai chi is a complex multicomponent mind-body exercise. Many studies have provided evidence that tai chi benefits patients with a variety of chronic disorders. This form of mind-body exercise enhances cardiovascular fitness, muscular strength, balance, and physical function and seems to be associated with reduced stress, anxiety, and depression and improved quality of life. Thus, despite certain limitations in the evidence, tai chi can be recommended to patients with osteoarthritis, rheumatoid arthritis, and fibromyalgia as a complementary and alternative medical approach. This article overviews the current knowledge about tai chi to better inform clinical decision making for rheumatic patients. Copyright © 2011 Elsevier Inc. All rights reserved.

  12. Leptonic decay of light vector mesons in an independent quark model

    International Nuclear Information System (INIS)

    Barik, N.; Dash, P.C.; Panda, A.R.

    1993-01-01

    Leptonic decay widths of light vector mesons are calculated in a framework based on the independent quark model with a scalar-vector harmonic potential. Assuming a strong correlation to exist between the quark-antiquark momenta inside the meson, so as to make their total momentum identically zero in the center-of-mass frame of the meson, we extract the quark and antiquark momentum distribution amplitudes from the bound quark eigenmode. Using the model parameters determined from earlier studies, we arrive at the leptonic decay widths of (ρ,ω,φ) as (6.26 keV, 0.67 keV, 1.58 keV) which are in very good agreement with the respective experimental data (6.77±0.32 keV, 0.6±0.02 keV, 1.37±0.05 keV)

  13. Characteristics of unnatural parity meson exchange term, and nonevasive component

    International Nuclear Information System (INIS)

    Bando, Masako

    1974-01-01

    The characteristics of scattering amplitude, which were found from the amplitude analysis of π (K)N scattering, are as follows. The Regge pole model of natural parity mesons is good for s dependence. The behavior of the imaginary part of the amplitude is stipulated by Δn(s channel net helicity flip). The phase is in agreement with Regge phase for Δn=1, but deviates for Δn=0. EXD is almost good except tensor meson exchange part. Relations such as Isub(t)=1 in case of /f sub(Δn=1)/>>/f sub(Δn=0)/, and Isub(t)=0 in case of /f sub(Δn=0)/>>/f sub(Δn=1)/ exist between the magnitudes of t channel exchanged quantum number and residue. The consistent theory for two body scattering amplitude has not yet been obtained. As examples, the processes Psub(s)B → VB (or Δ) and γN → Psub(s)B (or Δ) were analyzed, The s dependence and the t dependence of the cross section were investigated. The resonance amplitude for γN → Psub(s)B (or Δ) has been studied with resonance parameters. The position of dip and the coupling strength were found. These data resulted from the separation of natural parity meson exchange and unnatural parity meson exc