WorldWideScience

Sample records for chi square test

  1. Chi-squared goodness of fit tests with applications

    CERN Document Server

    Balakrishnan, N; Nikulin, MS

    2013-01-01

    Chi-Squared Goodness of Fit Tests with Applications provides a thorough and complete context for the theoretical basis and implementation of Pearson's monumental contribution and its wide applicability for chi-squared goodness of fit tests. The book is ideal for researchers and scientists conducting statistical analysis in processing of experimental data as well as to students and practitioners with a good mathematical background who use statistical methods. The historical context, especially Chapter 7, provides great insight into importance of this subject with an authoritative author team

  2. Chi-square goodness of fit tests for weighted histograms. Review and improvements

    International Nuclear Information System (INIS)

    Weighted histograms are used for the estimation of probability density functions. Computer simulation is the main domain of application of this type of histogram. A review of chi-square goodness of fit tests for weighted histograms is presented in this paper. Improvements are proposed to these tests that have size more close to its nominal value. Numerical examples are presented in this paper for evaluation of tests and to demonstrate various applications of tests

  3. Chi-Square Goodness-if-Fit Tests for Randomly Censored Data

    OpenAIRE

    Habib, M. G.; Thomas, D R

    1986-01-01

    Two Pearson-type goodness-of-fit test statistics for parametric families are considered for randomly right-censored data. Asymptotic distribution theory for the test statistics is based on the result that the product-limit process with MLE for nuisance parameters converges weakly to a Gaussian process. The Chernoff-Lehmann (1954) result extends to a generalized Pearson statistic. A modified Pearson statistic is shown to have a limiting chi-square null distribution.

  4. 改进卡方检验%A Modified Chi-Squared Goodness-of-Fit Test

    Institute of Scientific and Technical Information of China (English)

    戴家佳; 杨爱军

    2009-01-01

    In goodness-of-fit tests,Pearson's chi-squared test is one of most widely used tools of formal statistical analysis.However,Pearson's chi-squared test depends on the partition of the sample space.Different constructions of the partition of the sample space may lead to different conclusions.Based on an equiprobable partition of sample space,a modified chi-squared test is proposed.A method for constructing the modified chi-squared test is proposed.As an application,the proposed test is used to test whether vectorial data come from an uniformity distribution defined on the hypersphere.Some simulation studies show that the modified chi-squared test against different alternative is robust.

  5. Exact Chi-Square and Fisher's Exact Probability Test for 3 by 2 Cross-Classification Tables.

    Science.gov (United States)

    Berry, Kenneth J.; Mielke, Paul W., Jr.

    1987-01-01

    Subroutines to calculate exact chi square and Fisher's exact probability tests are presented for 3 by 2 cross-classification tables. A nondirectional probability value for each test is computed recursively. (Author/GDC)

  6. Use of the Chi-square Test to Determine Significance of Cumulative Antibiogram Data

    Directory of Open Access Journals (Sweden)

    Rocco J. Perla

    2005-01-01

    Full Text Available An important function of a hospital’s Infectious Disease and Pharmacy programs is to review and compare the most recent antibiogram with that of the previous year to determine if significant changes in antibiotic susceptibility results are noted and to communicate this information and its consequences to the medical staff. However, there are currently no formal analytical (decision-making models in use to determine if the rate of resistance to an antibiotic from one year to the next has significantly changed more or less than one would expect due to sampling error and test reliability. The purpose of this article, therefore, is to demonstrate the utility of using a well-established and simple nonparametric statistical technique (chi-square for analyzing annual variations in cumulative antibiogram data and to determine whether such variations are significantly different from chance and to what to degree. The chi-square model outlined here is a simple, practical, quick, low burden and easy to understand and execute approach that greatly improves the analysis of antibiogram data and decision-making by practitioners. More work and research is needed to develop additional inferential statistical methods and models that can be applied to antibiogram data.

  7. An Efficient Algorithm for Auto Upload and Chi - Square Test on Application Software

    Directory of Open Access Journals (Sweden)

    Sampada Kembhavi

    2013-06-01

    Full Text Available In this paper weproposed a novel algorithm for autouploading the data in the cloud environment withoutanylicense considerationand suggest a novelframework where data is auto upload after a properauthentication and processing their task (gatheringand sharing inthe cloudenvironment.Here wepresent the authenticationprocess with autouploading process.We also use the traditionalmethod of data uploading, data gathering andsharing.So that we compare our statistics. We useobject orientedprograming (OOP programsas adata which is used for data sharing and gathering.We use java programs for comparison.Thenweapply Chi-Square test, to test the hypothesis forcorrectness. Then we check the program capabilityunder three parameters; first is F-measure (FM,second is odds ratio (OR and third is power (PO.Based on the three parameters we can find the betterapplication software as a service approach. Basedon the above phenomena we can compare theexecutiontimein different operating applicationwith the help of software quality metrics

  8. Asymptotic Chi-Square Tests for a Large Class of Factor Analysis Models

    OpenAIRE

    Amemiya, Yasuo; Anderson, T W

    1990-01-01

    Three types of asymptotic $\\chi^2$ goodness-of-fit tests derived under the normal assumption have been used widely in factor analysis. Asymptotic behavior of the test statistics is investigated here for the factor analysis model with linearly or nonlinearly restricted factor loadings under weak assumptions on the factor vector and the error vector. In particular the limiting $\\chi^2$ result for the three tests is shown to hold for the factor vector, either fixed or random with any distributio...

  9. An Efficient Algorithm for Auto Upload and Chi-Square Test on Application Software

    Directory of Open Access Journals (Sweden)

    Sampada Kembhavi

    2013-06-01

    Full Text Available In this paper we proposed a novel algorithm for auto uploading the data in the cloud environment without any license consideration and suggest a novel framework where data is auto upload after a proper authentication and processing their task (gathering and sharing in the cloud environment. Here we present the authentication process with auto uploading process. We also use the traditional method of data uploading, data gathering and sharing. So that we compare our statistics. We use object oriented programing (OOP programs as a data which is used for data sharing and gathering. We use java programs for comparison. Then we apply Chi-Square test, to test the hypothesis for correctness. Then we check the program capability under three parameters; first is F-measure (FM, second is odds ratio (OR and third is power (PO. Based on the three parameters we can find the better application software as a service approach. Based on the above phenomena we can compare the execution time in different operating application with the help of software quality metrics.

  10. Measures of effect size for chi-squared and likelihood-ratio goodness-of-fit tests.

    Science.gov (United States)

    Johnston, Janis E; Berry, Kenneth J; Mielke, Paul W

    2006-10-01

    A fundamental shift in editorial policy for psychological journals was initiated when the fourth edition of the Publication Manual of the American Psychological Association (1994) placed emphasis on reporting measures of effect size. This paper presents measures of effect size for the chi-squared and the likelihood-ratio goodness-of-fit statistic tests. PMID:17165404

  11. Performance test of RM CLEAN and its evaluation with chi-square value

    Science.gov (United States)

    Miyashita, Yoshimitsu; Ideguchi, Shinsuke; Takahashi, Keitaro

    2016-06-01

    RM CLEAN is a standard method to reconstruct the distribution of cosmic magnetic fields and polarized sources along the line of sight (LOS) from the observed polarization spectrum. This method is similar to the CLEAN algorithm for aperture synthesis of radio telescope images but it is rather unclear in what cases RM CLEAN works well. In this paper, we evaluate the performance of RM CLEAN by simulating spectro-polarimetric observations of two compact sources located in the same LOS, varying the relative initial polarization angle and Faraday depth systematically. In particular, we focus on whether the two polarized sources can be resolved in the Faraday depth space and how well the source parameters can be estimated. We confirm the previous studies that two sources cannot be resolved when they are closely located in the Faraday depth space for specific values of the relative initial polarization angle. Further, we calculate the chi-square value for the fit between the mock polarization spectrum data and the one from RM CLEAN. We find that the chi-square value is not always significantly large even when RM CLEAN gives wrong results.

  12. Performance test of RM CLEAN and its evaluation with chi-square value

    Science.gov (United States)

    Miyashita, Yoshimitsu; Ideguchi, Shinsuke; Takahashi, Keitaro

    2016-04-01

    RM CLEAN is a standard method to reconstruct the distribution of cosmic magnetic fields and polarized sources along the line of sight (LOS) from the observed polarization spectrum. This method is similar to the CLEAN algorithm for aperture synthesis of radio telescope images but it is rather unclear in what cases RM CLEAN works well. In this paper, we evaluate the performance of RM CLEAN by simulating spectro-polarimetric observations of two compact sources located in the same LOS, varying the relative initial polarization angle and Faraday depth systematically. In particular, we focus on whether the two polarized sources can be resolved in the Faraday depth space and how well the source parameters can be estimated. We confirm the previous studies that two sources cannot be resolved when they are closely located in the Faraday depth space for specific values of the relative initial polarization angle. Further, we calculate the chi-square value for the fit between the mock polarization spectrum data and the one from RM CLEAN. We find that the chi-square value is not always significantly large even when RM CLEAN gives wrong results.

  13. F-Test Alternatives to Fisher's Exact Test and to the Chi-Square Test of Homogeneity in 2x2 Tables.

    Science.gov (United States)

    Overall, John E.; Starbuck, Robert R.

    1983-01-01

    An alternative to Fisher's exact test and the chi-square test for homogeneity in two-by-two tables is developed. The method provides for Type I error rates which are closer to the stated alpha level than either of the alternatives. (JKS)

  14. Performance test of RM CLEAN and its evaluation with chi-square value

    CERN Document Server

    Miyashita, Yoshimitsu; Takahashi, Keitaro

    2016-01-01

    RM CLEAN is a standard method to reconstruct the distribution of cosmic magnetic fields and polarized sources along the line of sight (LOS) from observed polarization spectrum. This method is similar to the CLEAN algorithm for aperture synthesis radio telescope images but it is rather unclear in what cases RM CLEAN works well. In this paper, we evaluate the performance of RM CLEAN by simulating spectro-polarimetric observations of two compact sources located in the same LOS, varying the relative initial polarization angle and Faraday depth systematically. Especially, we focus on if the two polarized sources can be resolved in the Faraday depth space and how well the source parameters can be estimated. We confirm the previous studies that two sources cannot be resolved when they are closely located in the Faraday depth space for specific values of the relative initial polarization angle. Further, we calculate the chi-square value for the fit between the mock data of polarization spectrum and the one from RM CL...

  15. A Simple Chi-Square Statistic for Testing Homogeneity of Zero-Inflated Distributions

    OpenAIRE

    Johnson, William D.; Burton, Jeffrey H.; Beyl, Robbie A.; Romer, Jacob E.

    2015-01-01

    Zero-inflated distributions are common in statistical problems where there is interest in testing homogeneity of two or more independent groups. Often, the underlying distribution that has an inflated number of zero-valued observations is asymmetric, and its functional form may not be known or easily characterized. In this case, comparisons of the groups in terms of their respective percentiles may be appropriate as these estimates are nonparametric and more robust to outliers and other irreg...

  16. Chi-squared and Associations in Tabular Audiology Data

    OpenAIRE

    Muhammad N. Anwar; Michael P. Oakes; Ken McGarry

    2010-01-01

    In this paper, we have used the chi-squared test and Yule’s Q measure to discover associations in tables of patient audiology data. These records are examples of heterogeneous medical records, since they contain audiograms, textual notes and typical relational fields. In our first experiment we used the chi-squared measure to discover associations between the different fields of audiology data such as patient gender and patient age with diagnosis. Then, in our second experiment we used Yule’s...

  17. Dos and don'ts of reduced chi-squared

    CERN Document Server

    Andrae, Rene; Melchior, Peter

    2010-01-01

    Reduced chi-squared is a very popular method for model assessment, model comparison, convergence diagnostic, and error estimation in astronomy. In this manuscript, we discuss the pitfalls involved in using reduced chi-squared. There are two independent problems: (a) The number of degrees of freedom can only be estimated for linear models. Concerning nonlinear models, the number of degrees of freedom is unknown, i.e., it is not possible to compute the value of reduced chi-squared. (b) Due to random noise in the data, also the value of reduced chi-squared itself is subject to noise, i.e., the value is uncertain. This uncertainty impairs the usefulness of reduced chi-squared for differentiating between models or assessing convergence of a minimisation procedure. The impact of noise on the value of reduced chi-squared is surprisingly large, in particular for small data sets, which are very common in astrophysical problems. We conclude that reduced chi-squared can only be used with due caution for linear models, w...

  18. A chi-square goodness-of-fit test for non-identically distributed random variables: with application to empirical Bayes

    International Nuclear Information System (INIS)

    When using parametric empirical Bayes estimation methods for estimating the binomial or Poisson parameter, the validity of the assumed beta or gamma conjugate prior distribution is an important diagnostic consideration. Chi-square goodness-of-fit tests of the beta or gamma prior hypothesis are developed for use when the binomial sample sizes or Poisson exposure times vary. Nine examples illustrate the application of the methods, using real data from such diverse applications as the loss of feedwater flow rates in nuclear power plants, the probability of failure to run on demand and the failure rates of the high pressure coolant injection systems at US commercial boiling water reactors, the probability of failure to run on demand of emergency diesel generators in US commercial nuclear power plants, the rate of failure of aircraft air conditioners, baseball batting averages, the probability of testing positive for toxoplasmosis, and the probability of tumors in rats. The tests are easily applied in practice by means of corresponding Mathematica reg-sign computer programs which are provided

  19. The Shape of the Noncentral Chi-square Density

    CERN Document Server

    Yu, Yaming

    2011-01-01

    A noncentral chi-square density is log-concave if the degree of freedom is nu>=2. We complement this known result by showing that, for each 00 such that the chi-square with nu degrees of freedom and noncentrality parameter lambda has a decreasing density if lambda <= lambda_nu, and is bi-modal otherwise. The critical lambda_nu is characterized by an equation involving a ratio of modified Bessel functions. When an interior mode exists we derive precise bounds on its location.

  20. A proposal for a different chi-square function for Poisson distributions

    OpenAIRE

    Almeida Jr., F. M. L.; Barbi, M; Vale, M. A. B. do

    1999-01-01

    We obtain an approximate Gaussian distribution from a Poisson distribution after doing a change of variable. A new chi-square function is obtained which can be used for parameter estimations and goodness-of-fit testing when adjusting curves to histograms. Since the new distribution is approximately Gaussian we can use it even when the bin contents are small. The corresponding chi-square function can be used for curve fitting. This chi-square function is simple to implement and presents a fast...

  1. The rate of convergence of some asymptotically chi-square distributed statistics by Stein's method

    OpenAIRE

    Gaunt, Robert E.; Reinert, Gesine

    2016-01-01

    We build on recent works on Stein's method for functions of multivariate normal random variables to derive bounds for the rate of convergence of some asymptotically chi-square distributed statistics. We obtain some general bounds and establish some simple sufficient conditions for convergence rates of order $n^{-1}$ for smooth test functions. These general bounds are applied to Friedman's statistic for comparing $r$ treatments across $n$ trials and the family of power divergence statistics fo...

  2. A proposal for a different chi-square function for Poisson distributions

    International Nuclear Information System (INIS)

    We obtain an approximate Gaussian distribution from a Poisson distribution after doing a change of variable. A new chi-square function is obtained which can be used for parameter estimations and goodness-of-fit testing when adjusting curves to histograms. Since, the new distribution is approximately Gaussian we can use it even when the bin contents are small. The corresponding chi-square function can be used for curve fitting. This chi-square function is simple to implement and presents a fast convergence of the parameters to the correct value, especially for the parameters associated with the width of the fitted curve. We present a Monte Carlo comparative study of the fitting method introduced here and two other methods for three types of curves: Gaussian, Breit-Wigner and Moyal, when each bin content obeys a Poisson distribution. It is also shown that the new method and the other two converge to the same result when the number of events increases

  3. Chi-square analysis of the reduction of ATP levels in L-02 hepatocytes by hexavalent chromium

    Directory of Open Access Journals (Sweden)

    Yang Yuan

    2012-06-01

    Full Text Available This study explored the reduction of adenosine triphosphate (ATP levels in L-02 hepatocytes by hexavalent chromium (Cr(VI using chi-square analysis. Cells were treated with 2, 4, 8, 16, or 32 μM Cr(VI for 12, 24, or 36 h. Methyl thiazolyl tetrazolium (MTT experiments and measurements of intracellular ATP levels were performed by spectrophotometry or bioluminescence assays following Cr(VI treatment. The chi-square test was used to determine the difference between cell survival rate and ATP levels. For the chi-square analysis, the results of the MTT or ATP experiments were transformed into a relative ratio with respect to the control (%. The relative ATP levels increased at 12 h, decreased at 24 h, and increased slightly again at 36 h following 4, 8, 16, 32 μM Cr(VI treatment, corresponding to a "V-shaped" curve. Furthermore, the results of the chi-square analysis demonstrated a significant difference of the ATP level in the 32-μM Cr(VI group (P < 0.05. The results suggest that the chi-square test can be applied to analyze the interference effects of Cr(VI on ATP levels in L-02 hepatocytes. The decreased ATP levels at 24 h indicated disruption of mitochondrial energy metabolism and the slight increase of ATP levels at 36 h indicated partial recovery of mitochondrial function or activated glycolysis in L-02 hepatocytes.

  4. Clarification of the use of chi-square and likelihood functions in fits to histograms

    International Nuclear Information System (INIS)

    We consider the problem of fitting curves to histograms in which the data obey multinomial or Poisson statistics. Techniques commonly used by physicists are examined in light of standard results found in the statistics literature. We review the relationship between multinomial and Poisson distributions, and clarify a sufficient condition for equality of the area under the fitted curve and the number of events on the histogram. Following the statisticians, we use the likelihood ratio test to construct a general Z2 statistic, Zsub(lambda)2, which yields parameter and error estimates identical to those of the method of maximum likelihood. The Zsub(lambda)2 statistic is further useful for testing goodness-of-fit since the value of its minimum asymptotically obeys a classical chi-square distribution. One should be aware, however, of the potential for statistical bias, especially when the number of events is small. (orig.)

  5. A Chi-Square Program for a Microcomputer Using a Tape Unit.

    Science.gov (United States)

    Dreger, Ralph Mason

    1979-01-01

    A program is described utilizing a microcomputer and tape drive with any contingency or chi-square table from 2x2 to 8x8. It requires only the entering of the number of rows and number of columns, plus one-time entry of cell frequencies. (Author/JKS)

  6. R by C Chi-Square Analysis with Small Expected Cell Frequencies.

    Science.gov (United States)

    Berry, Kenneth J.; Mielke, Paul W., Jr.

    1986-01-01

    A nonasymptotic Chi-Square analysis algorithm is presented to investigate r by c contingency tables where small expected cell frequencies render the usual asymptotic analysis inappropriate. A FORTRAN subroutine is provided for analyzing the tables having highly disproportionate or small marginal totals. (Author/GDC)

  7. Chi-square Fitting When Overall Normalization is a Fit Parameter

    CERN Document Server

    Roe, Byron

    2015-01-01

    The problem of fitting an event distribution when the total expected number of events is not fixed, keeps appearing in experimental studies. In a chi-square fit, if overall normalization is one of the parameters parameters to be fit, the fitted curve may be seriously low with respect to the data points, sometimes below all of them. This problem and the solution for it are well known within the statistics community, but, apparently, not well known among some of the physics community. The purpose of this note is didactic, to explain the cause of the problem and the easy and elegant solution. The solution is to use maximum likelihood instead of chi-square. The essential difference between the two approaches is that maximum likelihood uses the normalization of each term in the chi-square assuming it is a normal distribution, 1/sqrt(2 pi sigma-square). In addition, the normalization is applied to the theoretical expectation not to the data. In the present note we illustrate what goes wrong and how maximum likeliho...

  8. Chi Square Feature Extraction Based Svms Arabic Language Text Categorization System

    OpenAIRE

    Abdelwadood M.A. MESLEH

    2007-01-01

    This paper aims to implement a Support Vector Machines (SVMs) based text classification system for Arabic language articles. This classifier uses CHI square method as a feature selection method in the pre-processing step of the Text Classification system design procedure. Comparing to other classification methods, our system shows a high classification effectiveness for Arabic data set in term of F-measure (F=88.11).

  9. Reconstructing Chi-squared Intra-table Distances in the Analysis of a Set of Contingency Tables

    OpenAIRE

    Zárraga Castro, María Amaya; Goitisolo Lezama, Beatriz

    2007-01-01

    To study similarities among the set of rows -and columns- of a contingency table, Correspondence Analysis uses chi-squared distances between row profiles -and column profiles- of that table. This article presents a factor analysis for the study of a set of contingency tables in which, unlike more classical methods such as the analysis of juxtaposition and Intra Analysis; the existing relationships within each table -defined across the chi-squared distances-, are not altered.

  10. Landslide susceptibility mapping using decision-tree based CHi-squared automatic interaction detection (CHAID) and Logistic regression (LR) integration

    International Nuclear Information System (INIS)

    This article uses methodology based on chi-squared automatic interaction detection (CHAID), as a multivariate method that has an automatic classification capacity to analyse large numbers of landslide conditioning factors. This new algorithm was developed to overcome the subjectivity of the manual categorization of scale data of landslide conditioning factors, and to predict rainfall-induced susceptibility map in Kuala Lumpur city and surrounding areas using geographic information system (GIS). The main objective of this article is to use CHi-squared automatic interaction detection (CHAID) method to perform the best classification fit for each conditioning factor, then, combining it with logistic regression (LR). LR model was used to find the corresponding coefficients of best fitting function that assess the optimal terminal nodes. A cluster pattern of landslide locations was extracted in previous study using nearest neighbor index (NNI), which were then used to identify the clustered landslide locations range. Clustered locations were used as model training data with 14 landslide conditioning factors such as; topographic derived parameters, lithology, NDVI, land use and land cover maps. Pearson chi-squared value was used to find the best classification fit between the dependent variable and conditioning factors. Finally the relationship between conditioning factors were assessed and the landslide susceptibility map (LSM) was produced. An area under the curve (AUC) was used to test the model reliability and prediction capability with the training and validation landslide locations respectively. This study proved the efficiency and reliability of decision tree (DT) model in landslide susceptibility mapping. Also it provided a valuable scientific basis for spatial decision making in planning and urban management studies

  11. A chi-squared-transformed subspace of LBP histogram for visual recognition.

    Science.gov (United States)

    Ren, Jianfeng; Jiang, Xudong; Yuan, Junsong

    2015-06-01

    Local binary pattern (LBP) and its variants have been widely used in many recognition tasks. Subspace approaches are often applied to the LBP feature in order to remove unreliable dimensions, or to derive a compact feature representation. It is well-known that subspace approaches utilizing up to the second-order statistics are optimal only when the underlying distribution is Gaussian. However, due to its nonnegative and simplex constraints, the LBP feature deviates significantly from Gaussian distribution. To alleviate this problem, we propose a chi-squared transformation (CST) to transfer the LBP feature to a feature that fits better to Gaussian distribution. The proposed CST leads to the formulation of a two-class classification problem. Due to its asymmetric nature, we apply asymmetric principal component analysis (APCA) to better remove the unreliable dimensions in the CST feature space. The proposed CST-APCA is evaluated extensively on spatial LBP for face recognition, protein cellular classification, and spatial-temporal LBP for dynamic texture recognition. All experiments show that the proposed feature transformation significantly enhances the recognition accuracy. PMID:25769153

  12. Statistics of the Chi-Square Type, with Application to the Analysis of Multiple Time-Series Power Spectra

    CERN Document Server

    Sturrock, P A

    2003-01-01

    It is often necessary to compare the power spectra of two or more time series: one may, for instance, wish to estimate what the power spectrum of the combined data sets might have been, or one may wish to estimate the significance of a particular peak that shows up in two or more power spectra. Also, one may occasionally need to search for a complex of peaks in a single power spectrum, such as a fundamental and one or more harmonics, or a fundamental plus sidebands, etc. Visual inspection can be revealing, but it can also be misleading. This leads one to look for one or more ways of forming statistics, which readily lend themselves to significance estimation, from two or more power spectra. The familiar chi-square statistic provides a convenient mechanism for combining variables drawn from normal distributions, and one may generalize the chi-square statistic to be any function of any number of variables with arbitrary distributions. In dealing with power spectra, we are interested mainly in exponential distri...

  13. Chi 2 tests: how useful are they in the analysis of medical research data?

    Science.gov (United States)

    Osborn, J F

    1989-01-01

    This paper has outlined analyses of data for which the chi 2 test is commonly applied and has shown that on its own, a chi 2 test provides very little information about the interpretation of the data. In goodness to fit tests, at best, the chi 2 test is a mere first step in the interpretation of the data and much more information can be gleaned from the deviations between the observed and theoretical distributions, and graphical methods are more sensitive for assessing Normality. Similarly, the chi 2 test as the analysis of a 2 x 2 contingency table misses the most important features of the data. A chi 2 value and associated p value should not be presented without an estimation of the effect and its confidence interval. The use of NS, (not significant), after a chi 2 value (or any other test statistic) is particularly meaningless as it does not even specify a level of significance. The analysis of 2 x 2 contingency tables should specify a measure of the effect such as the difference between two proportions, their ratio or the odds ratio. Confidence intervals should be calculated and least importantly, statistical significance assessed by the Standard Normal Deviate. Chi 2 has no useful role to play in the analysis of 2 x 2 contingency tables. In fact, even with larger two dimensional tables, although chi 2 can be used to test the significance of associations between the rows and columns, such results are seldom of much interest as they give no indication of where in the table associations may exist. They are insensitive particularly if the categories of the row or column variables are quantitative since chi 2 takes no account of the ordering of the rows and columns. Although simple analyses of such tables are inefficient the advent of desk-top computers means that more sophisticated techniques such as logistic regression for proportions and Poisson regression for larger or multidimensional contingency tables can be applied. Although these methods may involve chi 2

  14. Testing the gravitational inverse-square law

    International Nuclear Information System (INIS)

    theorists seriously entertain the idea that there are actually six or seven additional spatial dimensions; these extra dimensions are needed to make the theory both mathematically consistent and capable of describing gravity. One of the big puzzles about gravity is the fact that it is so much weaker than the other forces: it is a factor of about 1040 times weaker than the electrostatic and magnetic forces. In 1998 three theorists - Nima Arkani-Hamed, Savas Dimopoulos and Gia Dvali - offered a bold explanation for this weakness (see further reading). Gravity appears weak, they said, because some of the extra dimensions predicted by string theory are surprisingly large compared with the Planck length. Even without large extra dimensions and fat gravitons, string theories contain many new and as yet unobserved particles. These include the dilaton (which is the partner of the graviton in string theory), the radion (which stabilizes the size of the extra dimensions) and various 'moduli' (particles that set the values of coupling strengths, particle masses and other parameters in the Standard Model). The quantum-mechanical exchange of these particles would lead to very strong, short-range forces that could show up in tests of the inverse-square law. Promising new techniques involving small oscillators and micro cantilevers are also being introduced to search for new physics hidden in the behaviour of gravity over short distances. Although these devices have not yet achieved the sensitivity of torsion pendulums, modern fabrication techniques allow them to be much smaller and stiffer. This suppresses the problems associated with seismic noise and alignment, and allows much smaller separations of the test masses to be explored. (U.K.)

  15. A Search for WIMP Dark Matter Using an Optimized Chi-square Technique on the Final Data from the Cryogenic Dark Matter Search Experiment (CDMS II)

    Energy Technology Data Exchange (ETDEWEB)

    Manungu Kiveni, Joseph [Syracuse Univ., NY (United States)

    2012-12-01

    This dissertation describes the results of a WIMP search using CDMS II data sets accumulated at the Soudan Underground Laboratory in Minnesota. Results from the original analysis of these data were published in 2009; two events were observed in the signal region with an expected leakage of 0.9 events. Further investigation revealed an issue with the ionization-pulse reconstruction algorithm leading to a software upgrade and a subsequent reanalysis of the data. As part of the reanalysis, I performed an advanced discrimination technique to better distinguish (potential) signal events from backgrounds using a 5-dimensional chi-square method. This dataanalysis technique combines the event information recorded for each WIMP-search event to derive a backgrounddiscrimination parameter capable of reducing the expected background to less than one event, while maintaining high efficiency for signal events. Furthermore, optimizing the cut positions of this 5-dimensional chi-square parameter for the 14 viable germanium detectors yields an improved expected sensitivity to WIMP interactions relative to previous CDMS results. This dissertation describes my improved (and optimized) discrimination technique and the results obtained from a blind application to the reanalyzed CDMS II WIMP-search data.

  16. Quantitative analysis of urban sprawl in Tripoli using Pearson's Chi-Square statistics and urban expansion intensity index

    Science.gov (United States)

    Al-sharif, Abubakr A. A.; Pradhan, Biswajeet; Zulhaidi Mohd Shafri, Helmi; Mansor, Shattri

    2014-06-01

    Urban expansion is a spatial phenomenon that reflects the increased level of importance of metropolises. The remotely sensed data and GIS have been widely used to study and analyze the process of urban expansions and their patterns. The capital of Libya (Tripoli) was selected to perform this study and to examine its urban growth patterns. Four satellite imageries of the study area in different dates (1984, 1996, 2002 and 2010) were used to conduct this research. The main goal of this work is identification and analyzes the urban sprawl of Tripoli metropolitan area. Urban expansion intensity index (UEII) and degree of freedom test were used to analyze and assess urban expansions in the area of study. The results show that Tripoli has sprawled urban expansion patterns; high urban expansion intensity index; and its urban development had high degree of freedom according to its urban expansion history during the time period (1984-2010). However, the novel proposed hypothesis used for zones division resulted in very good insight understanding of urban expansion direction and the effect of the distance from central business of district (CBD).

  17. Materials testing by electromagnetic square-wave oscillations

    Science.gov (United States)

    Lambeck, M.

    1981-09-01

    Two new methods for eddy-current inspection are presented. The information on the specimen is obtained by the easy measurement of self-excited square-wave oscillations. In thickness measurements the range from μm to mm is covered. Applications include the sorting of welding electrodes, the test of heat treatments and tube wall thicknesses.

  18. Sub-Millimeter Tests of the Newtonian Inverse Square Law

    International Nuclear Information System (INIS)

    It is remarkable that small-scale experiments can address important open issues in fundamental science such as: 'why is gravity so weak compared to the other interactions?' and 'why is the cosmological constant so small compared to the predictions of quantum mechanics?' String theory ideas (new scalar particles and extra dimensions) and other notions hint that Newton's Inverse-Square Law could break down at distances less than 1 mm. I will review some motivations for testing the Inverse-Square Law, and discuss recent mechanical experiments with torsion balances, small-scillators, micro-cantilevers, and ultra-cold neutrons. Our torsion-balance experiments have probed for gravitational-strength interactions with length scales down to 70 micrometers, which is approximately the diameter of a human hair.

  19. Spatial autocorrelation approaches to testing residuals from least squares regression

    CERN Document Server

    Chen, Yanguang

    2015-01-01

    In statistics, the Durbin-Watson test is always employed to detect the presence of serial correlation of residuals from a least squares regression analysis. However, the Durbin-Watson statistic is only suitable for ordered time or spatial series. If the variables comprise cross-sectional data coming from spatial random sampling, the Durbin-Watson will be ineffectual because the value of Durbin-Watson's statistic depends on the sequences of data point arrangement. Based on the ideas from spatial autocorrelation, this paper presents two new statistics for testing serial correlation of residuals from least squares regression based on spatial samples. By analogy with the new form of Moran's index, an autocorrelation coefficient is defined with a standardized residual vector and a normalized spatial weight matrix. Then on the analogy of the Durbin-Watson statistic, a serial correlation index is constructed. As a case, the two statistics are applied to the spatial sample of 29 China's regions. These results show th...

  20. Evaluating Outlier Identification Tests: Mahalanobis "D" Squared and Comrey "Dk."

    Science.gov (United States)

    Rasmussen, Jeffrey Lee

    1988-01-01

    A Monte Carlo simulation was used to compare the Mahalanobis "D" Squared and the Comrey "Dk" methods of detecting outliers in data sets. Under the conditions investigated, the "D" Squared technique was preferable as an outlier removal statistic. (SLD)

  1. Backtracking Based Integer Factorisation, Primality Testing and Square Root Calculation

    Directory of Open Access Journals (Sweden)

    Mohammed Golam Kaosar

    2014-02-01

    Full Text Available Breaking a big integer into two factors is a famous problem in the field of Mathematics and Cryptography for years. Many crypto-systems use suc h a big number as their key or part of a key with the assumption - it is too big that the fa stest factorisation algorithms running on the fastest computers would take impractically long per iod of time to factorise. Hence, many efforts have been provided to break those crypto-systems by finding two factors of an integer for decades. In this paper, a new factorisation techniq ue is proposed which is based on the concept of backtracking. Binary bit by bit operations are p erformed to find two factors of a given integer. This proposed solution can be applied in c omputing square root, primality test, finding prime factors of integer numbers etc. If the propos ed solution is proven to be efficient enough, it may break the security of many crypto-systems. Impl ementation and performance comparison of the technique is kept for future research.

  2. Stratospheric Assimilation of Chemical Tracer Observations Using a Kalman Filter. Pt. 2; Chi-Square Validated Results and Analysis of Variance and Correlation Dynamics

    Science.gov (United States)

    Menard, Richard; Chang, Lang-Ping

    1998-01-01

    A Kalman filter system designed for the assimilation of limb-sounding observations of stratospheric chemical tracers, which has four tunable covariance parameters, was developed in Part I (Menard et al. 1998) The assimilation results of CH4 observations from the Cryogenic Limb Array Etalon Sounder instrument (CLAES) and the Halogen Observation Experiment instrument (HALOE) on board of the Upper Atmosphere Research Satellite are described in this paper. A robust (chi)(sup 2) criterion, which provides a statistical validation of the forecast and observational error covariances, was used to estimate the tunable variance parameters of the system. In particular, an estimate of the model error variance was obtained. The effect of model error on the forecast error variance became critical after only three days of assimilation of CLAES observations, although it took 14 days of forecast to double the initial error variance. We further found that the model error due to numerical discretization as arising in the standard Kalman filter algorithm, is comparable in size to the physical model error due to wind and transport modeling errors together. Separate assimilations of CLAES and HALOE observations were compared to validate the state estimate away from the observed locations. A wave-breaking event that took place several thousands of kilometers away from the HALOE observation locations was well captured by the Kalman filter due to highly anisotropic forecast error correlations. The forecast error correlation in the assimilation of the CLAES observations was found to have a structure similar to that in pure forecast mode except for smaller length scales. Finally, we have conducted an analysis of the variance and correlation dynamics to determine their relative importance in chemical tracer assimilation problems. Results show that the optimality of a tracer assimilation system depends, for the most part, on having flow-dependent error correlation rather than on evolving the

  3. A null test of the inverse square law of gravitation

    International Nuclear Information System (INIS)

    There has recently been a revival of interest in the inverse square law of gravitation from both theoretical and experimental standpoints. The authors attempt to improve the empirical limits of validity for Newton's law on the laboratory and geological distance scales. A unique feature in their approach is the examination of the tensor nature of the local gravitational field as opposed to the measurement of a spatial dependence of the gravitational force as is done in conventional experiments. (Auth.)

  4. Quantitative analysis of urban sprawl in Tripoli using Pearson's Chi-Square statistics and urban expansion intensity index

    International Nuclear Information System (INIS)

    Urban expansion is a spatial phenomenon that reflects the increased level of importance of metropolises. The remotely sensed data and GIS have been widely used to study and analyze the process of urban expansions and their patterns. The capital of Libya (Tripoli) was selected to perform this study and to examine its urban growth patterns. Four satellite imageries of the study area in different dates (1984, 1996, 2002 and 2010) were used to conduct this research. The main goal of this work is identification and analyzes the urban sprawl of Tripoli metropolitan area. Urban expansion intensity index (UEII) and degree of freedom test were used to analyze and assess urban expansions in the area of study. The results show that Tripoli has sprawled urban expansion patterns; high urban expansion intensity index; and its urban development had high degree of freedom according to its urban expansion history during the time period (1984-2010). However, the novel proposed hypothesis used for zones division resulted in very good insight understanding of urban expansion direction and the effect of the distance from central business of district (CBD)

  5. Submillimeter tests of the gravitational inverse-square law

    International Nuclear Information System (INIS)

    Motivated by a variety of theories that predict new effects, we tested the gravitational 1/r2 law at separations between 10.77 mm and 137 μm using two different 10-fold azimuthally symmetric torsion pendulums and rotating 10-fold symmetric attractors. Our work improves upon other experiments by up to a factor of about 100. We found no deviation from Newtonian physics at the 95% confidence level and interpret these results as constraints on extensions of the standard model that predict Yukawa or power-law forces. We set a constraint on the largest single extra dimension (assuming toroidal compactification and that one extra dimension is significantly larger than all the others) of R*≤160 μm, and on two equal-sized large extra dimensions of R*≤130 μm. Yukawa interactions with |α|≥1 are ruled out at 95% confidence for λ≥197 μm. Extra-dimensions scenarios stabilized by radions are restricted to unification masses M*≥3.0 TeV/c2, regardless of the number of large extra dimensions. We also provide new constraints on power-law potentials V(r)∝r-k with k between 2 and 5 and on the γ5 couplings of pseudoscalars with m≤10 meV/c2

  6. The four square step test in children with Down syndrome: Reliability and concurrent validity

    OpenAIRE

    Ajai Verma; Asir John Samuel; Vencita Priyanka Aranha

    2014-01-01

    Purpose: To estimate test-retest reliability, inter-rater reliability and validation of a method for measuring balance by stepping over four squares, four square step test (FSST) in children with Down syndrome (DS). Methods: A sample of 13 children with DS was recruited for the cross-sectional study. They were asked to perform FSST and the time taken was noted. For estimating test-retest reliability, FSST was done by principal investigator twice and Inter-rater reliability was assessed by pri...

  7. Sample Size Calculation for Estimating or Testing a Nonzero Squared Multiple Correlation Coefficient

    Science.gov (United States)

    Krishnamoorthy, K.; Xia, Yanping

    2008-01-01

    The problems of hypothesis testing and interval estimation of the squared multiple correlation coefficient of a multivariate normal distribution are considered. It is shown that available one-sided tests are uniformly most powerful, and the one-sided confidence intervals are uniformly most accurate. An exact method of calculating sample size to…

  8. Tests of the gravitational inverse square law on a laboratory distance scale

    International Nuclear Information System (INIS)

    Although the validity of the Newtonian gravitational inverse square law is well established on a planetary distance scale, the possibility of deviation from 1/R2 behavior on a laboratory distance scale (1mm-1km) has been much discussed in recent years. This paper reviews some of the motivations for inverse square tests, and presents a short review of the experimental situation. Preliminary results of the authors' own most recent experiment, indicating that the variation of the gravitational force from 5 to 105 cm agrees with the Newtonian prediction to about 7 parts in 104. (Auth.)

  9. The Australian Square Kilometre Array Pathfinder: Performance of the Boolardy Engineering Test Array

    Science.gov (United States)

    McConnell, D.; Allison, J. R.; Bannister, K.; Bell, M. E.; Bignall, H. E.; Chippendale, A. P.; Edwards, P. G.; Harvey-Smith, L.; Hegarty, S.; Heywood, I.; Hotan, A. W.; Indermuehle, B. T.; Lenc, E.; Marvil, J.; Popping, A.; Raja, W.; Reynolds, J. E.; Sault, R. J.; Serra, P.; Voronkov, M. A.; Whiting, M.; Amy, S. W.; Axtens, P.; Ball, L.; Bateman, T. J.; Bock, D. C.-J.; Bolton, R.; Brodrick, D.; Brothers, M.; Brown, A. J.; Bunton, J. D.; Cheng, W.; Cornwell, T.; DeBoer, D.; Feain, I.; Gough, R.; Gupta, N.; Guzman, J. C.; Hampson, G. A.; Hay, S.; Hayman, D. B.; Hoyle, S.; Humphreys, B.; Jacka, C.; Jackson, C. A.; Jackson, S.; Jeganathan, K.; Joseph, J.; Koribalski, B. S.; Leach, M.; Lensson, E. S.; MacLeod, A.; Mackay, S.; Marquarding, M.; McClure-Griffiths, N. M.; Mirtschin, P.; Mitchell, D.; Neuhold, S.; Ng, A.; Norris, R.; Pearce, S.; Qiao, R. Y.; Schinckel, A. E. T.; Shields, M.; Shimwell, T. W.; Storey, M.; Troup, E.; Turner, B.; Tuthill, J.; Tzioumis, A.; Wark, R. M.; Westmeier, T.; Wilson, C.; Wilson, T.

    2016-09-01

    We describe the performance of the Boolardy Engineering Test Array, the prototype for the Australian Square Kilometre Array Pathfinder telescope. Boolardy Engineering Test Array is the first aperture synthesis radio telescope to use phased array feed technology, giving it the ability to electronically form up to nine dual-polarisation beams. We report the methods developed for forming and measuring the beams, and the adaptations that have been made to the traditional calibration and imaging procedures in order to allow BETA to function as a multi-beam aperture synthesis telescope. We describe the commissioning of the instrument and present details of Boolardy Engineering Test Array's performance: sensitivity, beam characteristics, polarimetric properties, and image quality. We summarise the astronomical science that it has produced and draw lessons from operating Boolardy Engineering Test Array that will be relevant to the commissioning and operation of the final Australian Square Kilometre Array Path telescope.

  10. The Australian Square Kilometre Array Pathfinder: System Architecture and Specifications of the Boolardy Engineering Test Array

    OpenAIRE

    Hotan, A. W.; Bunton, J. D.; Harvey-Smith, L.; Humphreys, B.; Jeffs, B. D.; Shimwell, T.; Tuthill, J.; Voronkov, M.; G. Allen; Amy, S.; Ardern, K.; Axtens, P.; Ball, L; Bannister, K.; Barker, S.

    2014-01-01

    This paper describes the system architecture of a newly constructed radio telescope - the Boolardy Engineering Test Array, which is a prototype of the Australian Square Kilometre Array Pathfinder telescope. Phased array feed technology is used to form multiple simultaneous beams per antenna, providing astronomers with unprecedented survey speed. The test array described here is a 6-antenna interferometer, fitted with prototype signal processing hardware capable of forming at least 9 dual-pola...

  11. The Australian Square Kilometre Array Pathfinder: System Architecture and Specifications of the Boolardy Engineering Test Array

    CERN Document Server

    Hotan, A W; Harvey-Smith, L; Humphreys, B; Jeffs, B D; Shimwell, T; Tuthill, J; Voronkov, M; Allen, G; Amy, S; Ardern, K; Axtens, P; Ball, L; Bannister, K; Barker, S; Bateman, T; Beresford, R; Bock, D; Bolton, R; Bowen, M; Boyle, B; Braun, R; Broadhurst, S; Brodrick, D; Brooks, K; Brothers, M; Brown, A; Cantrall, C; Carrad, G; Chapman, J; Cheng, W; Chippendale, A; Chung, Y; Cooray, F; Cornwell, T; Davis, E; de Souza, L; DeBoer, D; Diamond, P; Edwards, P; Ekers, R; Feain, I; Ferris, D; Forsyth, R; Gough, R; Grancea, A; Gupta, N; Guzman, JC; Hampson, G; Haskins, C; Hay, S; Hayman, D; Hoyle, S; Jacka, C; Jackson, C; Jackson, S; Jeganathan, K; Johnston, S; Joseph, J; Kendall, R; Kesteven, M; Kiraly, D; Koribalski, B; Leach, M; Lenc, E; Lensson, E; Li, L; Mackay, S; Macleod, A; Maher, T; Marquarding, M; McClure-Griffiths, N; McConnell, D; Mickle, S; Mirtschin, P; Norris, R; Neuhold, S; Ng, A; O'Sullivan, J; Pathikulangara, J; Pearce, S; Phillips, C; Qiao, RY; Reynolds, J E; Rispler, A; Roberts, P; Roxby, D; Schinckel, A; Shaw, R; Shields, M; Storey, M; Sweetnam, T; Troup, E; Turner, B; Tzioumis, A; Westmeier, T; Whiting, M; Wilson, C; Wilson, T; Wormnes, K; Wu, X

    2014-01-01

    This paper describes the system architecture of a newly constructed radio telescope - the Boolardy Engineering Test Array, which is a prototype of the Australian Square Kilometre Array Pathfinder telescope. Phased array feed technology is used to form multiple simultaneous beams per antenna, providing astronomers with unprecedented survey speed. The test array described here is a 6-antenna interferometer, fitted with prototype signal processing hardware capable of forming at least 9 dual-polarisation beams simultaneously, allowing several square degrees to be imaged in a single pointed observation. The main purpose of the test array is to develop beamforming and wide-field calibration methods for use with the full telescope, but it will also be capable of limited early science demonstrations.

  12. Tube vibration in industrial-size test heat exchanger (90/sup 0/ square layout)

    Energy Technology Data Exchange (ETDEWEB)

    Halle, H.; Wambsganss, M.W.

    1983-02-01

    Tube vibrations in heat exchangers are being systematically investigated in a series of tests performed with an industrial-size test exchanger. Results from waterflow tests of eleven different tube bundles, in six- and eight-crosspass configurations on a 90/sup 0/ square layout with a pitch-to-diameter ratio of 1.25 are reported. The test cases include full tube bundles, no-tubes-in-window bundles, finned tube bundles, and proposed field and design fixes. The testing focused on identification of the lowest critical flowrate to initiate fluidelastic instability (large amplitude tube motion) and the location within the bundle of the tubes which first experience instability. The test results are tabulated to permit comparison with results obtained from previous tests with a 30/sup 0/ triangular layout tube bundle. Instability criteria are evaluated preliminarily. Pressure drop data are also generated and reported.

  13. The Australian Square Kilometre Array Pathfinder: Performance of the Boolardy Engineering Test Array

    OpenAIRE

    McConnell, D.; J. R. Allison; Bannister, K.; Bell, M. E.; Bignall, H. E.; Chippendale, A. P.; Edwards, P. G.; Harvey-Smith, L.; Hegarty, S; Heywood, I.; Hotan, A. W.; Indermuehle, B. T.; Lenc, E.; Marvil, J.; Popping, A.

    2016-01-01

    We describe the performance of the Boolardy Engineering Test Array (BETA), the prototype for the Australian Square Kilometre Array Pathfinder telescope ASKAP. BETA is the first aperture synthesis radio telescope to use phased array feed technology, giving it the ability to electronically form up to nine dual-polarization beams. We report the methods developed for forming and measuring the beams, and the adaptations that have been made to the traditional calibration and imaging procedures in o...

  14. Test of Newton's inverse-square law in the Greenland ice cap

    International Nuclear Information System (INIS)

    An Airy-type geophysical experiment was conducted in a 2-km-deep hole in the Greenland ice cap at depths between 213 and 1673 m to test for possible violations of Newton's inverse-square law. An anomalous gravity gradient was observed. We cannot unambiguously attribute it to a breakdown of Newtonian gravity because we have shown that it might be due to unexpected geological features in the rock below the ice

  15. GOODNESS-OF-FIT TEST WITH GENETIC BACKGROUND

    Institute of Scientific and Technical Information of China (English)

    WU Jihua; XIE Minyu; PENG Rong; SUN Zhihua

    2005-01-01

    The chi-square test is a well-known goodness-of-fit test. It is available for arbitrary alternative hypothesis, particularly for a very general alternative. However, when the alternative is a "one-sided" hypothesis, which usually appears in genetic linkage analysis, the chi-square test does not use the information offered by the one-sided hypothesis.Therefore, it is possible that an appropriate one-sided test, which uses the information,will be better than the chi-square test. This paper gives such an efficient one-sided test.Monte Carlo simulation results show that it is more powerful than the chi-square test, and its power has been in creased by 30 percent as compared with that of the chi-square test inmost situations.

  16. A Note on the Nonparametric Least-squares Test for Checking a Polynomial Relationship

    Institute of Scientific and Technical Information of China (English)

    Chang-lin Mei; Shu-yuan He; Yan-hua Wang

    2003-01-01

    Recently, Gijbels and Rousson[6] suggested a new approach, called nonparametric least-squares test, to check polynomial regression relationships. Although this test procedure is not only simple but also powerful in most cases, there are several other parameters to be chosen in addition to the kernel and bandwidth.As shown in their paper, choice of these parameters is crucial but sometimes intractable. We propose in this paper a new statistic which is based on sample variance of the locally estimated pth derivative of the regression function at each design point. The resulting test is still simple but includes no extra parameters to be determined besides the kernel and bandwidth that are necessary for nonparametric smoothing techniques. Comparison by simulations demonstrates that our test performs as well as or even better than Gijbels and Rousson's approach.Furthermore, a real-life data set is analyzed by our method and the results obtained are satisfactory.

  17. Nonasymptotic Goodness-of-Fit Tests for Categorical Data.

    Science.gov (United States)

    Berry, Kenneth J.; Mielke, Paul W., Jr.

    1994-01-01

    A FORTRAN-77 subroutine is presented to calculate two test statistics for assessing goodness-of-fit in categorical data. The test statistic inferences are based on the exact first three cumulants of the Pearson chi-square statistic and a recently published modification of the Pearson chi-square statistic. (Author)

  18. A Cautionary Note on Using G[squared](dif) to Assess Relative Model Fit in Categorical Data Analysis

    Science.gov (United States)

    Maydeu-Olivares, Albert; Cai, Li

    2006-01-01

    The likelihood ratio test statistic G[squared](dif) is widely used for comparing the fit of nested models in categorical data analysis. In large samples, this statistic is distributed as a chi-square with degrees of freedom equal to the difference in degrees of freedom between the tested models, but only if the least restrictive model is correctly…

  19. The Australian Square Kilometre Array Pathfinder: Performance of the Boolardy Engineering Test Array

    CERN Document Server

    McConnell, D; Bannister, K; Bell, M E; Bignall, H E; Chippendale, A P; Edwards, P G; Harvey-Smith, L; Hegarty, S; Heywood, I; Hotan, A W; Indermuehle, B T; Lenc, E; Marvil, J; Popping, A; Raja, W; Reynolds, J E; Sault, R J; Serra, P; Voronkov, M A; Whiting, M; Amy, S W; Axtens, P; Ball, L; Bateman, T J; Bock, D C -J; Bolton, R; Brodrick, D; Brothers, M; Brown, A J; Bunton, J D; Cheng, W; Cornwell, T; DeBoer, D; Feain, I; Gough, R; Gupta, N; Guzman, J C; Hampson, G A; Hay, S; Hayman, D B; Hoyle, S; Humphreys, B; Jacka, C; Jackson, C A; Jackson, S; Jeganathan, K; Joseph, J; Koribalski, B S; Leach, M; Lensson, E S; MacLeod, A; Mackay, S; Marquarding, M; McClure-Griffiths, N M; Mirtschin, P; Mitchell, D; Neuhold, S; Ng, A; Norris, R; Pearce, S; Qiao, R Y; Schinckel, A E T; Shields, M; Shimwell, T W; Storey, M; Troup, E; Turner, B; Tuthill, J; Tzioumis, A; Wark, R M; Westmeier, T; Wilson, C; Wilson, T

    2016-01-01

    We describe the performance of the Boolardy Engineering Test Array (BETA), the prototype for the Australian Square Kilometre Array Pathfinder telescope ASKAP. BETA is the first aperture synthesis radio telescope to use phased array feed technology, giving it the ability to electronically form up to nine dual-polarization beams. We report the methods developed for forming and measuring the beams, and the adaptations that have been made to the traditional calibration and imaging procedures in order to allow BETA to function as a multi-beam aperture synthesis telescope. We describe the commissioning of the instrument and present details of BETA's performance: sensitivity, beam characteristics, polarimetric properties and image quality. We summarise the astronomical science that it has produced and draw lessons from operating BETA that will be relevant to the commissioning and operation of the final ASKAP telescope.

  20. Chi-Nu Level 2 Review

    Energy Technology Data Exchange (ETDEWEB)

    Haight, Robert Cameron [Los Alamos National Laboratory; Lee, Hye Young [Los Alamos National Laboratory; Mosby, Shea Morgan [Los Alamos National Laboratory; O' Donnell, John M. [Los Alamos National Laboratory; Solomon, Clell Jeffrey Jr. [Los Alamos National Laboratory; Taddeucci, Terry Nicholas [Los Alamos National Laboratory; Fotiadis, Nikolaos [Los Alamos National Laboratory; Devlin, Matthew James [Los Alamos National Laboratory; Ullmann, John Leonard [Los Alamos National Laboratory; Bredeweg, Todd Allen [Los Alamos National Laboratory; Jandel, Marian [Los Alamos National Laboratory; Nelson, Ronald Owen [Los Alamos National Laboratory; Wender, Stephen Arthur [Los Alamos National Laboratory; Neudecker, Denise [Los Alamos National Laboratory; Rising, Michael Evan [Los Alamos National Laboratory; White, Morgan Curtis [Los Alamos National Laboratory; Wu, Ching-Yen [Los Alamos National Laboratory; Bucher, Brian Michael [Los Alamos National Laboratory; Buckner, Matthew Quinn [Los Alamos National Laboratory; Henderson, Roger Alan [Los Alamos National Laboratory

    2015-09-18

    This series of slides presents information on Chi-Nu measurements and analysis of prompt fission neutron spectra (PFNS) for neutron energy below 1 MeV for 235U. A key focus of the Chi-Nu measurement is to address the energy dependence of the low-energy emissions. The 235U PFNS evaluation is in progress. Chi-Nu delivered preliminary experimental data and input for part of the old experimental data base. The 239Pu PFNS evaluation is finalized and submitted for testing. Data from 252Cf spontaneous fission will also be obtained.

  1. Null test of the gravitational inverse square law with a superconducting gravity gradiometer

    International Nuclear Information System (INIS)

    The single-axis portion of a three-axis superconducting gravity gradiometer has been completed in the course of this research. The theory of the superconducting gravity gradiometer has been generalized and put into a Lagrangian formulation. A condition for frequency-independent common mode balance combined with a multi-stage vibration isolation scheme has enabled a stable operation of the gradiometer for prolonged periods. In a preliminary test, the gradiometer has exhibited a noise level of 1-2 E Hz-/sup 1/2/ below 1 Hz, limited by seismic noise, where 1 E = 10-9 m s-2 m-1. To perform a test of the inverse square law, the single-axis gradiometer is mounted with its axis tilted from the vertial by an angle tan-1 √2. The device is then turned incrementally by 1200 around the vertical to carry the gradiometer from one axis to the other two axes of an orthogonal coordinate system. A lead pendulum weighing 1600 kg forms a periodic monopole source of gravity. The gradiometer outputs are individually time-averaged over 2000 s for each orientation of the gradients, and then are summed together. With somewhat crude metrology thus far, a preliminary test gives limits -0.012less than or equal toαless than or equal to0.036 for the coupling α of the nonNewtonian amplitude at the force rance μ-1 of 1 m, when the force law is written as phi(r) = -GM/r(1 + αe-/sup μr/). A few metrological corrections were made to account for errors induced in turning the single-axis detector into the three orientations

  2. Extending cosmological tests of General Relativity with the Square Kilometre Array

    CERN Document Server

    Bull, Philip

    2016-01-01

    Tests of general relativity (GR) are still in their infancy on cosmological scales, but forthcoming experiments promise to greatly improve their precision over a wide range of distance scales and redshifts. One such experiment, the Square Kilometre Array (SKA), will carry out several wide and deep surveys of resolved and unresolved neutral hydrogen (HI) 21cm line-emitting galaxies, mapping a significant fraction of the sky from $0 \\le z \\lesssim 6$. I present forecasts for the ability of a suite of possible SKA HI surveys to detect deviations from GR by reconstructing the cosmic expansion and growth history. SKA Phase 1 intensity mapping surveys can achieve sub-1% measurements of $f\\sigma_8$ out to $z\\approx 1$, with an SKA1-MID Band 2 survey out to $z \\lesssim 0.6$ able to surpass contemporary spectroscopic galaxy surveys such as DESI and Euclid in terms of constraints on modified gravity parameters if challenges such as foreground contamination can be tackled effectively. A more futuristic Phase 2 HI survey...

  3. Validation of Chinese Version of Polycystic Ovary Syndrome Health-Related Quality of Life Questionnaire (Chi-PCOSQ.

    Directory of Open Access Journals (Sweden)

    Chung-Ying Lin

    Full Text Available To evaluate the responsiveness, longitudinal validity, and measurement invariance of the Chinese version of the Polycystic Ovary Syndrome Health-related Quality of Life Questionnaire (Chi-PCOSQ.This prospective study was conducted in a medical center in southern Taiwan. 102 women aged 18-45 years and diagnosed with PCOS were enrolled. Objective indicators for clinical changes of PCOS included assessing the 2-hour glucose and insulin levels before and after treatment. The responsiveness of Chi-PCOSQ and WHOQOL-BREF was analyzed using paired t-tests and the standard response mean. Confirmatory factor analysis was performed to assess the measurement invariance of Chi-PCOSQ.With improved 2-hour glucose and insulin levels, we also found significantly increased Chi-PCOSQ total and individual domain scores (total score: t (49 = 5.20; p < 0.001, domain scores: t (49 = 2.72 to 3.87; p < 0.01, except for hair growth. Half of the domains scores (3 of 6 and the total score of Chi-PCOSQ had a medium responsiveness, but WHOQOL-BREF was not sufficiently responsive to clinical changes of PCOS. Improved PCOS-specific health-related quality of life (HRQoL, as indicated by Chi-PCOSQ scores, was significantly associated with improved 2-hour glucose and insulin levels. All indices of the data-model fit of the Chi-PCOSQ structure were satisfactory, except for the slightly high standardized root mean square residual values (0.087 to 0.088. The measurement invariance of Chi-PCOSQ was supported across time.Chi-PCOSQ is sufficiently sensitive in detecting clinical changes and its measurement structure is suitable for Chinese women with PCOS. It is thus a promising tool for assessing the HRQoL of ethnic Chinese women with PCOS.

  4. How to Test for Diagonalizability: The Discretized PT-Invariant Square-Well Potential

    OpenAIRE

    Weigert, Stefan

    2005-01-01

    Given a non-hermitean matrix M, the structure of its minimal polynomial encodes whether M is diagonalizable or not. This note will explain how to determine the minimal polynomial of a matrix without going through its characteristic polynomial. The approach is applied to a quantum mechanical particle moving in a square well under the influence of a piece-wise constant PT-symmetric potential. Upon discretizing the configuration space, the system is decribed by a matrix of dimension three. It tu...

  5. Experimental tests of the universality of free fall and of the inverse square law

    International Nuclear Information System (INIS)

    Recent suggestions of a ''fifth force'' have stimulated many experiments to search for new macroscopic interactions arising from the exchange of ultra-low mass fundamental bosons. The experiments fall into two categories: searches for violation of the inverse square law, or of the universality of free fall. The principles of both classes of experiments are described and their results are summarized. Because some groups claim positive effects considerably larger than the upper limits established by others, subtle systematic errors that could masquerade as a ''fifth force'' are briefly discussed. It is concluded that there is, at present, no credible evidence for new macroscopic interactions. (author)

  6. Fabrication end Deployment Testing of Meter Solar Sail Quadrants for a Scaleable Square Solar Sail Ground Test System

    Science.gov (United States)

    Laue, Greg; Case, David; Moore, Jim

    2005-01-01

    In order for solar sail propulsion technologies to be considered as a viable option for a wide range of near term practical missions a predictable, stable, reliable, manufactureable, scaleable, and cost effective system must be developed and tested first on earth and then on orbit. The design and development of a Scaleable Square Solar Sail System (S^4) is well underway a t AEC-Able Engineering Co. Inc., and the design and production of the Solar Sails for this system is being carried out by SRS Technologies. In April and May of 2004 a single quadrant 10-meter system was tested at NASA LARC's vacuum chamber and a four quadrant 20-meter system has been designed and built for deployment and testing in the Spring of 2005 at NASA/Glenn Research Center's Plumb Brook Facility. SRS has developed an effective and efficient design for triangular sail quadrants that are supported are three points and provide a flat reflective surface with a high fill factor. This sail design is robust enough for deployments in a one atmosphere, one gravity environment and incorporates several advanced features including adhesiveless seaming of membrane strips, compliant edge borders to allow for film membrane cord strain mismatch without causing wrinkling and low mass (3% of total sail mass) ripstop. This paper will outline the sail design and fabrication process, the lessons learned and the resulting mature production, packaging and deployment processes that have been developed. It will also highlight the scalability of the equipment and processes that were developed to fabricate and package the sails. Based on recent experience, SRS is confidant that flight worthy solar sails in the 40-120-meter size range with areal density in the 4-5g/sq m (sail minus structure) range can be produced with existing technology. Additional film production research will lead to further reductions in film thickness to less than 1 micron enabling production of sails with areal densities as low as 20 g/sq m

  7. Experimental tests of the gravitational inverse-square law for mass separations from 2 to 105 cm

    International Nuclear Information System (INIS)

    We report two experiments which test the inverse-square distance dependence of the Newtonian gravitational force law. One experiment uses a torsion balance consisting of a 60-cm-long copper bar suspended at its midpoint by a tungsten wire, to compare the torque produced by copper masses 105 cm from the balance axis with the torque produced by a copper mass 5 cm from the side of the balance bar, near its end. Defining R/sub expt/ to be the measured ratio of the torques due to the masses at 105 cm and 5 cm, and R/sub Newton/ to be the corresponding ratio computed assuming an inverse-square force law, we find deltaequivalent(R/sub expt//R/sub Newton/-1) = (1.2 +- 7) x 10-4. Assuming a force deviating from an inverse-square distance dependence by a factor [1+epsilon lnr(cm)], this result implies epsilon = (0.5 +- 2.7) x 10-4. An earlier experiment, which has been reported previously, is described here in detail. This experiment tested the inverse-square law over a distance range of approximately 2 to 5 cm, by probing the gravitational field inside a steel mass tube using a copper test mass suspended from the end of a torsion balance bar. This experiment yielded a value for the parameter epsilon defined above: epsilon = (1 +- 7) x 10-5. The results of both of these experiments are in good agreement with the Newton- ian prediction. Limits on the strength and range of a Yukawa potential term superimposed on the Newtonian gravitational potential are discussed

  8. How to Test for Diagonalizability: The Discretized PT-Invariant Square-Well Potential

    CERN Document Server

    Weigert, S

    2005-01-01

    Given a non-hermitean matrix M, the structure of its minimal polynomial encodes whether M is diagonalizable or not. This note will explain how to determine the minimal polynomial of a matrix without going through its characteristic polynomial. The approach is applied to a quantum mechanical particle moving in a square well under the influence of a piece-wise constant PT-symmetric potential. Upon discretizing the configuration space, the system is decribed by a matrix of dimension three. It turns out not to be diagonalizable for a critical strength of the interaction, also indicated by the transition of two real into a pair of complex energy eigenvalues. The systems develops a three-fold degenerate eigenvalue, and two of the three eigenfunctions disappear at this exceptional point, giving a difference between the algebraic and geometric multiplicity of the eigenvalue equal to two.

  9. Investigation of Dynamic Force/Vibration Transmission Characteristics of Four-Square Type Gear Durability Test Machines

    Science.gov (United States)

    Kahraman, Ahmet

    2002-01-01

    In this study, design requirements for a dynamically viable, four-square type gear test machine are investigated. Variations of four-square type gear test machines have been in use for durability and dynamics testing of both parallel- and cross-axis gear set. The basic layout of these machines is illustrated. The test rig is formed by two gear pairs, of the same reduction ratio, a test gear pair and a reaction gear pair, connected to each other through shafts of certain torsional flexibility to form an efficient, closed-loop system. A desired level of constant torque is input to the circuit through mechanical (a split coupling with a torque arm) or hydraulic (a hydraulic actuator) means. The system is then driven at any desired speed by a small DC motor. The main task in hand is the isolation of the test gear pair from the reaction gear pair under dynamic conditions. Any disturbances originated at the reaction gear mesh might potentially travel to the test gearbox, altering the dynamic loading conditions of the test gear mesh, and hence, influencing the outcome of the durability or dynamics test. Therefore, a proper design of connecting structures becomes a major priority. Also, equally important is the issue of how close the operating speed of the machine is to the resonant frequencies of the gear meshes. This study focuses on a detailed analysis of the current NASA Glenn Research Center gear pitting test machine for evaluation of its resonance and vibration isolation characteristics. A number of these machines as the one illustrated has been used over last 30 years to establish an extensive database regarding the influence of the gear materials, processes surface treatments and lubricants on gear durability. This study is intended to guide an optimum design of next generation test machines for the most desirable dynamic characteristics.

  10. New Test of the Gravitational Inverse-Square Law at the Submillimeter Range with Dual Modulation and Compensation

    Science.gov (United States)

    Tan, Wen-Hai; Yang, Shan-Qing; Shao, Cheng-Gang; Li, Jia; Du, An-Bin; Zhan, Bi-Fu; Wang, Qing-Lan; Luo, Peng-Shun; Tu, Liang-Cheng; Luo, Jun

    2016-04-01

    By using a torsion pendulum and a rotating eightfold symmetric attractor with dual modulation of both the interested signal and the gravitational calibration signal, a new test of the gravitational inverse-square law at separations down to 295 μ m is presented. A dual-compensation design by adding masses on both the pendulum and the attractor was adopted to realize a null experiment. The experimental result shows that, at a 95% confidence level, the gravitational inverse-square law holds (|α |≤1 ) down to a length scale λ =59 μ m . This work establishes the strongest bound on the magnitude α of Yukawa-type deviations from Newtonian gravity in the range of 70 - 300 μ m , and improves the previous bounds by up to a factor of 2 at the length scale λ ≈160 μ m .

  11. Validation of Chinese Version of Polycystic Ovary Syndrome Health-Related Quality of Life Questionnaire (Chi-PCOSQ)

    Science.gov (United States)

    Lin, Chung-Ying; Ou, Huang-tz; Wu, Meng-Hsing; Chen, Pei-Chi

    2016-01-01

    Objectives To evaluate the responsiveness, longitudinal validity, and measurement invariance of the Chinese version of the Polycystic Ovary Syndrome Health-related Quality of Life Questionnaire (Chi-PCOSQ). Research Design and Method This prospective study was conducted in a medical center in southern Taiwan. 102 women aged 18–45 years and diagnosed with PCOS were enrolled. Objective indicators for clinical changes of PCOS included assessing the 2-hour glucose and insulin levels before and after treatment. The responsiveness of Chi-PCOSQ and WHOQOL-BREF was analyzed using paired t-tests and the standard response mean. Confirmatory factor analysis was performed to assess the measurement invariance of Chi-PCOSQ. Results With improved 2-hour glucose and insulin levels, we also found significantly increased Chi-PCOSQ total and individual domain scores (total score: t (49) = 5.20; p PCOS. Improved PCOS-specific health-related quality of life (HRQoL), as indicated by Chi-PCOSQ scores, was significantly associated with improved 2-hour glucose and insulin levels. All indices of the data-model fit of the Chi-PCOSQ structure were satisfactory, except for the slightly high standardized root mean square residual values (0.087 to 0.088). The measurement invariance of Chi-PCOSQ was supported across time. Conclusion Chi-PCOSQ is sufficiently sensitive in detecting clinical changes and its measurement structure is suitable for Chinese women with PCOS. It is thus a promising tool for assessing the HRQoL of ethnic Chinese women with PCOS. PMID:27124836

  12. In-service inspection and testing of TAPS square fuel channels

    International Nuclear Information System (INIS)

    Tarapur Atomic Power Station is a twin unit Boiling Water Reactor. The initial each unit design was for 210 MWe. Subsequently due to Secondary Steam Generator tube leak problem, the units were de-rated to 160 MWe in the year 1985-86. Since then each unit is operating at 160 MWe. The station has completed 32 years of successful commercial operation. Presently each reactor is re-rated to 530 MWth. There are 284 fuel assemblies in each reactor. Each fuel assembly utilizes fuel channel made of Zircaloy-4 material. The fuel channel is a square tube and it surrounds the fuel bundle. The channel is secured to the fuel bundle by means of channel fastener assembly. The fuel channel length is 158.625 and wall thickness is 0.060. The fuel channel directs the coolant flow to fuel rods. It is also used as a guide for control blade movement inside the core. It provides for the structural stability of the fuel assembly. Initially during fabrication of the fuel channel, care is taken to control its dimensions very stringently by following quality assurance plan. However, once the channels are loaded into core along with fuel bundle, it undergoes dimensional changes due to neutron exposure. The fuel channels are monitored for its dimensions due to the neutron exposure and taken out of core at appropriate time. The paper prescribes the methodology adopted for inspecting the channels and the findings of the inspection. (author)

  13. A new field experiment in the Greenland ice cap to test Newton's inverse square law

    International Nuclear Information System (INIS)

    Recent experimental evidence suggests that Newton's law of gravity may not be precise. There are modern theories of quantum gravity that, in their attempts to unify gravity with other forces of nature, predict non-Newtonian gravitational forces that could have ranges on the order of 102--105 m. If they exist, these forces would be apparent as violations of Newton's inverse square law. A geophysical experiment was carried out to search for possible finite-range, non-Newtonian gravity over depths of 213--1673 m in the glacial ice of the Greenland ice cap. The principal reason for this choice of experimental site is that a hole drilled through the ice cap already existed and the uniformity of the ice eliminates one of the major sources of uncertainty arising in the first of earlier studies, namely, the heterogeneity of the rocks through which a mine shaft or drill hole passes. This paper presents observations made in the summer of 1987 at Dye 3, Greenland, in the 2033-m-deep borehole, which reached the basement rock

  14. GOODNESS-OF-FIT TEST ON TWO SAMPLES

    Institute of Scientific and Technical Information of China (English)

    WANG Lixin; YANG Zhenhai; PANG Wankai

    2000-01-01

    In this paper, a new statistics for testing two samples coming from the same population is derived from a simple linear model with an artificial parameter. Its limit distribution is a chi-squared distribution with 2 degrees of freedom under null hypothesis and the limit distribution is a noncentral chi-squared distribution with 2 degrees of freedom under certain sequence of alternative hypothesis. Finally, we make power comparison with other tests on two samples, especially, with Smirnov statistics.

  15. Multilocus association testing of quantitative traits based on partial least-squares analysis.

    Directory of Open Access Journals (Sweden)

    Feng Zhang

    Full Text Available Because of combining the genetic information of multiple loci, multilocus association studies (MLAS are expected to be more powerful than single locus association studies (SLAS in disease genes mapping. However, some researchers found that MLAS had similar or reduced power relative to SLAS, which was partly attributed to the increased degrees of freedom (dfs in MLAS. Based on partial least-squares (PLS analysis, we develop a MLAS approach, while avoiding large dfs in MLAS. In this approach, genotypes are first decomposed into the PLS components that not only capture majority of the genetic information of multiple loci, but also are relevant for target traits. The extracted PLS components are then regressed on target traits to detect association under multilinear regression. Simulation study based on real data from the HapMap project were used to assess the performance of our PLS-based MLAS as well as other popular multilinear regression-based MLAS approaches under various scenarios, considering genetic effects and linkage disequilibrium structure of candidate genetic regions. Using PLS-based MLAS approach, we conducted a genome-wide MLAS of lean body mass, and compared it with our previous genome-wide SLAS of lean body mass. Simulations and real data analyses results support the improved power of our PLS-based MLAS in disease genes mapping relative to other three MLAS approaches investigated in this study. We aim to provide an effective and powerful MLAS approach, which may help to overcome the limitations of SLAS in disease genes mapping.

  16. Model Waveform Accuracy Requirements for the $\\chi^2$ Discriminator

    CERN Document Server

    Lindblom, Lee

    2016-01-01

    This paper derives accuracy standards for model gravitational waveforms required to ensure proper use of the $\\chi^2$ discriminator test in gravitational wave (GW) data analysis. These standards are different from previously established requirements for detection and waveform parameter measurement based on signal-to-noise optimization. We present convenient formulae both for evaluating and interpreting the contribution of model errors to measured $\\chi^2$ values. Motivated by these formula, we also present an enhanced, complexified variant of the standard $\\chi^2$ statistic used in GW searches. While our results are not directly relevant to current searches (which use the $\\chi^2$ test only to veto signal candidates with extremely high $\\chi^2$ values), they could be useful in future GW searches and as figures of merit for model gravitational waveforms.

  17. Digital squares

    DEFF Research Database (Denmark)

    Forchhammer, Søren; Kim, Chul E

    1988-01-01

    Digital squares are defined and their geometric properties characterized. A linear time algorithm is presented that considers a convex digital region and determines whether or not it is a digital square. The algorithm also determines the range of the values of the parameter set of its preimages. ....... The analysis involves transforming the boundary of a digital region into parameter space of slope and y-intercept......Digital squares are defined and their geometric properties characterized. A linear time algorithm is presented that considers a convex digital region and determines whether or not it is a digital square. The algorithm also determines the range of the values of the parameter set of its preimages...

  18. Square baler field test under different sugar cane crop residue conditions

    Energy Technology Data Exchange (ETDEWEB)

    Mello, Arthur Miola de; Ripoli, Tomaz Caetano Cannavan; Gadanha Junior, Casimiro [Escola Superior de Agricultura Luiz de Queiroz (ESALQ-USP), Piracicaba (Brazil). Dept. de Engenharia Rural], E-mail: ammello@esalq.usp.br; Ripoli, Marco Lorezzo Cunali [John Deere, Ribeirao Preto, SP (Brazil)

    2008-07-01

    The energy demand increase of the country allows the sugar cane business sector to be a major player in production and commercialization areas of electric energy using cogeneration powered by bagasse and sugar cane residues. The objective of the study was to evaluate some of the performance parameters of an Express 5040 baler, brand Nogueira, used to collect residues. The tests were conducted in a sugar cane mechanized harvest area. The baler was submitted to three different conditions of residues windrowing: 'in natura', under single and double raking operations. For all treatments soil sampling analyzes were done to find out ground homogeneity conditions were the test took place. The simple raking operation offered better conditions for the machine: Effective Capacity of 8.21 t.{sup h}-{sup 1} and 0.88 ha.h{sup -1}; average bale weight of 22.33 kg (SD=3.58, CV=16.01 %); costs of 7.45 R$.t{sup -1} of baled residue; 0.17 R$.fardo{sup -1} and 69.47 R$.ha{sup -1}. (author)

  19. Square Root +

    Science.gov (United States)

    Frederiksen, John G.

    1969-01-01

    A rational presentation of the so-called long division method for extracting the square root of a number. Diagrams are used to show relationship of this technique to the binomial theorem. Presentation exposes student to many facets of mathematics in addition to the mechanics of funding square root and cube root. Geometry, algebraic statements,…

  20. Economic-statistical design of variable parameters non-central chi-square control chart Projeto econômico-estatístico de gráficos de controle qui-quadrado não-central com parâmetros variáveis

    Directory of Open Access Journals (Sweden)

    Maysa Sacramento de Magalhães

    2011-06-01

    Full Text Available Production processes are monitored by control charts since their inception by Shewhart (1924. This surveillance is useful in improving the production process due to increased stabilization of the process, and consequently standardization of the output. Control charts keep track of a few key quality characteristics of the outcome of the production process. This is done by means of univariate or multivariate charts. Small improvements in control chart methodology can have significant economic impact in the production process. In this investigation, we propose the monitoring of a single variable by means of a variable parameter non-central chi-square control chart. The design of the chart is accomplished by means of optimizing a cost function. We use here a simulated annealing optimization tool, due to the difficulty of classical gradient based optimization techniques to handle the optimization of the cost function. The results show some of the drawbacks of using this model.Processos de produção são monitorados por gráficos de controle desde a sua introdução por Shewhart (1924. Este monitoramento é útil na melhoria do processo de produção devido à crescente estabilização do processo, e consequentemente, padronização do produto. Gráficos de controle mantêm vigilância de características de qualidade de um processo de produção. Isto é feito por intermédio de gráficos univariados ou multivariados. Melhorias na metodologia de gráficos de controle podem levar a um impacto econômico significativo no processo de produção. Neste artigo, propomos um gráfico de controle de parâmetros variáveis baseado na estatística qui-quadrado nãocentral para monitorar uma característica de qualidade de interesse. O projeto do gráfico é realizado através da otimização de uma função custo. O algoritmo simulated annealing é usado devido à dificuldade dos métodos clássicos de otimização baseados no gradiente, de lidarem com a

  1. Rolling Squares

    Science.gov (United States)

    Holton, Derek; Knights, Carol

    2008-01-01

    Here, we investigate what loci are produced when a square of side-length one is allowed to rotate around a square of side-length n, where n is a whole number. We find that if i = 1, 2, 3 or 4 (mod 4), the loci obtained for n [congruent to] i (mod 4) all have the same symmetry and we show how the perimeter of each class can be determined. We also…

  2. Creating Magic Squares.

    Science.gov (United States)

    Lyon, Betty Clayton

    1990-01-01

    One method of making magic squares using a prolongated square is illustrated. Discussed are third-order magic squares, fractional magic squares, fifth-order magic squares, decimal magic squares, and even magic squares. (CW)

  3. CHY formula and MHV amplitudes

    CERN Document Server

    Du, Yi-jian; Wu, Yong-shi

    2016-01-01

    In this paper, we study the relation between the Cachazo-He-Yuan (CHY) formula and the maximal-helicity-violating (MHV) amplitudes of Yang-Mills and gravity in four dimensions. We prove that only one special rational solution of the scattering equations found by Weinzierl support the MHV amplitudes. Namely, localized at this solution, the integrated CHY formula reproduces the Parke-Taylor formula for Yang-Mills amplitudes as well as the Hodges formula for gravitational amplitudes. This is achieved by developing techniques, in a manifestly M\\"obius covariant formalism, to explicitly compute relevant reduced Pfaffians/determinants. We observe and prove two interesting properties (or identities), which facilitate the computations. We also check that all the other $(n-3)!-1$ solutions to the scattering equations do not support the MHV amplitudes, and prove analytically that this is indeed true for the other special rational solution proposed by Weinzierl, that actually supports the anti-MHV amplitudes.

  4. The CHI 2013 interactive schedule

    DEFF Research Database (Denmark)

    Satyanarayan, Arvind; Strazzulla, Daniel; Klokmose, Clemens Nylandsted;

    2013-01-01

    available. The CHI'13 Interactive Schedule helps attendees navigate this wealth of video content in order to identify events they would like to attend. It consists of a number of large display screens throughout the conference venue which cycle through a video playlist of events. Attendees can interact with...... these displays using their mobile devices by either constructing custom video playlists or adding on-screen content to their personal schedule....

  5. CHY formula and MHV amplitudes

    Science.gov (United States)

    Du, Yi-Jian; Teng, Fei; Wu, Yong-Shi

    2016-05-01

    In this paper, we study the relation between the Cachazo-He-Yuan (CHY) formula and the maximal-helicity-violating (MHV) amplitudes of Yang-Mills and gravity in four dimensions. We prove that only one special rational solution of the scattering equations found by Weinzierl supports the MHV amplitudes. Namely, localized at this solution, the integrated CHY formula produces the Parke-Taylor formula for MHV Yang-Mills amplitudes as well as the Hodges formula for MHV gravitational amplitudes, with an arbitrary number of external gluons/gravitons. This is achieved by developing techniques, in a manifestly Möbius covariant formalism, to explicitly compute relevant reduced Pfaffians/determinants. We observe and prove two interesting properties (or identities), which facilitate the computations. We also check that all the other ( n - 3)! - 1 solutions to the scattering equations do not support the MHV amplitudes, and prove analytically that this is indeed true for the other special rational solution proposed by Weinzierl, that actually supports the anti-MHV amplitudes. Our results reveal a mysterious feature of the CHY formalism that in Yang-Mills and gravity theory, solutions of scattering equations, involving only external momenta, somehow know about the configuration of external polarizations of the scattering amplitudes.

  6. A novel variable-distance antenna test range and high spatial resolution corroboration of the inverse square law for 433.5 MHz radiation

    CERN Document Server

    de Haën, Christoph; Erhardt, Matthias

    2015-01-01

    A novel, low-budget, open-air, slant-geometry antenna test range for UHF radiation is presented. It was designed primarily to facilitate variation of the distance between emitter and receiver antennas, but has also the potential for adaptation to simultaneous variation of distance and receiver antenna orientation. In support of the validity of the range the inverse square law for 433.5 MHz radiation between two naked half-wave dipole antennas was tested with high spatial resolution from close to the far field limit outward to 46 wavelengths. Sine amplitude input voltage at the receiver antenna varied with the distance to the power -0.9970 +/- 0.0051 (R^2 = 0.992), thus corroborating the inverse square law for transmission power at the lowest frequency for which thus far data have been published. Keywords: inverse square law; dipole antenna; test facility; electromagnetic propagation; UHF measurements; distance dependence.

  7. Democracy Squared

    DEFF Research Database (Denmark)

    Rose, Jeremy; Sæbø, Øystein

    2005-01-01

    On-line political communities, such as the Norwegian site Demokratitorget (Democracy Square), are often designed according to a set of un-reflected assumptions about the political interests of their potential members. In political science, democracy is not taken as given in this way, but can be...... represented by different models which characterize different relationships between politicians and the citizens they represent. This paper uses quantitative and qualitative content analysis to analyze the communication mediated by the Democracy Square discussion forum in the first ten months of its life. In...... the quantitative analysis, citizens’ and politicians’ contributions are analyzed against four different democracy models: Consumer, Demo-Elitist, Neo-Republican and Cyber-Democratic. Whereas politicians’ contributions mainly reflected the Demo-Elitist model, citizens’ contributions tended to reflect...

  8. All SQUARE

    CERN Multimedia

    1972-01-01

    With the existing Systems for using the accelerated protons, it is possible to supply only one slow ejected beam (feeding the East Hall) and, at the same time, to have only a small percentage of the beam on an internal target (feeding the South Hall). The arrangement will be replaced by a new System called SQUARE (Semi- QUAdrupole Resonant Extraction) which will give greater flexibility in supplying the three areas.

  9. Tai Chi: Rx for Arthritic Knees

    Science.gov (United States)

    ... that tai chi can be effective in helping sleep, while reducing stress, anxiety and depression. "The mind component [of tai chi] promotes psychological well-being, life satisfaction, and improved perceptions of health," said Wang. Dr. Matthew Hepinstall, an ...

  10. Biomedical wellness by tai chi and sports

    Science.gov (United States)

    Chin, Daniel C.; Chin, Amita G.

    2011-06-01

    Tai-chi chuan is popular worldwide especially in China. People practice tai-chi chuan daily with faith believing that they will be rewarded with health and varieties of other rewords. The Tai Chi Chuan Theory by Master Chang and the Tai Chi Chuan Theory by Master Wang are translated to be the baseline of the tai-chi chuan. The theory described in these two papers clearly shows that the tai-chi power source is the combination of the two antigravity forces distinction by each foot. The ying, yang and hollowed, solid discussed in the papers are the properties and body relationship of the two antigravity forces. The antigravity forces presented inside of body are as air to the balloon termed chi. However chi could be generated by any muscle pressing; only the antigravity forces from feet are called nature chi that has the maximum strength of the person. When a person is soft, as an infant the nature chi will fulfill entire body with no time and effort. The sequence forms were designed for deploying the nature chi in speed and power. The combination of chi and tai-chi form make tai chi chuan supreme than other kinds of martial art. In the training process chi massages whole body many time for a sequence form practice that stimulate all organs and could lead to cure body diseases, lose weight, postpone aging process, and remove the aging symptoms. For the people practicing in the park daily with proper guidance they will fulfill their wishes. Tai chi exercise could also apply to other sports as in dancing and golfing they are discussed at the end of the paper.

  11. Least square fitting with one parameter less

    CERN Document Server

    Berg, Bernd A

    2015-01-01

    It is shown that whenever the multiplicative normalization of a fitting function is not known, least square fitting by $\\chi^2$ minimization can be performed with one parameter less than usual by converting the normalization parameter into a function of the remaining parameters and the data.

  12. A New Test for a Normal Covariance Matrix

    Institute of Scientific and Technical Information of China (English)

    禹建奇

    2015-01-01

    The problem of testing the normal covariance matrix equal to a specified matrix is considered.A new Chi-Square test statistic is derived for multivariate normal population.Unlike the likelihood ratio test,the new test is an exact one.

  13. A new approach to non-homogeneous local $Tb$ theorems: Square functions and weak $(1,1)$ testing with measures

    OpenAIRE

    Martikainen, Henri; Mourgoglou, Mihalis; Vuorinen, Emil

    2015-01-01

    We develop a new method to prove local $Tb$ theorems via the non-homogeneous good lambda method and boundedness in big pieces. We also significantly improve known results. Here we work in the setting of vertical square functions $V$ in $\\mathbb{R}^n$ equipped with a non-homogeneous Borel measure $\\mu$. We only need that for every doubling cube $Q \\subset \\mathbb{R}^n$ with small boundary there exists a non-degenerate complex measure $\

  14. Chi activity during transduction-associated recombination.

    OpenAIRE

    Dower, N. A.; Stahl, F. W.

    1981-01-01

    Chi is a genetic element that stimulates phage lambda recombination by the Escherichia coli recBC pathway during lytic infection [Stahl, F. W. (1979) Annu. Rev. Genet. 13, 7--24]. Herein we show that chi in lambda prophage influences exchange distribution in P1 phage-mediated transduction and in conjugation. This demonstration encourages the view that chi may influence genetic exchange in E. coli in the total absence of lambda.

  15. Tai Chi philosophy and nursing epistemology.

    Science.gov (United States)

    Alperson, Sunny Yim

    2008-01-01

    This article analyzes the philosophy underpinning Tai Chi practice in light of nursing epistemology. The first half of the article reviews the general characteristics of major Chinese philosophical traditions that have been merged in Tai Chi: Confucianism, Daoism, and Buddhism. In the second half, themes of integration and praxis in Tai Chi are linked with Carper's fundamental patterns of knowing in nursing. Tai Chi is a practical fusion of humanistic philosophy with an experiential dimension of movement in a nondualistic foundation. The author argues that TC philosophy can be applied to integrated knowledge development and nursing praxis. PMID:20531257

  16. Square Heating Applied to Shearography and Active Infrared Thermography Measurements Coupling: From Feasibility Test in Laboratory to Numerical Study of Pultruded CFRP Plates Glued on Concrete Specimen

    OpenAIRE

    THEROUX, Luc D.; Dumoulin, Jean; MALADAGUE, X

    2014-01-01

    This paper investigates thermography and shearography couplings, using feasibility trials and numerical simulations, for non-destructive control evaluations of bonding of carbon fiber-reinforced polymer plates glued over concrete structures. Those are well-known methods in non-destructive testing (NDT) applied to civil engineering, but in this context, they are seen as paired because they use the same excitation source: square-pulsed optical heating. Furthermore, because both methods are base...

  17. Healing of subsurface damage after the 1999 Chi-Chi earthquake

    Science.gov (United States)

    Chen, K. H.; Rau, R.; Dreger, D. S.

    2009-12-01

    Observation of six M 4.6 repeating earthquakes in eastern Taiwan from 1991 to 2007 reveals a unique temporal and spatial variation in seismic wave character associated with the 1999 Mw 7.6 Chi-Chi earthquakes that occurred ~90 km away. Post-Chi-Chi events have reduced waveform similarity, suggesting a sudden change of seismic wave propagation properties after the Chi-Chi event. The changes in seismic character are widely distributed over Taiwan and remain significant in 5 years after Chi-Chi. Since 2004, the waveform similarity gradually recovered to the pre-Chi-Chi level. The most recent repeating event occurred on 15 November 2007 reveals only a subtle variation in seismic character compared to the pre-Chi-Chi event. This indicates that the damaged rock has been regaining the strength with time. The healing of subsurface damage zone, however, is not fully complete even 8 yr after the Chi-Chi earthquake. Using cross correlation function derived time-lag between the pre- and post- Chi-Chi events, we also identify a ~1 sec delay for the 2001 repeating event at a number of stations. Such a large delay shown in different parts of seismograms for different stations may indicate a broad range of fluid-filled scatterers along the travel path. For the station with the longest distance from the M 4.6 event (~200 km), PNG station on Penghu island off the western coast of Taiwan, the 1sec delay appears on early P wave coda. This suggests that the scatterers are likely located down to a depth of at least 20 km.

  18. Comparison Study of Airway Reactivity Outcomes due to a Pharmacologic Challenge Test: Impulse Oscillometry versus Least Mean Squared Analysis Techniques

    Directory of Open Access Journals (Sweden)

    Elena Rodriguez

    2013-01-01

    Full Text Available The technique of measuring transpulmonary pressure and respiratory airflow with manometry and pneumotachography using the least mean squared analysis (LMS has been used broadly in both preclinical and clinical settings for the evaluation of neonatal respiratory function during tidal volume breathing for lung tissue and airway frictional mechanical properties measurements. Whereas the technique of measuring respiratory function using the impulse oscillation technique (IOS involves the assessment of the relationship between pressure and flow using an impulse signal with a range of frequencies, requires less cooperation and provides more information on total respiratory system resistance (chest wall, lung tissue, and airways. The present study represents a preclinical animal study to determine whether these respiratory function techniques (LMS and IOS are comparable in detecting changes in respiratory resistance derived from a direct pharmacological challenge.

  19. CHI: A General Agent Communication Framework

    Energy Technology Data Exchange (ETDEWEB)

    Goldsmith, S.Y.; Phillips, L.R.; Spires, S.V.

    1998-12-17

    We have completed and exercised a communication framework called CHI (CLOS to HTML Interface) by which agents can communicate with humans. CHI follows HTTP (HyperText Transfer Protocol) and produces HTML (HyperText Markup Language) for use by WWW (World-Wide Web) browsers. CHI enables the rapid and dynamic construction of interface mechanisms. The essence of CHI is automatic registration of dynamically generated interface elements to named objects in the agent's internal environment. The agent can access information in these objects at will. State is preserved, so an agent can pursue branching interaction sequences, activate failure recovery behaviors, and otherwise act opportunistically to maintain a conversation. The CHI mechanism remains transparent in multi-agent, multi-user environments because of automatically generated unique identifiers built into the CHI mechanism. In this paper we discuss design, language, implementation, and extension issues, and, by way of illustration, examine the use of the general CHI/HCHI mechanism in a specific international electronic commerce system. We conclude that the CHI mechanism is an effective, efficient, and extensible means of the agent/human communication.

  20. A numerical test of a high-penetrability approximation for the one-dimensional penetrable-square-well model.

    Science.gov (United States)

    Fantoni, Riccardo; Giacometti, Achille; Malijevský, Alexandr; Santos, Andrés

    2010-07-14

    The one-dimensional penetrable-square-well fluid is studied using both analytical tools and specialized Monte Carlo simulations. The model consists of a penetrable core characterized by a finite repulsive energy combined with a short-range attractive well. This is a many-body one-dimensional problem, lacking an exact analytical solution, for which the usual van Hove theorem on the absence of phase transition does not apply. We determine a high-penetrability approximation complementing a similar low-penetrability approximation presented in previous work. This is shown to be equivalent to the usual Debye-Hückel theory for simple charged fluids for which the virial and energy routes are identical. The internal thermodynamic consistency with the compressibility route and the validity of the approximation in describing the radial distribution function is assessed by a comparison against numerical simulations. The Fisher-Widom line separating the oscillatory and monotonic large-distance behaviors of the radial distribution function is computed within the high-penetrability approximation and compared with the opposite regime, thus providing a strong indication of the location of the line in all possible regimes. The high-penetrability approximation predicts the existence of a critical point and a spinodal line, but this occurs outside the applicability domain of the theory. We investigate the possibility of a fluid-fluid transition by the Gibbs ensemble Monte Carlo techniques, not finding any evidence of such a transition. Additional analytical arguments are given to support this claim. Finally, we find a clustering transition when Ruelle's stability criterion is not fulfilled. The consequences of these findings on the three-dimensional phase diagrams are also discussed. PMID:20632742

  1. The Square Kilometre Array

    OpenAIRE

    Lazio, Joseph

    2009-01-01

    The Square Kilometre Array (SKA) is intended as the next-generation radio telescope and will address fundamental questions in astrophysics, physics, and astrobiology. The international science community has developed a set of Key Science Programs: (1) Emerging from the Dark Ages and the Epoch of Reionization, (2) Galaxy Evolution, Cosmology, and Dark Energy, (3) The Origin and Evolution of Cosmic Magnetism, (4) Strong Field Tests of Gravity Using Pulsars and Black Holes, and (5) The Cradle of...

  2. Effective Field Theory and $\\chi$pt

    OpenAIRE

    Holstein, Barry R.

    2000-01-01

    A brief introduction to the subject of chiral perturbation theory ($\\chi$pt) is given, including a discussion of effective field theory and application to the upcoming Bates virtual Compton scattering measurement.

  3. Reproducible Analysis and Blindness in a Null Test of Newton's Gravitational Inverse Square Law At Sub-millimeter Scales

    Science.gov (United States)

    Hagedorn, Charles; Venkateswara, Krishna; Gundlach, Jens

    2016-03-01

    Proper execution of an experiment is independent of its result. Physicists who test fundamental physical law face the reality that signals for new physics receive more attention and scrutiny than null results. Yet, null results may have greater impact upon the direction of both experiment and theory. Blind experiments and result-blind review are bulwarks against systematic human bias for both experimenters and referees. I'll describe the method that made possible an irreversible public unblinding of our torsion-balance parallel-plate test of gravity at submillimeter scales in 2015. One publicly-available computer procedure generated from blind raw data the analysis, the final result, and the complete documenting thesis. The experiment included an optical ``foil monitor'' to constrain a systematic effect intrinsic to all short-range parallel-plate gravity experiments. I'll describe the experiment, successes, lessons learned, and result. Supported by NSF (PHY-1305726) and DOE support for CENPA.

  4. Unifying Least Squares, Total Least Squares and Data Least Squares

    Czech Academy of Sciences Publication Activity Database

    Paige, C. C.; Strakoš, Zdeněk

    Dordrecht : Kluwer Academic Publishers, 2002 - (van Huffel, S.; Lemmerling, P.), s. 25-34 ISBN 1-4020-0476-1. [International Workshop on TLS and Errore-in-Variables Modelling. Leuven (BE), 27.08.2001-29.08.2001] R&D Projects: GA AV ČR IAA2030801 Grant ostatní: NSERC(CA) OGP0009236 Institutional research plan: AV0Z1030915 Keywords : scaled total least squares * ordinary least squares * data least squares * core problem * orthogonal reduction * singular value decomposition Subject RIV: BA - General Mathematics

  5. Goodness-of-fit test in a multivariate errors-in-variables model $AX = B$

    OpenAIRE

    Kukush, Alexander; Tsaregorodtsev, Yaroslav

    2016-01-01

    A multivariable functional errors-in-variables model $AX \\approx B$ is considered, where the data matrices $A$ and $B$ are observed with errors and a matrix parameter $X$ is to be estimated. A goodness-of-fit test is constructed based on the total least squares estimator. The proposed test is asymptotically chi-squared under null hypothesis. The power of the test under local alternatives is discussed.

  6. $\\chi_{c1}$ and $\\chi_{c2}$ production at $e^+e^-$ colliders

    CERN Document Server

    Czyz, Henryk; Tracz, Szymon

    2016-01-01

    Direct, resonant production of the charmonium states $\\chi_{c1}$ and $\\chi_{c2}$ in electron-positron annihilation is investigated. Depending on details of the model, a sizeable variation of the prediction for the production cross section is anticipated. It is demonstrated that resonant production could be observed under favorable circumstances.

  7. A SUCCESSIVE LEAST SQUARES METHOD FOR STRUCTURED TOTAL LEAST SQUARES

    Institute of Scientific and Technical Information of China (English)

    Plamen Y. Yalamov; Jin-yun Yuan

    2003-01-01

    A new method for Total Least Squares (TLS) problems is presented. It differs from previous approaches and is based on the solution of successive Least Squares problems.The method is quite suitable for Structured TLS (STLS) problems. We study mostly the case of Toeplitz matrices in this paper. The numerical tests illustrate that the method converges to the solution fast for Toeplitz STLS problems. Since the method is designed for general TLS problems, other structured problems can be treated similarly.

  8. Gain Shift Corrections at Chi-Nu

    Energy Technology Data Exchange (ETDEWEB)

    Brown, Tristan Brooks [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Univ. of Massachusetts, Lowell, MA (United States). Dept. of Physics and Applied Physics; Devlin, Matthew James [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2016-08-30

    Ambient conditions have the potential to cause changes in liquid scintillator detector gain that vary with time and temperature. These gain shifts can lead to poor resolution in both energy as well as pulse shape discrimination. In order to correct for these shifts in the Chi-Nu high energy array, a laser system has been developed for calibration of the pulse height signals.

  9. Tai Chi, Qi Gong and Reiki.

    Science.gov (United States)

    Chu, Dennis A

    2004-11-01

    Tai Chi, Qi Gong, and Reiki are complementary therapies that are gaining popularity with patients. Although these therapies seem simple and attractive in their philosophy and are easy to apply,more objective, well-designed research is needed to prove their efficacy and to gain acceptance from the medical community. PMID:15458751

  10. Tai Chi Chuan in Medicine and Health Promotion

    OpenAIRE

    Ching Lan; Ssu-Yuan Chen; Jin-Shin Lai; Alice May-Kuen Wong

    2013-01-01

    Tai Chi Chuan (Tai Chi) is a Chinese traditional mind-body exercise and recently, it becomes popular worldwide. During the practice of Tai Chi, deep diaphragmatic breathing is integrated into body motions to achieve a harmonious balance between body and mind and to facilitate the flow of internal energy (Qi). Participants can choose to perform a complete set of Tai Chi or selected movements according to their needs. Previous research substantiates that Tai Chi has significant benefits to heal...

  11. Analysis of Paired Dichotomous Data: A Gentle Introduction to the McNemar Test in SPSS

    Science.gov (United States)

    Adedokun, Omolola A.; Burgess, Wilella D.

    2012-01-01

    Background: Although McNemar Test is the most appropriate tool for analyzing pre-post differences in dichotomous items (e.g., "yes" or "no", "correct" or "incorrect", etc.), many scholars have noted the inappropriate use of Pearson's Chi-square Test by researchers, including social scientists and evaluators, for the analysis of related or…

  12. Militarist, Marxian, and Non-Marxian Materialist Theories of Gender Inequality: A Cross-Cultural Test

    Science.gov (United States)

    Sanderson, Stephen K.; Heckert, D. Alex; Dubrow, Joshua K.

    2005-01-01

    This study tested three types of theories of gender inequality in preindustrial societies by using half the societies in the Standard Cross-Cultural Sample: militarist, Marxian, and non-Marxian materialist theories. The first phase of the research used simple cross-tabulations with chi-square as a test of significance and gamma as a measure of…

  13. A Pearson's test for symmetry with an application to the Spanish business cycle

    OpenAIRE

    Jorge Belaire-Franch; Dulce Contreras

    2002-01-01

    In this paper, we look for asymmetries in the Spanish business cycle. To that end, we firstly propose an easy nonparametric testing procedure to test for symmetry based on a Pearson's chi-squared statistic, which we call P-test. Then, we test for two popular forms of asymmetry, deepness and steepness, using a battery of nonparametric tests. In addition, we analyse possible complementarities between the tests used in this paper, and we compute p-value adjustments for multiple tests.

  14. Effect of near-fault earthquake on bridges: lessons learned from Chi-Chi earthquake

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    The objective of this paper is to describe the lessons learned and actions that have been taken related to the seismicdesign of bridge structures after the Chi-Chi, Taiwan earthquake. Much variable near-fault ground motion data was collected fromthe rupture of Chelungpu fault during the Chi-Chi earthquake, allowing the seismic response of bridge structures subjected to thesenear-fault ground motions to be carefully examined. To study the near-fault ground motion effect on bridge seismic design codes, atwo-level seismic design of bridge structures was developed and implemented. This design code reflects the near-fault factors in theseismic design forces. Finally, a risk assessment methodology, based on bridge vulnerability, is also developed to assist in decisionsfor reducing seismic risk due to failure of bridges.

  15. A precursory ULF signature for the Chi-Chi earthquake in Taiwan

    Directory of Open Access Journals (Sweden)

    Y. Akinaga

    2001-01-01

    Full Text Available ULF emission data at Lunping (epicentral distance, 120 km have been analysed for the Chi-Chi earthquake (with magnitude 7.6 and depth of 11 km in Taiwan which occurred on 21 September 1999. Simple intensity analyses have not yielded any significant results but we have found, based on the analysis of polarization (the ratio of vertical magnetic field component Z to the horizontal component G, that the polarization (Z/G showed a significant enhancement for two months before the earthquake. This kind of temporal evolution of polarization seems to be very similar to previous results, so that it is highly likely that this phenomenon may be associated with the Chi-Chi earthquake. Also, the comparison of the results of polarization analyses, by changing the signal threshold, has given us an approximate intensity of the seismogenic emission of the order of the monthly mean value.

  16. Tai chi training reduces self-report of inattention in healthy young adults.

    Science.gov (United States)

    Converse, Alexander K; Ahlers, Elizabeth O; Travers, Brittany G; Davidson, Richard J

    2014-01-01

    It is important to identify effective non-pharmacological alternatives to stimulant medications that reduce symptoms of attention deficit hyperactivity disorder (ADHD). In this study of healthy young adults, we measured the effects of training in tai chi, which involves mindful attention to the body during movement. Using a non-randomized, controlled, parallel design, students in a 15-week introductory tai chi course (n = 28) and control participants (n = 44) were tested for ADHD indicators and cognitive function at three points over the course of the 15-weeks. The tai chi students' self-report of attention, but not hyperactivity-impulsivity, improved compared to controls. At baseline, inattention correlated positively with reaction time variability in an affective go/no-go task across all participants, and improvements in attention correlated with reductions in reaction time variability across the tai chi students. Affective bias changed in the tai chi students, as reaction times to positive- and negative-valenced words equalized over time. These results converge to suggest that tai chi training may help improve attention in healthy young adults. Further studies are needed to confirm these results and to evaluate tai chi as therapy for individuals with ADHD. PMID:24478679

  17. Tai chi training reduces self-report of inattention in healthy young adults

    Directory of Open Access Journals (Sweden)

    Alexander K. Converse

    2014-01-01

    Full Text Available It is important to identify effective non-pharmacological alternatives to stimulant medications that reduce symptoms of attention deficit hyperactivity disorder (ADHD. In this study of healthy young adults, we measured the effects of training in tai chi, which involves mindful attention to the body during movement. Using a non-randomized, controlled, parallel design, students in a 15-week introductory tai chi course (n=28 and control participants (n=44 were tested for ADHD indicators and cognitive function at three points over the course of the 15 weeks. The tai chi students' self-report of attention, but not hyperactivity-impulsivity, improved compared to controls. At baseline, inattention correlated positively with reaction time variability in an affective go/no-go task across all participants, and improvements in attention correlated with reductions in reaction time variability across the tai chi students. Affective bias changed in the tai chi students, as reaction times to positive- and negative-valenced words equalized over time. These results converge to suggest that tai chi training may help improve attention in healthy young adults. Further studies are needed to confirm these results and to evaluate tai chi as therapy for individuals with ADHD.

  18. chi_{c1} and chi_{c2} decay angular distributions at the Fermilab Tevatron

    CERN Document Server

    Kniehl, Bernd A; Palisoc, C P

    2003-01-01

    We consider the hadroproduction of chi_{c1} and chi_{c2} mesons and their subsequent radiative decays to J/psi mesons and photons in the factorization formalism of nonrelativistic quantum chromodynamics, and study the decay angular distributions, by means of helicity density matrices, in view of their sensitivity to color-octet processes. We present numerical results appropriate for the Fermilab Tevatron.

  19. Geometry of Fractal Squares

    OpenAIRE

    Roinestad, Kristine A

    2010-01-01

    This paper will examine analogues of Cantor sets, called fractal squares, and some of the geometric ways in which fractal squares raise issues not raised by Cantor sets. Also discussed will be a technique using directed graphs to prove bilipschitz equivalence of two fractal squares.

  20. A DoS/DDoS Attack Detection System Using Chi-Square Statistic Approach

    OpenAIRE

    Fang-Yie Leu; I-Long Lin

    2010-01-01

    Nowadays, users can easily access and download network attack tools, which often provide friendly interfaces and easily operated features, from the Internet. Therefore, even a naive hacker can also launch a large scale DoS or DDoS attack to prevent a system, i.e., the victim, from providing Internet services. In this paper, we propose an agent based intrusion detection architecture, which is a distributed detection system, to detect DoS/DDoS attacks by invoking a statistic approach that compa...

  1. A DoS/DDoS Attack Detection System Using Chi-Square Statistic Approach

    Directory of Open Access Journals (Sweden)

    Fang-Yie Leu

    2010-04-01

    Full Text Available Nowadays, users can easily access and download network attack tools, which often provide friendly interfaces and easily operated features, from the Internet. Therefore, even a naive hacker can also launch a large scale DoS or DDoS attack to prevent a system, i.e., the victim, from providing Internet services. In this paper, we propose an agent based intrusion detection architecture, which is a distributed detection system, to detect DoS/DDoS attacks by invoking a statistic approach that compares source IP addresses' normal and current packet statistics to discriminate whether there is a DoS/DDoS attack. It first collects all resource IPs' packet statistics so as to create their normal packet distribution. Once some IPs' current packet distribution suddenly changes, very often it is an attack. Experimental results show that this approach can effectively detect DoS/DDoS attacks.

  2. On the (im)possibility of testing new physics in exoplanets using transit timing variations: deviation from inverse-square law of gravity

    CERN Document Server

    Xie, Yi

    2014-01-01

    Ground-based and space-borne observatories studying exoplanetary transits now and in the future will considerably increase the number of known exoplanets and the precision of the measured times of transit minima. Variations in the transit times can not only be used to infer the presence of additional planets, but might also provide opportunities for testing new physics in the places beyond the Solar system. In this work, we take deviation from the inverse-square law of gravity as an example, focus on the fifth-force-like Yukawa-type correction to the Newtonian gravitational force which parameterizes this deviation, investigate its effects on the secular transit timing variations and analyze their observability in exoplanetary systems. It is found that the most optimistic values of Yukawa-type secular transit timing variations are at the level of $\\sim 0.1$ seconds per year. Those values unfortunately appear only in rarely unique cases and, most importantly, they are still at least two orders of magnitude belo...

  3. Barbed congruence of the asymmetric chi calculus

    Institute of Scientific and Technical Information of China (English)

    DONG Xiao-ju; FU Yu-xi

    2006-01-01

    The chi calculus is a model of mobile processes. It has evolved from the pi-calculus with motivations from simplification and communication-as-cut-elimination. This paper studies the chi calculus in the framework incorporating asymmetric communication. The major feature of the calculus is the identification of two actions:x/x and τ. The investigation on the barbed bisimilarity shows how the property affects the observational theory.Based on the definition of the barbed bisimilarity, the simulation properties of the barbed bisimilarity are studied. It shows that the algebraic properties of the barbed bisimilarity have changed greatly compared with the chi calculus. Although the definition of the barbed bisimilarity is very simple, the property of closeness under contexts makes it difficult to understand the barbed bisimilarity directly. Therefore an open style definition of the barbed bisimilarity is given, which is a context free description of barbed bisimilarity. Its definition is complex,but it is a well-behaved relation for it coincides with the barbed bisimilarity. It also helps to build an axiomatization system for the barbed congruence. Besides the axioms for the strong barbed bisimilarity, the paper proposes a new tau law and four new update laws for the barbed congruence. Both the operational and algebraic properties of the enriched calculus improve the understanding of the bisimulation behaviors of the model.

  4. Dicty_cDB: CHI518 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHI518 (Link to dictyBase) - - - Contig-U11768-1 CHI518P (Link to Original ... CVRY YFKALVYSGKINKANLGMTKLPPPTKKMTKAAREALGSE--- ---skw *rnh*yqtnr*ckr*yfngscsfeccne*rskt*hcls*swscfgssnd*s ...

  5. Dicty_cDB: CHI394 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHI394 (Link to dictyBase) - - - Contig-U16405-1 CHI394P (Link to Original ... sntvedctfdasglvyypkvynlkyskktkniw*ryshywlif kiiwws*fpy *fh*ck*tfcc--- ---TTFIGVRSGPSTTLTYIKPMISEIPTIENKIEK ...

  6. A Theorem on the Rank of a Product of Matrices with Illustration of Its Use in Goodness of Fit Testing.

    Science.gov (United States)

    Satorra, Albert; Neudecker, Heinz

    2015-12-01

    This paper develops a theorem that facilitates computing the degrees of freedom of Wald-type chi-square tests for moment restrictions when there is rank deficiency of key matrices involved in the definition of the test. An if and only if (iff) condition is developed for a simple rule of difference of ranks to be used when computing the desired degrees of freedom of the test. The theorem is developed exploiting basics tools of matrix algebra. The theorem is shown to play a key role in proving the asymptotic chi-squaredness of a goodness of fit test in moment structure analysis, and in finding the degrees of freedom of this chi-square statistic. PMID:25537142

  7. Measurement of chi(3510) and chi(3555) production in 190 GeV/c piminus-beryllium interactions

    International Nuclear Information System (INIS)

    Charmonium production in 190 GeV/c π--Be interactions has been observed. The states chi(3510) and chi(3555) are seen through their radiative decay into J/Psi, and are found to correspond to 0.29 +- 0.09 of total J/Psi production for J/Psi's with x/sub f/ > 0.2. The rate of production for the two chi states appears as Bsigma(chi(3555))/Bsigma(chi(3510) = 0.60 +- 0.35. The fraction of J/Psi's produced through chi decay appears to rise with higher x/sub f/. For J/Psi's with x/sub f/ > 0.42, chi decay is responsible for 0.345 +- 0.09 of the total J/Psi sample, with the two states produced at the rate Bsigma(chi(3555))/Bsigma(3510) = 0.82 +- 0.45

  8. Quality of Reporting of Randomized Clinical Trials in Tai Chi Interventions—A Systematic Review

    Directory of Open Access Journals (Sweden)

    Jing-Yi Li

    2011-01-01

    Full Text Available Objectives. To evaluate the reporting quality of published randomized clinical trials (RCTs in the Tai Chi literature following the publication of the CONSORT guidelines in 2001. Data Sources. The OVID MEDLINE and PUBMED databases. Review Methods. To survey the general characteristics of Tai Chi RCTs in the literature, we included any report if (i it was an original report of the trial; (ii its design was RCT; (iii one of the treatments being tested was Tai Chi; and (iv it was in English. In addition, we assessed the reporting quality of RCTs that were published between 2002 and 2007, using a modified CONSORT checklist of 40 items. The adequate description of Tai Chi interventions in these trials was examined against a 10-item checklist adapted from previous reviews. Results. The search yielded 31 Tai Chi RCTs published from 2002 to 2007 and only 11 for 1992–2001. Among trials published during 2002–2007, the most adequately reported criteria were related to background, participant eligibility and interpretation of the study results. Nonetheless, the most poorly reported items were associated with randomization allocation concealment, implementation of randomization and the definitions of period of recruitment and follow-up. In addition, only 23% of RCTs provided adequate details of Tai Chi intervention used in the trials. Conclusion. The findings in this review indicated that the reporting quality of Tai Chi intervention trials is sub-optimal. Substantial improvement is required to meet the CONSORT guidelines and allow assessment of the quality of evidence. We believe that not only investigators, but also journal editors, reviewers and funding agencies need to follow the CONSORT guidelines to improve the standards of research and strengthen the evidence base for Tai Chi and for complementary and alternative medicine.

  9. CHY-Graphs on a Torus

    CERN Document Server

    Cardona, Carlos

    2016-01-01

    Recently, we proposed a new approach using a punctured Elliptic curve in the CHY framework in order to compute one-loop scattering amplitudes. In this note, we further develop this approach by introducing a set of connectors, which become the main ingredient to build integrands on $\\mathfrak{M}_{1,n}$, the moduli space of n-punctured Elliptic curves. As a particular application, we study the $\\Phi^3$ bi-adjoint scalar theory. We propose a set of rules to construct integrands on $\\mathfrak{M}_{1,n}$ from $\\Phi^ 3$ integrands on $\\mathfrak{M}_{0,n}$, the moduli space of n-punctured spheres. We illustrate these rules by computing a variety of $\\Phi^3$ one-loop Feynman diagrams. Conversely, we also provide another set of rules to compute the corresponding CHY-integrand on $\\mathfrak{M}_{1,n}$ by starting instead from a given $\\Phi^ 3$ one-loop Feynman diagram. In addition, our results can easily be extended to higher loops.

  10. Tests for Comparing Weighted Histograms. Review and Improvements

    CERN Document Server

    Gagunashvili, Nikolai

    2016-01-01

    Histograms with weighted entries are used to estimate probability density functions. Computer simulation is the main application of this type of histograms. A review on chi-square tests for comparing weighted histograms is presented in this paper. Improvements to these tests that have a size closer to its nominal value are proposed. Numerical examples are presented for evaluation and demonstration of various applications of the tests.

  11. Analysis of static and dynamic balance in healthy elderly practitioners of Tai Chi Chuan versus ballroom dancing

    Directory of Open Access Journals (Sweden)

    Miguel Antônio Rahal

    2015-03-01

    Full Text Available OBJECTIVE: To determine whether Tai Chi Chuan or ballroom dancing promotes better performance with respect to postural balance, gait, and postural transfer among elderly people. METHODS: We evaluated 76 elderly individuals who were divided into two groups: the Tai Chi Chuan Group and the Dance Group. The subjects were tested using the NeuroCom Balance Master¯ force platform system with the following protocols: static balance tests (the Modified Clinical Tests of Sensory Interaction on Balance and Unilateral Stance and dynamic balance tests (the Walk Across Test and Sit-to-stand Transfer Test. RESULTS: In the Modified Clinical Test of Sensory Interaction on Balance, the Tai Chi Chuan Group presented a lower sway velocity on a firm surface with open and closed eyes, as well as on a foam surface with closed eyes. In the Modified Clinical Test of Sensory Interaction on Unilateral Stance, the Tai Chi Chuan Group presented a lower sway velocity with open eyes, whereas the Dance Group presented a lower sway velocity with closed eyes. In the Walk Across Test, the Tai Chi Chuan Group presented faster walking speeds than those of the Dance Group. In the Sit-to-stand Transfer Test, the Tai Chi Chuan Group presented shorter transfer times from the sitting to the standing position, with less sway in the final standing position. CONCLUSION: The elderly individuals who practiced Tai Chi Chuan had better bilateral balance with eyes open on both types of surfaces compared with the Dance Group. The Dance Group had better unilateral postural balance with eyes closed. The Tai Chi Chuan Group had faster walking speeds, shorter transfer times, and better postural balance in the final standing position during the Sit-to-stand Test.

  12. The Square Kilometre Array

    Science.gov (United States)

    Huynh, Minh; Lazio, Joseph

    2011-01-01

    The Square Kilometre Array (SKA) will be the premier instrument to study radiation at centimetre and metre wavelengths from the cosmos, and in particular neutral hydrogen, the most abundant element in the universe. The SKA will probe the dawn of galaxy formation as well as allow advances in many other areas of astronomy, such as fundamental physics, astro-biology and cosmology. The SKA will have a collecting area of up to one million square metres spread over at least 3000 km, providing a collecting area more than twenty times greater than the current largest radio telescope. Its field of view on the sky will be several tens of square degrees with potentially several large (100 square degrees) independent beams at the lower frequencies, providing a survey speed many thousands of times greater than current facilities. This paper summarises the key science drivers of the SKA and provides an update on the international project.

  13. Square and Delta reflection

    OpenAIRE

    Fontanella, Laura; Hayut, Yair

    2016-01-01

    Starting from infinitely many supercompact cardinals, we force a model of ZFC where $\\aleph_{\\omega^2+1}$ satisfies simultaneously a strong principle of reflection, called $\\Delta$-reflection, and a version of the square principle, denoted $\\square(\\aleph_{\\omega^2+1}).$ Thus we show that $\\aleph_{\\omega^2+1}$ can satisfy simultaneously a strong reflection principle and an anti-reflection principle.

  14. A Study on Near-Fault Mortality from the 1999 Chi-Chi, Taiwan Earthquake

    Science.gov (United States)

    Pai, C.; Tien, Y.; Teng, T.

    2004-12-01

    A new approach for estimating the relations between mortality and strong shaking from the 1999 Chi-Chi, Taiwan earthquake is introduced. We have finished the database giving the attributes of victims through a compilation of various after-earthquake survey documents. This survey was a comprehensive filed visit confirming exact locations of victims and their possible cause of death. Among the total 2492 victims of the Chi-Chi earthquake, 2039 victims (81.8% of the total) were located by using GPS. Through the attributive database of victims, digital maps and Geographic Information Systems, we can easily map the spatial distribution and the cause of death data of victims with accuracy of the smallest administrative districts in Taiwan. Moreover, a regression analysis gives correlated equations for the mortality as functions of the distance to the Chelungpu fault. We find that the percentage of the mortality M can be expressed as:\\[M=\\frac{(1.626+0.0007\\timesd)} {(1+0.0125\\timesd)}\\] Here d is the closest distance to the fault in meter. As expected, the shorter distance to the Chelungpu fault causes the higher mortality. We device three disastrous levels and then suggest the orders and scopes of the earthquake disaster rescue according to the regression curve of the mortality and the closest distance to the fault. The difference in mortality between hanging-wall and footwall areas is also discussed and different regression curves of hanging-wall and footwall areas are suggested. In near-fault regions, the mortality for the residents lived in hanging-wall block (1348) is significantly higher than that in the footwall block (557). The death ratio of hanging-wall vs. footwall block is approximately 2.4:1. Finally, we gathered the data of the peak ground acceleration (PGA) data for the mainshock of Chi-Chi earthquake at the 63 seismic stations on both sides of the causal fault. The regression curve of the PGA and mortality as functions of the closest distance to the

  15. A randomized controlled trial of tai chi for long-term low back pain (TAI CHI: Study rationale, design, and methods

    Directory of Open Access Journals (Sweden)

    Hall Amanda M

    2009-05-01

    Full Text Available Abstract Background Low back pain persisting for longer than 3 months is a common and costly condition for which many current treatments have low-moderate success rates at best. Exercise is among the more successful treatments for this condition, however, the type and dosage of exercise that elicits the best results is not clearly defined. Tai chi is a gentle form of low intensity exercise that uses controlled movements in combination with relaxation techniques and is currently used as a safe form of exercise for people suffering from other chronic pain conditions such as arthritis. To date, there has been no scientific evaluation of tai chi as an intervention for people with back pain. Thus the aim of this study will be to examine the effects of a tai chi exercise program on pain and disability in people with long-term low back pain. Methods and design The study will recruit 160 healthy individuals from the community setting to be randomised to either a tai chi intervention group or a wait-list control group. Individuals in the tai chi group will attend 2 tai chi sessions (40 minutes/week for 8 weeks followed by 1 tai chi session/week for 2 weeks. The wait-list control will continue their usual health care practices and have the opportunity to participate in the tai chi program once they have completed the follow-up assessments. The primary outcome will be bothersomeness of back symptoms measured with a 0–10 numerical rating scale. Secondary outcomes include, self-reports of pain-related disability, health-related quality of life and global perceived effect of treatment. Statistical analysis of primary and secondary outcomes will be based on the intention to treat principle. Linear mixed models will be used to test for the effect of treatment on outcome at 10 weeks follow up. This trial has received ethics approval from The University of Sydney Human Research Ethics Committee. HREC Approval No.10452 Discussion This study will be the first

  16. Green tea polyphenols and Tai Chi for bone health: Designing a placebo-controlled randomized trial

    Directory of Open Access Journals (Sweden)

    Chyu Ming-Chien

    2009-09-01

    Full Text Available Abstract Background Osteoporosis is a major health problem in postmenopausal women. Evidence suggests the importance of oxidative stress in bone metabolism and bone loss. Tea consumption may be beneficial to osteoporosis due to its antioxidant capability. However, lack of objective data characterizing tea consumption has hindered the precise evaluation of the association between tea ingestion and bone mineral density in previous questionnaire-based epidemiological studies. On the other hand, although published studies suggest that Tai Chi (TC exercise can benefit bone health and may reduce oxidative stress, all studies were conducted using a relatively healthy older population, instead of a high-risk one such as osteopenic postmenopausal women. Therefore, this study was designed to test an intervention including green tea polyphenol (GTP and TC exercise for feasibility, and to quantitatively assess their individual and interactive effects on postmenopausal women with osteopenia. Methods/Design One hundred and forty postmenopausal women with osteopenia (defined as bone mineral density T-score at the spine and/or hip between 1 to 2.5 SD below the reference database were randomly assigned to 4 treatment arms: (1 placebo group receiving 500 mg medicinal starch daily, (2 GTP group receiving 500 mg of GTP per day, (3 placebo+TC group receiving both placebo treatment and TC training (60-minute group exercise, 3 times per week, and (4 GTP+TC group receiving both GTP and TC training for 24 weeks. The outcome measures were bone formation biomarker (serum bone alkaline phosphatase, bone resorption biomarker (serum tartrate resistant acid phosphatase, and oxidative DNA damage biomarker (urinary 8-hydroxy-2'-deoxyguanosine. All outcome measures were determined at baseline, 4, 12, and 24 weeks. Urinary and serum GTP concentrations were also determined at baseline, 4, 12, and 24 weeks for bioavailability. Liver function was monitored monthly for safety. A

  17. Bi-normalized response spectral characteristics of the 1999 Chi-Chi earthquake

    Institute of Scientific and Technical Information of China (English)

    徐龙军; 谢礼立

    2004-01-01

    To develop uniform and seismic environment-dependent design spectrum, common acceleration response spectral characteristics need to be identified. In this paper, a bi-normalized response spectrum (BNRS) is proposed, which is defined as a spectrum of peak response acceleration normalized with respect to peak acceleration of the excitation plotted vs. the natural period of the system normalized with respect to the spectrum predominant period, Tp. Based on a statistical analysis of records from the 1999 Chi-Chi earthquake, the conventionally normalized response spectrum(NRS) and the BNRS are examined to account for the effects of soil conditions, epicentral distance, hanging wall and damping. It is found that compared to the NRS, the BNRS is much less dependent on these factors. Finally, some simple relationships between the BNRS tor a specified damping ratio and that for a damping ratio of 5%, and between the spectra predominant period and epicentral distance for different soil types are provided.

  18. A $\\chi^2$ veto for continuous wave searches

    CERN Document Server

    de la Jordana, Llucia Sancho

    2008-01-01

    $\\chi^2$ vetoes are commonly used in searching for gravitational waves, in particular for broad-band signals, but they can also be applied to narrow-band continuous wave signals, such as those expected from rapidly rotating neutron stars. In this paper we present a $\\chi^2$ veto adapted to the Hough transform searches for continuous gravitational wave signals; we characterize the $\\chi^2$-significance plane for different frequency bands; and discuss the expected performance of this veto in LIGO analysis.

  19. O Tai Chi Chuan na percussão

    OpenAIRE

    Teixeira, Mário Jorge Peixoto

    2013-01-01

    A good motricity and a strong psyche that allow for excellence in performance are essential in musical execution. Since Tai Chi Chuan is an activity that implies a considerable psychomotor and psychological development, it is the aim of this thesis to assess whether the practice of Tai Chi Chuan can be an optimising factor in a percussionist’s performance. Based on the outstanding physical and psychological effects that result from the practice of Tai Chi Chuan and the ce...

  20. Tai Chi Chuan in Medicine and Health Promotion

    Directory of Open Access Journals (Sweden)

    Ching Lan

    2013-01-01

    Full Text Available Tai Chi Chuan (Tai Chi is a Chinese traditional mind-body exercise and recently, it becomes popular worldwide. During the practice of Tai Chi, deep diaphragmatic breathing is integrated into body motions to achieve a harmonious balance between body and mind and to facilitate the flow of internal energy (Qi. Participants can choose to perform a complete set of Tai Chi or selected movements according to their needs. Previous research substantiates that Tai Chi has significant benefits to health promotion, and regularly practicing Tai Chi improves aerobic capacity, muscular strength, balance, health-related quality of life, and psychological well-being. Recent studies also prove that Tai Chi is safe and effective for patients with neurological diseases (e.g., stroke, Parkinson's disease, traumatic brain injury, multiple sclerosis, cognitive dysfunction, rheumatological disease (e.g., rheumatoid arthritis, ankylosing spondylitis, and fibromyalgia, orthopedic diseases (e.g., osteoarthritis, osteoporosis, low-back pain, and musculoskeletal disorder, cardiovascular diseases (e.g., acute myocardial infarction, coronary artery bypass grafting surgery, and heart failure, chronic obstructive pulmonary diseases, and breast cancers. Tai Chi is an aerobic exercise with mild-to-moderate intensity and is appropriate for implementation in the community. This paper reviews the existing literature on Tai Chi and introduces its health-promotion effect and the potential clinical applications.

  1. Dicty_cDB: CHI194 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 58.1 V112D8 mTn-3xHA/lacZ Insertion Library, strain Y2278 Saccharomyces cerevisiae genomic 5', genomic survey se...) Frame A: ksnfi*ii*knk*ynikndiisnylmy*gn*ndlktstrsi*kkyknsnkeiisinwfsd nwyifsictsmvfvtnwmdiygysmlwiilcwvcmw...uolar 4.0 %: nuclear 4.0 %: vesicles of secretory system >> prediction for CHI194 is end 5' end seq. ID CHI194F 5' end se...CTTT TAATGGTTTAGTTTATAATCATTCATTTGCTGCTAGAAATTATTTGGATCTTTATAGAGT TGCTTTATTATCAAANNAATAAAATTAAATCATT Length of 3' end se...q. 754 Connected seq. ID CHI194P Connected seq. >CHI194P.Seq AAATCAAA

  2. Graphs with $\\chi=\\Delta$ have big cliques

    OpenAIRE

    Cranston, Daniel W.; Rabern, Landon

    2013-01-01

    Brooks' Theorem states that if a graph has $\\Delta\\ge 3$ and $\\omega \\le \\Delta$, then $\\chi \\le \\Delta$. Borodin and Kostochka conjectured that if $\\Delta\\ge 9$ and $\\omega\\le \\Delta-1$, then $\\chi\\le \\Delta-1$. We show that if $\\Delta\\ge 13$ and $\\omega \\le \\Delta-4$, then $\\chi\\le \\Delta-1$. For a graph $G$, let $\\mathcal{H}$ denote the subgraph of $G$ induced by vertices of degree $\\Delta$. We also show that if $\\omega\\le \\Delta-1$ and $\\omega(\\mathcal{H})\\le \\Delta-6$, then $\\chi\\le \\Del...

  3. Search for B --> chi_c K(*) decays

    CERN Document Server

    Aubert, B; Abrams, G S; Adye, T; Ahmed, S; Alam, M S; Albert, J; Aleksan, Roy; Allison, J; Allmendinger, T; Altenburg, D; Andreotti, M; Angelini, C; Anulli, F; Aston, D; Azzolini, V; Baak, M; Back, J J; Bailey, S; Baldini-Ferroli, R; Band, H R; Banerjee, Sw; Barate, R; Bard, D J; Barlow, N R; Barlow, R J; Barrett, M; Bartoldus, R; Batignani, G; Bauer, J M; Beck, T W; Bellini, F; Benayoun, M; Berger, N; Bernard, D; Berryhill, J W; Best, D; Bettarini, S; Bettoni, D; Bevan, A J; Bhimji, W; Bianchi, F; Biasini, M; Blanc, F; Blaylock, G; Blinov, A E; Blinov, V E; Bloom, P; Bóna, M; Bondioli, M; Bonneaud, G R; Borgland, A W; Bosisio, L; Boutigny, D; Bowerman, D A; Boyarski, A M; Boyd, J T; Bozzi, C; Brandenburg, G; Brandt, T; Brau, J E; Breon, A B; Briand, H; Brochard, F; Brose, J; Brown, C L; Brown, C M; Brown, D; Brown, D N; Bruinsma, M; Brunet, S; Bucci, F; Buchanan, C; Buchmüller, O L; Bulten, H; Burchat, Patricia R; Button-Shafer, J; Buzzo, A; Côté, D; Cahn, R N; Calabrese, R; Calcaterra, A; Calderini, G; Campagnari, C; Capra, R; Carpinelli, M; Cartaro, C; Cavallo, N; Cavoto, G; Chaisanguanthum, K S; Chao, M; Charles, E; Charles, M J; Chauveau, J; Chavez, C A; Chen, A; Chen, E; Chen, J C; Chen, S; Cheng, B; Cheng, C H; Chevalier, N; Christ, S; Cibinetto, G; Clark, P J; Claus, R; Cochran, J; Colecchia, F; Coleman, J P; Contri, R; Convery, M R; Cormack, C M; Cossutti, F; Cottingham, W N; Couderc, F; Covarelli, R; Cowan, G; Crawley, H B; Cremaldi, L M; Cristinziani, M; Crosetti, G; Çuhadar-Dönszelmann, T; Dahmes, B; Dallapiccola, C; Danielson, N; Dasu, S; Datta, M; Dauncey, P D; David, P; Davier, M; Davis, C L; Day, C T; De Groot, N; De Nardo, Gallieno; Del Buono, L; Della Ricca, G; Di Lodovico, F; Dickopp, M; Dittongo, S; Dong, D; Dorfan, J; Dorigo, A; Druzhinin, V P; Dubois-Felsmann, G P; Dujmic, D; Dunwoodie, W M; Dvoretskii, A; Eckmann, R; Edwards, A J; Egede, U; Eichenbaum, A M; Eigen, G; Eisner, A M; Elmer, P; Elsen, E E; Emery, S; Ernst, J A; Eschenburg, V; Eschrich, I; Fabozzi, F; Faccini, R; Fan, S; Farbin, A; Feltresi, E; Ferrarotto, F; Ferroni, F; Field, R C; Finocchiaro, G; Flack, R L; Flächer, H U; Flood, K T; Ford, K E; Ford, W T; Forster, I J; Forti, F; Fortin, D; Foulkes, S D; Franek, B J; Frey, R; Fritsch, M; Fry, J R; Gabathuler, Erwin; Gaidot, A; Gaillard, J M; Gaillard, J R; Galeazzi, F; Gallo, F; Gamba, D; Gamet, R; Gan, K K; Ganzhur, S F; Gary, J W; Gaspero, M; Gatto, C; Geddes, N I; Gill, M S; Giorgi, M A; Giraud, P F; Giroux, X; Gladney, L; Glanzman, T; Godang, R; Goetzen, K; Golubev, V B; Gopal, G P; Gowdy, S J; Graham, M; Grancagnolo, S; Green, M G; Greene, M G; Grenier, G J; Grenier, P; Gritsan, A V; Grosdidier, G; Groysman, Y; Guo, Q H; Hadavand, H K; Hadig, T; Haire, M; Halyo, V; Hamel de Monchenault, G; Hamon, O; Harrison, P F; Harrison, T J; Hart, A J; Hart, P A; Hartfiel, B L; Harton, J L; Hast, C; Hauke, A; Hawkes, C M; Hearty, C; Held, T; Hertzbach, S S; Heusch, C A; Hicheur, A; Hill, E J; Hitlin, D G; Höcker, A; Hodgkinson, M C; Hollar, J J; Honscheid, K; Hrynóva, T; Hufnagel, D; Hulsbergen, W D; Hutchcroft, D E; Igonkina, O; Innes, W R; Ivanchenko, V N; Izen, J M; Jackson, P D; Jackson, P S; Jacobsen, R G; Jawahery, A; Jayatilleke, S M; Jessop, C P; John, M J J; Johnson, J R; Judd, D; Kadel, R W; Kadyk, J; Kagan, H; Karyotakis, Yu; Kass, R; Kelly, M P; Kelsey, M H; Kerth, L T; Khan, A; Kim, H; Kim, P; Kirkby, D; Kitayama, I; Knecht, N S; Koch, H; Kocian, M L; Kofler, R; Kolomensky, Yu G; Koptchev, V B; Kovalskyi, D; Kowalewski, R V; Kozanecki, Witold; Kravchenko, E A; Krishnamurthy, M; Kroeger, R; Kroseberg, J; Kukartsev, G; Kutter, P E; Kyberd, P; Lacker, H M; Lae, C K; Lafferty, G D; Lamsa, J; Lanceri, L; Lange, D J; Langenegger, U; Lankford, A J; Laplace, S; Latham, T E; Lau, Y P; Lavin, D; Lazzaro, A; Le Diberder, F R; Lees, J P; Legendre, M; Leith, D W G S; Lepeltier, V; Leruste, P; Lewandowski, B; Li Gioi, L; Li, H; Libby, J; Lillard, V; Lista, L; Liu, R; LoSecco, J M; Lo Vetere, M; Lockman, W S; Lombardo, V; London, G W; Long, O; Lou, X C; Lu, A; Lü, C; Luitz, S; Luppi, E; Lusiani, A; Lüth, V; Lutz, A M; Lynch, G; Lynch, H L; Lyon, A J; MacFarlane, D B; Macri, M; Malcles, J; Mallik, U; Mancinelli, G; Mandelkern, M A; Manfredi, P F; Mangeol, D J J; Marchiori, G; Margoni, M; Marsiske, H; Martínez-Vidal, F; Mattison, T S; Mayer, B; Mazur, M A; Mazzoni, M A; McKenna, J A; McMahon, T R; Meadows, B T; Messner, R; Meyer, T I; Meyer, W T; Miftakov, V; Mihályi, A; Mir, L M; Mohanty, G B; Mohapatra, A K; Mommsen, R K; Monge, M R; Monorchio, D; Moore, T B; Morandin, M; Morgan, S E; Morganti, M; Morganti, S; Morii, M; Morton, G W; Muheim, F; Müller, D R; Müller-Pfefferkorn, R; Narsky, I; Nash, J A; Nauenberg, U; Neal, H; Negrini, M; Neri, N; Nesom, G; Nicholson, H; Nikolich, M B; Nogowski, R; O'Grady, C P; Ocariz, J; Oddone, P J; Ofte, I; Olaiya, E O; Olivas, A; Olsen, J; Onuchin, A P; Orimoto, T J; Otto, S; Ozcan, V E; Paar, H P; Paick, K; Palano, A; Palombo, F; Pan, Y; Panetta, J; Panvini, R S; Paoloni, E; Paolucci, P; Parry, R J; Passaggio, S; Patel, P M; Patrignani, C; Patteri, P; Payne, D J; Pelizaeus, M; Perazzo, A; Perl, M; Peruzzi, I M; Petersen, B A; Petersen, T C; Petrak, S; Petzold, A; Piatenko, T; Piccolo, D; Piccolo, M; Piemontese, L; Pierini, M; Pioppi, M; Piredda, G; Pivk, M; Plaszczynski, S; Playfer, S; Pompili, A; Poropat, P; Porter, F C; Posocco, M; Potter, C T; Prell, S; Prepost, R; Pripstein, M; Pulliam, T; Purohit, M V; Qi, N D; Rahatlou, S; Rahimi, A M; Rama, M; Rankin, P; Ratcliff, B N; Raven, G; Re, V; Reidy, J; Ricciardi, S; Richman, J D; Ritchie, J L; Rizzo, G; Roat, C; Roberts, D A; Robertson, S H; Robutti, E; Roe, N A; Röthel, W; Ronan, Michael T; Roney, J M; Rong, G; Roodman, A; Roos, L; Rosenberg, E I; Rotondo, M; Rubin, A E; Ryd, A; Saeed, M A; Safai-Tehrani, F; Saleem, M; Salnikov, A A; Salvatore, F; Samuel, A; Sanders, D A; Sandrelli, F; Santroni, A; Saremi, S; Sarti, A; Satpathy, A; Schalk, T; Schindler, R H; Schott, G; Schrenk, S; Schubert, J; Schubert, Klaus R; Schumm, B A; Schune, M H; Schwiening, J; Schwierz, R; Schwitters, R F; Sciacca, C; Sciolla, G; Seiden, A; Sekula, S J; Serednyakov, S I; Sharma, V; Shelkov, V G; Shen, B C; Simani, M C; Simi, G; Simonetto, F; Sinev, N B; Skovpen, Yu I; Sloane, R J; Smith, A J S; Smith, J G; Snoek, H L; Snyder, A; Sobie, R J; Soffer, A; Soha, A; Sokoloff, M D; Solodov, E P; Spaan, B; Spanier, S M; Spradlin, P; Stängle, H; Steinke, M; Stelzer, J; Stoker, D P; Stroili, R; Strom, D; Stugu, B; Su, D; Sullivan, M K; Summers, D J; Sundermann, J E; T'Jampens, S; Tan, P; Tantot, L; Taras, P; Taylor, F; Taylor, G P; Telnov, A V; Teodorescu, L; Ter-Antonian, R; Therin, G; Thiebaux, C; Thiessen, D; Tiozzo, G; Tisserand, V; Toki, W H; Torrence, E; Tosi, S; Touramanis, C; Treadwell, E; Vasileiadis, G; Vasseur, G; Vavra, J; Verderi, M; Verkerke, W; Vitale, L; Voci, C; Voena, C; Vuagnin, G; Wagner, G; Wagner, S R; Wagoner, D E; Waldi, R; Walsh, J; Wang, K; Wang, P; Wappler, F R; Watson, A T; Weaver, M; Weidemann, A W; Weinstein, A J R; Wenzel, W A; Wilden, L; Williams, D C; Williams, J C; Willocq, S; Wilson, F F; Wilson, J R; Wilson, M G; Wilson, R J; Winter, M A; Wisniewski, W J; Wittgen, M; Won, E; Wong, Q K; Wormser, G; Wright, D H; Wright, D M; Wu, J; Wu, S L; Xie, Y; Yamamoto, R K; Yang, S; Yarritu, A K; Ye, S; Yéche, C; Yi, J; Young, C C; Yu, Z; Yumiceva, F X; Yushkov, A N; Zallo, A; Zeng, Q; Zghiche, A; Zhang, J; Zhang, L; Zhao, H W; Zhu, Y S; Zito, M; De Sangro, R; La Vaissière, C de

    2004-01-01

    We report on the search for the factorization suppressed decays B -> chi_c0 K(*) and B -> chi_c2 K(*), with chi_c0 and chi_c2 decaying into J/psi gamma. We use a sample of 124 million BBbar events collected with the BABAR detector at the PEP-II storage ring at the Stanford Linear Accelerator Center. No significant signal is found and upper bounds for the branching fractions are obtained. All results are preliminary.

  4. chi_c0 and chi_c2 Decays into eta eta, eta eta', and eta' eta' Final States

    CERN Document Server

    Adams, G S; Cummings, J P; Danko, I; Napolitano, J; He, Q; Insler, J; Muramatsu, H; Park, C S; Thorndike, E H; Yang, F; Coan, T E; Gao, Y S; Artuso, M; Blusk, S; Butt, J; Li, J; Menaa, N; Mountain, R; Nisar, S; Randrianarivony, K; Sia, R; Skwarnicki, T; Stone, S; Wang, J C; Zhang, K; Csorna, S E; Bonvicini, G; Cinabro, D; Dubrovin, M; Lincoln, A; Asner, D M; Edwards, K W; Briere, R A; Chen, J; Ferguson, T; Tatishvili, G T; Vogel, H; Watkins, M E; Rosner, J L; Adam, N E; Alexander, J P; Berkelman, K; Cassel, D G; Duboscq, J E; Ecklund, K M; Ehrlich, R; Fields, L; Galik, R S; Gibbons, L; Gray, R; Gray, S W; Hartill, D L; Heltsley, B K; Hertz, D; Jones, C D; Kandaswamy, J; Kreinick, D L; Kuznetsov, V E; Mahlke-Krüger, H; Onyisi, P U E; Patterson, J R; Peterson, D; Pivarski, J; Riley, D; Ryd, A; Sadoff, A J; Schwarthoff, H; Shi, X; Stroiney, S; Sun, W M; Wilksen, T; Weinberger, M; Athar, S B; Patel, R; Potlia, V; Yelton, J; Rubin, P; Cawlfield, C; Eisenstein, B I; Karliner, I; Kim, D; Lowrey, N; Naik, P; Sedlack, C; Selen, M; White, E J; Wiss, J; Mitchell, R E; Shepherd, M R; Besson, D; Pedlar, T K; Cronin-Hennessy, D; Gao, K Y; Hietala, J; Kubota, Y; Klein, T; Lang, B W; Poling, R; Scott, A W; Smith, A; Zweber, P; Dobbs, S; Metreveli, Z V; Seth, K K; Tomaradze, A G; Ernst, J; Severini, H; Dytman, S A; Love, W; Savinov, V; Aquines, O; Li, Z; López, A; Mehrabyan, S S; Méndez, H; Ramírez, J; Huang, G S; Miller, D H; Pavlunin, V; Sanghi, B; Shipsey, I P J; Xin, B; al, et

    2006-01-01

    Using a sample of 3 x 10^6 psi(2S) decays collected by the CLEO III and CLEO_c detector configurations, we present results of a study of \\chi_{c0} and \\chi_{c2} decays into eta-eta, eta-etaprime, and etaprime-etaprime final states. We find B(chi_{c0} -> eta-eta)= (0.31+-0.05+-0.04+-0.02)%, B(chi_{c0} -> eta-etaprime) etaprime-etaprime) = (0.17 +- 0.04 +-0.02 +-0.01)%. We also present upper limits for the decays of \\chi_{c2} into these final states. These results give information on the decay mechanism of \\chi_c states into pseudoscalars.

  5. Square Planar Monopole Antenna

    OpenAIRE

    Ammann, Max

    1999-01-01

    A planar monopole may be realised by replacing the wire element of a conventional monopole with a planar element. In this case, the planar element which is square, is located above a groundplane and fed using an SMA connector as illustrated. The square monopole has a simple geometry and a smaller bandwidth compared to the circular-disc monopole. However, it is still a broadband antenna with a typical impedance bandwidth of 75 % at S band. This broadband antenna shows a constant radiation patt...

  6. Community Recovery and Sustainable Development in the Region of Seismic Center in Taiwan after the 1999 CHI-CHI Earthquake

    OpenAIRE

    Hsiu-Jen Jennifer, Yeh

    2006-01-01

    International audience The major purpose of this study is to evaluate the progress of community recovery and sustainable development of the region of seismic centre in Taiwan after the 1999 Chi-Chi Earthquake. Data analyzed in this study were collected from a face-to-face interview survey conducted in the research site of Tzu-Shan Town, Nan-Tau County, an area close to the epicentre of Chi-Chi Town, Nan-Tau County. The analysis of this study indicates that before the earthquake the residen...

  7. Dicty_cDB: CHI458 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHI458 (Link to dictyBase) - - - Contig-U15607-1 CHI458P (Link to Original ... n*il nnnnynknnhqkhtlkkhkn*nkkkke*nn*kkiekimfqkv*lk*mis *qnlnh*ikll nlfhqmvivyikqlqtny*likilmkkrvkvmqrn*eq* ...

  8. The empirical likelihood goodness-of-fit test for regression model

    Institute of Scientific and Technical Information of China (English)

    Li-xing ZHU; Yong-song QIN; Wang-li XU

    2007-01-01

    Goodness-of-fit test for regression modes has received much attention in literature. In this paper, empirical likelihood (EL) goodness-of-fit tests for regression models including classical parametric and autoregressive (AR) time series models are proposed. Unlike the existing locally smoothing and globally smoothing methodologies, the new method has the advantage that the tests are self-scale invariant and that the asymptotic null distribution is chi-squared. Simulations are carried out to illustrate the methodology.

  9. A randomized controlled trial of Tai chi for balance, sleep quality and cognitive performance in elderly Vietnamese

    Directory of Open Access Journals (Sweden)

    Nguyen MH

    2012-06-01

    Full Text Available Manh Hung Nguyen, Andreas KruseInstitute of Gerontology, Heidelberg University, Heidelberg, GermanyObjective: To evaluate the effects of Tai chi exercise on balance, sleep quality, and cognitive performance in community-dwelling elderly in Vinh city, Vietnam.Design: A randomized controlled trial.Participants: One hundred two subjects were recruited.Intervention: Subjects were divided randomly into two groups. The Tai chi group was assigned 6 months' Tai chi training. The control group was instructed to maintain their routine daily activities.Outcome measures: The Falls Efficacy Scale (FES, Pittsburgh Sleep Quality Index (PSQI, and Trail Making Test (TMT were used as primary outcome measures.Results: Participants in the Tai chi group reported significant improvement in TMT (part A (F [1, 71] = 78.37, P < 0.001 and in TMT (part B, (F [1, 71] = 175.00, P < 0.001 in comparison with the control group. Tai chi participants also reported better scores in FES (F [1, 71] = 96.90, P < 0.001 and in PSQI (F [1,71] = 43.69, P = 0.001 than the control group.Conclusion: Tai chi is beneficial to improve balance, sleep quality, and cognitive performance of the elderly.Keywords: Tai chi, sleep, balance 

  10. Cross-Sectional Comparison of Executive Attention Function in Normally Aging Long-Term T'ai Chi, Meditation, and Aerobic Fitness Practitioners Versus Sedentary Adults

    OpenAIRE

    Hawkes, Teresa D; Manselle, Wayne; Woollacott, Marjorie H

    2014-01-01

    This cross-sectional field study documented the effect of long-term t'ai chi, meditation, or aerobic exercise training versus a sedentary lifestyle on executive function. It was predicted that long-term training in t'ai chi and meditation plus exercise would produce greater benefits to executive function than aerobic exercise. T'ai chi and meditation plus exercise include mental and physical training. Fifty-four volunteers were tested: t'ai chi (n=10); meditation+exercise (n=16); aerobic exer...

  11. Site responses in the Taipei basin during the 1999 Chi-Chi, Taiwan earthquake sequence

    International Nuclear Information System (INIS)

    On September 20, 1999 a magnitude ML 7.3 earthquake struck Taichung and Nantou in central Taiwan. Taipei basin located more than 100 km from the epicenter but also had many buildings damaged during the earthquake. In this study we use the main shock and aftershocks data of Chi-Chi earthquake to analyze the site effect of Taipei basin. The results show that the dominant low frequency band response is located in the western part of Taipei basin and Songshan area; the main high frequency band response areas are near the edge of basin. Another hand, comparing the results of amplification pattern with the location of damaged buildings found that the tall damaged buildings are located at the high response areas of low frequency band and the low-rise damaged structures are located at the high response areas of higher frequency band. From these results we can find the relationship between the site amplification and damaged structure distribution in the Taipei basin area during earthquakes. (authors)

  12. Tai Chi Chuan Exercise for Patients with Cardiovascular Disease

    Directory of Open Access Journals (Sweden)

    Ching Lan

    2013-01-01

    Full Text Available Exercise training is the cornerstone of rehabilitation for patients with cardiovascular disease (CVD. Although high-intensity exercise has significant cardiovascular benefits, light-to-moderate intensity aerobic exercise also offers health benefits. With lower-intensity workouts, patients may be able to exercise for longer periods of time and increase the acceptance of exercise, particularly in unfit and elderly patients. Tai Chi Chuan (Tai Chi is a traditional Chinese mind-body exercise. The exercise intensity of Tai Chi is light to moderate, depending on its training style, posture, and duration. Previous research has shown that Tai Chi enhances aerobic capacity, muscular strength, balance, and psychological well-being. Additionally, Tai Chi training has significant benefits for common cardiovascular risk factors, such as hypertension, diabetes mellitus, dyslipidemia, poor exercise capacity, endothelial dysfunction, and depression. Tai Chi is safe and effective in patients with acute myocardial infarction (AMI, coronary artery bypass grafting (CABG surgery, congestive heart failure (HF, and stroke. In conclusion, Tai Chi has significant benefits to patients with cardiovascular disease, and it may be prescribed as an alternative exercise program for selected patients with CVD.

  13. Variation in CHI3LI in relation to type 2 diabetes and related quantitative traits.

    Directory of Open Access Journals (Sweden)

    Camilla Noelle Rathcke

    Full Text Available BACKGROUND: CHI3LI encoding the inflammatory glycoprotein YKL-40 is located on chromosome 1q32.1. YKL-40 is involved in inflammatory processes and patients with Type 2 Diabetes (T2D have elevated circulating YKL-40 levels which correlate with their level of insulin resistance. Interestingly, it has been reported that rs10399931 (-329 G/A of CHI3LI contributes to the inter-individual plasma YKL-40 levels in patients with sarcoidosis, and that rs4950928 (-131 C/G is a susceptibility polymorphism for asthma and a decline in lung function. We hypothesized that single nucleotide polymorphisms (SNPs or haplotypes thereof the CHI3LI locus might influence risk of T2D. The aim of the present study was to investigate the putative association between SNPs and haplotype blocks of CHI3LI and T2D and T2D related quantitative traits. METHODS/PRINCIPAL FINDINGS: Eleven SNPs of CHI3LI were genotyped in 6514 individuals from the Inter99 cohort and 2924 individuals from the outpatient clinic at Steno Diabetes Center. In cas-control studies a total of 2345 T2D patients and 5302 individuals with a normal glucose tolerance test were examined. We found no association between rs10399931 (OR, 0.98 (CI, 0.88-1.10, p = 0.76, rs4950928 (0.98 (0.87-1.10, p = 0.68 or any of the other SNPs with T2D. Similarly, we found no significant association between any of the 11 tgSNPs and T2D related quantitative traits, all p>0.14. None of the identified haplotype blocks of CHI3LI showed any association with T2D, all p>0.16. CONCLUSIONS/SIGNIFICANCE: None of the examined SNPs or haplotype blocks of CHI3LI showed any association with T2D or T2D related quantitative traits. Estimates of insulin resistance and dysregulated glucose homeostasis in T2D do not seem to be accounted for by the examined variations of CHI3LI.

  14. Dicty_cDB: CHI575 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHI575 (Link to dictyBase) - - - Contig-U16427-1 - (Link to Original site) ... yfg*ytlyiyiiq*nviffrtdfrkdgfhr*ry*ihgns*sck*irkryf*ngs ... nl*k*ncykiisins*fsk*csrkcc*mfrfin*ks*rftsnrny*yiik ... n--- Homology vs CSM-cDNA Score E Sequences producing s ignificant alignments: (bits) Value CHI575 (CHI575 ... 003.10. 2 Homology vs DNA Score E Sequences producing s ignificant alignments: (bits) Value N AC116956 |AC ... 12. 7 Homology vs Protein Score E Sequences producing s ignificant alignments: (bits) Value (Q86KD1) RecNa ...

  15. Extrusion Temperature Test for 5B01 Aluminum Alloy Square Tube%5801铝合金方管型材的热挤压温度试验

    Institute of Scientific and Technical Information of China (English)

    蹇海根; 谢幸儿; 尹志民; 胡曼弘; 姜锋

    2011-01-01

    The internal and external surface, exterior angle, welding seam and tensile fracture surface of 5B01 aluminum alloy square tube are investigated by means of macrostructure, scanning electron microscopy and fracture morphology observation, and the extrusion temperature effect on the quality of profile extrusion is studied. The results reveal that the internal and external surface are in good quality and the exterior angle achieves good welding results without any fracture at 430 ℃ extrusion treatment, meanwhile it has good plasticity, shows ductile fracture, and its tension strength, yield strength and elongation rate are 335 MPa, 138 MPa and 26% respectively.%用低倍宏观观察、高倍扫描电镜微观组织观察和断口形貌观察等方法,对5801铝合金方管型材内外表面、外角、焊缝以及力学拉伸断口进行观察,研究了挤压温度对型材挤压质量的影响。结果表明:该合金在430℃时挤压加工,方管型材的内外表面质量好,外角无裂纹,焊合效果良好,型材整体塑性较好,呈韧性断裂,而且具有较好的基本力争性能,抗拉强度、屈服强度和延伸率分别为335MPa,138MPa和26%。

  16. Generalized Reduced Rank Tests using the Singular Value Decomposition

    OpenAIRE

    Kleibergen, F.R.; Paap, R.

    2003-01-01

    We propose a novel statistic to test the rank of a matrix. The rank statistic overcomes deficiencies of existing rank statistics, like: necessity of a Kronecker covariance matrix for the canonical correlation rank statistic of Anderson (1951), sensitivity to the ordering of the variables for the LDU rank statistic of Cragg and Donald (1996) and Gill and Lewbel (1992), a limiting distribution that is not a standard chi-squared distribution for the rank statistic of Robin and Smith (2000) and u...

  17. Generalized reduced rank tests using the singular value decomposition

    OpenAIRE

    Kleibergen, F.R.; Paap, R.

    2002-01-01

    We propose a novel statistic to test the rank of a matrix. The rank statistic overcomes deficiencies of existing rank statistics, like: necessity of a Kronecker covariance matrix for the canonical correlation rank statistic of Anderson (1951), sensitivity to the ordering of the variables for the LDU rank statistic of Cragg and Donald (1996) and Gill and Lewbel (1992), a limiting distribution that is not a standard chi-squared distribution for the rank statistic of Robin and Smith (2000) and u...

  18. The Square Kilometre Array

    CERN Document Server

    Rawlings, Steve

    2011-01-01

    We review the current status of the Square Kilometre Array (SKA) by outlining the science drivers for its Phase-1 (SKA1) and setting out the timeline for the key decisions and milestones on the way to the planned start of its construction in 2016. We explain how Phase-2 SKA (SKA2) will transform the research scope of the SKA infrastructure, placing it amongst the great astronomical observatories and survey instruments of the future, and opening up new areas of discovery, many beyond the confines of conventional astronomy.

  19. Use of dipole sum rules to estimate upper and lower bounds for radiative and total widths of chi (3414), chi (3508), and chi (3552)

    International Nuclear Information System (INIS)

    Upper and lower bounds on the widths for chi/sub J/→γpsi (3095) can be estimated by assuming E1 transitions and approximate Russell-Saunders coupling for the cc-bar system. Experimental widths for psi (3684) →γchi/sub J/ the lower bound more restrictive, giving radiative widths of 160→240, 230→400, and 280→480 keV for 3414-, 3508-, and 3552-MeV states, respectively. Cascade branching ratio data permit estimation of the total widths as >1.6, 0.3-1.5, and 0.6-4 MeV, respectively

  20. Tai chi: physiological characteristics and beneficial effects on health

    OpenAIRE

    Li, J.; Hong, Y.; Chan, K.

    2001-01-01

    Objectives—To assess the characteristic effects of Tai Chi Chuan (TCC) exercise on metabolism and cardiorespiratory response, and to measure its effect on cardiorespiratory function, mental control, immune capacity, and the prevention of falls in elderly people.

  1. Dicty_cDB: CHI228 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHI228 (Link to dictyBase) - - - Contig-U16517-1 - (Link to Original site) ... *edmqvqv* ekviy*elkiffhlqevllnvvykvfqifilninhyymif*ivf *rtn*kkplihtyqql nqerdhkm*lylwlvvslmkrh*pftllil*ilv ...

  2. ELMO Bumpy Square proposal

    International Nuclear Information System (INIS)

    The ELMO Bumpy Square (EBS) concept consists of four straight magnetic mirror arrays linked by four high-field corner coils. Extensive calculations show that this configuration offers major improvements over the ELMO Bumpy Torus (EBT) in particle confinement, heating, transport, ring production, and stability. The components of the EBT device at Oak Ridge National Laboratory can be reconfigured into a square arrangement having straight sides composed of EBT coils, with new microwave cavities and high-field corners designed and built for this application. The elimination of neoclassical convection, identified as the dominant mechanism for the limited confinement in EBT, will give the EBS device substantially improved confinement and the flexibility to explore the concepts that produce this improvement. The primary goals of the EBS program are twofold: first, to improve the physics of confinement in toroidal systems by developing the concepts of plasma stabilization using the effects of energetic electrons and confinement optimization using magnetic field shaping and electrostatic potential control to limit particle drift, and second, to develop bumpy toroid devices as attractive candidates for fusion reactors. This report presents a brief review of the physics analyses that support the EBS concept, discussions of the design and expected performance of the EBS device, a description of the EBS experimental program, and a review of the reactor potential of bumpy toroid configurations. Detailed information is presented in the appendices

  3. User's manual for ANALYZE: a variable-rate, multiple-well, least-squares matching routine for well-test analysis

    Energy Technology Data Exchange (ETDEWEB)

    McEdwards, D.G.; Benson, S.M.

    1981-07-01

    ANALYZE is a history-matching program designed for pressure-transient analysis of well tests in single-phase, fluid-saturated reservoirs. Both interference tests and production tests can be analyzed to yield reservoir transmissivity (kh/..mu..), storativity (phi ch), and hydrologic boundaries. An analytic solution is used to calculate the pressure drawdown/buildup in an idealized reservoir system. A schematic of the basic reservoir/well model assumed by the computational algorithm is shown. The reservoir is assumed to be an isothermal, isotropic, homogeneous, porous medium of constant thickness and infinite areal extent. The production well is modeled as a line source which fully penetrates the reservoir. The flow into the well is radial and uniformly distributed over the height of the well (gravity effects neglected).

  4. Tai Chi Chuan Exercise for Patients with Cardiovascular Disease

    OpenAIRE

    Ching Lan; Ssu-Yuan Chen; May-Kuen Wong; Jin Shin Lai

    2013-01-01

    Exercise training is the cornerstone of rehabilitation for patients with cardiovascular disease (CVD). Although high-intensity exercise has significant cardiovascular benefits, light-to-moderate intensity aerobic exercise also offers health benefits. With lower-intensity workouts, patients may be able to exercise for longer periods of time and increase the acceptance of exercise, particularly in unfit and elderly patients. Tai Chi Chuan (Tai Chi) is a traditional Chinese mind-body exercise. T...

  5. Tai Chi Quan and Stroke Prevention and Rehabilitation

    OpenAIRE

    Yoshinaga, Shuri; Cai, Dingfang

    2013-01-01

    Stroke is a major cause of mortality and disability across the globe and remains the third leading cause of death in China, with the total stroke incidence increasing 6.7% annually from 1984 to 2004. The prevention of strokes is more important than their treatment. Tai Chi Quan is a slow and graceful Chinese exercise that includes a form of mindful meditation known for its health benefits. Many studies have shown that Tai Chi Quan not only improves gait, balance cap...

  6. Dicty_cDB: CHI718 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHI718 (Link to dictyBase) - G20569 DDB0188420 Contig-U11787-1 CHI718P (Lin ... 4 (Q9QZ71) RecName: Full=Xenotropic and polytropic retrovirus ... rece... 82 2e-14 (Q9R031) RecName: Full=Xenotropic ... and polytropic retrovirus ... rece... 82 2e-14 AF131096_1( AF131096 |pid:none) M ...

  7. Search for the Z_1(4050)^+ and Z_2(4250)^+ States in bar B^0 to chi_{c1} K^- pi^+ and B^+ to chi_{c1} K^0_S pi^+

    Energy Technology Data Exchange (ETDEWEB)

    Lees, J.P.; Poireau, V.; Tisserand, V.; /Annecy, LAPP; Garra Tico, J.; Grauges, E.; /Barcelona U., ECM; Martinelli, M.; /INFN, Bari /Bari U.; Milanes, D.A.; /INFN, Bari; Palano, A.; Pappagallo, M.; /INFN, Bari /Bari U.; Eigen, G.; Stugu, B.; /Bergen U.; Brown, D.N.; Kerth, L.T.; Kolomensky, Yu.G.; Lynch, G.; /UC, Berkeley; Koch, H.; Schroeder, T.; /Ruhr U., Bochum; Asgeirsson, D.J.; Hearty, C.; Mattison, T.S.; McKenna, J.A.; /British Columbia U. /Brunel U. /Novosibirsk, IYF /UC, Irvine /UC, Riverside /UC, Santa Barbara /UC, Santa Cruz /Caltech /Cincinnati U. /Colorado U. /Colorado State U. /Dortmund U. /Dresden, Tech. U. /Ecole Polytechnique /Edinburgh U. /INFN, Ferrara /Ferrara U. /INFN, Ferrara /Ferrara U. /INFN, Ferrara /Frascati /INFN, Genoa /Genoa U. /INFN, Genoa /INFN, Genoa /Genoa U. /INFN, Genoa /Indian Inst. Tech., Guwahati /Harvard U. /Harvey Mudd Coll. /Heidelberg U. /Humboldt U., Berlin /Imperial Coll., London /Iowa State U. /Iowa State U. /Johns Hopkins U. /Paris U., VI-VII /LLNL, Livermore /Liverpool U. /Queen Mary, U. of London /Royal Holloway, U. of London /Royal Holloway, U. of London /Louisville U. /Mainz U., Inst. Kernphys. /Manchester U. /Maryland U. /Massachusetts U., Amherst /MIT /McGill U. /INFN, Milan /Milan U. /Mississippi U. /Montreal U. /INFN, Naples /Naples U. /NIKHEF, Amsterdam /NIKHEF, Amsterdam /Notre Dame U. /Ohio State U. /Oregon U. /INFN, Padua /Padua U. /INFN, Padua /INFN, Padua /Padua U. /Paris U., VI-VII /INFN, Perugia /Perugia U. /INFN, Pisa /Pisa U. /INFN, Pisa /Pisa, Scuola Normale Superiore /INFN, Pisa /Pisa U. /INFN, Pisa /INFN, Pisa /Pisa U. /INFN, Pisa /Princeton U. /INFN, Rome /INFN, Rome /Rome U. /INFN, Rome /INFN, Rome /Rome U. /INFN, Rome /Rostock U. /Rutherford /DAPNIA, Saclay /SLAC /South Carolina U. /Southern Methodist U. /Stanford U., Phys. Dept. /SUNY, Albany /Tel Aviv U. /Tennessee U. /Texas Nuclear Corp., Austin /Texas U., Dallas /INFN, Turin /Turin U. /INFN, Trieste /Trieste U. /Valencia U. /Victoria U. /Warwick U. /Wisconsin U., Madison

    2012-04-10

    We search for the Z{sub 1}(4050){sup +} and Z{sub 2}(4250){sup +} states, reported by the Belle Collaboration, decaying to {chi}{sub c1}{pi}{sup +} in the decays {bar B}{sup 0} {yields} {chi}{sub c1}K{sup -}{pi}{sup +} and B{sup +} {yields} {chi}{sub c1}K{sub S}{sup 0}{pi}{sup +} where {chi}{sub c1} {yields} J/{psi}{gamma}. The data were collected with the BABAR detector at the SLAC PEP-II asymmetric-energy e{sup +}e{sup -} collider operating at center-of-mass energy 10.58 GeV, and correspond to an integrated luminosity of 429 fb{sup -1}. In this analysis, we model the background-subtracted, efficiency-corrected {chi}{sub c1}{pi}{sup +} mass distribution using the K{pi} mass distribution and the corresponding normalized K{pi} Legendre polynomial moments, and then test the need for the inclusion of resonant structures in the description of the {chi}{sub c1}{pi}{sup +} mass distribution. No evidence is found for the Z{sub 1}(4050){sup +} and Z{sub 2}(4250){sup +} resonances, and 90% confidence level upper limits on the branching fractions are reported for the corresponding B-meson decay modes.

  8. Investigating Students' Understanding of Square Numbers and Square Roots

    OpenAIRE

    Hiebert, Erica Jemm Aileen

    2013-01-01

    The ideas related to square numbers and square roots, despite the apparent simplicity, appear problematic to high school students. I inquired into students' understanding of square numbers and square roots, focusing on obstacles that students face in considering these concepts and solution approaches that they prefer. The study followed a modified analytic induction methodology. A written questionnaire was administered to 51 pre-calculus 11 students and followed up with clinical interviews w...

  9. CHI '13 Extended Abstracts on Human Factors in Computing Systems

    DEFF Research Database (Denmark)

    The CHI Papers and Notes program is continuing to grow along with many of our sister conferences. We are pleased that CHI is still the leading venue for research in human-computer interaction. CHI 2013 continued the use of subcommittees to manage the review process. Authors selected the subcommit......The CHI Papers and Notes program is continuing to grow along with many of our sister conferences. We are pleased that CHI is still the leading venue for research in human-computer interaction. CHI 2013 continued the use of subcommittees to manage the review process. Authors selected the...... tremendous amount of work from all areas of the human-computer interaction community. As co-chairs of the process, we are amazed at the ability of the community to organize itself to accomplish this task. We would like to thank the 2680 individual reviewers for their careful consideration of these papers. We...... that you enjoy these papers and notes, which represent the best research in human-computer interaction....

  10. A note on the asymptotic distribution of likelihood ratio tests to test variance components.

    Science.gov (United States)

    Visscher, Peter M

    2006-08-01

    When using maximum likelihood methods to estimate genetic and environmental components of (co)variance, it is common to test hypotheses using likelihood ratio tests, since such tests have desirable asymptotic properties. In particular, the standard likelihood ratio test statistic is assumed asymptotically to follow a chi2 distribution with degrees of freedom equal to the number of parameters tested. Using the relationship between least squares and maximum likelihood estimators for balanced designs, it is shown why the asymptotic distribution of the likelihood ratio test for variance components does not follow a chi2 distribution with degrees of freedom equal to the number of parameters tested when the null hypothesis is true. Instead, the distribution of the likelihood ratio test is a mixture of chi2 distributions with different degrees of freedom. Implications for testing variance components in twin designs and for quantitative trait loci mapping are discussed. The appropriate distribution of the likelihood ratio test statistic should be used in hypothesis testing and model selection. PMID:16899155

  11. THE EFFECTS OF TAI CHI CHUAN COMBINED WITH VIBRATION TRAINING ON BALANCE CONTROL AND LOWER EXTREMITY MUSCLE POWER

    Directory of Open Access Journals (Sweden)

    Pao-Hung Chung

    2013-03-01

    Full Text Available The aim of this study was to determine whether performing Tai Chi Chuan on a customized vibration platform could enhance balance control and lower extremity muscle power more efficiently than Tai Chi Chuan alone in an untrained young population. Forty-eight healthy young adults were randomly assigned to the following three groups: a Tai Chi Chuan combined with vibration training group (TCV, a Tai Chi Chuan group (TCC or a control group. The TCV group underwent 30 minutes of a reformed Tai Chi Chuan program on a customized vibration platform (32 Hz, 1 mm three times a week for eight weeks, whereas the TCC group was trained without vibration stimuli. A force platform was used to measure the moving area of a static single leg stance and the heights of two consecutive countermovement jumps. The activation of the knee extensor and flexor was also measured synchronously by surface electromyography in all tests. The results showed that the moving area in the TCV group was significantly decreased by 15.3%. The second jump height in the TCV group was significantly increased by 8.14%, and the activation of the knee extensor/flexor was significantly decreased in the first jump. In conclusion, Tai Chi Chuan combined with vibration training can more efficiently improve balance control, and the positive training effect on the lower extremity muscle power induced by vibration stimuli still remains significant because there is no cross-interaction between the two different types of training methods.

  12. Bayesian least squares deconvolution

    Science.gov (United States)

    Asensio Ramos, A.; Petit, P.

    2015-11-01

    Aims: We develop a fully Bayesian least squares deconvolution (LSD) that can be applied to the reliable detection of magnetic signals in noise-limited stellar spectropolarimetric observations using multiline techniques. Methods: We consider LSD under the Bayesian framework and we introduce a flexible Gaussian process (GP) prior for the LSD profile. This prior allows the result to automatically adapt to the presence of signal. We exploit several linear algebra identities to accelerate the calculations. The final algorithm can deal with thousands of spectral lines in a few seconds. Results: We demonstrate the reliability of the method with synthetic experiments and we apply it to real spectropolarimetric observations of magnetic stars. We are able to recover the magnetic signals using a small number of spectral lines, together with the uncertainty at each velocity bin. This allows the user to consider if the detected signal is reliable. The code to compute the Bayesian LSD profile is freely available.

  13. Bayesian least squares deconvolution

    CERN Document Server

    Ramos, A Asensio

    2015-01-01

    Aims. To develop a fully Bayesian least squares deconvolution (LSD) that can be applied to the reliable detection of magnetic signals in noise-limited stellar spectropolarimetric observations using multiline techniques. Methods. We consider LSD under the Bayesian framework and we introduce a flexible Gaussian Process (GP) prior for the LSD profile. This prior allows the result to automatically adapt to the presence of signal. We exploit several linear algebra identities to accelerate the calculations. The final algorithm can deal with thousands of spectral lines in a few seconds. Results. We demonstrate the reliability of the method with synthetic experiments and we apply it to real spectropolarimetric observations of magnetic stars. We are able to recover the magnetic signals using a small number of spectral lines, together with the uncertainty at each velocity bin. This allows the user to consider if the detected signal is reliable. The code to compute the Bayesian LSD profile is freely available.

  14. Generalized conjugate gradient squared

    Energy Technology Data Exchange (ETDEWEB)

    Fokkema, D.R.; Sleijpen, G.L.G. [Utrecht Univ. (Netherlands)

    1994-12-31

    In order to solve non-symmetric linear systems of equations, the Conjugate Gradient Squared (CGS) is a well-known and widely used iterative method. In practice the method converges fast, often twice as fast as the Bi-Conjugate Gradient method. This is what you may expect, since CGS uses the square of the BiCG polynomial. However, CGS may suffer from its erratic convergence behavior. The method may diverge or the approximate solution may be inaccurate. BiCGSTAB uses the BiCG polynomial and a product of linear factors in an attempt to smoothen the convergence. In many cases, this has proven to be very effective. Unfortunately, the convergence of BiCGSTAB may stall when a linear factor (nearly) degenerates. BiCGstab({ell}) is designed to overcome this degeneration of linear factors. It generalizes BiCGSTAB and uses both the BiCG polynomial and a product of higher order factors. Still, CGS may converge faster than BiCGSTAB or BiCGstab({ell}). So instead of using a product of linear or higher order factors, it may be worthwhile to look for other polynomials. Since the BiCG polynomial is based on a three term recursion, a natural choice would be a polynomial based on another three term recursion. Possibly, a suitable choice of recursion coefficients would result in method that converges faster or as fast as CGS, but less erratic. It turns out that an algorithm for such a method can easily be formulated. One particular choice for the recursion coefficients leads to CGS. Therefore one could call this algorithm generalized CGS. Another choice for the recursion coefficients leads to BiCGSTAB. It is therefore possible to mix linear factors and some polynomial based on a three term recursion. This way one may get the best of both worlds. The authors will report on their findings.

  15. Approximating Probability Levels for Testing Null Hypotheses with Noncentral F Distributions.

    Science.gov (United States)

    Fowler, Robert L.

    1984-01-01

    This study compared two approximations for normalizing noncentral F distributions: one based on the square root of the chi-square distribution (SRA), the other derived from a cube root of the chi-square distribution (CRA). The CRA was superior, and generally provided an excellent approximation for noncentral F. (Author/BW)

  16. A semiparametric Wald statistic for testing logistic regression models based on case-control data

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    We propose a semiparametric Wald statistic to test the validity of logistic regression models based on case-control data. The test statistic is constructed using a semiparametric ROC curve estimator and a nonparametric ROC curve estimator. The statistic has an asymptotic chi-squared distribution and is an alternative to the Kolmogorov-Smirnov-type statistic proposed by Qin and Zhang in 1997, the chi-squared-type statistic proposed by Zhang in 1999 and the information matrix test statistic proposed by Zhang in 2001. The statistic is easy to compute in the sense that it requires none of the following methods: using a bootstrap method to find its critical values, partitioning the sample data or inverting a high-dimensional matrix. We present some results on simulation and on analysis of two real examples. Moreover, we discuss how to extend our statistic to a family of statistics and how to construct its Kolmogorov-Smirnov counterpart.

  17. Effects of the hanging wall and footwall on peak acceleration during the Jiji (Chi-Chi), Taiwan Province, earthquake

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    The M=7.6 Jiji (Chi-Chi) earthquake, Taiwan Province, on September 21, 1999 (local time) is a thrust fault style earthquake. The empirical attenuation relations of the horizontal and vertical peak ground accelerations (PGA) for the Jiji (Chi-Chi) earthquake are developed by regression method. By examining the residuals from the Jiji (Chi-Chi) earthquake-specific peak acceleration attenuation relations, it is found that there are systematic differences between PGA on the hanging-wall and footwall. The recorded peak accelerations are higher on the hanging-wall and lower on the footwall. The clear asymmetry of PGA distribution to the surface rupture trace can also be seen from the PGA contour map. These evidences indicate that the PGA attenuates faster on the hanging-wall than on the footwall. In the study of near-source strong motion, seismic hazard assessment, scenario earthquake and seis-mic disaster prediction, the style-of-faulting must be considered in order that the attenuation model can reflect the characteristic of ground motion in various seismic environmental regions.

  18. Conjectures and experiments concerning the moments of $L(1/2,\\chi_d)$

    CERN Document Server

    Alderson, Matthew W

    2011-01-01

    We report on some extensive computations and experiments concerning the moments of quadratic Dirichlet $L$-functions at the critical point. We computed the values of $L(1/2,\\chi_d)$ for $- 5\\times 10^{10} < d < 1.3 \\times 10^{10}$ in order to numerically test conjectures concerning the moments $\\sum_{|d|chi_d)^k$. Specifically, we tested the full asymptotics for the moments conjectured by Conrey, Farmer, Keating, Rubinstein, and Snaith, as well as the conjectures of Diaconu, Goldfeld, Hoffstein, and Zhang concerning additional lower terms in the moments. We also describe the algorithms used for this large scale computation.

  19. Physiological responses to Tai Chi in stable patients with COPD.

    Science.gov (United States)

    Qiu, Zhi-Hui; Guo, Hong-Xi; Lu, Gan; Zhang, Ning; He, Bai-Ting; Zhou, Lian; Luo, Y M; Polkey, M I

    2016-01-15

    We compared the physiological work, judged by oxygen uptake, esophageal pressure swing and diaphragm electromyography, elicited by Tai Chi compared with that elicited by constant rate treadmill walking at 60% of maximal load in eleven patients with COPD (Mean FEV1 61% predicted, FEV1/FVC 47%). Dynamic hyperinflation was assessed by inspiratory capacity and twitch quadriceps tension (TwQ) elicited by supramaximal magnetic stimulation of the femoral nerve was also measured before and after both exercises. The EMGdi and esophageal pressure at the end of exercise were similar for both treadmill exercise and Tai Chi (0.109±0.047 mV vs 0.118±0.061 mV for EMGdi and 22.3±7.1 cmH2O vs 21.9±8.1 cmH2O for esophageal pressure). Moreover the mean values of oxygen uptake during Tai Chi and treadmill exercise did not differ significantly: 11.3 ml/kg/min (51.1% of maximal oxygen uptake derived from incremental exercise) and 13.4 ml/kg/min (52.5%) respectively, p>0.05. Respiratory rate during Tai Chi was significantly lower than that during treadmill exercise. Both Tai Chi and treadmill exercise elicited a fall in IC at end exercise, indicating dynamic hyperinflation, but this was statistically significant only after treadmill exercise. TwQ decreased significantly after Tai Chi but not after treadmill. We conclude that Tai Chi constitutes a physiologically similar stimulus to treadmill exercise and may therefore be an acceptable modality for pulmonary rehabilitation which may be culturally more acceptable in some parts of the world. PMID:26549554

  20. Comparison of remove-compute-restore and least squares modification of Stokes' formula techniques to quasi-geoid determination over the Auvergne test area

    DEFF Research Database (Denmark)

    Yildiz, H.; Forsberg, René; Ågren, J.; Tscherning, C.; Sjöberg, L.

    2012-01-01

    Auvergne test area. All methods showed a reasonable agreement with GPS-levelling data, in the order of a 3-3.5 cm in the central region having relatively smooth topography, which is consistent with the accuracies of GPS and levelling. When a 1-parameter fit is used, the FFT method using kernel modification...... performs best with 3.0 cm r.m.s difference with GPS-levelling while the LSMS method gives the best agreement with GPS-levelling with 2.4 cm r.m.s after a 4-parameter fit is used. However, the quasi-geoid models derived using two techniques differed from each other up to 33 cm in the high mountains near the...

  1. METHODS FOR TESTING DISCRIMINANT VALIDITY

    Directory of Open Access Journals (Sweden)

    Adriana ZAIŢ

    2011-01-01

    Full Text Available The study presents three methods which can be used to assess discriminant validity for multi-item scales. Q-sorting is presented as a method that can be used in early stages of research, being more exploratory, while the chi-square difference test and the average variance extracted analysis are recommended for the confirmatory stages of research. The paper describes briefly the three methods and presents evidence from two surveys that aimed to develop a scale for measuring perceived risk in e-commerce.

  2. Squaring the Magic

    CERN Document Server

    Cacciatori, Sergio L; Marrani, Alessio

    2012-01-01

    We construct and classify all possible Magic Squares (MS's) related to Euclidean or Lorentzian rank-3 simple Jordan algebras, both on normed division algebras and split composition algebras. Besides the known Freudenthal-Rozenfeld-Tits MS, the single-split G\\"unaydin-Sierra-Townsend MS, and the double-split Barton-Sudbery MS, we obtain other 7 Euclidean and 10 Lorentzian novel MS's. We elucidate the role and the meaning of the various non-compact real forms of Lie algebras, entering the MS's as symmetries of theories of Einstein-Maxwell gravity coupled to non-linear sigma models of scalar fields, possibly endowed with local supersymmetry, in D = 3, 4 and 5 space-time dimensions. In particular, such symmetries can be recognized as the U-dualities or the stabilizers of scalar manifolds within space-time with standard Lorentzian signature or with other, more exotic signatures, also relevant to suitable compactifications of the so-called M*- and M'- theories. Symmetries pertaining to some attractor U-orbits of ma...

  3. Effects of an Exercise Program with Tai Chi in Older Women

    Directory of Open Access Journals (Sweden)

    Mónica Andrea Silva-Zemanate

    2014-09-01

    Full Text Available Objective: This research was aimed at determining the effects of an exercise program with the art of Tai Chi in older women. Material and Methods: A quasi-experimental study with a longitudinal cutting was conducted; the study population was a group of elderly in the city of Popayan. It consisted of three phases: in the first one, an initial evaluation of physical capacity (walking, balance, daily basic activities was applied, afterward, the scale of Yesavage for signs of depression, and finally the Folstien Mini Mental Test to assess cognitive functions. In the second phase, a program of Tai Chi exercises in one weekly session for a twelve weeks period was implemented. In the third phase, the evaluation of the results of the program through participant re-evaluating was carried out. Results: The functional capacity improved in all the tested aspects, the difference in walking speed and the static and dynamic balance were statistically significant; in the same way, the cognitive ability improved in all the tested items, statistical significance was found in aspects such as memory, attention, calculation and language. All participants achieved full functionality of the daily basic activities. Conclusions: The application of a Tai Chi technique provides significant benefits in the balance and the cognitive ability of the elderly, leading to a breakthrough in their independent behavior and improving their functional capacity, so it could be recommended as an alternative technique of physiotherapeutic intervention in neuronal rehabilitation.

  4. Asymptotic goodness-of-fit tests for the Palm mark distribution of stationary point processes with correlated marks

    OpenAIRE

    Heinrich, Lothar; Lück, Sebastian; Schmidt, Volker

    2014-01-01

    We consider spatially homogeneous marked point patterns in an unboundedly expanding convex sampling window. Our main objective is to identify the distribution of the typical mark by constructing an asymptotic $\\chi^{2}$-goodness-of-fit test. The corresponding test statistic is based on a natural empirical version of the Palm mark distribution and a smoothed covariance estimator which turns out to be mean square consistent. Our approach does not require independent marks and allows dependences...

  5. The characteristics and relevant factors of Pap smear test use for women with intellectual disabilities in Taiwan

    OpenAIRE

    Yen, Suh-May; Kung, Pei-Tseng; Tsai, Wen-Chen

    2014-01-01

    Background This study examines the Pap smear usage conditions and relevant influential factors for 18,204 women aged 30 years and above with intellectual disabilities, using nationwide data from 2008. Methods The research method of this study is secondary data analysis. The data was obtained from three nationwide databases from 2006 to 2008. This study employed descriptive statistics to analyze the use and rate of Pap smear testing by women with intellectual disabilities. Chi-square test was ...

  6. Consumer Acceptance of Functional Foods in Ho Chi Minh City

    Directory of Open Access Journals (Sweden)

    Duy Tung BUI

    2015-11-01

    Full Text Available The aim of this paper is to identify and evaluate the underlying factors affecting consumer acceptance of functional foods. The contribution of this study is to better understand customer willingness to buy such products in Ho Chi Minh City by shedding light on how socio-demographic, cognitive and attitudinal determinants affect consumer's choices of foods. We conducted a survey using 217 respondents from Ho Chi Minh City. Next, we develop a binary-probit model to quantify the impact of each factor on consumer acceptance. The results show that having a sick relative, beliefs in health benefits positively affect acceptance level. Other than that, old people in Ho Chi Minh City tend to reject the use of functional foods. However, when they are provided with enough knowledge, they are the most intensive buyers of these products. Implications and further researches are also discussed.

  7. A CHI wiggler ubitron amplifier experiment: Wiggler characterization

    Energy Technology Data Exchange (ETDEWEB)

    Taccetti, J.M.; Jackson, R.H.; Freund, H.P. [Naval Research Lab., Washington, DC (United States)] [and others

    1995-12-31

    A 35 GHz CHI (Coaxial Hybrid Iron) wiggler ubitron amplifier experiment is under construction at the Naval Research Laboratory. The CHI wiggler configuration has the potential of generating high wiggler magnetic fields at short periods with excellent beam focusing and transport properties. This makes it a desirable configuration for the generation of high power coherent radiation in relatively compact systems. The CHI wiggler consists of alternating rings of magnetic and non-magnetic materials concentric with a central rod of similar alternating design but shifted along the axis by half a period. Once inserted in a solenoidal magnetic field, the CHI structure deforms the axial field to create a radial field oscillating with the same periodicity as the rings. An annular electron beam is propagated through the coaxial gap where the oscillating radial field imparts an azimuthal wiggle motion. The principal goals of the experiment are to investigate the performance tradeoffs involved in the CHI configuration for high frequency amplifiers operating at low voltages with small wiggler periods. The nominal design parameters are a center frequency of 35 GHz, wiggler period of 0.75 cm, and beam voltage of approximately 150 kV. Calculations have shown an intrinsic (untapered) efficiency of {approximately} 7% when operating at 6.3 kG axial field (wiggler field, B{sub w}{approximately}1270 G). The calculated gain was 36 dB, saturating at a distance of 46 cm. These parameters yield an instantaneous amplifier bandwidth of {approximately} 25%. There appears to be room for further improvement in efficiency, a matter which will be scrutinized more closely in the final design. A prototype CHI wiggler is presently being fabricated for use in conjunction with an existing 30 kG superconducting solenoid. The performance properties of the prototype will be characterized and compared with linear and non-linear calculations.

  8. Observation of B0 -> chi_c0 K*0 and Evidence of B+ -> chi_c0 K*+

    Energy Technology Data Exchange (ETDEWEB)

    Aubert, : B.

    2008-08-13

    The authors present the observation of the decay B{sup 0} {yields} {chi}{sub c0}K*{sup 0} as well as evidence of B{sup +} {yields} {chi}{sub c0}K*{sup +}, with an 8.9 and a 3.6 standard deviation significance, respectively, using a data sample of 454 million {Upsilon}(4S) {yields} B{bar B} decays collected with the BABAR detector at the PEP-II B meson factory located at the Standard Linear Accelerator Center (SLAC). The measured branching fractions are: {Beta}(B{sup 0} {yields} {chi}{sub c0}K*{sup 0}) = (1.7 {+-} 0.3 {+-} 0.2) x 10{sup -4} and {Beta}(B{sup +} {yields} {chi}{sub c0}K*{sup +}) = (1.4 {+-} 0.5 {+-} 0.2) x 10{sup -4}, where the first quoted errors are statistical and the second are systematic. They obtain a branching fraction upper limit of {Beta}(B{sup +} {yields} {chi}{sub c0}K*{sup +}) < 2.1 x 10{sup -4} at the 90% confidence level.

  9. Dicty_cDB: CHI642 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHI642 (Link to dictyBase) - - - Contig-U14351-1 CHI642E (Link to Original ... 37 (Q4G069) RecName: Full=Regulator of microtubule dynamics ... protein... 154 3e-36 AF151848_1( AF151848 |pid:non ... 36 (Q96DB5) RecName: Full=Regulator of microtubule dynamics ... protein... 153 5e-36 (Q5R8E4) RecName: Full=Regula ...

  10. Dicty_cDB: CHI478 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHI478 (Link to dictyBase) - G01678 DDB0185605 Contig-U11784-1 CHI478P (Lin ... lis melanin b... 82 4e-14 ( P07524 ) RecName: Full=Tyrosinase ; EC=1.14.18.1; AltNam... 81 9e-14 AP009493_2447( A ... us subsp. gri... 80 2e-13 ( P06845 ) RecName: Full=Tyrosinase ; EC=1.14.18.1; AltNam... 79 4e-13 A24089( A24089 ) ...

  11. Search for Surface Magnetic Fields in Mira Stars. First Detection in chi Cyg

    CERN Document Server

    Lèbre, A; Fabas, N; Gillet, D; Herpin, F; Konstantinova-Antova, R; Petit, P

    2013-01-01

    In order to complete the knowledge of the magnetic field and of its influence during the transition from Asymptotic Giant Branch to Planetary Nebulae stages, we have undertaken a search for magnetic fields at the surface of Mira stars. We used spectropolarimetric observations, collected with the Narval instrument at TBL, in order to detect - with Least Squares Deconvolution method - a Zeeman signature in the visible part of the spectrum. We present the first spectropolarimetric observations of the S-type Mira star chi Cyg, performed around its maximum light. We have detected a polarimetric signal in the Stokes V spectra and we have established its Zeeman origin. We claim that it is likely to be related to a weak magnetic field present at the photospheric level and in the lower part of the stellar atmosphere. We have estimated the strength of its longitudinal component to about 2-3 Gauss. This result favors a 1/r law for the variation of the magnetic field strength across the circumstellar envelope of chi Cyg....

  12. Variation in CHI3LI in relation to type 2 diabetes and related quantitative traits

    DEFF Research Database (Denmark)

    Rathcke, Camilla Noelle; Holmkvist, Johan; Jørgensen, Torben; Borch-Johnsen, Knut; Hansen, Torben; Pedersen, Oluf; Vestergaard, Henrik

    2009-01-01

    BACKGROUND: CHI3LI encoding the inflammatory glycoprotein YKL-40 is located on chromosome 1q32.1. YKL-40 is involved in inflammatory processes and patients with Type 2 Diabetes (T2D) have elevated circulating YKL-40 levels which correlate with their level of insulin resistance. Interestingly, it...... has been reported that rs10399931 (-329 G/A) of CHI3LI contributes to the inter-individual plasma YKL-40 levels in patients with sarcoidosis, and that rs4950928 (-131 C/G) is a susceptibility polymorphism for asthma and a decline in lung function. We hypothesized that single nucleotide polymorphisms...... 6514 individuals from the Inter99 cohort and 2924 individuals from the outpatient clinic at Steno Diabetes Center. In cas-control studies a total of 2345 T2D patients and 5302 individuals with a normal glucose tolerance test were examined. We found no association between rs10399931 (OR, 0.98 (CI, 0...

  13. Square Source Type Diagram

    Science.gov (United States)

    Aso, N.; Ohta, K.; Ide, S.

    2014-12-01

    Deformation in a small volume of earth interior is expressed by a symmetric moment tensor located on a point source. The tensor contains information of characteristic directions, source amplitude, and source types such as isotropic, double-couple, or compensated-linear-vector-dipole (CLVD). Although we often assume a double couple as the source type of an earthquake, significant non-double-couple component including isotropic component is often reported for induced earthquakes and volcanic earthquakes. For discussions on source types including double-couple and non-double-couple components, it is helpful to display them using some visual diagrams. Since the information of source type has two degrees of freedom, it can be displayed onto a two-dimensional flat plane. Although the diagram developed by Hudson et al. [1989] is popular, the trace corresponding to the mechanism combined by two mechanisms is not always a smooth line. To overcome this problem, Chapman and Leaney [2012] developed a new diagram. This diagram has an advantage that a straight line passing through the center corresponds to the mechanism obtained by a combination of an arbitrary mechanism and a double-couple [Tape and Tape, 2012], but this diagram has some difficulties in use. First, it is slightly difficult to produce the diagram because of its curved shape. Second, it is also difficult to read out the ratios among isotropic, double-couple, and CLVD components, which we want to obtain from the estimated moment tensors, because they do not appear directly on the horizontal or vertical axes. In the present study, we developed another new square diagram that overcomes the difficulties of previous diagrams. This diagram is an orthogonal system of isotropic and deviatoric axes, so it is easy to get the ratios among isotropic, double-couple, and CLVD components. Our diagram has another advantage that the probability density is obtained simply from the area within the diagram if the probability density

  14. Measurement of hadronic production of the chi /sub 1//sup ++/(3507) and the chi /sub 2//sup ++/(3553) through their radiative decay to J/ psi

    CERN Document Server

    Lemoigne, Y; Barate, R; Bareyre, P; Bonamy, P; Borgeaud, P; Brabson, B B; Crittenden, R R; David, M; Duane, A; Gentit, F X; Heinz, R M; King, G J; Krider, J; Laurens, G; Marshall, T; McEwen, J G; Namjoshi, R; Nandi, B C; Pietrzyk, B; Villet, G; Websdale, D M; Wiejak, J; Zaninotti, S

    1982-01-01

    The chi /sub 1//sup ++/(3507) and the chi /sub 2//sup ++/(3553) states have been observed in the Goliath spectrometer at the CERN SPS in 185 GeV/c\\pi^{-}-Be collisions. Their radiative decays contribute 27.7% (for the chi /sub 1//sup ++/) and 12.8% (for the chi /sub 2//sup ++/) to J/ psi production. At this energy, their cross sections are 65+or-19 nb and 96+or-29 nb, respectively.

  15. Anomalous effect in Schumann resonance phenomena observed in Japan, possibly associated with the Chi-chi earthquake in Taiwan

    Directory of Open Access Journals (Sweden)

    M. Hayakawa

    2005-06-01

    Full Text Available The Schumann resonance phenomenon has been monitored at Nakatsugawa (near Nagoya in Japan since the beginning of 1999, and due to the occurance of a severe earthquake (so-called Chi-chi earthquake on 21 September 1999 in Taiwan we have examined our Schumann resonance data at Nakatsugawa during the entire year of 1999. We have found a very anomalous effect in the Schumann resonance, possibly associated with two large land earthquakes (one is the Chi-chi earthquake and another one on 2 November 1999 (Chia-yi earthquake with a magnitude again greater than 6.0. Conspicuous effects are observed for the larger Chi-chi earthquake, so that we summarize the characteristics for this event. The anomaly is characterized mainly by the unusual increase in amplitude of the fourth Schumann resonance mode and a significant frequency shift of its peak frequency (~1.0Hz from the conventional value on the By magnetic field component which is sensitive to the waves propagating in the NS meridian plane. Anomalous Schumann resonance signals appeared from about one week to a few days before the main shock. Secondly, the goniometric estimation of the arrival angle of the anomalous signal is found to coincide with the Taiwan azimuth (the unresolved dual direction indicates toward South America. Also, the pulsed signals, such as the Q-bursts, were simultaneously observed with the "carrier" frequency around the peak frequency of the fourth Schumann resonance mode. The anomaly for the second event for the Chia-yi earthquake on 2 November had much in common. But, most likely due to a small magnitude, the anomaly appears one day before and lasts until one day after the main shock, with the enhancement at the fourth Schumann resonance mode being smaller in amplitude than the case of the Chi-chi earthquake. Yet, the other characteristics, including the goniometric direction finding result, frequency shift, etc., are nearly the same. Although the emphasis of

  16. Multivariate Portmanteau test for Autoregressive models with uncorrelated but nonindependent errors

    OpenAIRE

    Francq, Christian; Raïssi, Hamdi

    2007-01-01

    In this paper we consider estimation and test of fit for multiple autoregressive time series models with nonindependent innovations. We derive the asymptotic distribution of the residual autocorrelations. It is shown that this asymptotic distribution can be quite different for models with iid innovations and models in which the innovations exhibit conditional heteroscedasticity or other forms of dependence. Consequently, the usual chi-square distribution does not provide adequate approximatio...

  17. Statistical testing of the association between annual turnover and marketing activities in SMEs using χ2

    Science.gov (United States)

    Pater, Liana; Miclea, Şerban; Izvercian, Monica

    2016-06-01

    This paper considers the impact of SMEs' annual turnover upon its marketing activities (in terms of marketing responsibility, strategic planning and budgeting). Empirical results and literature reviews unveil that SMEs managers incline to partake in planned and profitable marketing activities, depending on their turnover's level. Thus, using the collected data form 131 Romanian SMEs managers, we have applied the Chi-Square Test in order to validate or invalidate three research assumptions (hypotheses), created starting from the empirical and literature findings.

  18. Programme Note: Realities and Opportunities in Ho Chi Minh City.

    Science.gov (United States)

    Franchet, Chi Nguyen

    1996-01-01

    The current status of street children in Ho Chi Minh City, Vietnam, is characterized by marginalization from society through street vending, begging, theft, and prostitution. Evaluation of a drop-in center serving children without family linkages indicates need for needs assessments, follow-up activities, measurement of individual child progress,…

  19. Modulational instability in the nonlocal chi(2)-model

    DEFF Research Database (Denmark)

    Wyller, John Andreas; Krolikowski, Wieslaw; Bang, Ole;

    2007-01-01

    are recovered as the asymptotic limit of one of the branches of the plane waves (i.e. the adiabatic branch or the acoustic branch) of the full chi((2))-model by means of a singular perturbational approach. It is also proven that the stability results for the adiabatic branch continuously approach...

  20. Escape angles in bulk chi((2)) soliton interactions

    DEFF Research Database (Denmark)

    Johansen, Steffen Kjær; Bang, Ole; Sørensen, Mads Peter

    2002-01-01

    We develop a theory for nonplanar interaction between two identical type I spatial solitons propagating at opposite, but arbitrary transverse angles in quadratic nonlinear (or so-called chi((2))) bulk, media. We predict quantitatively the outwards escape angle, below which the solitons turn aroun...

  1. Dicty_cDB: CHI113 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHI113 (Link to dictyBase) - - - Contig-U14338-1 - (Link to Original site) ... 37591_59( DQ437591 |pid:none) Variola virus strain Sumatra ... 1970... 33 3.0 AL844504_205( AL844504 |pid:none) P ...

  2. Dicty_cDB: CHI816 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHI816 (Link to dictyBase) - G20190 DDB0202068 Contig-U14357-1 - (Link to O ... BD080275 |BD080275.1 Transgenic plant with altered morphology ... and endo-1,4-beta-glucanase gene, promoter and pro ...

  3. Bisimulation Lattice of Asymmetric Chi Calculus with Mismatch

    Institute of Scientific and Technical Information of China (English)

    Dong Xiaoju(董笑菊); Zhong Farong; Fu Yuxi

    2003-01-01

    This paper carries out a systematic investigation into the bisimulation lattice of asymmetric chi calculus with a mismatch combinator. It is shown that all the sixty three L-bisimilarities collapse to twelve distinct relations and they form a bisimulation lattice with respect to set inclusion. The top of the lattice coincides with the barbed bisimilarity.

  4. Dicty_cDB: CHI610 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHI610 (Link to dictyBase) - - - Contig-U14350-1 - (Link to Original site) ... CFFFFFWI*kk--- Translated Amino Acid sequence (All Frames ) Frame A: nsnthlthysqkkk**ink**in*ink*nfihi*lnfls* ...

  5. Measurement of $\\chi_{c1}$ and $\\chi_{c2}$ production with $\\sqrt{s}=7$ TeV $pp$ collisions at ATLAS

    CERN Document Server

    Aad, Georges; Abbott, Brad; Abdallah, Jalal; Abdel Khalek, Samah; Abdinov, Ovsat; Aben, Rosemarie; Abi, Babak; Abolins, Maris; AbouZeid, Ossama; Abramowicz, Halina; Abreu, Henso; Abulaiti, Yiming; Acharya, Bobby Samir; Adamczyk, Leszek; Adams, David; Addy, Tetteh; Adelman, Jahred; Adomeit, Stefanie; Adye, Tim; Aefsky, Scott; Agatonovic-Jovin, Tatjana; Aguilar-Saavedra, Juan Antonio; Agustoni, Marco; Ahlen, Steven; Ahmad, Ashfaq; Ahmadov, Faig; Aielli, Giulio; Åkesson, Torsten Paul Ake; Akimoto, Ginga; Akimov, Andrei; Alam, Muhammad Aftab; Albert, Justin; Albrand, Solveig; Alconada Verzini, Maria Josefina; Aleksa, Martin; Aleksandrov, Igor; Alessandria, Franco; Alexa, Calin; Alexander, Gideon; Alexandre, Gauthier; Alexopoulos, Theodoros; Alhroob, Muhammad; Aliev, Malik; Alimonti, Gianluca; Alio, Lion; Alison, John; Allbrooke, Benedict; Allison, Lee John; Allport, Phillip; Allwood-Spiers, Sarah; Almond, John; Aloisio, Alberto; Alon, Raz; Alonso, Alejandro; Alonso, Francisco; Altheimer, Andrew David; Alvarez Gonzalez, Barbara; Alviggi, Mariagrazia; Amako, Katsuya; Amaral Coutinho, Yara; Amelung, Christoph; Ammosov, Vladimir; Amor Dos Santos, Susana Patricia; Amorim, Antonio; Amoroso, Simone; Amram, Nir; Amundsen, Glenn; Anastopoulos, Christos; Ancu, Lucian Stefan; Andari, Nansi; Andeen, Timothy; Anders, Christoph Falk; Anders, Gabriel; Anderson, Kelby; Andreazza, Attilio; Andrei, George Victor; Anduaga, Xabier; Angelidakis, Stylianos; Anger, Philipp; Angerami, Aaron; Anghinolfi, Francis; Anisenkov, Alexey; Anjos, Nuno; Annovi, Alberto; Antonaki, Ariadni; Antonelli, Mario; Antonov, Alexey; Antos, Jaroslav; Anulli, Fabio; Aoki, Masato; Aperio Bella, Ludovica; Apolle, Rudi; Arabidze, Giorgi; Aracena, Ignacio; Arai, Yasuo; Arce, Ayana; Arfaoui, Samir; Arguin, Jean-Francois; Argyropoulos, Spyridon; Arik, Engin; Arik, Metin; Armbruster, Aaron James; Arnaez, Olivier; Arnal, Vanessa; Arslan, Ozan; Artamonov, Andrei; Artoni, Giacomo; Asai, Shoji; Asbah, Nedaa; Ask, Stefan; Åsman, Barbro; Asquith, Lily; Assamagan, Ketevi; Astalos, Robert; Astbury, Alan; Atkinson, Markus; Atlay, Naim Bora; Auerbach, Benjamin; Auge, Etienne; Augsten, Kamil; Aurousseau, Mathieu; Avolio, Giuseppe; Azuelos, Georges; Azuma, Yuya; Baak, Max; Bacci, Cesare; Bach, Andre; Bachacou, Henri; Bachas, Konstantinos; Backes, Moritz; Backhaus, Malte; Backus Mayes, John; Badescu, Elisabeta; Bagiacchi, Paolo; Bagnaia, Paolo; Bai, Yu; Bailey, David; Bain, Travis; Baines, John; Baker, Oliver Keith; Baker, Sarah; Balek, Petr; Balli, Fabrice; Banas, Elzbieta; Banerjee, Swagato; Banfi, Danilo; Bangert, Andrea Michelle; Bansal, Vikas; Bansil, Hardeep Singh; Barak, Liron; Baranov, Sergei; Barber, Tom; Barberio, Elisabetta Luigia; Barberis, Dario; Barbero, Marlon; Barillari, Teresa; Barisonzi, Marcello; Barklow, Timothy; Barlow, Nick; Barnett, Bruce; Barnett, Michael; Baroncelli, Antonio; Barone, Gaetano; Barr, Alan; Barreiro, Fernando; Barreiro Guimarães da Costa, João; Bartoldus, Rainer; Barton, Adam Edward; Bartos, Pavol; Bartsch, Valeria; Bassalat, Ahmed; Basye, Austin; Bates, Richard; Batkova, Lucia; Batley, Richard; Battistin, Michele; Bauer, Florian; Bawa, Harinder Singh; Beau, Tristan; Beauchemin, Pierre-Hugues; Beccherle, Roberto; Bechtle, Philip; Beck, Hans Peter; Becker, Anne Kathrin; Becker, Sebastian; Beckingham, Matthew; Beddall, Andrew; Beddall, Ayda; Bedikian, Sourpouhi; Bednyakov, Vadim; Bee, Christopher; Beemster, Lars; Beermann, Thomas; Begel, Michael; Behr, Katharina; Belanger-Champagne, Camille; Bell, Paul; Bell, William; Bella, Gideon; Bellagamba, Lorenzo; Bellerive, Alain; Bellomo, Massimiliano; Belloni, Alberto; Beloborodova, Olga; Belotskiy, Konstantin; Beltramello, Olga; Benary, Odette; Benchekroun, Driss; Bendtz, Katarina; Benekos, Nektarios; Benhammou, Yan; Benhar Noccioli, Eleonora; Benitez Garcia, Jorge-Armando; Benjamin, Douglas; Bensinger, James; Benslama, Kamal; Bentvelsen, Stan; Berge, David; Bergeaas Kuutmann, Elin; Berger, Nicolas; Berghaus, Frank; Berglund, Elina; Beringer, Jürg; Bernard, Clare; Bernat, Pauline; Bernhard, Ralf; Bernius, Catrin; Bernlochner, Florian Urs; Berry, Tracey; Berta, Peter; Bertella, Claudia; Bertolucci, Federico; Besana, Maria Ilaria; Besjes, Geert-Jan; Bessidskaia, Olga; Besson, Nathalie; Bethke, Siegfried; Bhimji, Wahid; Bianchi, Riccardo-Maria; Bianchini, Louis; Bianco, Michele; Biebel, Otmar; Bieniek, Stephen Paul; Bierwagen, Katharina; Biesiada, Jed; Biglietti, Michela; Bilbao De Mendizabal, Javier; Bilokon, Halina; Bindi, Marcello; Binet, Sebastien; Bingul, Ahmet; Bini, Cesare; Bittner, Bernhard

    2014-01-01

    The prompt and non-prompt production cross-sections for the $\\chi_{c1}$ and $\\chi_{c2}$ charmonium states are measured in $pp$ collisions at $\\sqrt{s}=7$ TeV with the ATLAS detector at the LHC using 4.5 fb-1 of integrated luminosity. The $\\chi_{c}$ states are reconstructed through the radiative decay $\\chi_{c}\\rightarrow J/\\psi\\,\\gamma$ (with $J/\\psi\\rightarrow\\mu^{+}\\mu^{-}$) where photons are reconstructed from $\\gamma\\rightarrow e^{+}e^{-}$ conversions. The production rate of the $\\chi_{c2}$ state relative to the $\\chi_{c1}$ state is measured for prompt and non-prompt $\\chi_{c}$ as a function of $J/\\psi$ transverse momentum. The prompt $\\chi_{c}$ cross-sections are combined with existing measurements of prompt $J/\\psi$ production to derive the fraction of prompt $J/\\psi$ produced in feed-down from $\\chi_{c}$ decays. The fractions of $\\chi_{c1}$ and $\\chi_{c2}$ produced in $b$-hadron decays are also measured. In addition to measurements of inclusive $\\chi_{c}$ production, the branching fraction ${\\cal B}(B^...

  6. From Square Dance to Mathematics

    Science.gov (United States)

    Bremer, Zoe

    2010-01-01

    In this article, the author suggests a cross-curricular idea that can link with PE, dance, music and history. Teacher David Schmitz, a maths teacher in Illinois who was also a square dance caller, had developed a maths course that used the standard square dance syllabus to teach mathematical principles. He presents an intensive, two-week course…

  7. Algebraic Squares: Complete and Incomplete.

    Science.gov (United States)

    Gardella, Francis J.

    2000-01-01

    Illustrates ways of using algebra tiles to give students a visual model of competing squares that appear in algebra as well as in higher mathematics. Such visual representations give substance to the symbolic manipulation and give students who do not learn symbolically a way of understanding the underlying concepts of completing the square. (KHR)

  8. Latin and Cross Latin Squares

    Science.gov (United States)

    Emanouilidis, Emanuel

    2008-01-01

    Latin squares were first introduced and studied by the famous mathematician Leonhard Euler in the 1700s. Through the years, Latin squares have been used in areas such as statistics, graph theory, coding theory, the generation of random numbers as well as in the design and analysis of experiments. Recently, with the international popularity of…

  9. Measurement of the $\\chi_b(3P)$ mass and of the relative rate of $\\chi_{b1}(1P)$ and $\\chi_{b2}(1P)$ production

    CERN Document Server

    Aaij, Roel; Adinolfi, Marco; Affolder, Anthony; Ajaltouni, Ziad; Akar, Simon; Albrecht, Johannes; Alessio, Federico; Alexander, Michael; Ali, Suvayu; Alkhazov, Georgy; Alvarez Cartelle, Paula; Alves Jr, Antonio Augusto; Amato, Sandra; Amerio, Silvia; Amhis, Yasmine; An, Liupan; Anderlini, Lucio; Anderson, Jonathan; Andreassen, Rolf; Andreotti, Mirco; Andrews, Jason; Appleby, Robert; Aquines Gutierrez, Osvaldo; Archilli, Flavio; Artamonov, Alexander; Artuso, Marina; Aslanides, Elie; Auriemma, Giulio; Baalouch, Marouen; Bachmann, Sebastian; Back, John; Badalov, Alexey; Baesso, Clarissa; Baldini, Wander; Barlow, Roger; Barschel, Colin; Barsuk, Sergey; Barter, William; Batozskaya, Varvara; Battista, Vincenzo; Bay, Aurelio; Beaucourt, Leo; Beddow, John; Bedeschi, Franco; Bediaga, Ignacio; Belogurov, Sergey; Belous, Konstantin; Belyaev, Ivan; Ben-Haim, Eli; Bencivenni, Giovanni; Benson, Sean; Benton, Jack; Berezhnoy, Alexander; Bernet, Roland; Bettler, Marc-Olivier; van Beuzekom, Martinus; Bien, Alexander; Bifani, Simone; Bird, Thomas; Bizzeti, Andrea; Bjørnstad, Pål Marius; Blake, Thomas; Blanc, Frédéric; Blouw, Johan; Blusk, Steven; Bocci, Valerio; Bondar, Alexander; Bondar, Nikolay; Bonivento, Walter; Borghi, Silvia; Borgia, Alessandra; Borsato, Martino; Bowcock, Themistocles; Bowen, Espen Eie; Bozzi, Concezio; Brambach, Tobias; van den Brand, Johannes; Bressieux, Joël; Brett, David; Britsch, Markward; Britton, Thomas; Brodzicka, Jolanta; Brook, Nicholas; Brown, Henry; Bursche, Albert; Busetto, Giovanni; Buytaert, Jan; Cadeddu, Sandro; Calabrese, Roberto; Calvi, Marta; Calvo Gomez, Miriam; Campana, Pierluigi; Campora Perez, Daniel; Carbone, Angelo; Carboni, Giovanni; Cardinale, Roberta; Cardini, Alessandro; Carson, Laurence; Carvalho Akiba, Kazuyoshi; Casse, Gianluigi; Cassina, Lorenzo; Castillo Garcia, Lucia; Cattaneo, Marco; Cauet, Christophe; Cenci, Riccardo; Charles, Matthew; Charpentier, Philippe; Chefdeville, Maximilien; Chen, Shanzhen; Cheung, Shu-Faye; Chiapolini, Nicola; Chrzaszcz, Marcin; Ciba, Krzystof; Cid Vidal, Xabier; Ciezarek, Gregory; Clarke, Peter; Clemencic, Marco; Cliff, Harry; Closier, Joel; Coco, Victor; Cogan, Julien; Cogneras, Eric; Cojocariu, Lucian; Collins, Paula; Comerma-Montells, Albert; Contu, Andrea; Cook, Andrew; Coombes, Matthew; Coquereau, Samuel; Corti, Gloria; Corvo, Marco; Counts, Ian; Couturier, Benjamin; Cowan, Greig; Craik, Daniel Charles; Cruz Torres, Melissa Maria; Cunliffe, Samuel; Currie, Robert; D'Ambrosio, Carmelo; Dalseno, Jeremy; David, Pascal; David, Pieter; Davis, Adam; De Bruyn, Kristof; De Capua, Stefano; De Cian, Michel; De Miranda, Jussara; De Paula, Leandro; De Silva, Weeraddana; De Simone, Patrizia; Decamp, Daniel; Deckenhoff, Mirko; Del Buono, Luigi; Déléage, Nicolas; Derkach, Denis; Deschamps, Olivier; Dettori, Francesco; Di Canto, Angelo; Dijkstra, Hans; Donleavy, Stephanie; Dordei, Francesca; Dorigo, Mirco; Dosil Suárez, Alvaro; Dossett, David; Dovbnya, Anatoliy; Dreimanis, Karlis; Dujany, Giulio; Dupertuis, Frederic; Durante, Paolo; Dzhelyadin, Rustem; Dziurda, Agnieszka; Dzyuba, Alexey; Easo, Sajan; Egede, Ulrik; Egorychev, Victor; Eidelman, Semen; Eisenhardt, Stephan; Eitschberger, Ulrich; Ekelhof, Robert; Eklund, Lars; El Rifai, Ibrahim; Elsasser, Christian; Ely, Scott; Esen, Sevda; Evans, Hannah Mary; Evans, Timothy; Falabella, Antonio; Färber, Christian; Farinelli, Chiara; Farley, Nathanael; Farry, Stephen; Fay, Robert; Ferguson, Dianne; Fernandez Albor, Victor; Ferreira Rodrigues, Fernando; Ferro-Luzzi, Massimiliano; Filippov, Sergey; Fiore, Marco; Fiorini, Massimiliano; Firlej, Miroslaw; Fitzpatrick, Conor; Fiutowski, Tomasz; Fontana, Marianna; Fontanelli, Flavio; Forty, Roger; Francisco, Oscar; Frank, Markus; Frei, Christoph; Frosini, Maddalena; Fu, Jinlin; Furfaro, Emiliano; Gallas Torreira, Abraham; Galli, Domenico; Gallorini, Stefano; Gambetta, Silvia; Gandelman, Miriam; Gandini, Paolo; Gao, Yuanning; García Pardiñas, Julián; Garofoli, Justin; Garra Tico, Jordi; Garrido, Lluis; Gaspar, Clara; Gauld, Rhorry; Gavardi, Laura; Gavrilov, Gennadii; Geraci, Angelo; Gersabeck, Evelina; Gersabeck, Marco; Gershon, Timothy; Ghez, Philippe; Gianelle, Alessio; Gianì, Sebastiana; Gibson, Valerie; Giubega, Lavinia-Helena; Gligorov, Vladimir; Göbel, Carla; Golubkov, Dmitry; Golutvin, Andrey; Gomes, Alvaro; Gotti, Claudio; Grabalosa Gándara, Marc; Graciani Diaz, Ricardo; Granado Cardoso, Luis Alberto; Graugés, Eugeni; Graziani, Giacomo; Grecu, Alexandru; Greening, Edward; Gregson, Sam; Griffith, Peter; Grillo, Lucia; Grünberg, Oliver; Gui, Bin; Gushchin, Evgeny; Guz, Yury; Gys, Thierry; Hadjivasiliou, Christos; Haefeli, Guido; Haen, Christophe; Haines, Susan; Hall, Samuel; Hamilton, Brian; Hampson, Thomas; Han, Xiaoxue; Hansmann-Menzemer, Stephanie; Harnew, Neville; Harnew, Samuel; Harrison, Jonathan; He, Jibo; Head, Timothy; Heijne, Veerle; Hennessy, Karol; Henrard, Pierre; Henry, Louis; Hernando Morata, Jose Angel; van Herwijnen, Eric; Heß, Miriam; Hicheur, Adlène; Hill, Donal; Hoballah, Mostafa; Hombach, Christoph; Hulsbergen, Wouter; Hunt, Philip; Hussain, Nazim; Hutchcroft, David; Hynds, Daniel; Idzik, Marek; Ilten, Philip; Jacobsson, Richard; Jaeger, Andreas; Jalocha, Pawel; Jans, Eddy; Jaton, Pierre; Jawahery, Abolhassan; Jing, Fanfan; John, Malcolm; Johnson, Daniel; Jones, Christopher; Joram, Christian; Jost, Beat; Jurik, Nathan; Kandybei, Sergii; Kanso, Walaa; Karacson, Matthias; Karbach, Moritz; Karodia, Sarah; Kelsey, Matthew; Kenyon, Ian; Ketel, Tjeerd; Khanji, Basem; Khurewathanakul, Chitsanu; Klaver, Suzanne; Klimaszewski, Konrad; Kochebina, Olga; Kolpin, Michael; Komarov, Ilya; Koopman, Rose; Koppenburg, Patrick; Korolev, Mikhail; Kozlinskiy, Alexandr; Kravchuk, Leonid; Kreplin, Katharina; Kreps, Michal; Krocker, Georg; Krokovny, Pavel; Kruse, Florian; Kucewicz, Wojciech; Kucharczyk, Marcin; Kudryavtsev, Vasily; Kurek, Krzysztof; Kvaratskheliya, Tengiz; La Thi, Viet Nga; Lacarrere, Daniel; Lafferty, George; Lai, Adriano; Lambert, Dean; Lambert, Robert W; Lanfranchi, Gaia; Langenbruch, Christoph; Langhans, Benedikt; Latham, Thomas; Lazzeroni, Cristina; Le Gac, Renaud; van Leerdam, Jeroen; Lees, Jean-Pierre; Lefèvre, Regis; Leflat, Alexander; Lefrançois, Jacques; Leo, Sabato; Leroy, Olivier; Lesiak, Tadeusz; Lespinasse, Mickael; Leverington, Blake; Li, Yiming; Likhomanenko, Tatiana; Liles, Myfanwy; Lindner, Rolf; Linn, Christian; Lionetto, Federica; Liu, Bo; Lohn, Stefan; Longstaff, Iain; Lopes, Jose; Lopez-March, Neus; Lowdon, Peter; Lu, Haiting; Lucchesi, Donatella; Luo, Haofei; Lupato, Anna; Luppi, Eleonora; Lupton, Oliver; Machefert, Frederic; Machikhiliyan, Irina V; Maciuc, Florin; Maev, Oleg; Malde, Sneha; Malinin, Alexander; Manca, Giulia; Mancinelli, Giampiero; Mapelli, Alessandro; Maratas, Jan; Marchand, Jean François; Marconi, Umberto; Marin Benito, Carla; Marino, Pietro; Märki, Raphael; Marks, Jörg; Martellotti, Giuseppe; Martens, Aurelien; Martín Sánchez, Alexandra; Martinelli, Maurizio; Martinez Santos, Diego; Martinez Vidal, Fernando; Martins Tostes, Danielle; Massafferri, André; Matev, Rosen; Mathe, Zoltan; Matteuzzi, Clara; Mazurov, Alexander; McCann, Michael; McCarthy, James; McNab, Andrew; McNulty, Ronan; McSkelly, Ben; Meadows, Brian; Meier, Frank; Meissner, Marco; Merk, Marcel; Milanes, Diego Alejandro; Minard, Marie-Noelle; Moggi, Niccolò; Molina Rodriguez, Josue; Monteil, Stephane; Morandin, Mauro; Morawski, Piotr; Mordà, Alessandro; Morello, Michael Joseph; Moron, Jakub; Morris, Adam Benjamin; Mountain, Raymond; Muheim, Franz; Müller, Katharina; Mussini, Manuel; Muster, Bastien; Naik, Paras; Nakada, Tatsuya; Nandakumar, Raja; Nasteva, Irina; Needham, Matthew; Neri, Nicola; Neubert, Sebastian; Neufeld, Niko; Neuner, Max; Nguyen, Anh Duc; Nguyen, Thi-Dung; Nguyen-Mau, Chung; Nicol, Michelle; Niess, Valentin; Niet, Ramon; Nikitin, Nikolay; Nikodem, Thomas; Novoselov, Alexey; O'Hanlon, Daniel Patrick; Oblakowska-Mucha, Agnieszka; Obraztsov, Vladimir; Oggero, Serena; Ogilvy, Stephen; Okhrimenko, Oleksandr; Oldeman, Rudolf; Onderwater, Gerco; Orlandea, Marius; Otalora Goicochea, Juan Martin; Owen, Patrick; Oyanguren, Maria Arantza; Pal, Bilas Kanti; Palano, Antimo; Palombo, Fernando; Palutan, Matteo; Panman, Jacob; Papanestis, Antonios; Pappagallo, Marco; Pappalardo, Luciano; Parkes, Christopher; Parkinson, Christopher John; Passaleva, Giovanni; Patel, Girish; Patel, Mitesh; Patrignani, Claudia; Pearce, Alex; Pellegrino, Antonio; Pepe Altarelli, Monica; Perazzini, Stefano; Perret, Pascal; Perrin-Terrin, Mathieu; Pescatore, Luca; Pesen, Erhan; Petridis, Konstantin; Petrolini, Alessandro; Picatoste Olloqui, Eduardo; Pietrzyk, Boleslaw; Pilař, Tomas; Pinci, Davide; Pistone, Alessandro; Playfer, Stephen; Plo Casasus, Maximo; Polci, Francesco; Poluektov, Anton; Polycarpo, Erica; Popov, Alexander; Popov, Dmitry; Popovici, Bogdan; Potterat, Cédric; Price, Eugenia; Prisciandaro, Jessica; Pritchard, Adrian; Prouve, Claire; Pugatch, Valery; Puig Navarro, Albert; Punzi, Giovanni; Qian, Wenbin; Rachwal, Bartolomiej; Rademacker, Jonas; Rakotomiaramanana, Barinjaka; Rama, Matteo; Rangel, Murilo; Raniuk, Iurii; Rauschmayr, Nathalie; Raven, Gerhard; Reichert, Stefanie; Reid, Matthew; dos Reis, Alberto; Ricciardi, Stefania; Richards, Sophie; Rihl, Mariana; Rinnert, Kurt; Rives Molina, Vincente; Roa Romero, Diego; Robbe, Patrick; Rodrigues, Ana Barbara; Rodrigues, Eduardo; Rodriguez Perez, Pablo; Roiser, Stefan; Romanovsky, Vladimir; Romero Vidal, Antonio; Rotondo, Marcello; Rouvinet, Julien; Ruf, Thomas; Ruiz, Hugo; Ruiz Valls, Pablo; Saborido Silva, Juan Jose; Sagidova, Naylya; Sail, Paul; Saitta, Biagio; Salustino Guimaraes, Valdir; Sanchez Mayordomo, Carlos; Sanmartin Sedes, Brais; Santacesaria, Roberta; Santamarina Rios, Cibran; Santovetti, Emanuele; Sarti, Alessio; Satriano, Celestina; Satta, Alessia; Saunders, Daniel Martin; Savrina, Darya; Schiller, Manuel; Schindler, Heinrich; Schlupp, Maximilian; Schmelling, Michael; Schmidt, Burkhard; Schneider, Olivier; Schopper, Andreas; Schune, Marie Helene; Schwemmer, Rainer; Sciascia, Barbara; Sciubba, Adalberto; Semennikov, Alexander; Sepp, Indrek; Serra, Nicola; Serrano, Justine; Sestini, Lorenzo; Seyfert, Paul; Shapkin, Mikhail; Shapoval, Illya; Shcheglov, Yury; Shears, Tara; Shekhtman, Lev; Shevchenko, Vladimir; Shires, Alexander; Silva Coutinho, Rafael; Simi, Gabriele; Sirendi, Marek; Skidmore, Nicola; Skwarnicki, Tomasz; Smith, Anthony; Smith, Edmund; Smith, Eluned; Smith, Jackson; Smith, Mark; Snoek, Hella; Sokoloff, Michael; Soler, Paul; Soomro, Fatima; Souza, Daniel; Souza De Paula, Bruno; Spaan, Bernhard; Sparkes, Ailsa; Spradlin, Patrick; Sridharan, Srikanth; Stagni, Federico; Stahl, Marian; Stahl, Sascha; Steinkamp, Olaf; Stenyakin, Oleg; Stevenson, Scott; Stoica, Sabin; Stone, Sheldon; Storaci, Barbara; Stracka, Simone; Straticiuc, Mihai; Straumann, Ulrich; Stroili, Roberto; Subbiah, Vijay Kartik; Sun, Liang; Sutcliffe, William; Swientek, Krzysztof; Swientek, Stefan; Syropoulos, Vasileios; Szczekowski, Marek; Szczypka, Paul; Szumlak, Tomasz; T'Jampens, Stephane; Teklishyn, Maksym; Tellarini, Giulia; Teubert, Frederic; Thomas, Christopher; Thomas, Eric; van Tilburg, Jeroen; Tisserand, Vincent; Tobin, Mark; Tolk, Siim; Tomassetti, Luca; Tonelli, Diego; Topp-Joergensen, Stig; Torr, Nicholas; Tournefier, Edwige; Tourneur, Stephane; Tran, Minh Tâm; Tresch, Marco; Trisovic, Ana; Tsaregorodtsev, Andrei; Tsopelas, Panagiotis; Tuning, Niels; Ubeda Garcia, Mario; Ukleja, Artur; Ustyuzhanin, Andrey; Uwer, Ulrich; Vagnoni, Vincenzo; Valenti, Giovanni; Vallier, Alexis; Vazquez Gomez, Ricardo; Vazquez Regueiro, Pablo; Vázquez Sierra, Carlos; Vecchi, Stefania; Velthuis, Jaap; Veltri, Michele; Veneziano, Giovanni; Vesterinen, Mika; Viaud, Benoit; Vieira, Daniel; Vieites Diaz, Maria; Vilasis-Cardona, Xavier; Vollhardt, Achim; Volyanskyy, Dmytro; Voong, David; Vorobyev, Alexey; Vorobyev, Vitaly; Voß, Christian; de Vries, Jacco; Waldi, Roland; Wallace, Charlotte; Wallace, Ronan; Walsh, John; Wandernoth, Sebastian; Wang, Jianchun; Ward, David; Watson, Nigel; Websdale, David; Whitehead, Mark; Wicht, Jean; Wiedner, Dirk; Wilkinson, Guy; Williams, Matthew; Williams, Mike; Wilson, Fergus; Wimberley, Jack; Wishahi, Julian; Wislicki, Wojciech; Witek, Mariusz; Wormser, Guy; Wotton, Stephen; Wright, Simon; Wu, Suzhi; Wyllie, Kenneth; Xie, Yuehong; Xing, Zhou; Xu, Zhirui; Yang, Zhenwei; Yuan, Xuhao; Yushchenko, Oleg; Zangoli, Maria; Zavertyaev, Mikhail; Zhang, Liming; Zhang, Wen Chao; Zhang, Yanxi; Zhelezov, Alexey; Zhokhov, Anatoly; Zhong, Liang; Zvyagin, Alexander

    2014-01-01

    The production of $\\chi_b$ mesons in proton-proton collisions is studied using a data sample collected by the LHCb detector, at centre-of-mass energies of $\\sqrt{s}=7$ and $8$ TeV and corresponding to an integrated luminosity of 3.0 fb$^{-1}$. The $\\chi_b$ mesons are identified through their decays to $\\Upsilon(1S)\\gamma$ and $\\Upsilon(2S)\\gamma$ using photons that converted to $e^+e^-$ pairs in the detector. The $\\chi_b(3P)$ meson mass, and the relative prompt production rate of $\\chi_{b1}(1P)$ and $\\chi_{b2}(1P)$ mesons as a function of the $\\Upsilon(1S)$ transverse momentum in the $\\chi_b$ rapidity range 2.0< $y$<4.5, are measured. Assuming a mass splitting between the $\\chi_{b1}(3P)$ and the $\\chi_{b2}(3P)$ states of 10.5 MeV/$c^2$, the mass of the $\\chi_{b1}(3P)$ meson is \\begin{equation*} m(\\chi_{b1}(3P))= 10515.7^{+2.2}_{-3.9}(stat) ^{+1.5}_{-2.1}(syst) MeV/c^2. \\end{equation*}

  10. Resilience of aging populations after devastating earthquake event and its determinants - A case study of the Chi-Chi earthquake in Taiwan

    Science.gov (United States)

    Hung, Chih-Hsuan; Hung, Hung-Chih

    2016-04-01

    1.Background Major portions of urban areas in Asia are highly exposed and vulnerable to devastating earthquakes. Many studies identify ways to reduce earthquake risk by concentrating more on building resilience for the particularly vulnerable populations. By 2020, as the United Nations' warning, many Asian countries would become 'super-aged societies', such as Taiwan. However, local authorities rarely use resilience approach to frame earthquake disaster risk management and land use strategies. The empirically-based research about the resilience of aging populations has also received relatively little attention. Thus, a challenge arisen for decision-makers is how to enhance resilience of aging populations within the context of risk reduction. This study aims to improve the understanding of the resilience of aging populations and its changes over time in the aftermath of a destructive earthquake at the local level. A novel methodology is proposed to assess the resilience of aging populations and to characterize their changes of spatial distribution patterns, as well as to examine their determinants. 2.Methods and data An indicator-based assessment framework is constructed with the goal of identifying composite indicators (including before, during and after a disaster) that could serve as proxies for attributes of the resilience of aging populations. Using the recovery process of the Chi-Chi earthquake struck central Taiwan in 1999 as a case study, we applied a method combined a geographical information system (GIS)-based spatial statistics technique and cluster analysis to test the extent of which the resilience of aging populations is spatially autocorrelated throughout the central Taiwan, and to explain why clustering of resilient areas occurs in specific locations. Furthermore, to scrutinize the affecting factors of resilience, we develop an aging population resilience model (APRM) based on existing resilience theory. Using the APRM, we applied a multivariate

  11. Seasonal fluctuations in prevalence of dog intestinal parasites in public squares of Mar del Plata city, Argentina and its risk for humans.

    Science.gov (United States)

    Andresiuk, V; Sardella, N; Denegri, G

    2007-01-01

    The aim of this work is to analyze whether there is a seasonal prevalence of parasites in dog feces from public squares in Mar del Plata city, Argentina, and to evaluate the climatic conditions that promote the development of parasites and allow the transmission to people. The study was performed in 21 squares from June 2001 to May 2002. Samples were processed by the Willis technique. Differences in prevalence of parasites were examined for significance by the Chi-square test. Climatic data were obtained from the Library of the National Meteorological Service of Argentina. Total parasitic prevalence was higher in winter than in summer. The prevalence of Ancylostoma spp. was higher in the summer-autumn period. For Toxocara canis, the prevalence was higher in winter whereas for Trichuris vulpis, it was higher in winter, spring and summer. This work shows high prevalence of total parasites throughout the year. For Ancylostoma spp., summer and autumn might be the seasons with higher sanitary risk. On the other hand, T. canis could present the higher risk to people in winter and, T. vulpis, would be transmitted throughout the whole year. The seasonal variation in prevalence of dog parasites results in continuous exposure to people visiting the squares, not only Mar del Plata residents but also tourists from other regions of Argentina and the world, with at least one species of parasite with sanitary risk. PMID:18390156

  12. TESTING THE ADEQUACY OF GARCH-TYPE MODELS IN TIME SERIES

    Institute of Scientific and Technical Information of China (English)

    Wu Jianhong; Zhu Lixing

    2009-01-01

    In this article a new approach for checking the adequacy of GARCH-typemodels in time series was proposed. The resulted tests involve weight functions, which provide them with the flexibility in choosing scores to enhance power performance. The choice of weight functions and the power properties of the tests are studied. For a large number of alternatives, asymptotically distribution-free maximin test is constructed. The tests are asymptotically chi-squared under the null hypothesis and easy to implement. Simulation results indicate that the tests perform well.

  13. A Score Type Test for General Autoregressive Models in Time Series

    Institute of Scientific and Technical Information of China (English)

    Jian-hong Wu; Li-xing Zhu

    2007-01-01

    This paper is devoted to the goodness-of-fit test for the general autoregressive models in time series. By averaging for the weighted residuals, we construct a score type test which is asymptotically standard chi-squared under the null and has some desirable power properties under the alternatives. Specifically, the test is sensitive to alternatives and can detect the alternatives approaching, along a direction, the null at a rate that is arbitrarily close to n-1/2. Furthermore, when the alternatives are not directional, we construct asymptotically distribution-free maximin tests for a large class of alternatives. The performance of the tests is evaluated through simulation studies.

  14. Transport simulations of ohmic TFTR experiments with profile-consistent microinstability-based models for chi/sub e/ and chi/sub i/

    International Nuclear Information System (INIS)

    Transport simulations of ohmically heated TFTR experiments with recently developed profile-consistent microinstability models for the anomalous thermal diffusivities, chi/sub e/ and chi/sub i/, give good agreement with experimental data. The steady-state temperature profiles and the total energy confinement times, tau/sub e/, were found to agree for each of the ohmic TFTR experiments simulated, including three high radiation cases and two plasmas fueled by pellet injection. Both collisional and collisionless models are tested. The trapped-electron drift wave microinstability model results are consistent with the thermal confinement of large plasma ohmic experiments on TFTR. We also find that transport due to the toroidal ion temperature gradient (eta/sub i/) modes can cause saturation in tau/sub E/ at the highest densities comparable to that observed on TFTR and equivalent to a neoclassical anomaly factor of 3. Predictions based on stabilized eta/sub i/-mode-driven ion transport are found to be in agreement with the enhanced global energy confinement times for pellet-fueled plasmas. 33 refs., 26 figs., 4 tabs

  15. Escape angles in bulk chi((2)) soliton interactions

    OpenAIRE

    Johansen, Steffen Kjær; Bang, Ole; Sørensen, Mads Peter

    2002-01-01

    We develop a theory for nonplanar interaction between two identical type I spatial solitons propagating at opposite, but arbitrary transverse angles in quadratic nonlinear (or so-called chi((2))) bulk, media. We predict quantitatively the outwards escape angle, below which the solitons turn around and collide, and above which they continue to move-away from each other. For in-plane interaction, the theory allows prediction of the Outcome of a collision through the inwards escape angle, i.e., ...

  16. Feynman Rules of Higher-order Poles in CHY Construction

    CERN Document Server

    Huang, Rijun; Luo, Ming-xing; Zhu, Chuan-Jie

    2016-01-01

    In this paper, we generalize the integration rules for scattering equations to situations where higher-order poles are present. We describe the strategy to deduce the Feynman rules of higher-order poles from known analytic results of simple CHY-integrands, and propose the Feynman rules for single double pole and triple pole as well as duplex-double pole and triplex-double pole structures. We demonstrate the validation and strength of these rules by ample non-trivial examples.

  17. Consumer Behaviour. Case: iPhone Ho Chi Minh City

    OpenAIRE

    Tran, Thi Xuan Oanh

    2016-01-01

    The main aim of this thesis is to figure out the factors that have influenced consumer behaviour of young iPhone users in Ho Chi Minh City. In this study, the author draw a conclusion based on the data collected from the survey and proposed some feasible recommendations for Apple and other high-end smartphone companies to understand their consumers and enhance brand equity. For the secondary data, a variety of theories, including consumers’ characteristics, promotion and the decision mak...

  18. Euclid Squares on Infinite Planes

    OpenAIRE

    W.B.Vasantha Kandasamy; Ilanthenral, K.; Florentin Smarandache

    2015-01-01

    In this book for the first time the authors study the new type of Euclid squares in various planes like real plane, complex plane, dual number plane, special dual like number plane and special quasi dual number plane.

  19. SQUARE AND RHOMBUS CENTRAL CONFIGURATIONS

    Institute of Scientific and Technical Information of China (English)

    2000-01-01

    In this paper, we consider the flat central configurations of bodies using the characteristic set method. We completely solve two special cases of four planets, namely,the square and the rhombus. For the square case, we obtain that a square is a central configuration only in the case where the masses are equal and there exactly are two different square central configurations determined by the mass and the angular velocity; for the rhombus case, we obtain that if a rhombus is a central configuration, then the masses of the diagonal vertices must be equal. Furthermore, there are two or three or four different rhombus central configurations determined by the masses and the angular velocity.

  20. An Advanced Dictionary? Similarities and Differences between Duramazwi ReChiShona and Duramazwi Guru ReChiShona *

    Directory of Open Access Journals (Sweden)

    Emmanuel Chabata

    2011-10-01

    Full Text Available

    Abstract: In this article a comparative analysis of Duramazwi ReChiShona (DRC and Duramazwi Guru ReChiShona (DGC is made. Both DRC and DGC are monolingual Shona dictionaries compiled by a team of researchers under the African Languages Lexical (ALLEX Project, now the African Languages Research Institute (ALRI. During the compilation process, DRC was known as the General Shona Dictionary and DGC as the Advanced Shona Dictionary. A simple analysis of these titles shows that the dictionaries are similar in some ways and also different in others. The writer tries to show the ways in which DGC is regarded as a more advanced dictionary when compared to DRC. Although the argument of the article is mainly built on those differences which make DGC the more advanced, attention is also paid to the similarities between the dictionaries.

    Keywords: ALLEX PROJECT, ALRI, DURAMAZWI RECHISHONA, DURAMAZWI GURU RECHISHONA, DICTIONARY, SHONA, HEADWORD, SENSE, MONOLINGUAL DICTIONARY, CORPUS, IDIOM, PROVERB, PITHY SAYING

    Opsomming: 'n Gevorderde woordeboek? Ooreenkomste en verskille tussen Duramazwi ReChiShona en Duramazwi Guru ReChiShona. In hierdie artikel word 'n vergelykende ontleding van Duramazwi ReChiShona (DRC en Duramazwi Guru ReChiShona (DGC gemaak. Sowel die DRC en DGC is eentalige Sjonawoordeboeke, saamgestel deur ?n span navorsers by die African Languages Lexical (ALLEX Project, tans die African Languages Research Institute (ALRI. Gedurende die samestellingsproses was DRC bekend as die Algemene Sjonawoordeboek en DGC as die Gevorderde Sjonawoordeboek. 'n Eenvoudige ontleding van hierdie titels toon dat die woordeboeke op sommige maniere eenders en op ander ook verskillend is. Die skrywer probeer die maniere aantoon waarop DGC beskou word as 'n meer gevorderde woordeboek wanneer dit met DRC vergelyk word. Alhoewel die argument van die artikel hoofsaaklik gebou is op daardie verskille wat DGC die gevorderdste maak, word ook aandag gegee aan

  1. Feasibility and effectiveness of a Chen-style Tai Chi programme for stress reduction in junior secondary school students.

    Science.gov (United States)

    Lee, Linda Y K; Chong, Yeuk Lan; Li, Ngai Yin; Li, Man Chung; Lin, Lai Na; Wong, Lee Yi; Wong, Brian Kit; Yip, Wing Ping; Hon, Cho Hang; Chung, Pui Kuen; Man, Shuk Yee

    2013-04-01

    Stress is common in junior secondary school students (JSSS). This study aimed to determine the feasibility and effectiveness of a Chen-style Tai Chi programme for stress reduction in JSSS. A non-equivalent pre-test/post-test control group design was adopted, and a convenience sample of 69 JSSS was recruited. The experimental group (n = 32) joined a Chen-style Tai Chi programme, which included 10 sessions of 80-minute Tai Chi training (one session per week). The control group (n = 37) proceeded with self-study. Participants' stress levels were assessed using the Perceived Stress Scale. Feasibility was determined as the percentage of participants completing and attending the programme. Effectiveness was measured as the significant difference in changes in stress levels before and after the intervention between the two groups. Results preliminarily supported that the programme was feasible for JSSS. Completion rate was 100%, and attendance rate was 90%. However, no significant difference was noted in changes in stress levels before and after the intervention between the two groups. The potential health benefits of Tai Chi could not be detected owing to the restrictions imposed by the research setting and study limitations. The present study represents initial efforts in this direction and serves as reference for future study. PMID:22674634

  2. Amplitude analyses of the decays chi_c1 -> eta pi+ pi- and chi_c1 -> eta' pi+ pi-

    CERN Document Server

    Adams, G S; Ecklund, K M; Insler, J; Muramatsu, H; Park, C S; Pearson, L J; Thorndike, E H; Ricciardi, S; Thomas, C; Artuso, M; Blusk, S; Mountain, R; Skwarnicki, T; Stone, S; Zhang, L M; Bonvicini, G; Cinabro, D; Lincoln, A; Smith, M J; Zhou, P; Zhu, J; Naik, P; Rademacker, J; Asner, D M; Edwards, K W; Randrianarivony, K; Tatishvili, G; Briere, R A; Vogel, H; Onyisi, P U E; Rosner, J L; Alexander, J P; Cassel, D G; Das, S; Ehrlich, R; Gibbons, L; Gray, S W; Hartill, D L; Heltsley, B K; Kreinick, D L; Kuznetsov, V E; Patterson, J R; Peterson, D; Riley, D; Ryd, A; Sadoff, A J; Shi, X; Sun, W M; Yelton, J; Rubin, P; Lowrey, N; Mehrabyan, S; Selen, M; Wiss, J; Libby, J; Kornicer, M; Mitchell, R E; Shepherd, M R; Szczepaniak, A; Besson, D; Pedlar, T K; Cronin-Hennessy, D; Hietala, J; Dobbs, S; Metreveli, Z; Seth, K K; Tomaradze, A; Xiao, T; Martin, L; Powell, A; Wilkinson, G; Ge, J Y; Miller, D H; Shipsey, I P J; Xin, B

    2011-01-01

    Using a data sample of 2.59 x 10^7 psi(2S) decays obtained with the CLEO-c detector, we perform amplitude analyses of the complementary decay chains chi_c1 -> eta pi+ pi- and chi_c1 -> eta' pi+ pi-. We find evidence for a P-wave eta' pi scattering amplitude, which, if interpreted as a resonance, would have exotic J^PC = 1^-+ and parameters consistent with the pi_1(1600) state reported in other production mechanisms. We also make the first observation of the decay a_0(980) -> eta' pi and measure the ratio of branching fractions B(a_0(980) -> eta' pi)/B(a_0(980) -> eta pi) = 0.064 +- 0.014 +- 0.014. The pi pi spectrum produced with a recoiling eta is compared to that with eta' recoil.

  3. Monte carlo simulation study of the square lattice S=1/2 quantum heisenberg antiferromagnet

    CERN Document Server

    Kim, J K

    1999-01-01

    For the two dimensional S= 1/2 isotopic quantum Heisenberg antiferromagnet on a square lattice, we report our results of an extensive quantum Monte Carlo simulation for various physical observables such as the correlation length xi, the staggered magnetic susceptibility chi sub S sub T , the structure factor peak value S(Q), the internal energy epsilon, and the uniform susceptibility chi sub u. We find that chi sub S sub T approx chi sup 2 T and S(Q) approx xi sup 2 T sup 2 , in agreement with the predictions of the conventional theory but in disagreement with recent experiments. Our estimate of the spin stiffness constant rho sub s and spin wave velocity c, from the low temperature behavior of the chi sub u is shown to be consistent with the theoretical prediction of the low temperature behavior of the epsilon, and of the xi provided an additional correction up to T sup 2. However, our data are definitely inconsistent with the scenario of the crossover for the xi.

  4. Prediction of temperature in thermal test based on least square method%基于最小二乘法的热试验温度数据预测

    Institute of Scientific and Technical Information of China (English)

    李西园; 龚喆; 马昆; 曹志松; 张景川

    2013-01-01

    The data validation and prediction are difficult yet important issues in the thermal vacuum test. In this paper, a typical solar panel thermal model is build, and the discrete equation is derived by the finite difference method. The coefficients are fitted by the least square method with "slip window" correction, to predict the temperatures of measuring points in the next measurement and control period. Correction slip window. Based on the test data of a certain solar panel, the prediction capability of this model and the related error analysis are made. In the end, the method to predict the heating power through the temperature of measurement points is discussed.%航天器真空热试验中,温度数据的正确判读及预测十分困难,又十分重要.文章针对典型的太阳电池板试件建立了热模型,使用热分析中常见的有限差分法建立离散方程,通过最小二乘法拟合其系数,以预测下一个测控周期各个测量点的温度,并提出了滑动窗口修正的方法.基于某型号电池板试验数据对热模型的预测精度进行了验证和误差分析,最后对通过测点温度逆向预测加热功率的应用进行了讨论.

  5. Maximum likelihood, least squares and penalized least squares for PET

    International Nuclear Information System (INIS)

    The EM algorithm is the basic approach used to maximize the log likelihood objective function for the reconstruction problem in PET. The EM algorithm is a scaled steepest ascent algorithm that elegantly handles the nonnegativity constraints of the problem. The authors show that the same scaled steepest descent algorithm can be applied to the least squares merit function, and that it can be accelerated using the conjugate gradient approach. The experiments suggest that one can cut the computation by about a factor of 3 by using this technique. The results also apply to various penalized least squares functions which might be used to produce a smoother image

  6. Measurement of the Branching Fraction for B+- --> chi_c0 K+-

    CERN Document Server

    Aubert, B; Boutigny, D; Gaillard, J M; Hicheur, A; Karyotakis, Yu; Lees, J P; Robbe, P; Tisserand, V; Zghiche, A; Palano, A; Pompili, A; Chen, J C; Qi, N D; Rong, G; Wang, P; Zhu, Y S; Eigen, G; Ofte, I; Stugu, B; Abrams, G S; Borgland, A W; Breon, A B; Brown, D N; Button-Shafer, J; Cahn, R N; Charles, E; Day, C T; Gill, M S; Gritsan, A V; Groysman, Y; Jacobsen, R G; Kadel, R W; Kadyk, J; Kerth, L T; Kolomensky, Yu G; Kral, J F; Kukartsev, G; Le Clerc, C; Levi, M E; Lynch, G; Mir, L M; Oddone, P J; Orimoto, T J; Pripstein, M; Roe, N A; Romosan, A; Ronan, Michael T; Shelkov, V G; Telnov, A V; Wenzel, W A; Ford, K; Harrison, T J; Hawkes, C M; Knowles, D J; Morgan, S E; Penny, R C; Watson, A T; Watson, N K; Goetzen, K; Held, T; Koch, H; Lewandowski, B; Pelizaeus, M; Peters, K; Schmücker, H; Steinke, M; Barlow, N R; Boyd, J T; Chevalier, N; Cottingham, W N; Kelly, M P; Latham, T E; MacKay, C; Wilson, F F; Abe, K; Çuhadar-Dönszelmann, T; Hearty, C; Mattison, T S; McKenna, J A; Thiessen, D; Kyberd, P; McKemey, A K; Blinov, V E; Bukin, A D; Golubev, V B; Ivanchenko, V N; Kravchenko, E A; Onuchin, A P; Serednyakov, S I; Skovpen, Yu I; Solodov, E P; Yushkov, A N; Best, D; Bruinsma, M; Chao, M; Kirkby, D; Lankford, A J; Mandelkern, M A; Mommsen, R K; Röthel, W; Stoker, D P; Buchanan, C; Hartfiel, B L; Shen, B C; Del Re, D; Hadavand, H K; Hill, E J; MacFarlane, D B; Paar, H P; Rahatlou, S; Sharma, V; Berryhill, J W; Campagnari, C; Dahmes, B; Kuznetsova, N; Levy, S L; Long, O; Lu, A; Mazur, M A; Richman, J D; Verkerke, W; Beck, T W; Beringer, J; Eisner, A M; Heusch, C A; Lockman, W S; Schalk, T; Schmitz, R E; Schumm, B A; Seiden, A; Turri, M; Walkowiak, W; Williams, D C; Wilson, M G; Albert, J; Chen, E; Dubois-Felsmann, G P; Dvoretskii, A; Hitlin, D G; Narsky, I; Porter, F C; Ryd, A; Samuel, A; Yang, S; Jayatilleke, S M; Mancinelli, G; Meadows, B T; Sokoloff, M D; Abe, T; Blanc, F; Bloom, P; Chen, S; Clark, P J; Ford, W T; Nauenberg, U; Olivas, A; Rankin, P; Roy, J; Smith, J G; Van Hoek, W C; Zhang, L; Harton, J L; Hu, T; Soffer, A; Toki, W H; Wilson, R J; Zhang, J; Altenburg, D; Brandt, T; Brose, J; Colberg, T; Dickopp, M; Dubitzky, R S; Hauke, A; Lacker, H M; Maly, E; Müller-Pfefferkorn, R; Nogowski, R; Otto, S; Schubert, J; Schubert, Klaus R; Schwierz, R; Spaan, B; Wilden, L; Bernard, D; Bonneaud, G R; Brochard, F; Cohen-Tanugi, J; Grenier, P; Thiebaux, C; Vasileiadis, G; Verderi, M; Khan, A; Lavin, D; Muheim, F; Playfer, S; Swain, J E; Andreotti, M; Azzolini, V; Bettoni, D; Bozzi, C; Calabrese, R; Cibinetto, G; Luppi, E; Negrini, M; Piemontese, L; Sarti, A; Treadwell, E; Anulli, F; Baldini-Ferroli, R; Biasini, M; Calcaterra, A; De Sangro, R; Falciai, D; Finocchiaro, G; Patteri, P; Peruzzi, I M; Piccolo, M; Pioppi, M; Zallo, A; Buzzo, A; Capra, R; Contri, R; Crosetti, G; Lo Vetere, M; Macri, M; Monge, M R; Passaggio, S; Patrignani, C; Robutti, E; Santroni, A; Tosi, S; Bailey, S; Morii, M; Won, E; Bhimji, W; Bowerman, D A; Dauncey, P D; Egede, U; Eschrich, I; Gaillard, J R; Morton, G W; Nash, J A; Sanders, P; Taylor, G P; Grenier, G J; Lee, S J; Mallik, U; Cochran, J; Crawley, H B; Lamsa, J; Meyer, W T; Prell, S; Rosenberg, E I; Yi, J; Davier, M; Grosdidier, G; Höcker, A; Laplace, S; Le Diberder, F R; Lepeltier, V; Lutz, A M; Petersen, T C; Plaszczynski, S; Schune, M H; Tantot, L; Wormser, G; Brigljevic, V; Cheng, C H; Lange, D J; Wright, D M; Bevan, A J; Coleman, J P; Fry, J R; Gabathuler, Erwin; Gamet, R; Kay, M; Parry, R J; Payne, D J; Sloane, R J; Touramanis, C; Back, J J; Harrison, P F; Shorthouse, H W; Strother, P; Vidal, P B; Brown, C L; Cowan, G; Flack, R L; Flächer, H U; George, S; Green, M G; Kurup, A; Marker, C E; McMahon, T R; Ricciardi, S; Salvatore, F; Vaitsas, G; Winter, M A; Brown, D; Davis, C L; Allison, J; Barlow, R J; Forti, A C; Hart, P A; Hodgkinson, M C; Jackson, F; Lafferty, G D; Lyon, A J; Weatherall, J H; Williams, J C; Farbin, A; Jawahery, A; Kovalskyi, D; Lae, C K; Lillard, V; Roberts, D A; Blaylock, G; Dallapiccola, C; Flood, K T; Hertzbach, S S; Kofler, R; Koptchev, V B; Moore, T B; Saremi, S; Stängle, H; Willocq, S; Cowan, R; Sciolla, G; Taylor, F; Yamamoto, R K; Mangeol, D J J; Patel, P M; Lazzaro, A; Palombo, F; Bauer, J M; Cremaldi, L M; Eschenburg, V; Godang, R; Kroeger, R; Reidy, J; Sanders, D A; Summers, D J; Zhao, H W; Brunet, S; Cote-Ahern, D; Hast, C; Taras, P; Nicholson, H; Cartaro, C; Cavallo, N; De Nardo, Gallieno; Fabozzi, F; Gatto, C; Lista, L; Paolucci, P; Piccolo, D; Sciacca, C; Baak, M A; Raven, G; LoSecco, J M; Gabriel, T A; Brau, B; Gan, K K; Honscheid, K; Hufnagel, D; Kagan, H; Kass, R; Pulliam, T; Wong, Q K; Brau, J E; Frey, R; Potter, C T; Sinev, N B; Strom, D; Torrence, E; Colecchia, F; Dorigo, A; Galeazzi, F; Margoni, M; Morandin, M; Posocco, M; Rotondo, M; Simonetto, F; Stroili, R; Tiozzo, G; Voci, C; Benayoun, M; Briand, H; Chauveau, J; David, P; La Vaissière, C de; Del Buono, L; Hamon, O; John, M J J; Leruste, P; Ocariz, J; Pivk, M; Roos, L; Stark, J; T'Jampens, S; Therin, G; Manfredi, P F; Re, V; Behera, P K; Gladney, L; Guo, Q H; Panetta, J; Angelini, C; Batignani, G; Bettarini, S; Bondioli, M; Bucci, F; Calderini, G; Carpinelli, M; Del Gamba, V; Forti, F; Giorgi, M A; Lusiani, A; Marchiori, G; Martínez-Vidal, F; Morganti, M; Neri, N; Paoloni, E; Rama, M; Rizzo, G; Sandrelli, F; Walsh, J; Haire, M; Judd, D; Paick, K; Wagoner, D E; Danielson, N; Elmer, P; Lü, C; Miftakov, V; Olsen, J; Smith, A J S; Tanaka, H A; Varnes, E W; Bellini, F; Cavoto, G; Faccini, R; Ferrarotto, F; Ferroni, F; Gaspero, M; Mazzoni, M A; Morganti, S; Pierini, M; Piredda, G; Safai-Tehrani, F; Voena, C; Christ, S; Wagner, G; Waldi, R; Adye, T; De Groot, N; Franek, B J; Geddes, N I; Gopal, G P; Olaiya, E O; Xella, S M; Aleksan, Roy; Emery, S; Gaidot, A; Ganzhur, S F; Giraud, P F; Hamel de Monchenault, G; Kozanecki, Witold; Langer, M; Legendre, M; London, G W; Mayer, B; Schott, G; Vasseur, G; Yéche, C; Zito, M; Purohit, M V; Weidemann, A W; Yumiceva, F X; Aston, D; Bartoldus, R; Berger, N; Boyarski, A M; Buchmüller, O L; Convery, M R; Coupal, D P; Dong, D; Dorfan, J; Dujmic, D; Dunwoodie, W M; Field, R C; Glanzman, T; Gowdy, S J; Graugès-Pous, E; Hadig, T; Halyo, V; Hrynóva, T; Innes, W R; Jessop, C P; Kelsey, M H; Kim, P; Kocian, M L; Langenegger, U; Leith, D W G S; Luitz, S; Lüth, V; Lynch, H L; Marsiske, H; Messner, R; Müller, D R; O'Grady, C P; Ozcan, V E; Perazzo, A; Perl, M; Petrak, S; Ratcliff, B N; Robertson, S H; Roodman, A; Salnikov, A A; Schindler, R H; Schwiening, J; Simi, G; Snyder, A; Soha, A; Stelzer, J; Su, D; Sullivan, M K; Vavra, J; Wagner, S R; Weaver, M; Weinstein, A J R; Wisniewski, W J; Wright, D H; Young, C C; Burchat, Patricia R; Edwards, A J; Meyer, T I; Petersen, B A; Roat, C; Ahmed, S; Alam, M S; Ernst, J A; Saleem, M; Wappler, F R; Bugg, W; Krishnamurthy, M; Spanier, S M; Eckmann, R; Kim, H; Ritchie, J L; Schwitters, R F; Izen, J M; Kitayama, I; Lou, X C; Ye, S; Bianchi, F; Bóna, M; Gallo, F; Gamba, D; Borean, C; Bosisio, L; Della Ricca, G; Dittongo, S; Grancagnolo, S; Lanceri, L; Poropat, P; Vitale, L; Vuagnin, G; Panvini, R S; Banerjee, Sw; Brown, C M; Fortin, D; Jackson, P D; Kowalewski, R V; Roney, J M; Band, H R; Dasu, S; Datta, M; Eichenbaum, A M; Johnson, J R; Kutter, P E; Li, H; Liu, R; Di Lodovico, F; Mihályi, A; Mohapatra, A K; Pan, Y; Prepost, R; Sekula, S J; Von Wimmersperg-Töller, J H; Wu, J; Wu, S L; Yu, Z; Neal, H

    2004-01-01

    We present a measurement of the branching fraction of the decay B+- --> chi_c0 K+- from a sample of 89 million BB pairs collected by the BaBar detector at the PEP-II asymmetric-energy B Factory at SLAC. The chi_c0 meson is reconstructed through its two-body decays to pi+ pi- and K+ K-. We measure BR(B+- --> chi_c0 K+-)* BR(chi_c0 --> pi+ pi-) = (1.32^{+0.28}_{-0.27}(stat) +- 0.09(syst))*10^-6 and BR(B+- --> chi_c0 K+-) * BR(chi_c0 --> K+ K-) = (1.49^{+0.36}_{-0.34}(stat) +- 0.11(syst))* 10^-6. Using the known values for the chi_c0 decays branching fractions, we combine these results to obtain BR(B+- --> chi_c0 K+-) = (2.7+-0.7)* 10^-4.

  7. The best approximation of $P-$ metric space of $\\chi^{2}-$ defined by Musielak

    Directory of Open Access Journals (Sweden)

    NAGARAJAN SUBRAMANIAN

    2014-06-01

    Full Text Available In this paper, we introduce the idea of constructing sequence space $\\chi^{2}$ of best approximation in $p-$ metric defined by Musielak and also construct some general topological properties of approximation of $\\chi^{2}$

  8. Effect of tai chi exercise on proprioception of ankle and knee joints in old people

    OpenAIRE

    Xu, D.; Hong, Y; Li, J.; Chan, K.

    2004-01-01

    Objectives: To assess if tai chi, a traditional Chinese form of exercise, could improve proprioception in old people and if the effects of tai chi on proprioception are more evident than other exercise forms in the elderly.

  9. $\\chi^2$-confidence sets in high-dimensional regression

    OpenAIRE

    van de Geer, Sara; Stucky, Benjamin

    2015-01-01

    We study a high-dimensional regression model. Aim is to construct a confidence set for a given group of regression coefficients, treating all other regression coefficients as nuisance parameters. We apply a one-step procedure with the square-root Lasso as initial estimator and a multivariate square-root Lasso for constructing a surrogate Fisher information matrix. The multivariate square-root Lasso is based on nuclear norm loss with $\\ell_1$-penalty. We show that this procedure leads to an as...

  10. A fast and powerful W-test for pairwise epistasis testing.

    Science.gov (United States)

    Wang, Maggie Haitian; Sun, Rui; Guo, Junfeng; Weng, Haoyi; Lee, Jack; Hu, Inchi; Sham, Pak Chung; Zee, Benny Chung-Ying

    2016-07-01

    Epistasis plays an essential role in the development of complex diseases. Interaction methods face common challenge of seeking a balance between persistent power, model complexity, computation efficiency, and validity of identified bio-markers. We introduce a novel W-test to identify pairwise epistasis effect, which measures the distributional difference between cases and controls through a combined log odds ratio. The test is model-free, fast, and inherits a Chi-squared distribution with data adaptive degrees of freedom. No permutation is needed to obtain the P-values. Simulation studies demonstrated that the W-test is more powerful in low frequency variants environment than alternative methods, which are the Chi-squared test, logistic regression and multifactor-dimensionality reduction (MDR). In two independent real bipolar disorder genome-wide associations (GWAS) datasets, the W-test identified significant interactions pairs that can be replicated, including SLIT3-CENPN, SLIT3-TMEM132D, CNTNAP2-NDST4 and CNTCAP2-RTN4R The genes in the pairs play central roles in neurotransmission and synapse formation. A majority of the identified loci are undiscoverable by main effect and are low frequency variants. The proposed method offers a powerful alternative tool for mapping the genetic puzzle underlying complex disorders. PMID:27112568

  11. Least-squares dosimetry unfolding: the program STAY'SL. [STAY'SL Code

    Energy Technology Data Exchange (ETDEWEB)

    Perey, F. G.

    1977-10-01

    A PDP-10 FORTRAN IV computer program STAY'SL, which solves the dosimetry unfolding problem by the method of least squares, is described. The solution (the output spectrum and its covariance matrix) is calculated by minimizing chi-square based on the input data (the activation data, the input spectrum, the dosimetry cross sections and their uncertainties given by covariance matrices). The solution reflects therefore the uncertainties in all of the input data and their correlations. The correlations among the various dosimetry cross sections are taken into account; however, the activation data, input spectrum and cross sections as classes are assumed to be uncorrelated with each other.

  12. Search for Factorization-Suppressed $B \\to{ chi_c} K^(*)$ Decays

    CERN Document Server

    Aubert, B; Boutigny, D; Couderc, F; Karyotakis, Yu; Lees, J P; Poireau, V; Tisserand, V; Zghiche, A; Graugès-Pous, E; Palano, A; Pompili, A; Chen, J C; Qi, N D; Rong, G; Wang, P; Zhu, Y S; Eigen, G; Ofte, I; Stugu, B; Abrams, G S; Borgland, A W; Breon, A B; Brown, D N; Button-Shafer, J; Cahn, R N; Charles, E; Day, C T; Gill, M S; Gritsan, A V; Groysman, Y; Jacobsen, R G; Kadel, R W; Kadyk, J; Kerth, L T; Kolomensky, Yu G; Kukartsev, G; Lynch, G; Mir, L M; Oddone, P J; Orimoto, T J; Pripstein, M; Roe, N A; Ronan, Michael T; Wenzel, W A; Barrett, M; Ford, K E; Harrison, T J; Hart, A J; Hawkes, C M; Morgan, S E; Watson, A T; Fritsch, M; Goetzen, K; Held, T; Koch, H; Lewandowski, B; Pelizaeus, M; Schröder, T; Steinke, M; Boyd, J T; Chevalier, N; Cottingham, W N; Kelly, M P; Latham, T E; Wilson, F F; Çuhadar-Dönszelmann, T; Hearty, C; Knecht, N S; Mattison, T S; McKenna, J A; Thiessen, D; Khan, A; Kyberd, P; Teodorescu, L; Blinov, A E; Blinov, V E; Druzhinin, V P; Golubev, V B; Ivanchenko, V N; Kravchenko, E A; Onuchin, A P; Serednyakov, S I; Skovpen, Yu I; Solodov, E P; Yushkov, A N; Best, D; Bruinsma, M; Chao, M; Eschrich, I; Kirkby, D; Lankford, A J; Mandelkern, M A; Mommsen, R K; Röthel, W; Stoker, D P; Buchanan, C; Hartfiel, B L; Weinstein, A J R; Foulkes, S D; Gary, J W; Long, O; Shen, B C; Wang, K; Del Re, D; Hadavand, H K; Hill, E J; MacFarlane, D B; Paar, H P; Rahatlou, S; Sharma, V; Berryhill, J W; Campagnari, C; Cunha, A; Dahmes, B; Hong, T M; Lu, A; Mazur, M A; Richman, J D; Verkerke, W; Beck, T W; Eisner, A M; Heusch, C A; Kroseberg, J; Lockman, W S; Nesom, G; Schalk, T; Schumm, B A; Seiden, A; Spradlin, P; Williams, D C; Wilson, M G; Albert, J; Chen, E; Dubois-Felsmann, G P; Dvoretskii, A; Hitlin, D G; Narsky, I; Piatenko, T; Porter, F C; Ryd, A; Samuel, A; Yang, S; Jayatilleke, S M; Mancinelli, G; Meadows, B T; Sokoloff, M D; Blanc, F; Bloom, P; Chen, S; Ford, W T; Nauenberg, U; Olivas, A; Rankin, P; Ruddick, W O; Smith, J G; Ulmer, K A; Zhang, J; Zhang, L; Chen, A; Eckhart, E A; Harton, J L; Soffer, A; Toki, W H; Wilson, R J; Zeng, Q; Spaan, B; Altenburg, D; Brandt, T; Brose, J; Dickopp, M; Feltresi, E; Hauke, A; Lacker, H M; Nogowski, R; Otto, S; Petzold, A; Schubert, J; Schubert, Klaus R; Schwierz, R; Sundermann, J E; Bernard, D; Bonneaud, G R; Grenier, P; Schrenk, S; Thiebaux, C; Vasileiadis, G; Verderi, M; Bard, D J; Clark, P J; Muheim, F; Playfer, S; Xie, Y; Andreotti, M; Azzolini, V; Bettoni, D; Bozzi, C; Calabrese, R; Cibinetto, G; Luppi, E; Negrini, M; Piemontese, L; Sarti, A; Anulli, F; Baldini-Ferroli, R; Calcaterra, A; De Sangro, R; Finocchiaro, G; Patteri, P; Peruzzi, I M; Piccolo, M; Zallo, A; Buzzo, A; Capra, R; Contri, R; Crosetti, G; Lo Vetere, M; Macri, M; Monge, M R; Passaggio, S; Patrignani, C; Robutti, E; Santroni, A; Tosi, S; Bailey, S; Brandenburg, G; Chaisanguanthum, K S; Morii, M; Won, E; Dubitzky, R S; Langenegger, U; Marks, J; Uwer, U; Bhimji, W; Bowerman, D A; Dauncey, P D; Egede, U; Gaillard, J R; Morton, G W; Nash, J A; Nikolich, M B; Taylor, G P; Charles, M J; Grenier, G J; Mallik, U; Cochran, J; Crawley, H B; Lamsa, J; Meyer, W T; Prell, S; Rosenberg, E I; Rubin, A E; Yi, J; Arnaud, N; Davier, M; Giroux, X; Grosdidier, G; Höcker, A; Le Diberder, F R; Lepeltier, V; Lutz, A M; Petersen, T C; Plaszczynski, S; Schune, M H; Wormser, G; Cheng, C H; Lange, D J; Simani, M C; Wright, D M; Bevan, A J; Chavez, C A; Coleman, J P; Forster, I J; Fry, J R; Gabathuler, Erwin; Gamet, R; Hutchcroft, D E; Parry, R J; Payne, D J; Touramanis, C; Cormack, C M; Di Lodovico, F; Brown, C L; Cowan, G; Flack, R L; Flächer, H U; Green, M G; Jackson, P S; McMahon, T R; Ricciardi, S; Salvatore, F; Winter, M A; Brown, D; Davis, C L; Allison, J; Barlow, N R; Barlow, R J; Hodgkinson, M C; Lafferty, G D; Williams, J C; Chen, C; Farbin, A; Hulsbergen, W D; Jawahery, A; Kovalskyi, D; Lae, C K; Lillard, V; Roberts, D A; Blaylock, G; Dallapiccola, C; Hertzbach, S S; Kofler, R; Koptchev, V B; Moore, T B; Saremi, S; Stängle, H; Willocq, S; Cowan, R; Koeneke, K; Sciolla, G; Sekula, S J; Taylor, F; Yamamoto, R K; Patel, P M; Robertson, S H; Lazzaro, A; Lombardo, V; Palombo, F; Bauer, J M; Cremaldi, L M; Eschenburg, V; Godang, R; Kroeger, R; Reidy, J; Sanders, D A; Summers, D J; Zhao, H W; Brunet, S; Côté, D; Taras, P; Nicholson, H; Cavallo, N; Fabozzi, F; Gatto, C; Lista, L; Monorchio, D; Paolucci, P; Piccolo, D; Sciacca, C; Baak, M; Bulten, H; Raven, G; Snoek, H L; Wilden, L; Jessop, C P; LoSecco, J M; Allmendinger, T; Benelli, G; Gan, K K; Honscheid, K; Hufnagel, D; Kagan, H; Kass, R; Pulliam, T; Rahimi, A M; Ter-Antonian, R; Wong, Q K; Brau, J E; Frey, R; Igonkina, O; Lu, M; Potter, C T; Sinev, N B; Strom, D; Torrence, E; Colecchia, F; Dorigo, A; Galeazzi, F; Margoni, M; Morandin, M; Posocco, M; Rotondo, M; Simonetto, F; Stroili, R; Voci, C; Benayoun, M; Briand, H; Chauveau, J; David, P; La Vaissière, C de; Del Buono, L; Hamon, O; John, M J J; Leruste, P; Malcles, J; Ocariz, J; Roos, L; Therin, G; Behera, P K; Gladney, L; Guo, Q H; Panetta, J; Biasini, M; Covarelli, R; Pioppi, M; Angelini, C; Batignani, G; Bettarini, S; Bondioli, M; Bucci, F; Calderini, G; Carpinelli, M; Forti, F; Giorgi, M A; Lusiani, A; Marchiori, G; Morganti, M; Neri, N; Paoloni, E; Rama, M; Rizzo, G; Simi, G; Walsh, J; Haire, M; Judd, D; Paick, K; Wagoner, D E; Danielson, N; Elmer, P; Lau, Y P; Lü, C; Miftakov, V; Olsen, J; Smith, A J S; Telnov, A V; Bellini, F; Cavoto, G; D'Orazio, A; Di Marco, E; Faccini, R; Ferrarotto, F; Ferroni, F; Gaspero, M; Li Gioi, L; Mazzoni, M A; Morganti, S; Pierini, M; Piredda, G; Polci, F; Safai-Tehrani, F; Voena, C; Christ, S; Schröder, H; Wagner, G; Waldi, R; Adye, T; De Groot, N; Franek, B J; Gopal, G P; Olaiya, E O; Aleksan, Roy; Emery, S; Gaidot, A; Ganzhur, S F; Giraud, P F; Hamel de Monchenault, G; Kozanecki, Witold; Legendre, M; London, G W; Mayer, B; Schott, G; Vasseur, G; Yéche, C; Zito, M; Purohit, M V; Weidemann, A W; Wilson, J R; Yumiceva, F X; Abe, T; Allen, M; Aston, D; Bartoldus, R; Berger, N; Boyarski, A M; Buchmüller, O L; Claus, R; Convery, M R; Cristinziani, M; De Nardo, Gallieno; Dingfelder, J C; Dong, D; Dorfan, J; Dujmic, D; Dunwoodie, W M; Fan, S; Field, R C; Glanzman, T; Gowdy, S J; Hadig, T; Halyo, V; Hast, C; Hrynóva, T; Innes, W R; Kelsey, M H; Kim, P; Kocian, M L; Leith, D W G S; Libby, J; Luitz, S; Lüth, V; Lynch, H L; Marsiske, H; Messner, R; Müller, D R; O'Grady, C P; Ozcan, V E; Perazzo, A; Perl, M; Ratcliff, B N; Roodman, A; Salnikov, A A; Schindler, R H; Schwiening, J; Snyder, A; Soha, A; Stelzer, J; Strube, J; Su, D; Sullivan, M K; Thompson, J; Vavra, J; Wagner, S R; Weaver, M; Wisniewski, W J; Wittgen, M; Wright, D H; Yarritu, A K; Young, C C; Burchat, Patricia R; Edwards, A J; Majewski, S A; Petersen, B A; Roat, C; Ahmed, M; Ahmed, S; Alam, M S; Ernst, J A; Saeed, M A; Saleem, M; Wappler, F R; Bugg, W; Krishnamurthy, M; Spanier, S M; Eckmann, R; Kim, H; Ritchie, J L; Satpathy, A; Schwitters, R F; Izen, J M; Kitayama, I; Lou, X C; Ye, S; Bianchi, F; Bóna, M; Gallo, F; Gamba, D; Bosisio, L; Cartaro, C; Cossutti, F; Della Ricca, G; Dittongo, S; Grancagnolo, S; Lanceri, L; Poropat, P; Vitale, L; Vuagnin, G; Martínez-Vidal, F; Panvini, R S; Banerjee, S; Bhuyan, B; Brown, C M; Fortin, D; Jackson, P D; Kowalewski, R V; Roney, J M; Sobie, R J; Back, J J; Harrison, P F; Mohanty, G B; Band, H R; Chen, X; Cheng, B; Dasu, S; Datta, M; Eichenbaum, A M; Flood, K T; Graham, M; Hollar, J J; Johnson, J R; Kutter, P E; Li, H; Liu, R; Mihályi, A; Pan, Y; Prepost, R; Tan, P; Von Wimmersperg-Töller, J H; Wu, J; Wu, S L; Yu, Z; Greene, M G; Neal, H

    2005-01-01

    We search for the factorization-suppressed decays B -> chi_c0 K(*) and B -> chi_c2 K(*), with chi_c0 and chi_c2 decaying into J/psi gamma using a sample of 124 10^6 BBbar events collected with the BABAR detector at the PEP-II storage ring of the Stanford Linear Accelerator Center.

  13. Squared Metric Facility Location Problem

    CERN Document Server

    Fernandes, Cristina G; Miyazawa, Flávio K; Pedrosa, Lehilton L C

    2011-01-01

    Jain et al. proposed two well-known algorithms for the Metric Facility Location Problem (MFLP), that achieve approximation ratios of 1.861 and 1.61. Mahdian et al. combined the latter algorithm with scaling and greedy augmentation techniques, obtaining a 1.52-approximation for the MFLP. We consider a generalization of the Squared Euclidean Facility Location Problem, when the distance function is a squared metric, which we call Squared Metric Facility Location Problem (SMFLP). We show that the algorithms of Jain et al. and of Mahdian et al., when applied to this variant of the facility location, achieve approximation ratios of 2.87, 2.43, and 2.17, respectively. It is shown that, for the SMFLP, there is no 2.04-approximation algorithm, assuming P $\

  14. A Solution to Weighted Sums of Squares as a Square

    Science.gov (United States)

    Withers, Christopher S.; Nadarajah, Saralees

    2012-01-01

    For n = 1, 2, ... , we give a solution (x[subscript 1], ... , x[subscript n], N) to the Diophantine integer equation [image omitted]. Our solution has N of the form n!, in contrast to other solutions in the literature that are extensions of Euler's solution for N, a sum of squares. More generally, for given n and given integer weights m[subscript…

  15. Tai Chi and Qi Gong for Health and Well-Being

    Medline Plus

    Full Text Available ... Tai Chi and Qi Gong for Health and Well-Being Share: taichi_nccamIMG_2962.jpg © Mariann Seriff ... Tai Chi and Qi Gong for Health and Well-Being Video › Tai Chi and Qi Gong for ...

  16. Sitting tai chi improves the balance control and muscle strength of community-dwelling persons with spinal cord injuries: a pilot study.

    Science.gov (United States)

    Tsang, William W N; Gao, Kelly L; Chan, K M; Purves, Sheila; Macfarlane, Duncan J; Fong, Shirley S M

    2015-01-01

    Objective. To investigate the effects of sitting Tai Chi on muscle strength, balance control, and quality of life (QOL) among survivors with spinal cord injuries (SCI). Methods. Eleven SCI survivors participated in the sitting Tai Chi training (90 minutes/session, 2 times/week for 12 weeks) and eight SCI survivors acted as controls. Dynamic sitting balance was evaluated using limits of stability test and a sequential weight shifting test in sitting. Handgrip strength was also tested using a hand-held dynamometer. QOL was measured using the World Health Organization's Quality of Life Scale. Results. Tai Chi practitioners achieved significant improvements in their reaction time (P = 0.042); maximum excursion (P = 0.016); and directional control (P = 0.025) in the limits of stability test after training. In the sequential weight shifting test, they significantly improved their total time to sequentially hit the 12 targets (P = 0.035). Significant improvement in handgrip strength was also found among the Tai Chi practitioners (P = 0.049). However, no significant within and between-group differences were found in the QOL outcomes (P > 0.05). Conclusions. Twelve weeks of sitting Tai Chi training could improve the dynamic sitting balance and handgrip strength, but not QOL, of the SCI survivors. PMID:25688276

  17. Sitting Tai Chi Improves the Balance Control and Muscle Strength of Community-Dwelling Persons with Spinal Cord Injuries: A Pilot Study

    Directory of Open Access Journals (Sweden)

    William W. N. Tsang

    2015-01-01

    Full Text Available Objective. To investigate the effects of sitting Tai Chi on muscle strength, balance control, and quality of life (QOL among survivors with spinal cord injuries (SCI. Methods. Eleven SCI survivors participated in the sitting Tai Chi training (90 minutes/session, 2 times/week for 12 weeks and eight SCI survivors acted as controls. Dynamic sitting balance was evaluated using limits of stability test and a sequential weight shifting test in sitting. Handgrip strength was also tested using a hand-held dynamometer. QOL was measured using the World Health Organization’s Quality of Life Scale. Results. Tai Chi practitioners achieved significant improvements in their reaction time (P=0.042; maximum excursion (P=0.016; and directional control (P=0.025 in the limits of stability test after training. In the sequential weight shifting test, they significantly improved their total time to sequentially hit the 12 targets (P=0.035. Significant improvement in handgrip strength was also found among the Tai Chi practitioners (P=0.049. However, no significant within and between-group differences were found in the QOL outcomes (P>0.05. Conclusions. Twelve weeks of sitting Tai Chi training could improve the dynamic sitting balance and handgrip strength, but not QOL, of the SCI survivors.

  18. Quasi-least squares regression

    CERN Document Server

    Shults, Justine

    2014-01-01

    Drawing on the authors' substantial expertise in modeling longitudinal and clustered data, Quasi-Least Squares Regression provides a thorough treatment of quasi-least squares (QLS) regression-a computational approach for the estimation of correlation parameters within the framework of generalized estimating equations (GEEs). The authors present a detailed evaluation of QLS methodology, demonstrating the advantages of QLS in comparison with alternative methods. They describe how QLS can be used to extend the application of the traditional GEE approach to the analysis of unequally spaced longitu

  19. Signed shape tilings of squares

    OpenAIRE

    Keating, Kevin

    1998-01-01

    Let T be a tile in the Cartesian plane made up of finitely many rectangles whose corners have rational coordinates and whose sides are parallel to the coordinate axes. This paper gives necessary and sufficient conditions for a square to be tilable by finitely many \\Q-weighted tiles with the same shape as T, and necessary and sufficient conditions for a square to be tilable by finitely many \\Z-weighted tiles with the same shape as T. The main tool we use is a variant of F. W. Barnes's algebrai...

  20. How The Semiotic Square Came

    OpenAIRE

    Badir, Sémir

    2012-01-01

    In this paper, I intend to give a presentation of the diagram known in semiotics as “the semiotic square”. More precisely, I would like to retrace semiotic square’s origins and early history until its “official” presentation in a dictionary of semiotics. One would expect that the logical square should have taken a great part in the invention of the semiotic diagram. However, the trajectory of the semiotic square was more fluctuating and heterogeneous than what is expected a priori, coming und...

  1. Least Squares Ranking on Graphs

    OpenAIRE

    Hirani, Anil N.; Kalyanaraman, Kaushik; Watts, Seth

    2010-01-01

    Given a set of alternatives to be ranked, and some pairwise comparison data, ranking is a least squares computation on a graph. The vertices are the alternatives, and the edge values comprise the comparison data. The basic idea is very simple and old: come up with values on vertices such that their differences match the given edge data. Since an exact match will usually be impossible, one settles for matching in a least squares sense. This formulation was first described by Leake in 1976 for ...

  2. Rates of convergence for estimation and testing in multinomial distributions

    International Nuclear Information System (INIS)

    This paper is concerned with various problems involving the multinomial distribution. Chapter 1 contains an asymptotic power comparison between the likelihood ratio test and a class of chi-square tests. The power comparison is based on the fact that suitably scaled the test statistics can be approximated by a normal. The comparison is similar to Hoeffding but his power comparison is made using the theory of large deviations. Chapters 2-4 deal with estimation of a single parameter. Expansion for the estimators and their mean square error are given. Many papers in this area have appeared including Rao, Effron, Ghosh and Subramanyam, and Robertson. Other authors justify the calculations for one fixed value of the parameter, in this paper it is shown how the calculations can be justified over the whole parameter space. It is also shown that there are other estimation procedures which have the same properties as minimum chi-square and maximum likelihood estimates. Chapter 4 contains examples of the expansions. When the examples are applied to the logistic model the results agree quite well with a computer study done by Berkson. Chapter 5 discussed estimation in the log-linear model. Under a full model a prior is defined for which the Bayes estimates can easily be calculated. Estimates for the submodel are obtained by projections. The results show that the contrasts in the log-odds of Lindley are Bayes with respect to a suitable prior

  3. Effectiveness of a Tai-Chi Training and Detraining on Functional Capacity, Symptomatology and Psychological Outcomes in Women with Fibromyalgia

    Directory of Open Access Journals (Sweden)

    Alejandro Romero-Zurita

    2012-01-01

    Full Text Available Background. The purpose was to analyze the effects of Tai-Chi training in women with fibromyalgia (FM. Methods. Thirty-two women with FM (mean age, 51.4±6.8 years attended to Tai-Chi intervention 3 sessions weekly for 28 weeks. The outcome measures were: tenderness, body composition, functional capacity and psychological outcomes (Fibromyalgia impact questionnaire (FIQ, Short Form Health Survey 36 (SF-36. Results. Patients showed improvements on pain threshold, total number of tender points and algometer score (all <0.001. The intervention was effective on 6-min walk (=0.006, back scratch (=0.002, handgrip strength (=0.006, chair stand, chair sit & reach, 8 feet up & go and blind flamingo tests (all <0.001. Tai-Chi group improved the FIQ total score (<0.001 and six subscales: stiffness (=0.005, pain, fatigue, morning tiredness, anxiety, and depression (all <0.001. The intervention was also effective in six SF-36 subscales: bodily pain (=0.003, vitality (=0.018, physical functioning, physical role, general health, and mental health (all <0.001. Conclusions. A 28-week Tai-Chi intervention showed improvements on pain, functional capacity, symptomatology and psychological outcomes in female FM patients.

  4. Dicty_cDB: CHI614 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 850F7 (Roswell Park Cancer Institute Human BAC Library) complete sequence. 38 0.53 5 CR382125 |CR382125.1 Kluyveromyces lact...AAACCTTATTATCCA ATATTTTATTATCAGGTTTTAGG Length of 3' end seq. 743 Connected seq. ID CHI614P Connected seq. >...IILVXIINXVYNXFSGHS SEHTKNXLKXASKTSKKX--- ---DNHTFLRENRDPVKKMKHLPQGIL*sksirerffigfgtwhwwcts...ENRDPVKKMKHLPQGIL*sksirerffigfgtwhwwctsfsqss*ti*lc isitllvatyss*yv*tlvlcrn*sfmrtqisiikhwsrsksystmskrw*nya*ysts...d in the head. 40 2.1 2 CR238085 |CR238085.1 Forward strand read from insert in 5'HPRT insertion

  5. Dicty_cDB: CHI740 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHI740 (Link to dictyBase) - - - Contig-U16419-1 - (Link to Original site) ... krftxchenctx** Frame B: ---xkttslvfkmxtks*m*i**prssmlc kgsp**mfikmshmamnvklitmvknvxsd pidhhhqkfvh*dahqnmnv ... slrcptwp*m*s*sqw*rmlxqi p*ttttrslfikmptkt*m*i**sw*kmlc kdsl**sl*frlw*rf*m*n*t*wfkmlc p frkttpttt*km**empxrp ... *m*s*stwkrmlrccp*txtkmlfkmstkt*m*sqpxw*r mlc *sspr*mfiemstrp*m*s*stwkrmxrccp*tttemlikmstkt*m*nqs ... lw*rml c *k*k*lfnl*rpktvkekvyxvp*klyxlik Homology vs CSM-cD ...

  6. Two-Photon Widths of the chi_cJ States of Charmonium

    CERN Document Server

    Ecklund, K M; Savinov, V; López, A; Méndez, H; Ramírez, J; Ge, J Y; Miller, D H; Shipsey, I P J; Xin, B; Adams, G S; Anderson, M; Cummings, J P; Danko, I; Hu, D; Moziak, B; Napolitano, J; He, Q; Insler, J; Muramatsu, H; Park, C S; Thorndike, E H; Yang, F; Artuso, M; Blusk, S; Khalil, S; Li, J; Mountain, R; Nisar, S; Randrianarivony, K; Sultana, N; Skwarnicki, T; Stone, S; Wang, J C; Zhang, L M; Bonvicini, G; Cinabro, D; Dubrovin, M; Lincoln, A; Naik, P; Rademacker, J; Asner, D M; Edwards, K W; Reed, J; Briere, R A; Ferguson, T; Tatishvili, G; Vogel, H; Watkins, M E; Rosner, J L; Alexander, J P; Cassel, D G; Duboscq, J E; Ehrlich, R; Fields, L; Galik, R S; Gibbons, L; Gray, R; Gray, S W; Hartill, D L; Hertz, D; Hunt, J M; Kandaswamy, J; Kreinick, D L; Kuznetsov, V E; Ledoux, J; Mahlke-Krüger, H; Mohapatra, D; Onyisi, P U E; Patterson, J R; Peterson, D; Riley, D; Ryd, A; Sadoff, A J; Shi, X; Stroiney, S; Sun, W M; Wilksen, T; Athar, S B; Patel, R; Yelton, J; Rubin, P; Eisenstein, B I; Karliner, I; Mehrabyan, S; Lowrey, N; Selen, M; White, E J; Wiss, J; Mitchell, R E; Shepherd, M R; Besson, D; Pedlar, T K; Cronin-Hennessy, D; Gao, K Y; Hietala, J; Kubota, Y; Klein, T; Lang, B W; Poling, R; Scott, A W; Zweber, P; Dobbs, S; Metreveli, Z; Seth, K K; Tomaradze, A G; Libby, J; Powell, A; Wilkinson, G

    2008-01-01

    Using a data sample of 24.5 million psi(2S) the reactions psi(2S)->gamma chi_cJ, chi_cJ->gamma gamma have been studied for the first time to determine the two-photon widths of the chi_cJ states of charmonium in their decay into two photons. The measured quantities are B(psi(2S)->gamma chi_c0)xB(chi_c0->gamma gamma)=(2.22+-0.32+-0.10)x10^-5, and B(psi(2S)->gamma chi_c2)xB(chi_c2->gamma gamma)=(2.70+-0.28+-0.15)x10^-5. Using values for B(psi(2S)->gamma chi_c0,c2) and \\Gamma(chi_c0,c2) from the literature the two-photon widths are derived to be \\Gamma_{gamma gamma}(chi_c0)=(2.53+-0.37+-0.26) keV, \\Gamma_{gamma gamma}(chi_c2)=(0.60+-0.06+-0.06) keV, and R=\\Gamma_{gamma gamma}(chi_c2)/\\Gamma_{gamma gamma}(chi_c0)= 0.237+-0.043+-0.034. The importance of the measurement of R is emphasized. For the forbidden transition, chi_c1->gamma gamma, an upper limit of \\Gamma_{gamma gamma}(chi_c1)<0.03 keV is established.

  7. Chinese-chi and Kundalini yoga Meditations Effects on the Autonomic Nervous System: Comparative Study

    Directory of Open Access Journals (Sweden)

    Anilesh Dey

    2016-06-01

    Full Text Available Cardiac disease is one of the major causes for death all over the world. Heart rate variability (HRV is a significant parameter that used in assessing Autonomous Nervous System (ANS activity. Generally, the 2D Poincare′ plot and 3D Poincaré plot of the HRV signals reflect the effect of different external stimuli on the ANS. Meditation is one of such external stimulus, which has different techniques with different types of effects on the ANS. Chinese Chi-meditation and Kundalini yoga are two different effective meditation techniques. The current work is interested with the analysis of the HRV signals under the effect of these two based on meditation techniques. The 2D and 3D Poincare′ plots are generally plotted by fitting respectively an ellipse/ellipsoid to the dense region of the constructed Poincare′ plot of HRV signals. However, the 2D and 3D Poincaré plots sometimes fail to describe the proper behaviour of the system. Thus in this study, a three-dimensional frequency-delay plot is proposed to properly distinguish these two famous meditation techniques by analyzing their effects on ANS. This proposed 3D frequency-delay plot is applied on HRV signals of eight persons practicing same Chi-meditation and four other persons practising same Kundalini yoga. To substantiate the result for larger sample of data, statistical Student t-test is applied, which shows a satisfactory result in this context. The experimental results established that the Chi-meditation has large impact on the HRVcompared to the Kundalini yoga.

  8. A square from similar rectangles

    OpenAIRE

    Dorichenko, Sergey; Skopenkov, Mikhail

    2013-01-01

    In the present popular science paper we determine when a square can be dissected into rectangles similar to a given rectangle. The approach to the question is based on a physical interpretation using electrical networks. Only secondary school background is assumed in the paper.

  9. Two-photon widths of the $\\chi_{c0, 2}$ states and helicity analysis for $\\chi_{c2}\\ar\\gamma\\gamma$}

    CERN Document Server

    Ablikim, M; Ambrose, D J; An, F F; An, Q; An, Z H; Bai, J Z; Ferroli, R B; Ban, Y; Becker, J; Berger, N; Bertani, M B; Bian, J M; Boger, E; Bondarenko, O; Boyko, I; Briere, R A; Bytev, V; Cai, X; Calcaterra, A C; Cao, G F; Chang, J F; Chelkov, G; Chen, G; Chen, H S; Chen, J C; Chen, M L; Chen, S J; Chen, Y; Chen, Y B; Cheng, H P; Chu, Y P; Cronin-Hennessy, D; Dai, H L; Dai, J P; Dedovich, D; Deng, Z Y; Denig, A; Denysenko, I; Destefanis, M; Ding, W M; Ding, Y; Dong, L Y; Dong, M Y; Du, S X; Fang, J; Fang, S S; Fava, L; Feldbauer, F; Feng, C Q; Fu, C D; Fu, J L; Gao, Y; Geng, C; Goetzen, K; Gong, W X; Gradl, W; Greco, M; Gu, M H; Gu, Y T; Guan, Y H; Guo, A Q; Guo, L B; Guo, Y P; Han, Y L; Hao, X Q; Harris, F A; He, K L; He, M; He, Z Y; Held, T; Heng, Y K; Hou, Z L; Hu, H M; Hu, J F; Hu, T; Huang, B; Huang, G M; Huang, J S; Huang, X T; Huang, Y P; Hussain, T; Ji, C S; Ji, Q; Ji, X B; Ji, X L; Jia, L K; Jiang, L L; Jiang, X S; Jiao, J B; Jiao, Z; Jin, D P; Jin, S; Jing, F F; Kalantar-Nayestanaki, N; Kavatsyuk, M; Kuehn, W; Lai, W; Lange, J S; Leung, J K C; Li, C H; Li, Cheng; Li, Cui; Li, D M; Li, F; Li, G; Li, H B; Li, J C; Li, K; Li, Lei; Li, N B; Li, Q J; Li, S L; Li, W D; Li, W G; Li, X L; Li, X N; Li, X Q; Li, X R; Li, Z B; Liang, H; Liang, Y F; Liang, Y T; Liao, G R; Liao, X T; Liu, B J; Liu, B J; Liu, C L; Liu, C X; Liu, C Y; Liu, F H; Liu, Fang; Liu, Feng; Liu, H; Liu, H B; Liu, H H; Liu, H M; Liu, H W; Liu, J P; Liu, Kun; Liu, Kai; Liu, K Y; Liu, P L; Liu, S B; Liu, X; Liu, X H; Liu, Y B; Liu, Y; Liu, Z A; Liu, Zhiqiang; Liu, Zhiqing; Loehner, H; Lu, G R; Lu, H J; Lu, J G; Lu, Q W; Lu, X R; Lu, Y P; Luo, C L; Luo, M X; Luo, T; Luo, X L; Lv, M; Ma, C L; Ma, F C; Ma, H L; Ma, Q M; Ma, S; Ma, T; Ma, X Y; Ma, Y; Maas, F E; Maggiora, M; Malik, Q A; Mao, H; Mao, Y J; Mao, Z P; Messchendorp, J G; Min, J; Min, T J; Mitchell, R E; Mo, X H; Morales, C Morales; Motzko, C; Muchnoi, N Yu; Nefedov, Y; Nicholson, C; Nikolaev, I B; Ning, Z; Olsen, S L; Ouyang, Q; Pacetti, S P; Park, J W; Pelizaeus, M; Peters, K; Ping, J L; Ping, R G; Poling, R; Prencipe, E; Pun, C S J; Qi, M; Qian, S; Qiao, C F; Qin, X S; Qin, Y; Qin, Z H; Qiu, J F; Rashid, K H; Rong, G; Ruan, X D; Sarantsev, A; Schulze, J; Shao, M; Shen, C P; Shen, X Y; Sheng, H Y; Shepherd, M R; Song, X Y; Spataro, S; Spruck, B; Sun, D H; Sun, G X; Sun, J F; Sun, S S; Sun, X D; Sun, Y J; Sun, Y Z; Sun, Z J; Sun, Z T; Tang, C J; Tang, X; Thorndike, E H; Tian, H L; Toth, D; Ulrich, M U; Varner, G S; Wang, B; Wang, B Q; Wang, K; Wang, L L; Wang, L S; Wang, M; Wang, P; Wang, P L; Wang, Q; Wang, Q J; Wang, S G; Wang, X F; Wang, X L; Wang, Y D; Wang, Y F; Wang, Y Q; Wang, Z; Wang, Z G; Wang, Z Y; Wei, D H; Weidenkaff, P; Wen, Q G; Wen, S P; Werner, M W; Wiedner, U; Wu, L H; Wu, N; Wu, S X; Wu, W; Wu, Z; Xia, L G; Xiao, Z J; Xie, Y G; Xiu, Q L; Xu, G F; Xu, G M; Xu, H; Xu, Q J; Xu, X P; Xu, Y; Xu, Z R; Xue, F; Xue, Z; Yan, L; Yan, W B; Yan, Y H; Yang, H X; Yang, T; Yang, Y; Yang, Y X; Ye, H; Ye, M; Ye, M H; Yu, B X; Yu, C X; Yu, J S; Yu, S P; Yuan, C Z; Yuan, W L; Yuan, Y; Zafar, A A; Zallo, A Z; Zeng, Y; Zhang, B X; Zhang, B Y; Zhang, C C; Zhang, D H; Zhang, H H; Zhang, H Y; Zhang, J; Zhang, J G; Zhang, J Q; Zhang, J W; Zhang, J Y; Zhang, J Z; Zhang, L; Zhang, S H; Zhang, T R; Zhang, X J; Zhang, X Y; Zhang, Y; Zhang, Y H; Zhang, Y S; Zhang, Z P; Zhang, Z Y; Zhao, G; Zhao, H S; Zhao, J W; Zhao, K X; Zhao, Lei; Zhao, Ling; Zhao, M G; Zhao, Q; Zhao, S J; Zhao, T C; Zhao, X H; Zhao, Y B; Zhao, Z G; Zhemchugov, A; Zheng, B; Zheng, J P; Zheng, Y H; Zheng, Z P; Zhong, B; Zhong, J; Zhou, L; Zhou, X K; Zhou, X R; Zhu, C; Zhu, K; Zhu, K J; Zhu, S H; Zhu, X L; Zhu, X W; Zhu, Y M; Zhu, Y S; Zhu, Z A; Zhuang, J; Zou, B S; Zou, J H; Zuo, J X

    2012-01-01

    Based on a data sample of 106 M $\\psi^{\\prime}$ events collected with the BESIII detector, the decays $\\psi^{\\prime}\\ar\\gamma\\chi_{c0, 2}$,$\\chi_{c0, 2}\\ar\\gamma\\gamma$ are studied to determine the two-photon widths of the $\\chi_{c0, 2}$ states. The two-photon decay branching fractions are determined to be ${\\cal B}(\\chi_{c0}\\ar\\gamma\\gamma) = (2.24\\pm 0.19\\pm 0.12\\pm 0.08)\\times 10^{-4}$ and ${\\cal B}(\\chi_{c2}\\ar\\gamma\\gamma) = (3.21\\pm 0.18\\pm 0.17\\pm 0.13)\\times 10^{-4}$. From these, the two-photon widths are determined to be $\\Gamma_{\\gamma \\gamma}(\\chi_{c0}) = (2.33\\pm0.20\\pm0.13\\pm0.17)$ keV, $\\Gamma_{\\gamma \\gamma}(\\chi_{c2}) = (0.63\\pm0.04\\pm0.04\\pm0.04)$ keV, and $\\cal R$ $=\\Gamma_{\\gamma \\gamma}(\\chi_{c2})/\\Gamma_{\\gamma \\gamma}(\\chi_{c0})=0.271\\pm 0.029\\pm 0.013\\pm 0.027$, where the uncertainties are statistical, systematic, and those from the PDG ${\\cal B}(\\psi^{\\prime}\\ar\\gamma\\chi_{c0,2})$ and $\\Gamma(\\chi_{c0,2})$ errors, respectively. The ratio of the two-photon widths for helicity $\\lambda=0...

  10. Chi-Chi (Taiwan) earthquake of September 21, 1999. Findings for the nuclear installations in Switzerland: short report

    International Nuclear Information System (INIS)

    The Swiss Federal Nuclear Safety Inspectorate (HSK) has a great interest to be rapidly informed and documented on relevant consequences of major earthquakes in industrialized countries in the world, in particular with respect to nuclear installations. The main goal is to recognize within a short time after such events, if measures should be taken at the Swiss nuclear installations. Therefore, Basler and Hofmann have prepared a report on the Chi-Chi (1999) earthquake for HSK within a few weeks after the event. The information was obtained primarily from the Internet and by directly contacting local authorities and other selected organisations in Taiwan. This short report is a summary representation of the HSK report of November 23, 1999. No updated or additional information on the earthquake is included herein. The summary concentrates on the findings for the Swiss nuclear installations. Compared with Taiwan, Switzerland is situated in a seismically much less active region. However, similarities exist with respect to the focal mechanism (thrust), the compressional stress regime and the low focal depth. Thus, the pattern of the iso-seismal lines and the maximum acceleration values would be similar in Switzerland in the case of an equally strong event. Such a strong event has been considered as unrealistic to occur in Switzerland so far. In the PSA studies for the Swiss nuclear power plants, a maximum magnitude up to 7.5 was considered, but only with a low weight. Under the assumption of a magnitude 7.6 event in the seismically most active region in Switzerland (Valais), the SSE accelerations at the closest site (Muehleberg NPP) could probably be exceeded. Most effects at components observed during the Chi-Chi earthquake (at non-nuclear sites) are already known to HSK and they have been considered systematically at the Swiss NPPs. A rather sensitive point is the possible loss of power from emergency diesel generators, as observed at non-nuclear sites in Taiwan. The

  11. Exclusive Baryon-Antibaryon Decays of the chi_cJ Mesons

    CERN Document Server

    Naik, P; Asner, D M; Edwards, K W; Reed, J; Briere, R A; Ferguson, T; Tatishvili, G; Vogel, H; Watkins, M E; Rosner, J L; Alexander, J P; Cassel, D G; Duboscq, J E; Ehrlich, R; Fields, L; Gibbons, L; Gray, R; Gray, S W; Hartill, D L; Heltsley, B K; Hertz, D; Hunt, J M; Kandaswamy, J; Kreinick, D L; Kuznetsov, V E; Ledoux, J; Mahlke-Krüger, H; Mohapatra, D; Onyisi, P U E; Patterson, J R; Peterson, D; Riley, D; Ryd, A; Sadoff, A J; Shi, X; Stroiney, S; Sun, W M; Wilksen, T; Athar, S B; Patel, R; Yelton, J; Rubin, P; Eisenstein, B I; Karliner, I; Mehrabyan, S; Lowrey, N; Selen, M; White, E J; Wiss, J; Mitchell, R E; Shepherd, M R; Besson, D; Pedlar, T K; Cronin-Hennessy, D; Gao, K Y; Hietala, J; Kubota, Y; Klein, T; Lang, B W; Poling, R; Scott, A W; Zweber, P; Dobbs, S; Metreveli, Z; Seth, K K; Tomaradze, A G; Libby, J; Powell, A; Wilkinson, G; Ecklund, K M; Love, W; Savinov, V; Méndez, H; Ge, J Y; Miller, D H; Shipsey, I P J; Xin, B; Adams, G S; Anderson, M; Cummings, J P; Danko, I; Hu, D; Moziak, B; Napolitano, J; He, Q; Insler, J; Muramatsu, H; Park, C S; Thorndike, E H; Yang, F; Artuso, M; Blusk, S; Khalil, S; Li, J; Mountain, R; Nisar, S; Randrianarivony, K; Sultana, N; Skwarnicki, T; Stone, S; Wang, J C; Zhang, L M; Bonvicini, G; Cinabro, D; Dubrovin, M; Lincoln, A

    2008-01-01

    Using a sample of 2.59 \\times 10^7 psi(2S) decays collected by the CLEO--c detector, we present results of a study of chi_{cJ} (J=0,1,2) decays into baryon-antibaryon final states. We present the world's most precise measurements of the chi_cJ -> p-pbar and chi_cJ -> Lambda-Lambdabar branching fractions, and the first measurements of chi_c0 decays to other hyperons. These results illuminate the decay mechanism of the chi_c states.

  12. Tai Chi as a form of exercise training in people with chronic obstructive pulmonary disease.

    Science.gov (United States)

    Leung, Regina W M; McKeough, Zoe J; Alison, Jennifer A

    2013-12-01

    Tai Chi is an ancient Chinese martial art which incorporates elements of strengthening, balance, postural alignment and concentration. The benefits of Tai Chi in the healthy population have been widely examined. In comparison, only three studies have evaluated the effects of Tai Chi in people with chronic obstructive pulmonary disease (COPD). Existing evidence suggests that the exercise intensity of Tai Chi reaches a moderate level in people with COPD. Furthermore, a short-term program of Tai Chi improves exercise capacity, health-related quality of life, balance and quadriceps strength in people with mild to moderate COPD. More studies are warranted to examine the effects of different styles of Tai Chi and the long-term benefits of Tai Chi as an exercise regimen for people with COPD. PMID:24224506

  13. mRNA Expression of EgCHI1, EgCHI2, and EgCHI3 in Oil Palm Leaves (Elaeis guineesis Jacq. after Treatment with Ganoderma boninense Pat. and Trichoderma harzianum Rifai

    Directory of Open Access Journals (Sweden)

    Laila Naher

    2012-01-01

    Full Text Available Background. Basal stem rot (BSR disease caused by the fungus Ganoderma boninense is the most serious disease affecting the oil palm; this is because the disease escapes the early disease detection. The biocontrol agent Trichoderma harzianum can protect the disease only at the early stage of the disease. In the present study, the expression levels of three oil palm (Elaeis guineensis Jacq. chitinases encoding EgCHI1, EgCHI2, and EgCHI3 at 2, 5, and 8 weeks inoculation were measured in oil palm leaves from plants treated with G. boninense or T. harzianum alone or both. Methods. The five-month-old oil palm seedlings were treated with Gano-wood blocks inoculum and trichomulch. Expression of EgCHI1, EgCHI2, and EgCHI3 in treated leaves tissue was determined by real-time PCR. Results. Oil palm chitinases were not strongly expressed in oil palm leaves of plants treated with G. boninense alone compared to other treatments. Throughout the 8-week experiment, expression of EgCHI1 increased more than 3-fold in leaves of plants treated with T. harzianum and G. boninense when compared to those of control and other treated plants. Conclusion. The data illustrated that chitinase cDNA expression varied depending on tissue and the type of treatment.

  14. Long-period ground motion characteristic of the 1999 Jiji (Chi-Chi), Taiwan, mainshock and aftershocks

    Institute of Scientific and Technical Information of China (English)

    LI Chun-feng; ZHANG Yang; ZHAO Jin-bao; TANG Hui

    2006-01-01

    This paper investigates long-period ground motion characteristic of the 1999 Jiji (Chi-Chi), Taiwan, mainshock and aftershocks on the basis of lots of high quality digital strong motion records. The study attaches the importance to the variation of strength of the long-period ground motion with the magnitude, distance, and site condition. In the meantime, the near-fault long-period ground motion characteristic is analyzed. The result shows that the shape of the long-period response spectrum is mainly controlled by site condition and magnitude (the spectrum of class D+E is wider than that of class B+C, and the spectrum of larger magnitude is wider than that of smaller magnitude), and the effect of fault distance on the shape is not evident. And near-fault long-period ground motion characteristic depends on fault activity apparently, that is to say, the long-term ground motion in the hanger is stronger than that in the footwall, and the long-term ground motion in the north is stronger than that in the south.

  15. mRNA Expression of EgCHI1, EgCHI2, and EgCHI3 in Oil Palm Leaves (Elaeis guineesis Jacq.) after Treatment with Ganoderma boninense Pat. and Trichoderma harzianum Rifai

    OpenAIRE

    Laila Naher; Soon Guan Tan; Chai Ling Ho; Umi Kalsom Yusuf; Siti Hazar Ahmad; Faridah Abdullah

    2012-01-01

    Background. Basal stem rot (BSR) disease caused by the fungus Ganoderma boninense is the most serious disease affecting the oil palm; this is because the disease escapes the early disease detection. The biocontrol agent Trichoderma harzianum can protect the disease only at the early stage of the disease. In the present study, the expression levels of three oil palm (Elaeis guineensis Jacq.) chitinases encoding EgCHI1, EgCHI2, and EgCHI3 at 2, 5, and 8 weeks inoculation were measured in oil pa...

  16. The Effect of Tai Chi Chuan on Obstacle Crossing Strategy in Older Adults.

    Science.gov (United States)

    Chang, Yao-Ting; Huang, Chen-Fu; Chang, Jia-Hao

    2015-01-01

    The purpose of this study was to determine the effect of Tai Chi Chuan on the strategies of obstacle-crossing behavior in older adults aged over 65 years. Fifteen Tai Chi group (TCG) participants were compared with 15 general group (GG) participants. Kinematic parameters (by Vicon motion analysis system) and ground reaction forces (by Kistler force plates) were synchronously recorded. A two-way mixed-design ANOVA (α = 0.05) was used to test the effects of the group and the obstacle height. The TCG performed significantly faster stride velocities, longer stride lengths, and shorter stride times than GG while crossing the obstacles. TCG could also produce significantly larger forward ground reaction forces to propel the body and were able to make a significantly greater flexion angle of the hip of the leading leg compared with the GG. It was concluded that the TCG adopted a different strategy with GG to cross the obstacles and completed the crossing behavior more effectively. PMID:26114218

  17. High-level expression and characterization of two chitinases, ChiCH and ChiCW, of Bacillus cereus 28-9 in Escherichia coli

    International Nuclear Information System (INIS)

    Many chitinase genes have been cloned and sequenced from prokaryotes and eukaryotes but overexpression of chitinases in Escherichia coli cells was less reported. ChiCH and ChiCW of Bacillus cereus 28-9 belong to two distinct groups based on their amino acid sequences of catalytic domains, and in addition, domain structures of two enzymes are different. In this study, we established an ideal method for high-level expression of chitinases in E. coli as glutathione-S-transferase fusion proteins using pGEX-6P-1 vector. Both ChiCH and ChiCW were successfully highly expressed in E. coli cells as soluble GST-chitinase fusion proteins, and recombinant native ChiCH and ChiCW could be purified after cleavage with PreScission protease to remove GST tag. Purified chitinases were used for biochemical characterization of kinetics, hydrolysis products, and binding activities. The results indicate that ChiCW is an endo-chitinase and effectively hydrolyzes chitin and chito-multimers to chito-oligomers and the end product chitobiose, and ChiCH is an exo-chitinase and degrades chito-oligomers to produce chitobiose. Furthermore, due to higher affinity of ChiCW toward colloidal chitin than Avicel, C-terminal domain of ChiCW should be classified as a chitin-binding domain not a cellulose-binding domain although that was revealed as a cellulose-binding domain by conserved domain analysis. Therefore, the method of high-level expression of chitinases is helpful to studies and applications of chitinases

  18. Chiral squaring and KLT relations

    OpenAIRE

    Schreiber, Anders

    2016-01-01

    We demonstrate that amplitudes based on matter supermultiplets can be combined to provide amplitudes of vector supermultiplets by means of KLT relations. In practice we do this by developing a procedure for removing supersymmetry supercharges from super Yang-Mills theory and supergravity supermultiplets, reducing them to vector and chiral supermultiplets respectively. This way, we reduce the super KLT relations to chiral KLT relations making chiral squaring of amplitudes manifest. We study th...

  19. Steenrod squares on conjugation spaces

    OpenAIRE

    Franz, Matthias; Puppe, Volker

    2005-01-01

    We prove that the coefficients of the so-called conjugation equation for conjugation spaces in the sense of Hausmann-Holm-Puppe are completely determined by Steenrod squares. This generalises a result of V.A. Krasnov for certain complex algebraic varieties. It also leads to a generalisation of a formula given by Borel and Haefliger, thereby largely answering an old question of theirs in the affirmative.

  20. Archimedes' calculations of square roots

    CERN Document Server

    Davies, E B

    2011-01-01

    We reconsider Archimedes' evaluations of several square roots in 'Measurement of a Circle'. We show that several methods proposed over the last century or so for his evaluations fail one or more criteria of plausibility. We also provide internal evidence that he probably used an interpolation technique. The conclusions are relevant to the precise calculations by which he obtained upper and lower bounds on pi.

  1. The CHY representation of tree-level primitive QCD amplitudes

    CERN Document Server

    de la Cruz, Leonardo; Weinzierl, Stefan

    2015-01-01

    In this paper we construct a CHY representation for all tree-level primitive QCD amplitudes. The quarks may be massless or massive. We define a generalised cyclic factor $\\hat{C}(w,z)$ and a generalised permutation invariant function $\\hat{E}(z,p,\\varepsilon)$. The amplitude is then given as a contour integral encircling the solutions of the scattering equations with the product $\\hat{C} \\hat{E}$ as integrand. Equivalently, it is given as a sum over the inequivalent solutions of the scattering equations, where the summand consists of a Jacobian times the product $\\hat{C} \\hat{E}$. This representation separates information: The generalised cyclic factor does not depend on the helicities of the external particles, the generalised permutation invariant function does not depend on the ordering of the external particles.

  2. The CHY representation of tree-level primitive QCD amplitudes

    Science.gov (United States)

    de la Cruz, Leonardo; Kniss, Alexander; Weinzierl, Stefan

    2015-11-01

    In this paper we construct a CHY representation for all tree-level primitive QCD amplitudes. The quarks may be massless or massive. We define a generalised cyclic factor Ĉ( w, z) and a generalised permutation invariant function Ê( z, p, ɛ). The amplitude is then given as a contour integral encircling the solutions of the scattering equations with the product ĈÊ as integrand. Equivalently, it is given as a sum over the inequivalent solutions of the scattering equations, where the summand consists of a Jacobian times the product Ĉ Ê. This representation separates information: The generalised cyclic factor does not depend on the helicities of the external particles, the generalised permutation invariant function does not depend on the ordering of the external particles.

  3. The Measurement and Analysis of Pressure Square Wave Generator

    International Nuclear Information System (INIS)

    Investigating the dynamic characteristics is a significant study for actual hydraulic pressure system because the dynamic environment is used more often than static one. A dynamic pressure generator is called pressure square wave generator (PSWG) that developed in our team and generate square-like waveform and change testing pressure and frequency form 0.1 to 5 MPa and 12 to 2 KHz, respectively. In this study, dynamic performance of PSWG was investigated under different testing tangent velocity of rotor of PSWG including detailed transient response of a pressure square-like wave, rise time and deviation of magnitude. Results show that the tangent velocity of the rotor of PSWG affects the transient response of pressure square-like wave form. The desired transient response can be obtained when the tangent velocity is larger than 0.5 m/s. Furthermore, the larger the tangent velocity used, the smaller the rise time will be

  4. Two-dimensional Co-Seismic Surface Displacements Field of the Chi-Chi Earthquake Inferred from SAR Image Matching

    Directory of Open Access Journals (Sweden)

    Jian-Jun Zhu

    2008-10-01

    Full Text Available The Mw=7.6 Chi-Chi earthquake in Taiwan occurred in 1999 over the Chelungpu fault and caused a great surface rupture and severe damage. Differential Synthetic Aperture Radar Interferometry (DInSAR has been applied previously to study the co-seismic ground displacements. There have however been significant limitations in the studies. First, only one-dimensional displacements along the Line-of-Sight (LOS direction have been measured. The large horizontal displacements along the Chelungpu fault are largely missing from the measurements as the fault is nearly perpendicular to the LOS direction. Second, due to severe signal decorrelation on the hangling wall of the fault, the displacements in that area are un-measurable by differential InSAR method. We estimate the co-seismic displacements in both the azimuth and range directions with the method of SAR amplitude image matching. GPS observations at the 10 GPS stations are used to correct for the orbital ramp in the amplitude matching and to create the two-dimensional (2D co-seismic surface displacements field using the descending ERS-2 SAR image pair. The results show that the co-seismic displacements range from about -2.0 m to 0.7 m in the azimuth direction (with the positive direction pointing to the flight direction, with the footwall side of the fault moving mainly southwards and the hanging wall side northwards. The displacements in the LOS direction range from about -0.5 m to 1.0 m, with the largest displacement occuring in the northeastern part of the hanging wall (the positive direction points to the satellite from ground. Comparing the results from amplitude matching with those from DInSAR, we can see that while only a very small fraction of the LOS displacement has been recovered by the DInSAR mehtod, the azimuth displacements cannot be well detected with the DInSAR measurements as they are almost perpendicular to the LOS. Therefore, the amplitude matching method is obviously more

  5. Chiral squaring and KLT relations

    CERN Document Server

    Schreiber, Anders

    2016-01-01

    We demonstrate that amplitudes based on matter supermultiplets can be combined to provide amplitudes of vector supermultiplets by means of KLT relations. In practice we do this by developing a procedure for removing supersymmetry supercharges from super Yang-Mills theory and supergravity supermultiplets, reducing them to vector and chiral supermultiplets respectively. This way, we reduce the super KLT relations to chiral KLT relations making chiral squaring of amplitudes manifest. We study these chiral KLT relations, discussing permutation symmetry and vanishing relations. Finally some explicit calculations are done to show how the relations work in detail.

  6. Counting Square-Free Numbers

    OpenAIRE

    Pawlewicz, Jakub

    2011-01-01

    The main topic of this contribution is the problem of counting square-free numbers not exceeding $n$. Before this work we were able to do it in time (Comparing to the Big-O notation, Soft-O ($\\softO$) ignores logarithmic factors) $\\softO(\\sqrt{n})$. Here, the algorithm with time complexity $\\softO(n^{2/5})$ and with memory complexity $\\softO(n^{1/5})$ is presented. Additionally, a parallel version is shown, which achieves full scalability. As of now the highest computed value was for $n=10^{1...

  7. Square Partitions and Catalan Numbers

    OpenAIRE

    Bennett, Matthew; Chari, Vyjayanthi; Dolbin, R. J.; Manning, Nathan

    2009-01-01

    For each integer $k\\ge 1$, we define an algorithm which associates to a partition whose maximal value is at most $k$ a certain subset of all partitions. In the case when we begin with a partition $\\lambda$ which is square, i.e $\\lambda=\\lambda_1\\ge...\\ge\\lambda_k>0$, and $\\lambda_1=k,\\lambda_k=1$, then applying the algorithm $\\ell$ times gives rise to a set whose cardinality is either the Catalan number $c_{\\ell-k+1}$ (the self dual case) or twice the Catalan number. The algorithm defines a t...

  8. Latin squares and their applications

    CERN Document Server

    Keedwell, A Donald

    2015-01-01

    Latin Squares and Their Applications Second edition offers a long-awaited update and reissue of this seminal account of the subject. The revision retains foundational, original material from the frequently-cited 1974 volume but is completely updated throughout. As with the earlier version, the author hopes to take the reader 'from the beginnings of the subject to the frontiers of research'. By omitting a few topics which are no longer of current interest, the book expands upon active and emerging areas. Also, the present state of knowledge regarding the 73 then-unsolved problems given at the

  9. The odd-number sequence: squares and sums

    Science.gov (United States)

    Leyendekkers, J. V.; Shannon, A. G.

    2015-11-01

    Direct study of various characteristics of integers and their interactions is readily accessible to undergraduate students. Integers obviously fall in different classes of modular rings and thus have features unique to that class which can result in a variety of formations, particularly with sums of squares. The sum of the first n odd numbers is itself the square of n within the odd number sequence, from which testing for primality within the Fibonacci sequence is investigated in this note.

  10. Study design for a randomised controlled trial to explore the modality and mechanism of Tai Chi in the pulmonary rehabilitation of chronic obstructive pulmonary disease

    Science.gov (United States)

    Fu, Juan-Juan; Min, Jie; Yu, Peng-Ming; McDonald, Vanessa M; Mao, Bing

    2016-01-01

    Introduction Although pulmonary rehabilitation (PR) is associated with significant clinical benefits in chronic obstructive pulmonary disease (COPD) and has been recommended by guidelines, PR with conventional exercise training has not been widely applied in the clinic because of its inherent limitations. Alternative exercise such as Tai Chi has been investigated and the results are promising. However, the strengths and weaknesses of the exercise modality of Tai Chi, conventional PR and a combination of Tai Chi and conventional PR and the possible mechanisms underlying Tai Chi exercise remain unclear. This study aims to address the above research gaps in a well-designed clinical trial. Methods and analysis This study is a single-blind, randomised controlled trial. Participants with stable COPD will be recruited and randomly assigned to one of four groups receiving Tai Chi exercise, conventional PR using a total body recumbent stepper (TBRS), combined Tai Chi and TBRS, or usual care (control) in a 1:1:1:1 ratio. Participants will perform 30 min of supervised exercise three times a week for 8 weeks; they will receive sequential follow-ups until 12 months after recruitment. The primary outcome will be health-related quality of life as measured by the St George's Respiratory Questionnaire. Secondary outcomes will include 6 min walking distance, pulmonary function, the modified Medical Research Council Dyspnoea Scale, the COPD Assessment Test, the Hospital Anxiety and Depression Scale, the Berg Balance Scale, exacerbation frequency during the study period, and systemic inflammatory and immune markers. Ethics and dissemination Ethics approval has been granted by the Clinical Trial and Biomedical Ethics Committee of West China Hospital of Sichuan University (No TCM-2015-82). Written informed consent will be obtained from each participant before any procedures are performed. The study findings will be published in peer-reviewed journals and presented at national

  11. Observation of direct ion heating in double-pulsing CHI in helicity injected spherical torus plasmas

    International Nuclear Information System (INIS)

    Anomalous ion heating has been observed for the first time during flux/current amplification by double-pulsing coaxial helicity injection (CHI) in the helicity injected spherical torus (HIST) device. Doppler ion temperature increases significantly near the separatrix on the inboard side during the second CHI pulse, whereas electron temperature remains constant. The experimental results indicate that selective ion heating may be associated with viscous damping of poloidal flows driven by the CHI pulse. (author)

  12. Training in ChiRunning to reduce blood pressure: a randomized controlled pilot study

    OpenAIRE

    McDermott, Kelly; Kumar, Deepak; Goldman, Veronica; Feng, Haojun; Mehling, Wolf; Moskowitz, Judith T.; Souza, Richard B.; Frederick M Hecht

    2015-01-01

    Background People with prehypertension (120–130/80–90 mmHg) are at increased risk of progressing to hypertension. Recommendations for prehypertension include engaging in regular physical activity. We aimed to assess feasibility and acceptability and collect preliminary outcome data on ChiRunning for people with elevated blood pressure. ChiRunning is a commercially available running program based on the mindful movements of Tai Chi, which is aimed at decreasing injury by both increasing body a...

  13. Probing scalar meson structures in $\\chi_{c1}$ decays into pseudoscalar and scalar

    CERN Document Server

    Wang, Qian; Zhao, Qiang

    2012-01-01

    We evaluate the decay branching ratios of $\\chi_{c1}\\to PS$, in a quark model parametrization scheme, where $P$ and $S$ stand for pseudoscalar and scalar meson, respectively. An interesting feature of this decay process is that the $c\\bar{c}$ annihilate via the pQCD hair-pin diagram is supposed to be dominant. Hence, this decay process should be sensitive to the quark components of the final-state light mesons, and would provide a great opportunity for testing the mixing relations among the scalar mesons, i.e. $f_0(1370)$, $f_0(1500)$ and $f_0(1710)$, by tagging the final state pseudoscalar mesons.

  14. The effects of Tai Chi exercise on cognitive function in older adults:A meta-analysis

    Institute of Scientific and Technical Information of China (English)

    Yin; Wu; Yongtai; Wang; Elisabeth; O.Burgess; Jerry; Wu

    2013-01-01

    Background:Cognitive impairment is prevalent among older adults and results in degraded quality of life for older adults.As the population ages,this may cause a huge burden to society.Research has demonstrated that physical exercise is beneficial to cognitive function.The purpose of this meta-analysis was to critically assess the effect of Tai Chi exercise on global cognitive,executive,and memory functions in older adults.Methods:After a thorough electronic search and selection,eight studies were included in this meta-analysis with two cross-sectional and six intervention studies.Nine variables included in this meta-analysis were:mini mental status examination(MMSE),Alzheimer’s disease assessment scale-cognitive subscale(ADAS-cog),trailmaking test part A(TMA),trailmaking test part B(TMB),digit span test forward(DSF),digit span test backward(DSB),visual span test backward(VSB),verbal fluency test(VFT),and word delay recall test(WDR).The effect sizes and forest plots of these nine variables were generated.Results:Four(MMSE,DSB,VSB,and VFT)out of nine variables were significantly improved after Tai Chi exercise with the effect sizes ranged from 0.20 to 0.46(small to medium).MMSE represented global cognitive function,and DSB,VSB,and VFT represented memory function.Conclusion:Tai Chi as a mind-body exercise has the positive effects on global cognitive and memory functions,and more consistent positive effects were found on memory function,especially verbal working memory.

  15. First Observation of Exclusive chi_cJ Decays to Two Charged and Two Neutral Hadrons

    OpenAIRE

    Q. He

    2008-01-01

    We study exclusive chi_c0, chi_c1 and chi_c2 decays to four-hadron final states involving two charged and two neutral mesons: pi^+pi^-pi^0pi^0, K^+K^-pi^0pi^0, pppi^0pi^0, K^+K^-etapi^0, and K^+-pi^-+K^0pi^0o. The chi_c states are produced in radiative decays of 3.08 million psi-prime resonance decays and observed in the CLEO detector. We also measure the largest substructure contributions to the modes pi^+pi^-pi^0pi^0 and K^+-pi^-+K^0pi^0.

  16. Study of {chi}{sub c} production using HERA-B data

    Energy Technology Data Exchange (ETDEWEB)

    Aleksandrov, Aleksandar

    2010-07-15

    In this thesis the production of the charmonium states {chi}{sub c1} and {chi}{sub c2} in protonnucleus collisions at a proton-nucleon center-of-mass energy {radical}(s)=41.6 GeV was studied. The data used for the analysis have been taken by the fixed-target experiment HERA-B that uses the HERA proton beam to scatter protons off the nuclei of different wire targets. About 122.10{sup 3} recorded muonic J/{psi} decays, J/{psi}{yields}{mu}{sup +}{mu}{sup -}, resulted in almost 10000 reconstructed {chi}{sub c}{yields}J/{psi}{gamma}. The ratio R{sub {chi}{sub c}}= sum {sub i=1,2}{sigma}({chi}{sub ci})Br({chi}{sub ci}{yields}J/{psi}{gamma})/{sigma}(J/{psi}), which is the ratio of J/{psi} from {chi}{sub c} decays to all produced J/{psi}, was measured in the kinematical range -0.35chi}{sub c}}=0.190{sub -0.029}{sup +0.030}. Despite the small separation of the masses of the two {chi}{sub c} states, comparable to the detector resolution, the ratio R{sub 12}=R{sub {chi}{sub c}{sub 1}}/R{sub {chi}{sub c}{sub 2}} was measured yielding R{sub 12}=1.30{sub -0.37}{sup +0.59} which corresponds to a production cross section ratio ({sigma}({chi}{sub c1}))/({sigma}({chi}{sub c2}))=0.74{sub -0.22}{sup +0.34}. By using the known J/{psi} production cross section, the {chi}{sub c1} and {chi}{sub c2} production cross sections are calculated to be {sigma}({chi}{sub c1})=(153{+-}27) nb/nucleon and {sigma}({chi}{sub c2})=(207{+-}39) nb/nucleon, respectively. All results were obtained under the assumption that both the J/{psi} and {chi}{sub c} states are produced without polarization. In addition a study of possible deviations of R{sub {chi}{sub c}} and R{sub 12} due to the polarization of J/{psi} and {chi}{sub c} was performed. By varying the polarization parameter, {lambda}{sub obs}, of all produced J/{psi} by 2{sigma} around the value measured by HERA-B, and assuming fully

  17. A flag-up algorithm and test for nonstationary customer-specific product graphs

    DEFF Research Database (Denmark)

    Fenger, Morten H. J.; Scholderer, Joachim

    period. The results show that the test is clearly able to identify customers with evolving behavior, and that it can easily be deployed as part of a CRM system. It enables companies with loyalty programs to focus on nonstationary customers, i.e. customers who may represent opportunities for cross...... values are above five. The resulting statistic is Chi-square distributed, with degrees of freedom equal to the number of edges that are present, with a penalty based on shopping basket size. The test is demonstrated using panel scanner data from 4,921 supermarket loyalty card holders over a 19-month...

  18. Learn with SAT to Minimize Büchi Automata

    Directory of Open Access Journals (Sweden)

    Stephan Barth

    2012-10-01

    Full Text Available We describe a minimization procedure for nondeterministic Büchi automata (NBA. For an automaton A another automaton A_min with the minimal number of states is learned with the help of a SAT-solver. This is done by successively computing automata A' that approximate A in the sense that they accept a given finite set of positive examples and reject a given finite set of negative examples. In the course of the procedure these example sets are successively increased. Thus, our method can be seen as an instance of a generic learning algorithm based on a "minimally adequate teacher'' in the sense of Angluin. We use a SAT solver to find an NBA for given sets of positive and negative examples. We use complementation via construction of deterministic parity automata to check candidates computed in this manner for equivalence with A. Failure of equivalence yields new positive or negative examples. Our method proved successful on complete samplings of small automata and of quite some examples of bigger automata. We successfully ran the minimization on over ten thousand automata with mostly up to ten states, including the complements of all possible automata with two states and alphabet size three and discuss results and runtimes; single examples had over 100 states.

  19. Electromagnetic Currents and Magnetic Moments in $\\chi$EFT

    Energy Technology Data Exchange (ETDEWEB)

    Saori Pastore, Luca Girlanda, Rocco Schiavilla, Michele Viviani, Robert Wiringa

    2009-09-01

    A two-nucleon potential and consistent electromagnetic currents are derived in chiral effective field theory ($\\chi$EFT) at, respectively, $Q^{\\, 2}$ (or N$^2$LO) and $e\\, Q$ (or N$^3$LO), where $Q$ generically denotes the low-momentum scale and $e$ is the electric charge. Dimensional regularization is used to renormalize the pion-loop corrections. A simple expression is derived for the magnetic dipole ($M1$) operator associated with pion loops, consisting of two terms, one of which is determined, uniquely, by the isospin-dependent part of the two-pion-exchange potential. This decomposition is also carried out for the $M1$ operator arising from contact currents, in which the unique term is determined by the contact potential. Finally, the low-energy constants (LEC's) entering the N$^2$LO potential are fixed by fits to the $np$ S- and P-wave phase shifts up to 100 MeV lab energies. Three additional LEC's are needed to completely specify the $M1$ operator at N$^3$L

  20. High chi polymer development for DSA applications using RAFT technology

    Science.gov (United States)

    Sheehan, Michael T.; Farnham, William B.; Tran, Hoang V.; Londono, J. David; Brun, Yefim

    2013-03-01

    Directed self-assembly (DSA) of block copolymers is proving to be an interesting and innovative method to make three-dimensional periodic, uniform patterns useful in a variety of microelectronics applications. Attributes critical to acceptable DSA performance of block copolymers include molecular weight uniformity, final purity, and reproducibility in all the steps involved in producing the polymers. Reversible Addition Fragmentation Chain Transfer (RAFT) polymerization technology enables the production of such materials provided that careful process monitoring and compositional homogeneity measurement systems are employed. It is uniquely suited to construction of multiblocks with components of widely divergent surface energies and functionality. We describe a high chi diblock system comprising partially fluorinated methacrylates and substituted styrenics. While special new polymer separation strategies involving controlled polymer particle assembly in liquid media are required for some monomer systems and molecular weight regimes, we have been able to demonstrate high yield and compositionally homogeneous diblocks of lamellar and cylindrical morphology with polydispersities < 1.1. During purification processes, these diblock materials undergo assembly processes in liquid media, and with appropriate controls, this allows for removal of soluble homopolymer contaminants. SAXS analyses of solid polymer samples provide estimates of lamellar d-spacing, and a good correlation with molecular weight is shown. This system will be described.

  1. The challenges of water governance in Ho Chi Minh City.

    Science.gov (United States)

    van Leeuwen, Cornelis J; Dan, Nguyen P; Dieperink, Carel

    2016-04-01

    Population growth, urbanization, pollution, and climate change pose urgent water challenges in cities. In this study, the sustainability of integrated water resources management in Ho Chi Minh City (HCMC) was evaluated using the City Blueprint approach. The City Blueprint is a set of 24 dedicated indicators divided over 8 categories (i.e., water security, water quality, drinking water, sanitation, infrastructure, climate robustness, biodiversity and attractiveness, and governance including public participation). The analysis showed that the rapid increase of water use for urban, industrial, and agricultural activities in HCMC has resulted in depletion of groundwater and severe pollution of both groundwater and surface water. Surface water quality, groundwater quality, biodiversity, and the sanitation of domestic and industrial wastewater are matters that need serious improvement. Current and future water supply in HCMC is at risk. HCMC can cope with it, but the 7 governance gaps as described by the Organisation for Economic Co-operation and Development (OECD) are major obstacles for HCMC. Rainwater harvesting, pollution reduction, as well as wastewater reuse are among the practical options. Wastewater reuse could lower the water stress index to 10%. The window to do this is narrow and rapidly closing as a result of the unprecedented urbanization and economic growth of this region. PMID:26009880

  2. Acute Cardiovascular Response to Sign Chi Do Exercise

    Directory of Open Access Journals (Sweden)

    Carol E. Rogers

    2015-08-01

    Full Text Available Safe and gentle exercise may be important for older adults overcoming a sedentary lifestyle. Sign Chi Do (SCD, a novel form of low impact exercise, has shown improved balance and endurance in healthy older adults, and there have been no SCD-related injuries reported. Sedentary older adults are known to have a greater cardiovascular (CV response to physical activity than those who regularly exercise. However their CV response to SCD is unknown. This study explored the acute CV response of older adults to SCD. Cross-sectional study of 34 sedentary and moderately active adults over age 55 with no previous experience practicing SCD. Participants completed a 10 min session of SCD. CV outcomes of heart rate, blood pressure, rate pressure product were recorded at 0, 5, 10 min of SCD performance, and after 10 min of rest. HR was recorded every minute. There was no difference in CV scores of sedentary and moderately active older adults after a session of SCD-related activity. All CV scores increased at 5 min, were maintained at 10 min, and returned to baseline within 10 min post SCD (p < 0.05. SCD may be a safe way to increase participation in regular exercise by sedentary older adults.

  3. Central Exclusive Production of $\\chi$ Mesons at LHCb

    CERN Document Server

    Bjornstad, Pal Marius

    The LHCb experiment is a forward spectrometer at the Large Hadron Collider, covering a range of pseudorapidity $1.9<\\eta<4.9$. It has a very precise vertex detector called the VELO, near the interaction point. The monitoring software for the VELO is discussed in this thesis. In proton-proton interactions, Central Exclusive Production (CEP) is a process where the protons remain intact after the interaction, and an additional simple central system is produced. CEP processes are selected experimentally by requiring that there is no activity in the detector apart from the central system. The installation of additional detectors to increase the sensitivity at small angles from the beam axis is discussed. A geometrical description of the region of the LHC up to $100$~m on each side of the LHCb interaction point is developed. Simulated forward shower counters are added to the model, and the efficiencies of the detectors are measured. The main part of this thesis describes an analysis of CEP of $\\chi_c$ mes...

  4. Statistical analysis of earthquakes after the 1999 MW 7.7 Chi-Chi, Taiwan, earthquake based on a modified Reasenberg-Jones model

    Science.gov (United States)

    Chen, Yuh-Ing; Huang, Chi-Shen; Liu, Jann-Yenq

    2015-12-01

    We investigated the temporal-spatial hazard of the earthquakes after the 1999 September 21 MW = 7.7 Chi-Chi shock in a continental region of Taiwan. The Reasenberg-Jones (RJ) model (Reasenberg and Jones, 1989, 1994) that combines the frequency-magnitude distribution (Gutenberg and Richter, 1944) and time-decaying occurrence rate (Utsu et al., 1995) is conventionally employed for assessing the earthquake hazard after a large shock. However, it is found that the b values in the frequency-magnitude distribution of the earthquakes in the study region dramatically decreased from background values after the Chi-Chi shock, and then gradually increased up. The observation of a time-dependent frequency-magnitude distribution motivated us to propose a modified RJ model (MRJ) to assess the earthquake hazard. To see how the models perform on assessing short-term earthquake hazard, the RJ and MRJ models were separately used to sequentially forecast earthquakes in the study region. To depict the potential rupture area for future earthquakes, we further constructed relative hazard (RH) maps based on the two models. The Receiver Operating Characteristics (ROC) curves (Swets, 1988) finally demonstrated that the RH map based on the MRJ model was, in general, superior to the one based on the original RJ model for exploring the spatial hazard of earthquakes in a short time after the Chi-Chi shock.

  5. Counting Square-Free Numbers

    CERN Document Server

    Pawlewicz, Jakub

    2011-01-01

    The main topic of this contribution is the problem of counting square-free numbers not exceeding $n$. Before this work we were able to do it in time (Comparing to the Big-O notation, Soft-O ($\\softO$) ignores logarithmic factors) $\\softO(\\sqrt{n})$. Here, the algorithm with time complexity $\\softO(n^{2/5})$ and with memory complexity $\\softO(n^{1/5})$ is presented. Additionally, a parallel version is shown, which achieves full scalability. As of now the highest computed value was for $n=10^{17}$. Using our implementation we were able to calculate the value for $n=10^{36}$ on a cluster.

  6. "Miracolo dell'arte" Chi ha inventato il telescopio?

    Science.gov (United States)

    Sodi, Francesca

    2006-02-01

    Who did invent the telescope? It seems a simple-answering question but this is untrue. The article recall the fundamental steps of the first phase in the telescope history between 16th and 17th century, from the first experiences with the lenses made by the Italian opticians to the Della Porta's theories, from the vicissitudes of the Dutch spectacle-makers to the spreading of the new instrument through the European squares. At last we meet the work of Galileo Galilei, the first man to use the telescope for scientific purposes, understanding all its potentialities.

  7. Observation of chi(cJ) decays to Lambda(Lambda)over-bar pi(+)pi(-)

    NARCIS (Netherlands)

    Ablikim, M.; Achasov, M. N.; Ambrose, D. J.; An, F. F.; An, Q.; An, Z. H.; Bai, J. Z.; Ban, Y.; Becker, J.; Bennett, J. V.; Bertani, M.; Bian, J. M.; Boger, E.; Bondarenko, O.; Boyko, I.; Briere, R. A.; Bytev, V.; Cai, X.; Cakir, O.; Calcaterra, A.; Cao, G. F.; Cetin, S. A.; Chang, J. F.; Chelkov, G.; Chen, G.; Chen, H. S.; Chen, J. C.; Chen, M. L.; Chen, S. J.; Chen, Y. B.; Cheng, H. P.; Chu, Y. P.; Cronin-Hennessy, D.; Dai, H. L.; Dai, J. P.; Dedovich, D.; Deng, Z. Y.; Denig, A.; Denysenko, I.; Destefanis, M.; Ding, W. M.; Ding, Y.; Dong, L. Y.; Dong, M. Y.; Du, S. X.; Fang, J.; Fang, S. S.; Fava, L.; Feldbauer, F.; Feng, C. Q.; Ferroli, R. B.; Fu, C. D.; Fu, J. L.; Gao, Y.; Geng, C.; Goetzen, K.; Gong, W. X.; Gradl, W.; Greco, M.; Gu, M. H.; Gu, Y. T.; Guan, Y. H.; Guo, A. Q.; Guo, L. B.; Guo, Y. P.; Han, Y. L.; Harris, F. A.; He, K. L.; He, M.; He, Z. Y.; Held, T.; Heng, Y. K.; Hou, Z. L.; Hu, H. M.; Hu, J. F.; Hu, T.; Huang, G. M.; Huang, J. S.; Huang, X. T.; Huang, Y. P.; Hussain, T.; Ji, C. S.; Ji, Q.; Ji, X. B.; Ji, X. L.; Jiang, L. L.; Jiang, X. S.; Jiao, J. B.; Jiao, Z.; Jin, D. P.; Jin, S.; Jing, F. F.; Kalantar-Nayestanaki, N.; Kavatsyuk, M.; Kuehn, W.; Lai, W.; Lange, J. S.; Li, C. H.; Li, Cheng; Li, Cui; Li, D. M.; Li, F.; Li, G.; Li, H. B.; Li, J. C.; Li, K.; Li, Lei; Li, Q. J.; Li, S. L.; Li, W. D.; Li, W. G.; Li, X. L.; Li, X. N.; Li, X. Q.; Li, X. R.; Li, Z. B.; Liang, H.; Liang, Y. F.; Liang, Y. T.; Liao, G. R.; Liao, X. T.; Liu, B. J.; Liu, C. L.; Liu, C. X.; Liu, C. Y.; Liu, F. H.; Liu, Fang; Liu, Feng; Liu, H.; Liu, H. B.; Liu, H. H.; Liu, H. M.; Liu, H. W.; Liu, J. P.; Liu, K. Y.; Liu, Kai; Liu, P. L.; Liu, Q.; Liu, S. B.; Liu, X.; Liu, X. H.; Liu, Y. B.; Liu, Z. A.; Liu, Zhiqiang; Liu, Zhiqing; Loehner, H.; Lu, G. R.; Lu, H. J.; Lu, J. G.; Lu, Q. W.; Lu, X. R.; Lu, Y. P.; Luo, C. L.; Luo, M. X.; Luo, T.; Luo, X. L.; Lv, M.; Ma, C. L.; Ma, F. C.; Ma, H. L.; Ma, Q. M.; Ma, S.; Ma, T.; Ma, X. Y.; Ma, Y.; Maas, F. E.; Maggiora, M.; Malik, Q. A.; Mao, Y. J.; Mao, Z. P.; Messchendorp, J. G.; Min, J.; Min, T. J.; Mitchell, R. E.; Mo, X. H.; Morales, C. Morales; Motzko, C.; Muchnoi, N. Yu.; Muramatsu, H.; Nefedov, Y.; Nicholson, C.; Nikolaev, I. B.; Ning, Z.; Olsen, S. L.; Ouyang, Q.; Pacetti, S.; Park, J. W.; Pelizaeus, M.; Peng, H. P.; Peters, K.; Ping, J. L.; Ping, R. G.; Poling, R.; Prencipe, E.; Qi, M.; Qian, S.; Qiao, C. F.; Qin, X. S.; Qin, Y.; Qin, Z. H.; Qiu, J. F.; Rashid, K. H.; Rong, G.; Ruan, X. D.; Sarantsev, A.; Schaefer, B. D.; Schulze, J.; Shao, M.; Shen, C. P.; Shen, X. Y.; Sheng, H. Y.; Shepherd, M. R.; Song, X. Y.; Spataro, S.; Spruck, B.; Sun, D. H.; Sun, G. X.; Sun, J. F.; Sun, S. S.; Sun, Y. J.; Sun, Y. Z.; Sun, Z. J.; Sun, Z. T.; Tang, C. J.; Tang, X.; Tapan, I.; Thorndike, E. H.; Toth, D.; Ullrich, M.; Varner, G. S.; Wang, B.; Wang, B. Q.; Wang, K.; Wang, L. L.; Wang, L. S.; Wang, M.; Wang, P.; Wang, P. L.; Wang, Q.; Wang, Q. J.; Wang, S. G.; Wang, X. L.; Wang, Y. D.; Wang, Y. F.; Wang, Y. Q.; Wang, Z.; Wang, Z. G.; Wang, Z. Y.; Wei, D. H.; Weidenkaff, P.; Wen, Q. G.; Wen, S. P.; Wiedner, U.; Wu, L. H.; Wu, N.; Wu, S. X.; Wu, W.; Wu, Z.; Xia, L. G.; Xiao, Z. J.; Xie, Y. G.; Xiu, Q. L.; Xu, G. F.; Xu, G. M.; Xu, H.; Xu, Q. J.; Xu, X. P.; Xu, Z. R.; Xue, F.; Xue, Z.; Yan, L.; Yan, W. B.; Yan, Y. H.; Yang, H. X.; Yang, Y.; Yang, Y. X.; Ye, H.; Ye, M.; Ye, M. H.; Yu, B. X.; Yu, C. X.; Yu, J. S.; Yu, S. P.; Yuan, C. Z.; Yuan, Y.; Zafar, A. A.; Zallo, A.; Zeng, Y.; Zhang, B. X.; Zhang, B. Y.; Zhang, C. C.; Zhang, D. H.; Zhang, H. H.; Zhang, H. Y.; Zhang, J. Q.; Zhang, J. W.; Zhang, J. Y.; Zhang, J. Z.; Zhang, S. H.; Zhang, X. J.; Zhang, X. Y.; Zhang, Y.; Zhang, Y. H.; Zhang, Y. S.; Zhang, Z. P.; Zhang, Z. Y.; Zhao, G.; Zhao, H. S.; Zhao, J. W.; Zhao, K. X.; Zhao, Lei; Zhao, Ling; Zhao, M. G.; Zhao, Q.; Zhao, S. J.; Zhao, T. C.; Zhao, X. H.; Zhao, Y. B.; Zhao, Z. G.; Zhemchugov, A.; Zheng, B.; Zheng, Y. H.; Zhong, B.; Zhong, J.; Zhou, L.; Zhou, X. K.; Zhou, X. R.; Zhu, C.; Zhu, K.; Zhu, K. J.; Zhu, S. H.; Zhu, X. L.; Zhu, X. W.; Zhu, Y. C.; Zhu, Y. M.; Zhu, Y. S.; Zhu, Z. A.; Zhuang, J.; Zou, B. S.; Zou, J. H.; Werner, M.J.; Zheng, J.P.

    2012-01-01

    Decays of the chi(cJ) states (J = 0, 1, 2) to Lambda(Lambda) over bar pi(+)pi(-), including processes with intermediate Sigma(1385), are studied through the E1 transition psi(1) -> gamma chi(cJ) using 106 x 10(6) psi(1) events collected with the BESIII detector at BEPCII. This is the first observati

  8. Higher-order multipole amplitude measurement in psi ' -> gamma chi(c2)

    NARCIS (Netherlands)

    Ablikim, M.; Achasov, M. N.; Alberto, D.; An, F. F.; An, Q.; An, Z. H.; Bai, J. Z.; Baldini, R.; Ban, Y.; Becker, J.; Berger, N.; Bertani, M.; Bian, J. M.; Boger, E.; Bondarenko, O.; Boyko, I.; Briere, R. A.; Bytev, V.; Cai, X.; Calcaterra, A. C.; Cao, G. F.; Chang, J. F.; Chelkov, G.; Chen, G.; Chen, H. S.; Chen, J. C.; Chen, M. L.; Chen, S. J.; Chen, Y.; Chen, Y. B.; Cheng, H. P.; Chu, Y. P.; Cronin-Hennessy, D.; Dai, H. L.; Dai, J. P.; Dedovich, D.; Deng, Z. Y.; Denysenko, I.; Destefanis, M.; Ding, Y.; Dong, L. Y.; Dong, M. Y.; Du, S. X.; Fang, J.; Fang, S. S.; Feng, C. Q.; Fu, C. D.; Fu, J. L.; Gao, Y.; Geng, C.; Goetzen, K.; Gong, W. X.; Greco, M.; Gu, M. H.; Gu, Y. T.; Guan, Y. H.; Guo, A. Q.; Guo, L. B.; Guo, Y. P.; Han, Y. L.; Hao, X. Q.; Harris, F. A.; He, K. L.; He, M.; He, Z. Y.; Heng, Y. K.; Hou, Z. L.; Hu, H. M.; Hu, J. F.; Hu, T.; Huang, B.; Huang, G. M.; Huang, J. S.; Huang, X. T.; Huang, Y. P.; Hussain, T.; Ji, C. S.; Ji, Q.; Ji, X. B.; Ji, X. L.; Jia, L. K.; Jiang, L. L.; Jiang, X. S.; Jiao, J. B.; Jiao, Z.; Jin, D. P.; Jin, S.; Jing, F. F.; Kalantar-Nayestanaki, N.; Kavatsyuk, M.; Kuehn, W.; Lai, W.; Lange, J. S.; Leung, J. K. C.; Li, C. H.; Li, Cheng; Li, Cui; Li, D. M.; Li, F.; Li, G.; Li, H. B.; Li, J. C.; Li, K.; Li, Lei; Li, N. B.; Li, Q. J.; Li, S. L.; Li, W. D.; Li, W. G.; Li, X. L.; Li, X. N.; Li, X. Q.; Li, X. R.; Li, Z. B.; Liang, H.; Liang, Y. F.; Liang, Y. T.; Liao, X. T.; Liu, B. J.; Liu, C. L.; Liu, C. X.; Liu, C. Y.; Liu, F. H.; Liu, Fang; Liu, Feng; Liu, H.; Liu, H. B.; Liu, H. H.; Liu, H. M.; Liu, H. W.; Liu, J. P.; Liu, K.; Liu, K.; Liu, K. Y.; Liu, Q.; Liu, S. B.; Liu, X.; Liu, X. H.; Liu, Y. B.; Liu, Y. W.; Liu, Yong; Liu, Z. A.; Liu, Zhiqiang; Liu, Zhiqing; Loehner, H.; Lu, G. R.; Lu, H. J.; Lu, J. G.; Lu, Q. W.; Lu, X. R.; Lu, Y. P.; Luo, C. L.; Luo, M. X.; Luo, T.; Luo, X. L.; Lv, M.; Ma, C. L.; Ma, F. C.; Ma, H. L.; Ma, Q. M.; Ma, S.; Ma, T.; Ma, X.; Ma, X. Y.; Maggiora, M.; Malik, Q. A.; Mao, H.; Mao, Y. J.; Mao, Z. P.; Messchendorp, J. G.; Min, J.; Min, T. J.; Mitchell, R. E.; Mo, X. H.; Muchnoi, N. Yu; Nefedov, Y.; Nikolaev, I. B.; Ning, Z.; Olsen, S. L.; Ouyang, Q.; Pacetti, S.; Park, J. W.; Pelizaeus, M.; Peters, K.; Ping, J. L.; Ping, R. G.; Poling, R.; Pun, C. S. J.; Qi, M.; Qian, S.; Qiao, C. F.; Qin, X. S.; Qiu, J. F.; Rashid, K. H.; Rong, G.; Ruan, X. D.; Sarantsev, A.; Schulze, J.; Shao, M.; Shen, C. P.; Shen, X. Y.; Sheng, H. Y.; Shepherd, M. R.; Song, X. Y.; Spataro, S.; Spruck, B.; Sun, D. H.; Sun, G. X.; Sun, J. F.; Sun, S. S.; Sun, X. D.; Sun, Y. J.; Sun, Y. Z.; Sun, Z. J.; Sun, Z. T.; Tang, C. J.; Tang, X.; Tian, H. L.; Toth, D.; Varner, G. S.; Wang, B.; Wang, B. Q.; Wang, K.; Wang, L. L.; Wang, L. S.; Wang, M.; Wang, P.; Wang, P. L.; Wang, Q.; Wang, Q. J.; Wang, S. G.; Wang, X. L.; Wang, Y. D.; Wang, Y. F.; Wang, Y. Q.; Wang, Z.; Wang, Z. G.; Wang, Z. Y.; Wei, D. H.; Wen, Q. G.; Wen, S. P.; Wiedner, U.; Wu, L. H.; Wu, N.; Wu, W.; Wu, Z.; Xiao, Z. J.; Xie, Y. G.; Xiu, Q. L.; Xu, G. F.; Xu, G. M.; Xu, H.; Xu, Q. J.; Xu, X. P.; Xu, Y.; Xu, Z. R.; Xu, Z. Z.; Xue, Z.; Yan, L.; Yan, W. B.; Yan, Y. H.; Yang, H. X.; Yang, T.; Yang, Y.; Yang, Y. X.; Ye, H.; Ye, M.; Ye, M. H.; Yu, B. X.; Yu, C. X.; Yu, S. P.; Yuan, C. Z.; Yuan, W. L.; Yuan, Y.; Zafar, A. A.; Zallo, A.; Zeng, Y.; Zhang, B. X.; Zhang, B. Y.; Zhang, C.; Zhang, C. C.; Zhang, D. H.; Zhang, H. H.; Zhang, H. Y.; Zhang, J.; Zhang, J. Q.; Zhang, J. W.; Zhang, J. Y.; Zhang, J. Z.; Zhang, L.; Zhang, S. H.; Zhang, T. R.; Zhang, X. J.; Zhang, X. Y.; Zhang, Y.; Zhang, Y. H.; Zhang, Y. S.; Zhang, Z. P.; Zhang, Z. Y.; Zhao, G.; Zhao, H. S.; Zhao, Jiawei; Zhao, Jingwei; Zhao, Lei; Zhao, Ling; Zhao, M. G.; Zhao, Q.; Zhao, S. J.; Zhao, T. C.; Zhao, X. H.; Zhao, Y. B.; Zhao, Z. G.; Zhao, Z. L.; Zhemchugov, A.; Zheng, B.; Zheng, J. P.; Zheng, Y. H.; Zheng, Z. P.; Zhong, B.; Zhong, J.; Zhong, L.; Zhou, L.; Zhou, X. K.; Zhou, X. R.; Zhu, C.; Zhu, K.; Zhu, K. J.; Zhu, S. H.; Zhu, X. L.; Zhu, X. W.; Zhu, Y. S.; Zhu, Z. A.; Zhuang, J.; Zou, B. S.; Zou, J. H.; Zuo, J. X.

    2011-01-01

    Using 106 x 10(6) psi' events collected with the BESIII detector at the BEPCII storage ring, the higher-order multipole amplitudes in the radiative transition psi' -> gamma chi(c2) -> gamma pi(+)pi(-)/gamma K+K- are measured. A fit to the chi(c2) production and decay angular distributions yields M2

  9. Quantum key distribution by swapping the entanglement of {chi}-type state

    Energy Technology Data Exchange (ETDEWEB)

    Gao Gan, E-mail: gaogan0556@163.co [Department of Electrical Engineering, Tongling University, Tongling 244000 (China)

    2010-06-01

    We propose a quantum key distribution protocol using entanglement swapping of {chi}-type state; in this protocol, Alice and Bob transmit a particle sequence to each other and perform {chi}-type state measurements. Alice's and Bob's roles are completely symmetric.

  10. Implementing e-Health through CHI: A Very Canadian Solution to a Very Canadian Problem

    Directory of Open Access Journals (Sweden)

    Tom Daniels

    2014-05-01

    Full Text Available Canada Health Infoway (CHI was established as an arms-length body by the federal government in 2001 to provide funding to provinces for the development of interoperable e-health systems. CHI was established in response to a number of reports calling on the government to act to make use of technological advances to improve health care quality and provide more rigorous data. In addition to these explicit goals, through establishing CHI the federal government also sought to avoid potential criticism if the implementation of e-health failed, increase its own popularity ahead of the 2000 election and subtly redistribute wealth between the provinces. The paper suggests that the major influence behind the policy to establish CHI came from Canadian institutions and the fact that the federal government was hamstrung by the Canadian Constitution and Canada Health Act. Evaluation of the reform shows that progress has been made by CHI in implementing e-health solutions, but that Canada still lags behind other comparable health systems in the use of technologies. SWOT analysis of the CHI implementation highlights the criticism that CHI could stifle provincial innovation but recognizes that it also offers the opportunity for best practice dissemination across Canada and ensures that ring-fenced funding is available for e-health implementation across the provinces. In conclusion, the paper suggests that, because of constitutional constraints, the federal government was limited in options to implement e-health and that CHI represents a fair compromise.

  11. $\\chi_{c2}$ formation in two-photon collisions at LEP

    CERN Document Server

    Acciarri, M; Adriani, O; Aguilar-Benítez, M; Alcaraz, J; Alemanni, G; Allaby, James V; Aloisio, A; Alviggi, M G; Ambrosi, G; Anderhub, H; Andreev, V P; Angelescu, T; Anselmo, F; Arefev, A; Azemoon, T; Aziz, T; Bagnaia, P; Baksay, L; Balandras, A; Ball, R C; Banerjee, S; Banerjee, Sw; Banicz, K; Barczyk, A; Barillère, R; Barone, L; Bartalini, P; Basile, M; Battiston, R; Bay, A; Becattini, F; Becker, U; Behner, F; Berdugo, J; Berges, P; Bertucci, B; Betev, B L; Bhattacharya, S; Biasini, M; Biland, A; Blaising, J J; Blyth, S C; Bobbink, Gerjan J; Böck, R K; Böhm, A; Boldizsar, L; Borgia, B; Bourilkov, D; Bourquin, Maurice; Braccini, S; Branson, J G; Brigljevic, V; Brochu, F; Buffini, A; Buijs, A; Burger, J D; Burger, W J; Busenitz, J K; Button, A M; Cai, X D; Campanelli, M; Capell, M; Cara Romeo, G; Carlino, G; Cartacci, A M; Casaus, J; Castellini, G; Cavallari, F; Cavallo, N; Cecchi, C; Cerrada-Canales, M; Cesaroni, F; Chamizo-Llatas, M; Chang, Y H; Chaturvedi, U K; Chemarin, M; Chen, A; Chen, G; Chen, G M; Chen, H F; Chen, H S; Chéreau, X J; Chiefari, G; Cifarelli, Luisa; Cindolo, F; Civinini, C; Clare, I; Clare, R; Coignet, G; Colijn, A P; Colino, N; Costantini, S; Cotorobai, F; de la Cruz, B; Csilling, Akos; Dai, T S; van Dalen, J A; D'Alessandro, R; De Asmundis, R; Déglon, P L; Degré, A; Deiters, K; Della Volpe, D; Denes, P; De Notaristefani, F; De Salvo, A; Diemoz, M; Van Dierendonck, D N; Di Lodovico, F; Dionisi, C; Dittmar, Michael; Dominguez, A; Doria, A; Dova, M T; Duchesneau, D; Dufournaud, D; Duinker, P; Durán, I; El-Mamouni, H; Engler, A; Eppling, F J; Erné, F C; Extermann, Pierre; Fabre, M; Faccini, R; Falagán, M A; Falciano, S; Favara, A; Fay, J; Fedin, O; Felcini, Marta; Ferguson, T; Ferroni, F; Fesefeldt, H S; Fiandrini, E; Field, J H; Filthaut, Frank; Fisher, P H; Fisk, I; Forconi, G; Fredj, L; Freudenreich, Klaus; Furetta, C; Galaktionov, Yu; Ganguli, S N; García-Abia, P; Gataullin, M; Gau, S S; Gentile, S; Gheordanescu, N; Giagu, S; Goldfarb, S; Gong, Z F; Grünewald, M W; van Gulik, R; Gupta, V K; Gurtu, A; Gutay, L J; Haas, D; Hartmann, B; Hasan, A; Hatzifotiadou, D; Hebbeker, T; Hervé, A; Hidas, P; Hirschfelder, J; Hofer, H; Holzner, G; Hoorani, H; Hou, S R; Iashvili, I; Jin, B N; Jones, L W; de Jong, P; Josa-Mutuberria, I; Khan, R A; Kamrad, D; Kapustinsky, J S; Kaur, M; Kienzle-Focacci, M N; Kim, D; Kim, D H; Kim, J K; Kim, S C; Kinnison, W W; Kirkby, Jasper; Kiss, D; Kittel, E W; Klimentov, A; König, A C; Kopp, A; Korolko, I; Koutsenko, V F; Krämer, R W; Krenz, W; Kunin, A; Lacentre, P E; Ladrón de Guevara, P; Laktineh, I; Landi, G; Lapoint, C; Lassila-Perini, K M; Laurikainen, P; Lavorato, A; Lebeau, M; Lebedev, A; Lebrun, P; Lecomte, P; Lecoq, P; Le Coultre, P; Lee, H J; Le Goff, J M; Leiste, R; Leonardi, E; Levchenko, P M; Li Chuan; Lin, C H; Lin, W T; Linde, Frank L; Lista, L; Liu, Z A; Lohmann, W; Longo, E; Lü, Y S; Lübelsmeyer, K; Luci, C; Luckey, D; Luminari, L; Lustermann, W; Ma Wen Gan; Maity, M; Majumder, G; Malgeri, L; Malinin, A; Maña, C; Mangeol, D J J; Marchesini, P A; Marian, G; Martin, J P; Marzano, F; Massaro, G G G; Mazumdar, K; McNeil, R R; Mele, S; Merola, L; Meschini, M; Metzger, W J; Von der Mey, M; Migani, D; Mihul, A; Milcent, H; Mirabelli, G; Mnich, J; Molnár, P; Monteleoni, B; Moulik, T; Muanza, G S; Muheim, F; Muijs, A J M; Nahn, S; Napolitano, M; Nessi-Tedaldi, F; Newman, H; Niessen, T; Nippe, A; Nisati, A; Nowak, H; Oh, Yu D; Organtini, G; Ostonen, R; Palomares, C; Pandoulas, D; Paoletti, S; Paolucci, P; Park, H K; Park, I H; Pascale, G; Passaleva, G; Patricelli, S; Paul, T; Pauluzzi, M; Paus, C; Pauss, Felicitas; Peach, D; Pedace, M; Pei, Y J; Pensotti, S; Perret-Gallix, D; Petersen, B; Petrak, S; Piccolo, D; Pieri, M; Piroué, P A; Pistolesi, E; Plyaskin, V; Pohl, M; Pozhidaev, V; Postema, H; Pothier, J; Produit, N; Prokofev, D; Prokofiev, D O; Quartieri, J; Rahal-Callot, G; Raja, N; Rancoita, P G; Raven, G; Razis, P A; Ren, D; Rescigno, M; Reucroft, S; Van Rhee, T; Riemann, S; Riles, K; Robohm, A; Rodin, J; Roe, B P; Romero, L; Rosier-Lees, S; Roth, S; Rubio, Juan Antonio; Ruschmeier, D; Rykaczewski, H; Sakar, S; Salicio, J; Sánchez, E; Sanders, M P; Sarakinos, M E; Schäfer, C; Shchegelskii, V; Schmidt-Kärst, S; Schmitz, D; Scholz, N; Schopper, Herwig Franz; Schotanus, D J; Schwenke, J; Schwering, G; Sciacca, C; Sciarrino, D; Servoli, L; Shevchenko, S; Shivarov, N; Shoutko, V; Shukla, J; Shumilov, E; Shvorob, A V; Siedenburg, T; Son, D; Smith, B; Spillantini, P; Steuer, M; Stickland, D P; Stone, A; Stone, H; Stoyanov, B; Strässner, A; Sudhakar, K; Sultanov, G G; Sun, L Z; Suter, H; Swain, J D; Szillási, Z; Tang, X W; Tauscher, Ludwig; Taylor, L; Timmermans, C; Ting, Samuel C C; Ting, S M; Tonwar, S C; Tóth, J; Tully, C; Tung, K L; Uchida, Y; Ulbricht, J; Valente, E; Vesztergombi, G; Vetlitskii, I; Viertel, Gert M; Villa, S; Vivargent, M; Vlachos, S; Vogel, H; Vogt, H; Vorobev, I; Vorobyov, A A; Vorvolakos, A; Wadhwa, M; Wallraff, W; Wang, J C; Wang, X L; Wang, Z M; Weber, A; Wilkens, H; Wu, S X; Wynhoff, S; Xia, L; Xu, Z Z; Yang, B Z; Yang, C G; Yang, H J; Yang, M; Ye, J B; Yeh, S C; You, J M; Zalite, A; Zalite, Yu; Zemp, P; Zeng, Y; Zhang, Z P; Zhu, G Y; Zhu, R Y; Zichichi, Antonino; Ziegler, F; Zilizi, G

    1999-01-01

    Two-photon formation of the charmonium resonance $\\chi_{{\\rm c}2}$ has been studied with the L3 detector at LEP. The $\\chi_{{\\rm c}2}$ is identified through its decay $\\chi_{{\\rm c}2} \\rightarrow \\gamma {\\rm J}$, with a subsequent decay ${\\rm J} \\rightarrow {\\mathrm{e^+ e^-}}$ or ${\\rm J} \\rightarrow {\\mathrm{\\mu^+ \\mu^-}}$. With an integrated luminosity of 140 pb$^{-1}$ at $\\sqrt{s} \\simeq$ 91~\\textrm{Ge\\kern -0.1em V} and 52 pb$^{-1}$ at $\\sqrt{s} \\simeq$ {Ge\\kern -0.1em V}, we measure the two-photon width of the $\\chi_{{\\rm c}2}$ to be \\begin{center} $\\Gamma_{\\gamma\\gamma}(\\chi_{{\\rm c}2})=1.02 \\pm 0.40 \\mbox{$\\;$(stat.)} \\pm 0.15 \\mbox{$\\;$(sys.)} \\pm 0.09(\\rm{BR.}) {\\mathrm{\\ ke\\kern -0.1em V}}$.

  12. An Assessment of Tai Chi Exercise on Cognitive Ability in Older Adults

    Directory of Open Access Journals (Sweden)

    Hung Manh NGUYEN

    2015-09-01

    Full Text Available The purpose of this study was to evaluate the effects of Tai Chi exercise on cognitive performance of community - dwelling elderly in Vinh city, Vietnam. It is a controlled trial. One hundred subjected were recruited. Subjects were divided randomly into two groups. Tai Chi group was assigned 6 - months Tai Chi training. Control group was instructed to maintain their routine daily activities. Participants in Tai Chi group reported significant improvement cognitive ability, part A with F(1, 68 = 75.36, p < .001, and in part B with F(1, 68= 172.83, p < .001 in comparison with Control group. Tai Chi is beneficial to improve cognitive performance of the elderly.

  13. Multiples least-squares reverse time migration

    KAUST Repository

    Zhang, D. L.

    2013-01-01

    To enhance the image quality, we propose multiples least-squares reverse time migration (MLSRTM) that transforms each hydrophone into a virtual point source with a time history equal to that of the recorded data. Since each recorded trace is treated as a virtual source, knowledge of the source wavelet is not required. Numerical tests on synthetic data for the Sigsbee2B model and field data from Gulf of Mexico show that MLSRTM can improve the image quality by removing artifacts, balancing amplitudes, and suppressing crosstalk compared to standard migration of the free-surface multiples. The potential liability of this method is that multiples require several roundtrips between the reflector and the free surface, so that high frequencies in the multiples are attenuated compared to the primary reflections. This can lead to lower resolution in the migration image compared to that computed from primaries.

  14. Science with the Square Kilometre Array

    Science.gov (United States)

    Lazio, Joseph; Huynh, Minh

    2010-01-01

    The Square Kilometre Array (SKA) is the centimeter- and meter-wavelength telescope for the 21st Century. Its Key Science Projects are (a) The end of the Dark Ages, involving searches for an H i signature and the first metalrich systems; (b) Testing theories of gravitation using an array of pulsars to search for gravitational waves and relativistic binaries to probe the strong-field regime; (c) Observations of H i to a redshift z 2 from which to study the evolution of galaxies and dark energy. (d) Astrobiology including planetary formation within protoplanetary disks; and (c) The origin and evolution of cosmic magnetism, both within the Galaxy and in intergalactic space. The SKA will operate over the wavelength range of at least 1.2 cm to 4 m (70 MHz to 25 GHz), providing milliarcsecond resolution at the shortest wavelengths.

  15. A Novel Latin Square Image Cipher

    CERN Document Server

    Wu, Yue; Noonan, Joseph P; Agaian, Sos; Chen, C L Philip

    2012-01-01

    In this paper, we introduce a symmetric-key Latin square image cipher (LSIC) for grayscale and color images. Our contributions to the image encryption community include 1) we develop new Latin square image encryption primitives including Latin Square Whitening, Latin Square S-box and Latin Square P-box ; 2) we provide a new way of integrating probabilistic encryption in image encryption by embedding random noise in the least significant image bit-plane; and 3) we construct LSIC with these Latin square image encryption primitives all on one keyed Latin square in a new loom-like substitution-permutation network. Consequently, the proposed LSIC achieve many desired properties of a secure cipher including a large key space, high key sensitivities, uniformly distributed ciphertext, excellent confusion and diffusion properties, semantically secure, and robustness against channel noise. Theoretical analysis show that the LSIC has good resistance to many attack models including brute-force attacks, ciphertext-only at...

  16. Nonnegative Polynomials and Sums of Squares

    CERN Document Server

    Blekherman, Grigoriy

    2010-01-01

    In the smallest cases where there exist nonnegative polynomials that are not sums of squares we present a complete classification of the differences between these sets. We show that in these cases the fundamental reason that the set of sums of squares is smaller than the set of nonnegative polynomials is that polynomials of degree d satisfy certain linear relations known as the Cayley-Bacharach relations, which are not satisfied by polynomials of full degree 2d. For any nonnegative polynomial that is not a sum of squares we can write down a linear inequality coming from a Cayley-Bacharach relation that certifies that the polynomial is not a sum of squares. We also present structure results on the strictly positive sums of squares that lie on the boundary of the cone of sums of squares and results on extreme rays of the cone dual to the cone of sums of squares.

  17. Patterns of Lifetime and Recent HIV Testing Among Men Who Have Sex with Men in New York City Who Use Grindr

    OpenAIRE

    Rendina, H. Jonathon; Jimenez, Ruben H.; Grov, Christian; Ventuneac, Ana; Parsons, Jeffrey T.

    2014-01-01

    Rates of HIV infection continue to rise for men who have sex with men (MSM), and may be partially due to lack of testing among groups at risk for HIV. Mobile applications have demonstrated promise to identify at-risk MSM, though more research is needed to address testing patterns among this population. We conducted an online survey of 1,351 MSM in the New York City (NYC) area recruited from Grindr and analyzed predictors of lifetime and past-year testing using Pearson’s chi-squared statistic,...

  18. Development of Chinese Version of Polycystic Ovary Syndrome Health-Related Quality of Life Questionnaire (Chi-PCOSQ.

    Directory of Open Access Journals (Sweden)

    Huang-tz Ou

    Full Text Available To develop the Chinese version of the Polycystic Ovary Syndrome Health-related Quality of Life Questionnaire (Chi-PCOSQ.This cross-sectional study was conducted in a medical center in Taiwan. Eighty women who met the criteria were enrolled: female, age range of 18-45 years, competent in the Chinese language, had been diagnosed with polycystic ovary syndrome (PCOS, and were regularly followed at outpatient clinics (defined as at least two outpatient visits before enrollment. The PCOSQ was translated and culturally adapted according to standard procedures. A semi-structured interview was applied to assess face validity. Exploratory factor analysis (EFA was applied to determine scale constructs. Measurements of internal consistency via Cronbach's α, test-retest reliability via intraclass correlation coefficient (ICC, construct validity, and discriminative validity were performed.Five additional items, representing the issues of acne, hair loss, and fear of getting diabetes, were incorporated into the original scale. A six-factor structure emerged as a result of the EFA, explaining 71.9% of the variance observed. The reliability analyses demonstrated satisfactory results for Cronbach's α ranging from 0.78-0.96, and for ICC ranging from 0.73-0.86. Construct validity was confirmed by significant correlation between the domains of the Chi-PCOSQ and generic health-related quality of life (HRQoL measures (WHOQOL-BREF, EQ-5D and clinical parameters (body mass index, waist-hip ratio, blood pressure. The known-group analysis indicated that the Chi-PCOSQ is a discriminative tool that differentiates patients according to their HRQoL.The Chi-PCOSQ seems internally consistent, culturally acceptable, and our preliminary evidence suggests that it may be reliable and valid. The Chi-PCOSQ is a promising assessment tool to address the HRQoL of women affected by PCOS in Chinese-speaking countries and to further identify ethnic/cultural differences in the HRQoL of

  19. New Urban Squares, Documentation for ten urban squares recently designed in the Netherlands

    OpenAIRE

    Attia, Shady

    2005-01-01

    It is claimed that Dutch squares have no symbolic meaning or characteristics like in southern Europe. In the Netherlands, urban squares are only used for functional activities. Until the beginning of the 1980s and before the introduction of café terraces or the 'terrasje' culture, the urban squares were only used as ‘marktpleinen’ or market squares. However, this study concludes that almost all the design strategies tried to introduce spacious empty squares. In each example, the design of the...

  20. [Epilepsy and Szondi test].

    Science.gov (United States)

    Andrade, L

    1976-05-01

    After having briefly recalled the different studies of epilepsy done on the basis of the Szondi test, the author proposes to study the drive structure of three groups of epileptics (19 cases of primary generalized epilepsy, 18 cases of partial temporal lobe epilepsy, 31 cases of partial non-temporal epilepsy) with the purpose of finding possible differences in psychological drive among the three groups and, at the same time, evaluating the test's capacity for discrimination by using the statistical method. The three groups show the same type of profile generally characterized by an extreme need for acceptance and affection (h + !, C- + !) counteracted by a strong repression (hy - !, k -) resulting in agressiveness (s + !). However, statistical analysis (chi square test), the drive formula, the drive class and the EKP showed that, beyond this shared area, there are differences among the three groups. The author then attempts to sort out the meaning of these differences. Finally, based on certain passages from Szondi as well as the test results, the author puts forward an hypothesis linking the psychological drive problematic in primary generalized epilepsies to a very early disturbance in the history of the individual's psychic development, the origins of which would go back to a split in the unity between mother and child. On the other hand, drive disturbances in partial epilepsies would be considered secondary to the illness. PMID:788602

  1. Measurement of the relative prompt production rate of $\\chi_{c2}$ and $\\chi_{c1}$ in pp collisions at $\\sqrt{s}$ = 7 TeV

    CERN Document Server

    Chatrchyan, Serguei; Sirunyan, Albert M; Tumasyan, Armen; Adam, Wolfgang; Aguilo, Ernest; Bergauer, Thomas; Dragicevic, Marko; Erö, Janos; Fabjan, Christian; Friedl, Markus; Fruehwirth, Rudolf; Ghete, Vasile Mihai; Hammer, Josef; Hörmann, Natascha; Hrubec, Josef; Jeitler, Manfred; Kiesenhofer, Wolfgang; Knünz, Valentin; Krammer, Manfred; Krätschmer, Ilse; Liko, Dietrich; Mikulec, Ivan; Pernicka, Manfred; Rahbaran, Babak; Rohringer, Christine; Rohringer, Herbert; Schöfbeck, Robert; Strauss, Josef; Taurok, Anton; Waltenberger, Wolfgang; Walzel, Gerhard; Widl, Edmund; Wulz, Claudia-Elisabeth; Mossolov, Vladimir; Shumeiko, Nikolai; Suarez Gonzalez, Juan; Bansal, Monika; Bansal, Sunil; Cornelis, Tom; De Wolf, Eddi A; Janssen, Xavier; Luyckx, Sten; Mucibello, Luca; Ochesanu, Silvia; Roland, Benoit; Rougny, Romain; Selvaggi, Michele; Staykova, Zlatka; Van Haevermaet, Hans; Van Mechelen, Pierre; Van Remortel, Nick; Van Spilbeeck, Alex; Blekman, Freya; Blyweert, Stijn; D'Hondt, Jorgen; Gonzalez Suarez, Rebeca; Kalogeropoulos, Alexis; Maes, Michael; Olbrechts, Annik; Van Doninck, Walter; Van Mulders, Petra; Van Onsem, Gerrit Patrick; Villella, Ilaria; Clerbaux, Barbara; De Lentdecker, Gilles; Dero, Vincent; Gay, Arnaud; Hreus, Tomas; Léonard, Alexandre; Marage, Pierre Edouard; Mohammadi, Abdollah; Reis, Thomas; Thomas, Laurent; Vander Marcken, Gil; Vander Velde, Catherine; Vanlaer, Pascal; Wang, Jian; Adler, Volker; Beernaert, Kelly; Cimmino, Anna; Costantini, Silvia; Garcia, Guillaume; Grunewald, Martin; Klein, Benjamin; Lellouch, Jérémie; Marinov, Andrey; Mccartin, Joseph; Ocampo Rios, Alberto Andres; Ryckbosch, Dirk; Strobbe, Nadja; Thyssen, Filip; Tytgat, Michael; Verwilligen, Piet; Walsh, Sinead; Yazgan, Efe; Zaganidis, Nicolas; Basegmez, Suzan; Bruno, Giacomo; Castello, Roberto; Ceard, Ludivine; Delaere, Christophe; Du Pree, Tristan; Favart, Denis; Forthomme, Laurent; Giammanco, Andrea; Hollar, Jonathan; Lemaitre, Vincent; Liao, Junhui; Militaru, Otilia; Nuttens, Claude; Pagano, Davide; Pin, Arnaud; Piotrzkowski, Krzysztof; Schul, Nicolas; Vizan Garcia, Jesus Manuel; Beliy, Nikita; Caebergs, Thierry; Daubie, Evelyne; Hammad, Gregory Habib; Alves, Gilvan; Correa Martins Junior, Marcos; De Jesus Damiao, Dilson; Martins, Thiago; Pol, Maria Elena; Henrique Gomes E Souza, Moacyr; Aldá Júnior, Walter Luiz; Carvalho, Wagner; Custódio, Analu; Da Costa, Eliza Melo; De Oliveira Martins, Carley; Fonseca De Souza, Sandro; Matos Figueiredo, Diego; Mundim, Luiz; Nogima, Helio; Oguri, Vitor; Prado Da Silva, Wanda Lucia; Santoro, Alberto; Soares Jorge, Luana; Sznajder, Andre; Souza Dos Anjos, Tiago; Bernardes, Cesar Augusto; De Almeida Dias, Flavia; Tomei, Thiago; De Moraes Gregores, Eduardo; Lagana, Caio; Da Cunha Marinho, Franciole; Mercadante, Pedro G; Novaes, Sergio F; Padula, Sandra; Genchev, Vladimir; Iaydjiev, Plamen; Piperov, Stefan; Rodozov, Mircho; Stoykova, Stefka; Sultanov, Georgi; Tcholakov, Vanio; Trayanov, Rumen; Vutova, Mariana; Dimitrov, Anton; Hadjiiska, Roumyana; Kozhuharov, Venelin; Litov, Leander; Pavlov, Borislav; Petkov, Peicho; Bian, Jian-Guo; Chen, Guo-Ming; Chen, He-Sheng; Jiang, Chun-Hua; Liang, Dong; Liang, Song; Meng, Xiangwei; Tao, Junquan; Wang, Jian; Wang, Xianyou; Wang, Zheng; Xiao, Hong; Xu, Ming; Zang, Jingjing; Zhang, Zhen; Asawatangtrakuldee, Chayanit; Ban, Yong; Guo, Yifei; Li, Wenbo; Liu, Shuai; Mao, Yajun; Qian, Si-Jin; Teng, Haiyun; Wang, Dayong; Zhang, Linlin; Zou, Wei; Avila, Carlos; Gomez, Juan Pablo; Gomez Moreno, Bernardo; Osorio Oliveros, Andres Felipe; Sanabria, Juan Carlos; Godinovic, Nikola; Lelas, Damir; Plestina, Roko; Polic, Dunja; Puljak, Ivica; Antunovic, Zeljko; Kovac, Marko; Brigljevic, Vuko; Duric, Senka; Kadija, Kreso; Luetic, Jelena; Morovic, Srecko; Attikis, Alexandros; Galanti, Mario; Mavromanolakis, Georgios; Mousa, Jehad; Nicolaou, Charalambos; Ptochos, Fotios; Razis, Panos A; Finger, Miroslav; Finger Jr, Michael; Assran, Yasser; Elgammal, Sherif; Ellithi Kamel, Ali; Khalil, Shaaban; Mahmoud, Mohammed; Radi, Amr; Kadastik, Mario; Müntel, Mait; Raidal, Martti; Rebane, Liis; Tiko, Andres; Eerola, Paula; Fedi, Giacomo; Voutilainen, Mikko; Härkönen, Jaakko; Heikkinen, Mika Aatos; Karimäki, Veikko; Kinnunen, Ritva; Kortelainen, Matti J; Lampén, Tapio; Lassila-Perini, Kati; Lehti, Sami; Lindén, Tomas; Luukka, Panja-Riina; Mäenpää, Teppo; Peltola, Timo; Tuominen, Eija; Tuominiemi, Jorma; Tuovinen, Esa; Ungaro, Donatella; Wendland, Lauri; Banzuzi, Kukka; Karjalainen, Ahti; Korpela, Arja; Tuuva, Tuure; Besancon, Marc; Choudhury, Somnath; Dejardin, Marc; Denegri, Daniel; Fabbro, Bernard; Faure, Jean-Louis; Ferri, Federico; Ganjour, Serguei; Givernaud, Alain; Gras, Philippe; Hamel de Monchenault, Gautier; Jarry, Patrick; Locci, Elizabeth; Malcles, Julie; Millischer, Laurent; Nayak, Aruna; Rander, John; Rosowsky, André; Shreyber, Irina; Titov, Maksym; Baffioni, Stephanie; Beaudette, Florian; Benhabib, Lamia; Bianchini, Lorenzo; Bluj, Michal; Broutin, Clementine; Busson, Philippe; Charlot, Claude; Daci, Nadir; Dahms, Torsten; Dobrzynski, Ludwik; Granier de Cassagnac, Raphael; Haguenauer, Maurice; Miné, Philippe; Mironov, Camelia; Naranjo, Ivo Nicolas; Nguyen, Matthew; Ochando, Christophe; Paganini, Pascal; Sabes, David; Salerno, Roberto; Sirois, Yves; Veelken, Christian; Zabi, Alexandre; Agram, Jean-Laurent; Andrea, Jeremy; Bloch, Daniel; Bodin, David; Brom, Jean-Marie; Cardaci, Marco; Chabert, Eric Christian; Collard, Caroline; Conte, Eric; Drouhin, Frédéric; Ferro, Cristina; Fontaine, Jean-Charles; Gelé, Denis; Goerlach, Ulrich; Juillot, Pierre; Le Bihan, Anne-Catherine; Van Hove, Pierre; Fassi, Farida; Mercier, Damien; Beauceron, Stephanie; Beaupere, Nicolas; Bondu, Olivier; Boudoul, Gaelle; Chasserat, Julien; Chierici, Roberto; Contardo, Didier; Depasse, Pierre; El Mamouni, Houmani; Fay, Jean; Gascon, Susan; Gouzevitch, Maxime; Ille, Bernard; Kurca, Tibor; Lethuillier, Morgan; Mirabito, Laurent; Perries, Stephane; Sordini, Viola; Tschudi, Yohann; Verdier, Patrice; Viret, Sébastien; Tsamalaidze, Zviad; Anagnostou, Georgios; Autermann, Christian; Beranek, Sarah; Edelhoff, Matthias; Feld, Lutz; Heracleous, Natalie; Hindrichs, Otto; Jussen, Ruediger; Klein, Katja; Merz, Jennifer; Ostapchuk, Andrey; Perieanu, Adrian; Raupach, Frank; Sammet, Jan; Schael, Stefan; Sprenger, Daniel; Weber, Hendrik; Wittmer, Bruno; Zhukov, Valery; Ata, Metin; Caudron, Julien; Dietz-Laursonn, Erik; Duchardt, Deborah; Erdmann, Martin; Fischer, Robert; Güth, Andreas; Hebbeker, Thomas; Heidemann, Carsten; Hoepfner, Kerstin; Klingebiel, Dennis; Kreuzer, Peter; Magass, Carsten; Merschmeyer, Markus; Meyer, Arnd; Olschewski, Mark; Papacz, Paul; Pieta, Holger; Reithler, Hans; Schmitz, Stefan Antonius; Sonnenschein, Lars; Steggemann, Jan; Teyssier, Daniel; Weber, Martin; Bontenackels, Michael; Cherepanov, Vladimir; Erdogan, Yusuf; Flügge, Günter; Geenen, Heiko; Geisler, Matthias; Haj Ahmad, Wael; Hoehle, Felix; Kargoll, Bastian; Kress, Thomas; Kuessel, Yvonne; Nowack, Andreas; Perchalla, Lars; Pooth, Oliver; Sauerland, Philip; Stahl, Achim; Aldaya Martin, Maria; Behr, Joerg; Behrenhoff, Wolf; Behrens, Ulf; Bergholz, Matthias; Bethani, Agni; Borras, Kerstin; Burgmeier, Armin; Cakir, Altan; Calligaris, Luigi; Campbell, Alan; Castro, Elena; Costanza, Francesco; Dammann, Dirk; Diez Pardos, Carmen; Eckerlin, Guenter; Eckstein, Doris; Flucke, Gero; Geiser, Achim; Glushkov, Ivan; Gunnellini, Paolo; Habib, Shiraz; Hauk, Johannes; Hellwig, Gregor; Jung, Hannes; Kasemann, Matthias; Katsas, Panagiotis; Kleinwort, Claus; Kluge, Hannelies; Knutsson, Albert; Krämer, Mira; Krücker, Dirk; Kuznetsova, Ekaterina; Lange, Wolfgang; Lohmann, Wolfgang; Lutz, Benjamin; Mankel, Rainer; Marfin, Ihar; Marienfeld, Markus; Melzer-Pellmann, Isabell-Alissandra; Meyer, Andreas Bernhard; Mnich, Joachim; Mussgiller, Andreas; Naumann-Emme, Sebastian; Olzem, Jan; Perrey, Hanno; Petrukhin, Alexey; Pitzl, Daniel; Raspereza, Alexei; Ribeiro Cipriano, Pedro M; Riedl, Caroline; Ron, Elias; Rosin, Michele; Salfeld-Nebgen, Jakob; Schmidt, Ringo; Schoerner-Sadenius, Thomas; Sen, Niladri; Spiridonov, Alexander; Stein, Matthias; Walsh, Roberval; Wissing, Christoph; Blobel, Volker; Draeger, Jula; Enderle, Holger; Erfle, Joachim; Gebbert, Ulla; Görner, Martin; Hermanns, Thomas; Höing, Rebekka Sophie; Kaschube, Kolja; Kaussen, Gordon; Kirschenmann, Henning; Klanner, Robert; Lange, Jörn; Mura, Benedikt; Nowak, Friederike; Peiffer, Thomas; Pietsch, Niklas; Rathjens, Denis; Sander, Christian; Schettler, Hannes; Schleper, Peter; Schlieckau, Eike; Schmidt, Alexander; Schröder, Matthias; Schum, Torben; Seidel, Markus; Sola, Valentina; Stadie, Hartmut; Steinbrück, Georg; Thomsen, Jan; Vanelderen, Lukas; Barth, Christian; Berger, Joram; Böser, Christian; Chwalek, Thorsten; De Boer, Wim; Descroix, Alexis; Dierlamm, Alexander; Feindt, Michael; Guthoff, Moritz; Hackstein, Christoph; Hartmann, Frank; Hauth, Thomas; Heinrich, Michael; Held, Hauke; Hoffmann, Karl-Heinz; Honc, Simon; Katkov, Igor; Komaragiri, Jyothsna Rani; Lobelle Pardo, Patricia; Martschei, Daniel; Mueller, Steffen; Müller, Thomas; Niegel, Martin; Nürnberg, Andreas; Oberst, Oliver; Oehler, Andreas; Ott, Jochen; Quast, Gunter; Rabbertz, Klaus; Ratnikov, Fedor; Ratnikova, Natalia; Röcker, Steffen; Scheurer, Armin; Schilling, Frank-Peter; Schott, Gregory; Simonis, Hans-Jürgen; Stober, Fred-Markus Helmut; Troendle, Daniel; Ulrich, Ralf; Wagner-Kuhr, Jeannine; Wayand, Stefan; Weiler, Thomas; Zeise, Manuel; Daskalakis, Georgios; Geralis, Theodoros; Kesisoglou, Stilianos; Kyriakis, Aristotelis; Loukas, Demetrios; Manolakos, Ioannis; Markou, Athanasios; Markou, Christos; Mavrommatis, Charalampos; Ntomari, Eleni; Gouskos, Loukas; Mertzimekis, Theodoros; Panagiotou, Apostolos; Saoulidou, Niki; Evangelou, Ioannis; Foudas, Costas; Kokkas, Panagiotis; Manthos, Nikolaos; Papadopoulos, Ioannis; Patras, Vaios; Bencze, Gyorgy; Hajdu, Csaba; Hidas, Pàl; Horvath, Dezso; Sikler, Ferenc; Veszpremi, Viktor; Vesztergombi, Gyorgy; Beni, Noemi; Czellar, Sandor; Molnar, Jozsef; Palinkas, Jozsef; Szillasi, Zoltan; Karancsi, János; Raics, Peter; Trocsanyi, Zoltan Laszlo; Ujvari, Balazs; Beri, Suman Bala; Bhatnagar, Vipin; Dhingra, Nitish; Gupta, Ruchi; Kaur, Manjit; Mehta, Manuk Zubin; Nishu, Nishu; Saini, Lovedeep Kaur; Sharma, Archana; Singh, Jasbir; Kumar, Ashok; Kumar, Arun; Ahuja, Sudha; Bhardwaj, Ashutosh; Choudhary, Brajesh C; Malhotra, Shivali; Naimuddin, Md; Ranjan, Kirti; Sharma, Varun; Shivpuri, Ram Krishen; Banerjee, Sunanda; Bhattacharya, Satyaki; Dutta, Suchandra; Gomber, Bhawna; Jain, Sandhya; Jain, Shilpi; Khurana, Raman; Sarkar, Subir; Sharan, Manoj; Abdulsalam, Abdulla; Choudhury, Rajani Kant; Dutta, Dipanwita; Kailas, Swaminathan; Kumar, Vineet; Mehta, Pourus; Mohanty, Ajit Kumar; Pant, Lalit Mohan; Shukla, Prashant; Aziz, Tariq; Ganguly, Sanmay; Guchait, Monoranjan; Maity, Manas; Majumder, Gobinda; Mazumdar, Kajari; Mohanty, Gagan Bihari; Parida, Bibhuti; Sudhakar, Katta; Wickramage, Nadeesha; Banerjee, Sudeshna; Dugad, Shashikant; Arfaei, Hessamaddin; Bakhshiansohi, Hamed; Etesami, Seyed Mohsen; Fahim, Ali; Hashemi, Majid; Hesari, Hoda; Jafari, Abideh; Khakzad, Mohsen; Mohammadi Najafabadi, Mojtaba; Paktinat Mehdiabadi, Saeid; Safarzadeh, Batool; Zeinali, Maryam; Abbrescia, Marcello; Barbone, Lucia; Calabria, Cesare; Chhibra, Simranjit Singh; Colaleo, Anna; Creanza, Donato; De Filippis, Nicola; De Palma, Mauro; Fiore, Luigi; Iaselli, Giuseppe; Lusito, Letizia; Maggi, Giorgio; Maggi, Marcello; Marangelli, Bartolomeo; My, Salvatore; Nuzzo, Salvatore; Pacifico, Nicola; Pompili, Alexis; Pugliese, Gabriella; Selvaggi, Giovanna; Silvestris, Lucia; Singh, Gurpreet; Venditti, Rosamaria; Zito, Giuseppe; Abbiendi, Giovanni; Benvenuti, Alberto; Bonacorsi, Daniele; Braibant-Giacomelli, Sylvie; Brigliadori, Luca; Capiluppi, Paolo; Castro, Andrea; Cavallo, Francesca Romana; Cuffiani, Marco; Dallavalle, Gaetano-Marco; Fabbri, Fabrizio; Fanfani, Alessandra; Fasanella, Daniele; Giacomelli, Paolo; Grandi, Claudio; Guiducci, Luigi; Marcellini, Stefano; Masetti, Gianni; Meneghelli, Marco; Montanari, Alessandro; Navarria, Francesco; Odorici, Fabrizio; Perrotta, Andrea; Primavera, Federica; Rossi, Antonio; Rovelli, Tiziano; Siroli, Gian Piero; Travaglini, Riccardo; Albergo, Sebastiano; Cappello, Gigi; Chiorboli, Massimiliano; Costa, Salvatore; Potenza, Renato; Tricomi, Alessia; Tuve, Cristina; Barbagli, Giuseppe; Ciulli, Vitaliano; Civinini, Carlo; D'Alessandro, Raffaello; Focardi, Ettore; Frosali, Simone; Gallo, Elisabetta; Gonzi, Sandro; Meschini, Marco; Paoletti, Simone; Sguazzoni, Giacomo; Tropiano, Antonio; Benussi, Luigi; Bianco, Stefano; Colafranceschi, Stefano; Fabbri, Franco; Piccolo, Davide; Fabbricatore, Pasquale; Musenich, Riccardo; Tosi, Silvano; Benaglia, Andrea; De Guio, Federico; Di Matteo, Leonardo; Fiorendi, Sara; Gennai, Simone; Ghezzi, Alessio; Malvezzi, Sandra; Manzoni, Riccardo Andrea; Martelli, Arabella; Massironi, Andrea; Menasce, Dario; Moroni, Luigi; Paganoni, Marco; Pedrini, Daniele; Ragazzi, Stefano; Redaelli, Nicola; Sala, Silvano; Tabarelli de Fatis, Tommaso; Buontempo, Salvatore; Carrillo Montoya, Camilo Andres; Cavallo, Nicola; De Cosa, Annapaola; Dogangun, Oktay; Fabozzi, Francesco; Iorio, Alberto Orso Maria; Lista, Luca; Meola, Sabino; Merola, Mario; Paolucci, Pierluigi; Azzi, Patrizia; Bacchetta, Nicola; Bisello, Dario; Branca, Antonio; Carlin, Roberto; Checchia, Paolo; Dorigo, Tommaso; Gasparini, Fabrizio; Gasparini, Ugo; Gozzelino, Andrea; Kanishchev, Konstantin; Lacaprara, Stefano; Lazzizzera, Ignazio; Margoni, Martino; Meneguzzo, Anna Teresa; Pazzini, Jacopo; Pozzobon, Nicola; Ronchese, Paolo; Simonetto, Franco; Torassa, Ezio; Tosi, Mia; Vanini, Sara; Zotto, Pierluigi; Zucchetta, Alberto; Zumerle, Gianni; Gabusi, Michele; Ratti, Sergio P; Riccardi, Cristina; Torre, Paola; Vitulo, Paolo; Biasini, Maurizio; Bilei, Gian Mario; Fanò, Livio; Lariccia, Paolo; Lucaroni, Andrea; Mantovani, Giancarlo; Menichelli, Mauro; Nappi, Aniello; Romeo, Francesco; Saha, Anirban; Santocchia, Attilio; Spiezia, Aniello; Taroni, Silvia; Azzurri, Paolo; Bagliesi, Giuseppe; Boccali, Tommaso; Broccolo, Giuseppe; Castaldi, Rino; D'Agnolo, Raffaele Tito; Dell'Orso, Roberto; Fiori, Francesco; Foà, Lorenzo; Giassi, Alessandro; Kraan, Aafke; Ligabue, Franco; Lomtadze, Teimuraz; Martini, Luca; Messineo, Alberto; Palla, Fabrizio; Rizzi, Andrea; Serban, Alin Titus; Spagnolo, Paolo; Squillacioti, Paola; Tenchini, Roberto; Tonelli, Guido; Venturi, Andrea; Verdini, Piero Giorgio; Barone, Luciano; Cavallari, Francesca; Del Re, Daniele; Diemoz, Marcella; Fanelli, Cristiano; Grassi, Marco; Longo, Egidio; Meridiani, Paolo; Micheli, Francesco; Nourbakhsh, Shervin; Organtini, Giovanni; Paramatti, Riccardo; Rahatlou, Shahram; Sigamani, Michael; Soffi, Livia; Amapane, Nicola; Arcidiacono, Roberta; Argiro, Stefano; Arneodo, Michele; Biino, Cristina; Cartiglia, Nicolo; Costa, Marco; Demaria, Natale; Mariotti, Chiara; Maselli, Silvia; Migliore, Ernesto; Monaco, Vincenzo; Musich, Marco; Obertino, Maria Margherita; Pastrone, Nadia; Pelliccioni, Mario; Potenza, Alberto; Romero, Alessandra; Sacchi, Roberto; Solano, Ada; Staiano, Amedeo; Usai, Emanuele; Vilela Pereira, Antonio; Belforte, Stefano; Candelise, Vieri; Cossutti, Fabio; Della Ricca, Giuseppe; Gobbo, Benigno; Marone, Matteo; Montanino, Damiana; Penzo, Aldo; Schizzi, Andrea; Heo, Seong Gu; Kim, Tae Yeon; Nam, Soon-Kwon; Chang, Sunghyun; Kim, Dong Hee; Kim, Gui Nyun; Kong, Dae Jung; Park, Hyangkyu; Ro, Sang-Ryul; Son, Dong-Chul; Son, Taejin; Kim, Jae Yool; Kim, Zero Jaeho; Song, Sanghyeon; Choi, Suyong; Gyun, Dooyeon; Hong, Byung-Sik; Jo, Mihee; Kim, Hyunchul; Kim, Tae Jeong; Lee, Kyong Sei; Moon, Dong Ho; Park, Sung Keun; Choi, Minkyoo; Kim, Ji Hyun; Park, Chawon; Park, Inkyu; Park, Sangnam; Ryu, Geonmo; Cho, Yongjin; Choi, Young-Il; Choi, Young Kyu; Goh, Junghwan; Kim, Min Suk; Kwon, Eunhyang; Lee, Byounghoon; Lee, Jongseok; Lee, Sungeun; Seo, Hyunkwan; Yu, Intae; Bilinskas, Mykolas Jurgis; Grigelionis, Ignas; Janulis, Mindaugas; Juodagalvis, Andrius; Castilla-Valdez, Heriberto; De La Cruz-Burelo, Eduard; Heredia-de La Cruz, Ivan; Lopez-Fernandez, Ricardo; Magaña Villalba, Ricardo; Martínez-Ortega, Jorge; Sánchez-Hernández, Alberto; Villasenor-Cendejas, Luis Manuel; Carrillo Moreno, Salvador; Vazquez Valencia, Fabiola; Salazar Ibarguen, Humberto Antonio; Casimiro Linares, Edgar; Morelos Pineda, Antonio; Reyes-Santos, Marco A; Krofcheck, David; Bell, Alan James; Butler, Philip H; Doesburg, Robert; Reucroft, Steve; Silverwood, Hamish; Ahmad, Muhammad; Ansari, Muhammad Hamid; Asghar, Muhammad Irfan; Hoorani, Hafeez R; Khalid, Shoaib; Khan, Wajid Ali; Khurshid, Taimoor; Qazi, Shamona; Shah, Mehar Ali; Shoaib, Muhammad; Bialkowska, Helena; Boimska, Bozena; Frueboes, Tomasz; Gokieli, Ryszard; Górski, Maciej; Kazana, Malgorzata; Nawrocki, Krzysztof; Romanowska-Rybinska, Katarzyna; Szleper, Michal; Wrochna, Grzegorz; Zalewski, Piotr; Brona, Grzegorz; Bunkowski, Karol; Cwiok, Mikolaj; Dominik, Wojciech; Doroba, Krzysztof; Kalinowski, Artur; Konecki, Marcin; Krolikowski, Jan; Almeida, Nuno; Bargassa, Pedrame; David Tinoco Mendes, Andre; Faccioli, Pietro; Ferreira Parracho, Pedro Guilherme; Gallinaro, Michele; Seixas, Joao; Varela, Joao; Vischia, Pietro; Belotelov, Ivan; Bunin, Pavel; Gavrilenko, Mikhail; Golutvin, Igor; Gorbunov, Ilya; Kamenev, Alexey; Karjavin, Vladimir; Kozlov, Guennady; Lanev, Alexander; Malakhov, Alexander; Moisenz, Petr; Palichik, Vladimir; Perelygin, Victor; Shmatov, Sergey; Smirnov, Vitaly; Volodko, Anton; Zarubin, Anatoli; Evstyukhin, Sergey; Golovtsov, Victor; Ivanov, Yury; Kim, Victor; Levchenko, Petr; Murzin, Victor; Oreshkin, Vadim; Smirnov, Igor; Sulimov, Valentin; Uvarov, Lev; Vavilov, Sergey; Vorobyev, Alexey; Vorobyev, Andrey; Andreev, Yuri; Dermenev, Alexander; Gninenko, Sergei; Golubev, Nikolai; Kirsanov, Mikhail; Krasnikov, Nikolai; Matveev, Viktor; Pashenkov, Anatoli; Tlisov, Danila; Toropin, Alexander; Epshteyn, Vladimir; Erofeeva, Maria; Gavrilov, Vladimir; Kossov, Mikhail; Lychkovskaya, Natalia; Popov, Vladimir; Safronov, Grigory; Semenov, Sergey; Stolin, Viatcheslav; Vlasov, Evgueni; Zhokin, Alexander; Belyaev, Andrey; Boos, Edouard; Dubinin, Mikhail; Dudko, Lev; Ershov, Alexander; Gribushin, Andrey; Klyukhin, Vyacheslav; Kodolova, Olga; Lokhtin, Igor; Markina, Anastasia; Obraztsov, Stepan; Perfilov, Maxim; Petrushanko, Sergey; Popov, Andrey; Sarycheva, Ludmila; Savrin, Viktor; Snigirev, Alexander; Andreev, Vladimir; Azarkin, Maksim; Dremin, Igor; Kirakosyan, Martin; Leonidov, Andrey; Mesyats, Gennady; Rusakov, Sergey V; Vinogradov, Alexey; Azhgirey, Igor; Bayshev, Igor; Bitioukov, Sergei; Grishin, Viatcheslav; Kachanov, Vassili; Konstantinov, Dmitri; Krychkine, Victor; Petrov, Vladimir; Ryutin, Roman; Sobol, Andrei; Tourtchanovitch, Leonid; Troshin, Sergey; Tyurin, Nikolay; Uzunian, Andrey; Volkov, Alexey; Adzic, Petar; Djordjevic, Milos; Ekmedzic, Marko; Krpic, Dragomir; Milosevic, Jovan; Aguilar-Benitez, Manuel; Alcaraz Maestre, Juan; Arce, Pedro; Battilana, Carlo; Calvo, Enrique; Cerrada, Marcos; Chamizo Llatas, Maria; Colino, Nicanor; De La Cruz, Begona; Delgado Peris, Antonio; Domínguez Vázquez, Daniel; Fernandez Bedoya, Cristina; Fernández Ramos, Juan Pablo; Ferrando, Antonio; Flix, Jose; Fouz, Maria Cruz; Garcia-Abia, Pablo; Gonzalez Lopez, Oscar; Goy Lopez, Silvia; Hernandez, Jose M; Josa, Maria Isabel; Merino, Gonzalo; Puerta Pelayo, Jesus; Quintario Olmeda, Adrián; Redondo, Ignacio; Romero, Luciano; Santaolalla, Javier; Soares, Mara Senghi; Willmott, Carlos; Albajar, Carmen; Codispoti, Giuseppe; de Trocóniz, Jorge F; Brun, Hugues; Cuevas, Javier; Fernandez Menendez, Javier; Folgueras, Santiago; Gonzalez Caballero, Isidro; Lloret Iglesias, Lara; Piedra Gomez, Jonatan; Brochero Cifuentes, Javier Andres; Cabrillo, Iban Jose; Calderon, Alicia; Chuang, Shan-Huei; Duarte Campderros, Jordi; Felcini, Marta; Fernandez, Marcos; Gomez, Gervasio; Gonzalez Sanchez, Javier; Graziano, Alberto; Jorda, Clara; Lopez Virto, Amparo; Marco, Jesus; Marco, Rafael; Martinez Rivero, Celso; Matorras, Francisco; Munoz Sanchez, Francisca Javiela; Rodrigo, Teresa; Rodríguez-Marrero, Ana Yaiza; Ruiz-Jimeno, Alberto; Scodellaro, Luca; Vila, Ivan; Vilar Cortabitarte, Rocio; Abbaneo, Duccio; Auffray, Etiennette; Auzinger, Georg; Bachtis, Michail; Baillon, Paul; Ball, Austin; Barney, David; Benitez, Jose F; Bernet, Colin; Bianchi, Giovanni; Bloch, Philippe; Bocci, Andrea; Bonato, Alessio; Botta, Cristina; Breuker, Horst; Camporesi, Tiziano; Cerminara, Gianluca; Christiansen, Tim; Coarasa Perez, Jose Antonio; D'Enterria, David; Dabrowski, Anne; De Roeck, Albert; Di Guida, Salvatore; Dobson, Marc; Dupont-Sagorin, Niels; Elliott-Peisert, Anna; Frisch, Benjamin; Funk, Wolfgang; Georgiou, Georgios; Giffels, Manuel; Gigi, Dominique; Gill, Karl; Giordano, Domenico; Giunta, Marina; Glege, Frank; Gomez-Reino Garrido, Robert; Govoni, Pietro; Gowdy, Stephen; Guida, Roberto; Hansen, Magnus; Harris, Philip; Hartl, Christian; Harvey, John; Hegner, Benedikt; Hinzmann, Andreas; Innocente, Vincenzo; Janot, Patrick; Kaadze, Ketino; Karavakis, Edward; Kousouris, Konstantinos; Lecoq, Paul; Lee, Yen-Jie; Lenzi, Piergiulio; Lourenco, Carlos; Magini, Nicolo; Maki, Tuula; Malberti, Martina; Malgeri, Luca; Mannelli, Marcello; Masetti, Lorenzo; Meijers, Frans; Mersi, Stefano; Meschi, Emilio; Moser, Roland; Mozer, Matthias Ulrich; Mulders, Martijn; Musella, Pasquale; Nesvold, Erik; Orimoto, Toyoko; Orsini, Luciano; Palencia Cortezon, Enrique; Perez, Emmanuelle; Perrozzi, Luca; Petrilli, Achille; Pfeiffer, Andreas; Pierini, Maurizio; Pimiä, Martti; Piparo, Danilo; Polese, Giovanni; Quertenmont, Loic; Racz, Attila; Reece, William; Rodrigues Antunes, Joao; Rolandi, Gigi; Rovelli, Chiara; Rovere, Marco; Sakulin, Hannes; Santanastasio, Francesco; Schäfer, Christoph; Schwick, Christoph; Segoni, Ilaria; Sekmen, Sezen; Sharma, Archana; Siegrist, Patrice; Silva, Pedro; Simon, Michal; Sphicas, Paraskevas; Spiga, Daniele; Tsirou, Andromachi; Veres, Gabor Istvan; Vlimant, Jean-Roch; Wöhri, Hermine Katharina; Worm, Steven; Zeuner, Wolfram Dietrich; Bertl, Willi; Deiters, Konrad; Erdmann, Wolfram; Gabathuler, Kurt; Horisberger, Roland; Ingram, Quentin; Kaestli, Hans-Christian; König, Stefan; Kotlinski, Danek; Langenegger, Urs; Meier, Frank; Renker, Dieter; Rohe, Tilman; Sibille, Jennifer; Bäni, Lukas; Bortignon, Pierluigi; Buchmann, Marco-Andrea; Casal, Bruno; Chanon, Nicolas; Deisher, Amanda; Dissertori, Günther; Dittmar, Michael; Donegà, Mauro; Dünser, Marc; Eugster, Jürg; Freudenreich, Klaus; Grab, Christoph; Hits, Dmitry; Lecomte, Pierre; Lustermann, Werner; Marini, Andrea Carlo; Martinez Ruiz del Arbol, Pablo; Mohr, Niklas; Moortgat, Filip; Nägeli, Christoph; Nef, Pascal; Nessi-Tedaldi, Francesca; Pandolfi, Francesco; Pape, Luc; Pauss, Felicitas; Peruzzi, Marco; Ronga, Frederic Jean; Rossini, Marco; Sala, Leonardo; Sanchez, Ann - Karin; Starodumov, Andrei; Stieger, Benjamin; Takahashi, Maiko; Tauscher, Ludwig; Thea, Alessandro; Theofilatos, Konstantinos; Treille, Daniel; Urscheler, Christina; Wallny, Rainer; Weber, Hannsjoerg Artur; Wehrli, Lukas; Amsler, Claude; Chiochia, Vincenzo; De Visscher, Simon; Favaro, Carlotta; Ivova Rikova, Mirena; Millan Mejias, Barbara; Otiougova, Polina; Robmann, Peter; Snoek, Hella; Tupputi, Salvatore; Verzetti, Mauro; Chang, Yuan-Hann; Chen, Kuan-Hsin; Kuo, Chia-Ming; Li, Syue-Wei; Lin, Willis; Liu, Zong-Kai; Lu, Yun-Ju; Mekterovic, Darko; Singh, Anil; Volpe, Roberta; Yu, Shin-Shan; Bartalini, Paolo; Chang, Paoti; Chang, You-Hao; Chang, Yu-Wei; Chao, Yuan; Chen, Kai-Feng; Dietz, Charles; Grundler, Ulysses; Hou, George Wei-Shu; Hsiung, Yee; Kao, Kai-Yi; Lei, Yeong-Jyi; Lu, Rong-Shyang; Majumder, Devdatta; Petrakou, Eleni; Shi, Xin; Shiu, Jing-Ge; Tzeng, Yeng-Ming; Wan, Xia; Wang, Minzu; Adiguzel, Aytul; Bakirci, Mustafa Numan; Cerci, Salim; Dozen, Candan; Dumanoglu, Isa; Eskut, Eda; Girgis, Semiray; Gokbulut, Gul; Gurpinar, Emine; Hos, Ilknur; Kangal, Evrim Ersin; Karaman, Turker; Karapinar, Guler; Kayis Topaksu, Aysel; Onengut, Gulsen; Ozdemir, Kadri; Ozturk, Sertac; Polatoz, Ayse; Sogut, Kenan; Sunar Cerci, Deniz; Tali, Bayram; Topakli, Huseyin; Vergili, Latife Nukhet; Vergili, Mehmet; Akin, Ilina Vasileva; Aliev, Takhmasib; Bilin, Bugra; Bilmis, Selcuk; Deniz, Muhammed; Gamsizkan, Halil; Guler, Ali Murat; Ocalan, Kadir; Ozpineci, Altug; Serin, Meltem; Sever, Ramazan; Surat, Ugur Emrah; Yalvac, Metin; Yildirim, Eda; Zeyrek, Mehmet; Gülmez, Erhan; Isildak, Bora; Kaya, Mithat; Kaya, Ozlem; Ozkorucuklu, Suat; Sonmez, Nasuf; Cankocak, Kerem; Levchuk, Leonid; Bostock, Francis; Brooke, James John; Clement, Emyr; Cussans, David; Flacher, Henning; Frazier, Robert; Goldstein, Joel; Grimes, Mark; Heath, Greg P; Heath, Helen F; Kreczko, Lukasz; Metson, Simon; Newbold, Dave M; Nirunpong, Kachanon; Poll, Anthony; Senkin, Sergey; Smith, Vincent J; Williams, Thomas; Basso, Lorenzo; Bell, Ken W; Belyaev, Alexander; Brew, Christopher; Brown, Robert M; Cockerill, David JA; Coughlan, John A; Harder, Kristian; Harper, Sam; Jackson, James; Kennedy, Bruce W; Olaiya, Emmanuel; Petyt, David; Radburn-Smith, Benjamin Charles; Shepherd-Themistocleous, Claire; Tomalin, Ian R; Womersley, William John; Bainbridge, Robert; Ball, Gordon; Beuselinck, Raymond; Buchmuller, Oliver; Colling, David; Cripps, Nicholas; Cutajar, Michael; Dauncey, Paul; Davies, Gavin; Della Negra, Michel; Ferguson, William; Fulcher, Jonathan; Futyan, David; Gilbert, Andrew; Guneratne Bryer, Arlo; Hall, Geoffrey; Hatherell, Zoe; Hays, Jonathan; Iles, Gregory; Jarvis, Martyn; Karapostoli, Georgia; Lyons, Louis; Magnan, Anne-Marie; Marrouche, Jad; Mathias, Bryn; Nandi, Robin; Nash, Jordan; Nikitenko, Alexander; Papageorgiou, Anastasios; Pela, Joao; Pesaresi, Mark; Petridis, Konstantinos; Pioppi, Michele; Raymond, David Mark; Rogerson, Samuel; Rose, Andrew; Ryan, Matthew John; Seez, Christopher; Sharp, Peter; Sparrow, Alex; Stoye, Markus; Tapper, Alexander; Vazquez Acosta, Monica; Virdee, Tejinder; Wakefield, Stuart; Wardle, Nicholas; Whyntie, Tom; Chadwick, Matthew; Cole, Joanne; Hobson, Peter R; Khan, Akram; Kyberd, Paul; Leggat, Duncan; Leslie, Dawn; Martin, William; Reid, Ivan; Symonds, Philip; Teodorescu, Liliana; Turner, Mark; Hatakeyama, Kenichi; Liu, Hongxuan; Scarborough, Tara; Charaf, Otman; Henderson, Conor; Rumerio, Paolo; Avetisyan, Aram; Bose, Tulika; Fantasia, Cory; Heister, Arno; St John, Jason; Lawson, Philip; Lazic, Dragoslav; Rohlf, James; Sperka, David; Sulak, Lawrence; Alimena, Juliette; Bhattacharya, Saptaparna; Cutts, David; Ferapontov, Alexey; Heintz, Ulrich; Jabeen, Shabnam; Kukartsev, Gennadiy; Laird, Edward; Landsberg, Greg; Luk, Michael; Narain, Meenakshi; Nguyen, Duong; Segala, Michael; Sinthuprasith, Tutanon; Speer, Thomas; Tsang, Ka Vang; Breedon, Richard; Breto, Guillermo; Calderon De La Barca Sanchez, Manuel; Chauhan, Sushil; Chertok, Maxwell; Conway, John; Conway, Rylan; Cox, Peter Timothy; Dolen, James; Erbacher, Robin; Gardner, Michael; Houtz, Rachel; Ko, Winston; Kopecky, Alexandra; Lander, Richard; Miceli, Tia; Pellett, Dave; Ricci-Tam, Francesca; Rutherford, Britney; Searle, Matthew; Smith, John; Squires, Michael; Tripathi, Mani; Vasquez Sierra, Ricardo; Andreev, Valeri; Cline, David; Cousins, Robert; Duris, Joseph; Erhan, Samim; Everaerts, Pieter; Farrell, Chris; Hauser, Jay; Ignatenko, Mikhail; Jarvis, Chad; Plager, Charles; Rakness, Gregory; Schlein, Peter; Traczyk, Piotr; Valuev, Vyacheslav; Weber, Matthias; Babb, John; Clare, Robert; Dinardo, Mauro Emanuele; Ellison, John Anthony; Gary, J William; Giordano, Ferdinando; Hanson, Gail; Jeng, Geng-Yuan; Liu, Hongliang; Long, Owen Rosser; Luthra, Arun; Nguyen, Harold; Paramesvaran, Sudarshan; Sturdy, Jared; Sumowidagdo, Suharyo; Wilken, Rachel; Wimpenny, Stephen; Andrews, Warren; Branson, James G; Cerati, Giuseppe Benedetto; Cittolin, Sergio; Evans, David; Golf, Frank; Holzner, André; Kelley, Ryan; Lebourgeois, Matthew; Letts, James; Macneill, Ian; Mangano, Boris; Padhi, Sanjay; Palmer, Christopher; Petrucciani, Giovanni; Pieri, Marco; Sani, Matteo; Sharma, Vivek; Simon, Sean; Sudano, Elizabeth; Tadel, Matevz; Tu, Yanjun; Vartak, Adish; Wasserbaech, Steven; Würthwein, Frank; Yagil, Avraham; Yoo, Jaehyeok; Barge, Derek; Bellan, Riccardo; Campagnari, Claudio; D'Alfonso, Mariarosaria; Danielson, Thomas; Flowers, Kristen; Geffert, Paul; Incandela, Joe; Justus, Christopher; Kalavase, Puneeth; Koay, Sue Ann; Kovalskyi, Dmytro; Krutelyov, Vyacheslav; Lowette, Steven; Mccoll, Nickolas; Pavlunin, Viktor; Rebassoo, Finn; Ribnik, Jacob; Richman, Jeffrey; Rossin, Roberto; Stuart, David; To, Wing; West, Christopher; Apresyan, Artur; Bornheim, Adolf; Chen, Yi; Di Marco, Emanuele; Duarte, Javier; Gataullin, Marat; Ma, Yousi; Mott, Alexander; Newman, Harvey B; Rogan, Christopher; Spiropulu, Maria; Timciuc, Vladlen; Veverka, Jan; Wilkinson, Richard; Xie, Si; Yang, Yong; Zhu, Ren-Yuan; Akgun, Bora; Azzolini, Virginia; Calamba, Aristotle; Carroll, Ryan; Ferguson, Thomas; Iiyama, Yutaro; Jang, Dong Wook; Liu, Yueh-Feng; Paulini, Manfred; Vogel, Helmut; Vorobiev, Igor; Cumalat, John Perry; Drell, Brian Robert; Edelmaier, Christopher; Ford, William T; Gaz, Alessandro; Heyburn, Bernadette; Luiggi Lopez, Eduardo; Smith, James; Stenson, Kevin; Ulmer, Keith; Wagner, Stephen Robert; Alexander, James; Chatterjee, Avishek; Eggert, Nicholas; Gibbons, Lawrence Kent; Heltsley, Brian; Khukhunaishvili, Aleko; Kreis, Benjamin; Mirman, Nathan; Nicolas Kaufman, Gala; Patterson, Juliet Ritchie; Ryd, Anders; Salvati, Emmanuele; Sun, Werner; Teo, Wee Don; Thom, Julia; Thompson, Joshua; Tucker, Jordan; Vaughan, Jennifer; Weng, Yao; Winstrom, Lucas; Wittich, Peter; Winn, Dave; Abdullin, Salavat; Albrow, Michael; Anderson, Jacob; Bauerdick, Lothar AT; Beretvas, Andrew; Berryhill, Jeffrey; Bhat, Pushpalatha C; Bloch, Ingo; Burkett, Kevin; Butler, Joel Nathan; Chetluru, Vasundhara; Cheung, Harry; Chlebana, Frank; Elvira, Victor Daniel; Fisk, Ian; Freeman, Jim; Gao, Yanyan; Green, Dan; Gutsche, Oliver; Hanlon, Jim; Harris, Robert M; Hirschauer, James; Hooberman, Benjamin; Jindariani, Sergo; Johnson, Marvin; Joshi, Umesh; Kilminster, Benjamin; Klima, Boaz; Kunori, Shuichi; Kwan, Simon; Leonidopoulos, Christos; Linacre, Jacob; Lincoln, Don; Lipton, Ron; Lykken, Joseph; Maeshima, Kaori; Marraffino, John Michael; Maruyama, Sho; Mason, David; McBride, Patricia; Mishra, Kalanand; Mrenna, Stephen; Musienko, Yuri; Newman-Holmes, Catherine; O'Dell, Vivian; Prokofyev, Oleg; Sexton-Kennedy, Elizabeth; Sharma, Seema; Spalding, William J; Spiegel, Leonard; Tan, Ping; Taylor, Lucas; Tkaczyk, Slawek; Tran, Nhan Viet; Uplegger, Lorenzo; Vaandering, Eric Wayne; Vidal, Richard; Whitmore, Juliana; Wu, Weimin; Yang, Fan; Yumiceva, Francisco; Yun, Jae Chul; Acosta, Darin; Avery, Paul; Bourilkov, Dimitri; Chen, Mingshui; Cheng, Tongguang; Das, Souvik; De Gruttola, Michele; Di Giovanni, Gian Piero; Dobur, Didar; Drozdetskiy, Alexey; Field, Richard D; Fisher, Matthew; Fu, Yu; Furic, Ivan-Kresimir; Gartner, Joseph; Hugon, Justin; Kim, Bockjoo; Konigsberg, Jacobo; Korytov, Andrey; Kropivnitskaya, Anna; Kypreos, Theodore; Low, Jia Fu; Matchev, Konstantin; Milenovic, Predrag; Mitselmakher, Guenakh; Muniz, Lana; Remington, Ronald; Rinkevicius, Aurelijus; Sellers, Paul; Skhirtladze, Nikoloz; Snowball, Matthew; Yelton, John; Zakaria, Mohammed; Gaultney, Vanessa; Hewamanage, Samantha; Lebolo, Luis Miguel; Linn, Stephan; Markowitz, Pete; Martinez, German; Rodriguez, Jorge Luis; Adams, Todd; Askew, Andrew; Bochenek, Joseph; Chen, Jie; Diamond, Brendan; Gleyzer, Sergei V; Haas, Jeff; Hagopian, Sharon; Hagopian, Vasken; Jenkins, Merrill; Johnson, Kurtis F; Prosper, Harrison; Veeraraghavan, Venkatesh; Weinberg, Marc; Baarmand, Marc M; Dorney, Brian; Hohlmann, Marcus; Kalakhety, Himali; Vodopiyanov, Igor; Adams, Mark Raymond; Anghel, Ioana Maria; Apanasevich, Leonard; Bai, Yuting; Bazterra, Victor Eduardo; Betts, Russell Richard; Bucinskaite, Inga; Callner, Jeremy; Cavanaugh, Richard; Evdokimov, Olga; Gauthier, Lucie; Gerber, Cecilia Elena; Hofman, David Jonathan; Khalatyan, Samvel; Lacroix, Florent; Malek, Magdalena; O'Brien, Christine; Silkworth, Christopher; Strom, Derek; Turner, Paul; Varelas, Nikos; Akgun, Ugur; Albayrak, Elif Asli; Bilki, Burak; Clarida, Warren; Duru, Firdevs; Griffiths, Scott; Merlo, Jean-Pierre; Mermerkaya, Hamit; Mestvirishvili, Alexi; Moeller, Anthony; Nachtman, Jane; Newsom, Charles Ray; Norbeck, Edwin; Onel, Yasar; Ozok, Ferhat; Sen, Sercan; Tiras, Emrah; Wetzel, James; Yetkin, Taylan; Yi, Kai; Barnett, Bruce Arnold; Blumenfeld, Barry; Bolognesi, Sara; Fehling, David; Giurgiu, Gavril; Gritsan, Andrei; Guo, Zijin; Hu, Guofan; Maksimovic, Petar; Rappoccio, Salvatore; Swartz, Morris; Whitbeck, Andrew; Baringer, Philip; Bean, Alice; Benelli, Gabriele; Grachov, Oleg; Kenny Iii, Raymond Patrick; Murray, Michael; Noonan, Daniel; Sanders, Stephen; Stringer, Robert; Tinti, Gemma; Wood, Jeffrey Scott; Zhukova, Victoria; Barfuss, Anne-Fleur; Bolton, Tim; Chakaberia, Irakli; Ivanov, Andrew; Khalil, Sadia; Makouski, Mikhail; Maravin, Yurii; Shrestha, Shruti; Svintradze, Irakli; Gronberg, Jeffrey; Lange, David; Wright, Douglas; Baden, Drew; Boutemeur, Madjid; Calvert, Brian; Eno, Sarah Catherine; Gomez, Jaime; Hadley, Nicholas John; Kellogg, Richard G; Kirn, Malina; Kolberg, Ted; Lu, Ying; Marionneau, Matthieu; Mignerey, Alice; Pedro, Kevin; Peterman, Alison; Skuja, Andris; Temple, Jeffrey; Tonjes, Marguerite; Tonwar, Suresh C; Twedt, Elizabeth; Apyan, Aram; Bauer, Gerry; Bendavid, Joshua; Busza, Wit; Butz, Erik; Cali, Ivan Amos; Chan, Matthew; Dutta, Valentina; Gomez Ceballos, Guillelmo; Goncharov, Maxim; Hahn, Kristan Allan; Kim, Yongsun; Klute, Markus; Krajczar, Krisztian; Li, Wei; Luckey, Paul David; Ma, Teng; Nahn, Steve; Paus, Christoph; Ralph, Duncan; Roland, Christof; Roland, Gunther; Rudolph, Matthew; Stephans, George; Stöckli, Fabian; Sumorok, Konstanty; Sung, Kevin; Velicanu, Dragos; Wenger, Edward Allen; Wolf, Roger; Wyslouch, Bolek; Yang, Mingming; Yilmaz, Yetkin; Yoon, Sungho; Zanetti, Marco; Cooper, Seth; Dahmes, Bryan; De Benedetti, Abraham; Franzoni, Giovanni; Gude, Alexander; Kao, Shih-Chuan; Klapoetke, Kevin; Kubota, Yuichi; Mans, Jeremy; Pastika, Nathaniel; Rusack, Roger; Sasseville, Michael; Singovsky, Alexander; Tambe, Norbert; Turkewitz, Jared; Cremaldi, Lucien Marcus; Kroeger, Rob; Perera, Lalith; Rahmat, Rahmat; Sanders, David A; Avdeeva, Ekaterina; Bloom, Kenneth; Bose, Suvadeep; Butt, Jamila; Claes, Daniel R; Dominguez, Aaron; Eads, Michael; Keller, Jason; Kravchenko, Ilya; Lazo-Flores, Jose; Malbouisson, Helena; Malik, Sudhir; Snow, Gregory R; Baur, Ulrich; Godshalk, Andrew; Iashvili, Ia; Jain, Supriya; Kharchilava, Avto; Kumar, Ashish; Shipkowski, Simon Peter; Smith, Kenneth; Alverson, George; Barberis, Emanuela; Baumgartel, Darin; Chasco, Matthew; Haley, Joseph; Nash, David; Trocino, Daniele; Wood, Darien; Zhang, Jinzhong; Anastassov, Anton; Kubik, Andrew; Mucia, Nicholas; Odell, Nathaniel; Ofierzynski, Radoslaw Adrian; Pollack, Brian; Pozdnyakov, Andrey; Schmitt, Michael; Stoynev, Stoyan; Velasco, Mayda; Won, Steven; Antonelli, Louis; Berry, Douglas; Brinkerhoff, Andrew; Hildreth, Michael; Jessop, Colin; Karmgard, Daniel John; Kolb, Jeff; Lannon, Kevin; Luo, Wuming; Lynch, Sean; Marinelli, Nancy; Morse, David Michael; Pearson, Tessa; Planer, Michael; Ruchti, Randy; Slaunwhite, Jason; Valls, Nil; Wayne, Mitchell; Wolf, Matthias; Bylsma, Ben; Durkin, Lloyd Stanley; Hill, Christopher; Hughes, Richard; Kotov, Khristian; Ling, Ta-Yung; Puigh, Darren; Rodenburg, Marissa; Vuosalo, Carl; Williams, Grayson; Winer, Brian L; Adam, Nadia; Berry, Edmund; Elmer, Peter; Gerbaudo, Davide; Halyo, Valerie; Hebda, Philip; Hegeman, Jeroen; Hunt, Adam; Jindal, Pratima; Lopes Pegna, David; Lujan, Paul; Marlow, Daniel; Medvedeva, Tatiana; Mooney, Michael; Olsen, James; Piroué, Pierre; Quan, Xiaohang; Raval, Amita; Safdi, Ben; Saka, Halil; Stickland, David; Tully, Christopher; Werner, Jeremy Scott; Zuranski, Andrzej; Acosta, Jhon Gabriel; Brownson, Eric; Huang, Xing Tao; Lopez, Angel; Mendez, Hector; Oliveros, Sandra; Ramirez Vargas, Juan Eduardo; Zatserklyaniy, Andriy; Alagoz, Enver; Barnes, Virgil E; Benedetti, Daniele; Bolla, Gino; Bortoletto, Daniela; De Mattia, Marco; Everett, Adam; Hu, Zhen; Jones, Matthew; Koybasi, Ozhan; Kress, Matthew; Laasanen, Alvin T; Leonardo, Nuno; Maroussov, Vassili; Merkel, Petra; Miller, David Harry; Neumeister, Norbert; Shipsey, Ian; Silvers, David; Svyatkovskiy, Alexey; Vidal Marono, Miguel; Yoo, Hwi Dong; Zablocki, Jakub; Zheng, Yu; Guragain, Samir; Parashar, Neeti; Adair, Antony; Boulahouache, Chaouki; Ecklund, Karl Matthew; Geurts, Frank JM; Padley, Brian Paul; Redjimi, Radia; Roberts, Jay; Zabel, James; Betchart, Burton; Bodek, Arie; Chung, Yeon Sei; Covarelli, Roberto; de Barbaro, Pawel; Demina, Regina; Eshaq, Yossof; Ferbel, Thomas; Garcia-Bellido, Aran; Goldenzweig, Pablo; Han, Jiyeon; Harel, Amnon; Miner, Daniel Carl; Vishnevskiy, Dmitry; Zielinski, Marek; Bhatti, Anwar; Ciesielski, Robert; Demortier, Luc; Goulianos, Konstantin; Lungu, Gheorghe; Malik, Sarah; Mesropian, Christina; Arora, Sanjay; Barker, Anthony; Chou, John Paul; Contreras-Campana, Christian; Contreras-Campana, Emmanuel; Duggan, Daniel; Ferencek, Dinko; Gershtein, Yuri; Gray, Richard; Halkiadakis, Eva; Hidas, Dean; Lath, Amitabh; Panwalkar, Shruti; Park, Michael; Patel, Rishi; Rekovic, Vladimir; Robles, Jorge; Rose, Keith; Salur, Sevil; Schnetzer, Steve; Seitz, Claudia; Somalwar, Sunil; Stone, Robert; Thomas, Scott; Cerizza, Giordano; Hollingsworth, Matthew; Spanier, Stefan; Yang, Zong-Chang; York, Andrew; Eusebi, Ricardo; Flanagan, Will; Gilmore, Jason; Kamon, Teruki; Khotilovich, Vadim; Montalvo, Roy; Osipenkov, Ilya; Pakhotin, Yuriy; Perloff, Alexx; Roe, Jeffrey; Safonov, Alexei; Sakuma, Tai; Sengupta, Sinjini; Suarez, Indara; Tatarinov, Aysen; Toback, David; Akchurin, Nural; Damgov, Jordan; Dragoiu, Cosmin; Dudero, Phillip Russell; Jeong, Chiyoung; Kovitanggoon, Kittikul; Lee, Sung Won; Libeiro, Terence; Roh, Youn; Volobouev, Igor; Appelt, Eric; Delannoy, Andrés G; Florez, Carlos; Greene, Senta; Gurrola, Alfredo; Johns, Willard; Johnston, Cody; Kurt, Pelin; Maguire, Charles; Melo, Andrew; Sharma, Monika; Sheldon, Paul; Snook, Benjamin; Tuo, Shengquan; Velkovska, Julia; Arenton, Michael Wayne; Balazs, Michael; Boutle, Sarah; Cox, Bradley; Francis, Brian; Goodell, Joseph; Hirosky, Robert; Ledovskoy, Alexander; Lin, Chuanzhe; Neu, Christopher; Wood, John; Yohay, Rachel; Gollapinni, Sowjanya; Harr, Robert; Karchin, Paul Edmund; Kottachchi Kankanamge Don, Chamath; Lamichhane, Pramod; Sakharov, Alexandre; Anderson, Michael; Belknap, Donald; Borrello, Laura; Carlsmith, Duncan; Cepeda, Maria; Dasu, Sridhara; Friis, Evan; Gray, Lindsey; Grogg, Kira Suzanne; Grothe, Monika; Hall-Wilton, Richard; Herndon, Matthew; Hervé, Alain; Klabbers, Pamela; Klukas, Jeffrey; Lanaro, Armando; Lazaridis, Christos; Leonard, Jessica; Loveless, Richard; Mohapatra, Ajit; Ojalvo, Isabel; Palmonari, Francesco; Pierro, Giuseppe Antonio; Ross, Ian; Savin, Alexander; Smith, Wesley H; Swanson, Joshua

    2012-01-01

    A measurement is presented of the relative prompt production rate of $\\chi_{c2}$ and $\\chi_{c1}$ with 4.6 inverse femtobarns of data collected by the CMS experiment at the LHC in pp collisions at $\\sqrt{s}$ = 7 TeV. The two states are measured via their radiative decays $\\chi_{c} \\to J/\\psi + \\gamma$, with the photon converting into a dielectron pair for J/$\\psi$ rapidity abs(y(J/$\\psi$)) 0.5 GeV. The measurement is given for six intervals of pt(J/$\\psi$) between 7 and 25 GeV. The results are compared to theoretical predictions.

  2. Characterization of new cell line stably expressing CHI3L1 oncogene

    Directory of Open Access Journals (Sweden)

    Chekhonin V. P.

    2011-06-01

    Full Text Available Aim. To characterize the immortalized 293 cell line after stable transfection with human oncogene (CHI3L1. Methods. 293 cells, stably transfected with pcDNA3.1_CHI3L1, and 293 cells, stably transfected with pcDNA3.1 as a negative control, were used throughout all experiments. The clones of CHI3L1-expressing 293 cells and 293 cells, transfected with pcDNA3.1, were analyzed by immunofluorescence and confocal microscopy. Cell proliferation was measured using MTT assay; analyses of ERK1/2 and AKT activation and their cellular localization were performed with anti-phospho-ERK and anti-phospho-AKT antibodies. Specific activation of MAP and PI3 kinases was measured by densitometric analysis of Western-blot signals. Results. The obtained results show quite modest ability of CHI3L1 to stimulate cell growth and reflect rather an improved cellular plating efficiency of the 293 cells stably transfected with pcDNA3.1_CHI3L1 as compared to the 293 cells transfected with an «empty» vector. ERK1/2 and AKT are activated in the 293_CHI3L1 cells. In these cells phosphorylated ERK1/2 were localized in both cell cytoplasm and nuclei while AKT only in cytoplasm. The 293_CHI3L1 cells differed from the 293 cells, transfected with an «empty» vector, in their size and ability to adhere to the culture plates. Conclusions. The overexpression of CHI3L1 is likely to have an important role in tumorigenesis via a mechanism which involves activation of PI3K and ERK1/2 pathways. The tumors which can be induced by orthotopic implantation of the transformed human cells with overexpressed human oncogene CHI3L1 into the rat brain can be used as a target for anticancer drug development.

  3. Two Kinds of Square-Conservative Integrators for Nonlinear Evolution Equations

    Institute of Scientific and Technical Information of China (English)

    CHEN Jing-Bo; LIU Hong

    2008-01-01

    @@ Based on the Lie-group and Gauss-Legendre methods, two kinds of square-conservative integrators for squareconservative nonlinear evolution equations are presented. Lie-group based square-conservative integrators are linearly implicit, while Gauss-Legendre based square-conservative integrators are nonlinearly implicit and iterarive schemes are needed to solve the corresponding integrators. These two kinds of integrators provide natural candidates for simulating square-conservative nonlinear evolution equations in the sense that these integrators not only preserve the square-conservative properties of the continuous equations but also are nonlinearly stable.Numerical experiments are performed to test the presented integrators.

  4. A {chi}{sup 2} veto for continuous gravitational wave searches

    Energy Technology Data Exchange (ETDEWEB)

    Sancho de la Jordana, Llucia; Sintes, Alicia M [Departament de Fisica, Universitat de les Illes Balears, Cra. Valldemossa Km. 7.5, E-07122 Palma de Mallorca (Spain)], E-mail: llucia.sancho@uib.es, E-mail: sintes@aei.mpg.de

    2008-09-21

    {chi}{sup 2} vetoes are commonly used in searching for gravitational waves, in particular for broadband signals, but they can also be applied to narrowband continuous wave signals, such as those expected from rapidly rotating neutron stars. In this paper, we present a {chi}{sup 2} veto adapted to the Hough transform searches for continuous gravitational wave signals; we characterize the {chi}{sup 2} significance plane for different frequency bands and discuss the expected performance of this veto in LIGO analysis.

  5. The Diophantine Equation x[squared]+ky[squared]=z[squared] and Integral Triangles with a Cosine Value of 1 over n

    Science.gov (United States)

    Zelator, Konstantine

    2006-01-01

    We sometimes teach our students a method of finding all integral triples that satisfy the Pythagorean Theorem x[squared]+y[squared]=z[squared]. These are called Pythagorean triples. In this paper, we show how to solve the equation x[squared]+ky[squared]=z[squared], where again, all variables are integers.

  6. Investigating bias in squared regression structure coefficients

    OpenAIRE

    Nimon, Kim F.; Zientek, Linda R.; Thompson, Bruce

    2015-01-01

    The importance of structure coefficients and analogs of regression weights for analysis within the general linear model (GLM) has been well-documented. The purpose of this study was to investigate bias in squared structure coefficients in the context of multiple regression and to determine if a formula that had been shown to correct for bias in squared Pearson correlation coefficients and coefficients of determination could be used to correct for bias in squared regression structure coefficie...

  7. The Square Light Clock and Special Relativity

    Science.gov (United States)

    Galli, J. Ronald; Amiri, Farhang

    2012-01-01

    A thought experiment that includes a square light clock is similar to the traditional vertical light beam and mirror clock, except it is made up of four mirrors placed at a 45[degree] angle at each corner of a square of length L[subscript 0], shown in Fig. 1. Here we have shown the events as measured in the rest frame of the square light clock. By…

  8. Broadband Corrugated Square-Shaped Monopole Antenna

    OpenAIRE

    S. D. Ahirwar; C. Sairam

    2011-01-01

    Design and development of a corrugated square-shaped monopole antenna is presented with measured results. The operational bandwidth of the antenna is 300 MHz–3000 MHz. The antenna is derived from a square-shaped planar monopole antenna. This basic square-shaped radiating element is corrugated in its lateral dimension. This corrugation reduces the lateral dimension of the antenna by 60%. Electrical performance of this antenna is better than its parent counterpart. This paper presents design an...

  9. Uniqueness of Minima of a Certain Least Squares Problem

    OpenAIRE

    Nohra, Jad

    2016-01-01

    This paper is essentially an exercise in studying the minima of a certain least squares optimization using the second partial derivative test. The motivation is to gain insight into an optimization-based solution to the problem of tracking human limbs using IMU sensors.

  10. Mapping Ground Subsidence Phenomena in Ho Chi Minh City through the Radar Interferometry Technique Using ALOS PALSAR Data

    Directory of Open Access Journals (Sweden)

    Dinh Ho Tong Minh

    2015-07-01

    Full Text Available The rapidly developing urbanization since the last decade of the 20th century has led to extensive groundwater extraction, resulting in subsidence in Ho Chi Minh City, Vietnam. Recent advances in multi-temporal spaceborne SAR interferometry, especially with a persistent scatters interferometry (PSI approach, has made this a robust remote sensing technique for measuring large-scale ground subsidence with millimetric accuracy. This work has presented an advanced PSI analysis, to provide an unprecedented spatial extent and continuous temporal coverage of the subsidence in Ho Chi Minh City from 2006 to 2010. The study shows that subsidence is most severe in the Holocene silt loam areas along the Sai Gon River and in the southwest of the city. The groundwater extraction resulting from urbanization and urban growth is mainly responsible for the subsidence. Subsidence in turn leads to more flooding and water nuisance. The correlation between the reference leveling velocity and the estimated PSI result is R2 = 0.88, and the root mean square error is 4.3 (mm/year, confirming their good agreement. From 2006 to 2010, the estimation of the average subsidence rate is -8.0 mm/year, with the maximum value up to -70 mm/year. After four years, in regions along Sai Gon River and in the southwest of the city, the land has sunk up to -12 cm. If not addressed, subsidence leads to the increase of inundation, both in frequency and spatial extent. Finally, regarding climate change, the effects of subsidence should be considered as appreciably greater than those resulting from rising sea level. It is essential to consider these two factors, because the city is inhabited by more than 7.5 million people, where subsidence directly impacts urban structures and infrastructure.

  11. From least squares to multilevel modeling: A graphical introduction to Bayesian inference

    Science.gov (United States)

    Loredo, Thomas J.

    2016-01-01

    This tutorial presentation will introduce some of the key ideas and techniques involved in applying Bayesian methods to problems in astrostatistics. The focus will be on the big picture: understanding the foundations (interpreting probability, Bayes's theorem, the law of total probability and marginalization), making connections to traditional methods (propagation of errors, least squares, chi-squared, maximum likelihood, Monte Carlo simulation), and highlighting problems where a Bayesian approach can be particularly powerful (Poisson processes, density estimation and curve fitting with measurement error). The "graphical" component of the title reflects an emphasis on pictorial representations of some of the math, but also on the use of graphical models (multilevel or hierarchical models) for analyzing complex data. Code for some examples from the talk will be available to participants, in Python and in the Stan probabilistic programming language.

  12. Power Efficient Division and Square Root Unit

    DEFF Research Database (Denmark)

    Liu, Wei; Nannarelli, Alberto

    2012-01-01

    Although division and square root are not frequent operations, most processors implement them in hardware to not compromise the overall performance. Two classes of algorithms implement division or square root: digit-recurrence and multiplicative (e.g., Newton-Raphson) algorithms. Previous work...... shows that division and square root units based on the digit-recurrence algorithm offer the best tradeoff delay-area-power. Moreover, the two operations can be combined in a single unit. Here, we present a radix-16 combined division and square root unit obtained by overlapping two radix-4 stages. The...

  13. Fluid Flow Through Triangular and Square Cylinders

    OpenAIRE

    Salam, Nasaruddin

    2014-01-01

    Characteristicsof fluid flowing through triangular and square cylindershas been analyzed experimentally andnumerically by CFDat Reynolds number based on square cylinders diameter,Re = 14.730;26.040 and 37.192. Ratio of the distance between cylinders to square cylinders diameter (L/D) was variedas0.0;1.0; 2.0; 3.0; 4.0; and 5.0 while ratio of the triangular cylinders diameter to square cylinders diameter (d/D) was constant at 0.5. The results showed that the vortex is damped...

  14. Sparse least-squares reverse time migration using seislets

    KAUST Repository

    Dutta, Gaurav

    2015-08-19

    We propose sparse least-squares reverse time migration (LSRTM) using seislets as a basis for the reflectivity distribution. This basis is used along with a dip-constrained preconditioner that emphasizes image updates only along prominent dips during the iterations. These dips can be estimated from the standard migration image or from the gradient using plane-wave destruction filters or structural tensors. Numerical tests on synthetic datasets demonstrate the benefits of this method for mitigation of aliasing artifacts and crosstalk noise in multisource least-squares migration.

  15. Tai Chi and Qi Gong for Health and Well-Being

    Medline Plus

    Full Text Available ... that features tai chi A practice in traditional Chinese medicine that uses a series of slow, gentle ... stress. and qi gong A component of traditional Chinese medicine that combines movement, meditation, and controlled breathing. ...

  16. Tai Chi and Qi Gong for Health and Well-Being

    Medline Plus

    Full Text Available ... Online Continuing Education Series Distinguished Lecture Series Integrated Medicine Research Lecture Series All Training Information News & Events ... features tai chi A practice in traditional Chinese medicine that uses a series of slow, gentle movements ...

  17. Tai Chi and Qi Gong for Health and Well-Being

    Medline Plus

    Full Text Available ... Legislation Advisory Council Job Opportunities All About NCCIH Health Topics A-Z # A B C D E ... Y Z Tai Chi and Qi Gong for Health and Well-Being Share: © Mariann Seriff The following ...

  18. Tai Chi and Qi Gong for Health and Well-Being

    Medline Plus

    Full Text Available ... NCCIH Clinical Digest A monthly newsletter with evidence-based information on complementary and integrative practices and a health condition All News & Events About NCCIH NCCIH At a Glance Mission and Vision Organizational ... Tai Chi and Qi ...

  19. Tai Chi and Qi Gong for Health and Well-Being

    Medline Plus

    Full Text Available ... Advisory Council Job Opportunities All About NCCIH Health Topics A-Z # A B C D E F ... up Qi Gong Tai Chi Cool Down This page last modified February 12, 2015 Follow NCCIH: Read ...

  20. Tai Chi and Qi Gong for Health and Well-Being

    Science.gov (United States)

    ... Vision Organizational Structure Director's Message Strategic Plans & Reports Budget & Legislation Advisory Council Job Opportunities All About NCCIH ... tool that features tai chi A practice in traditional Chinese medicine that uses a series of slow, ...

  1. Tai Chi and Qi Gong for Health and Well-Being

    Medline Plus

    Full Text Available ... Vision Organizational Structure Director's Message Strategic Plans & Reports Budget & Legislation Advisory Council Job Opportunities All About NCCIH ... tool that features tai chi A practice in traditional Chinese medicine that uses a series of slow, ...

  2. chi_cJ Decays to h^+h^-h^0

    CERN Document Server

    Athar, S; Potlia, V; Yelton, J; Rubin, P; Cawlfield, C; Eisenstein, B I; Karliner, I; Kim, D; Lowrey, N; Naik, P; Sedlack, C; Selen, M; White, E J; Wiss, J; Shepherd, M R; Besson, D; Pedlar, T K; Cronin-Hennessy, D; Gao, K Y; Gong, D T; Hietala, J; Kubota, Y; Klein, T; Lang, B W; Poling, R; Scott, A W; Smith, A; Zweber, P; Dobbs, S; Metreveli, Z V; Seth, K K; Tomaradze, A G; Ernst, J; Severini, H; Dytman, S A; Love, W; Savinov, V; Aquines, O; Li, Z; López, A; Mehrabyan, S S; Méndez, H; Ramírez, J; Huang, G S; Miller, D H; Pavlunin, V; Sanghi, B; Shipsey, I P J; Xin, B; Adams, G S; Anderson, M; Cummings, J P; Danko, I; Napolitano, J; He, Q; Insler, J; Muramatsu, H; Park, C S; Thorndike, E H; Yang, F; Coan, T E; Gao, Y S; Liu, F; Artuso, M; Blusk, S; Butt, J; Li, J; Menaa, N; Mountain, R; Nisar, S; Randrianarivony, K; Redjimi, R; Sia, R; Skwarnicki, T; Stone, S; Wang, J C; Zhang, K; Csorna, S E; Bonvicini, G; Cinabro, D; Dubrovin, M; Lincoln, A; Asner, D M; Edwards, K W; Briere, R A; Brock, I; Chen, J; Ferguson, T; Tatishvili, G T; Vogel, H; Watkins, M E; Rosner, J L; Adam, N E; Alexander, J P; Berkelman, K; Cassel, D G; Duboscq, J E; Ecklund, K M; Ehrlich, R; Fields, L; Galik, R S; Gibbons, L; Gray, R; Gray, S W; Hartill, D L; Heltsley, B K; Hertz, D; Jones, C D; Kandaswamy, J; Kreinick, D L; Kuznetsov, V E; Mahlke-Krüger, H; Onyisi, P U E; Patterson, J R; Peterson, D; Pivarski, J; Riley, D; Ryd, A; Sadoff, A J; Schwarthoff, H; Shi, X; Stroiney, S; Sun, W M; Wilksen, T; Weinberger, M

    2006-01-01

    Using a sample of 3x10^6 psi(2S) decays recorded by the CLEO detector, we study three body decays of the chi_{c0}, chi_{c1}, and chi_{c2} produced in radiative decays of the psi(2S). We consider the decay modes pi+ pi- eta, K+ K- eta, p pbar eta, pi+ pi- etaprime, K+ K- pi0, p pbar pi0, pi+ K- K0S, and K+ pbar Lambda measuring branching fractions or placing upper limits. For chi_{c1} to pi+ pi- eta, K+ K- pi0, and pi+ K- K0S our observed samples are large enough to study the substructure in a Dalitz plot analysis. The results presented in this document are preliminary.

  3. chi_{cJ} Decays to h^+h^-h^0

    CERN Document Server

    Athar, S; Potlia, V; Yelton, J; Rubin, P; Cawlfield, C; Eisenstein, B I; Karliner, I; Kim, D; Lowrey, N; Naik, P; Selen, M; White, E J; Wiss, J; Mitchell, R E; Shepherd, M R; Besson, D; Pedlar, T K; Cronin-Hennessy, D; Gao, K Y; Hietala, J; Kubota, Y; Klein, T; Lang, B W; Poling, R; Scott, A W; Smith, A; Zweber, P; Dobbs, S; Metreveli, Z V; Seth, K K; Tomaradze, A G; Ernst, J; Severini, H; Love, W; Savinov, V; Aquines, O; Li, Z; López, A; Mehrabyan, S S; Méndez, H; Ramírez, J; Huang, G S; Miller, D H; Pavlunin, V; Sanghi, B; Shipsey, I P J; Xin, B; Adams, G S; Anderson, M; Cummings, J P; Danko, I; Hu, D; Moziak, B; Napolitano, J; He, Q; Insler, J; Muramatsu, H; Park, C S; Thorndike, E H; Yang, F; Coan, T E; Gao, Y S; Artuso, M; Blusk, S; Butt, J; Li, J; Menaa, N; Mountain, R; Nisar, S; Randrianarivony, K; Sia, R; Skwarnicki, T; Stone, S; Wang, J C; Zhang, K; Bonvicini, G; Cinabro, D; Dubrovin, M; Lincoln, A; Asner, D M; Edwards, K W; Briere, R A; Ferguson, T; Tatishvili, G T; Vogel, H; Watkins, M E; Rosner, J L; Adam, N E; Alexander, J P; Cassel, D G; Duboscq, J E; Ecklund, K M; Ehrlich, R; Fields, L; Gibbons, L; Gray, R; Gray, S W; Hartill, D L; Heltsley, B K; Hertz, D; Jones, C D; Kandaswamy, J; Kreinick, D L; Kuznetsov, V E; Mahlke-Krüger, H; Onyisi, P U E; Patterson, J R; Peterson, D; Pivarski, J; Riley, D; Ryd, A; Sadoff, A J; Schwarthoff, H; Shi, X; Stroiney, S; Sun, W M; Wilksen, T; Weinberger, M; al, et

    2007-01-01

    Using a sample of 3 million psi(2S) decays recorded by the CLEO detector, we study three-body decays of the chi_c0, chi_c1, and chi_c2 produced in radiative decays of the psi(2S). We consider the final states pi+ pi- eta, K+ K- eta, p p-bar eta, pi+ pi- eta-prime, K+ K- pi0, p p-bar pi0, pi+ K- K0S, and K+ p-bar Lambda, measuring branching fractions or placing upper limits. For chi_c1 decays to pi+ pi- eta, K+ K- pi0, and pi+ K- K0S our observed samples are large enough to study the substructure in a Dalitz plot analysis.

  4. Tai Chi and Qi Gong for Health and Well-Being

    Medline Plus

    Full Text Available ... tool that features tai chi A practice in traditional Chinese medicine that uses a series of slow, gentle movements coordinated with breathing and meditation. The goal is to enhance physical functioning, improve balance and ...

  5. Tai Chi and Qi Gong for Health and Well-Being

    Medline Plus

    Full Text Available ... Council Job Opportunities All About NCCIH Health Topics A-Z # A B C D E F G H I ... be an educational tool that features tai chi A practice in traditional Chinese medicine that uses a ...

  6. Tai Chi and Qi Gong for Health and Well-Being

    Medline Plus

    Full Text Available ... tool that features tai chi A practice in traditional Chinese medicine that uses a series of slow, ... reduce stress. and qi gong A component of traditional Chinese medicine that combines movement, meditation, and controlled ...

  7. On the Correct Use of Statistical Tests: Reply to "Lies, damned lies and statistics (in Geology)"

    CERN Document Server

    Sornette, D

    2010-01-01

    In a recent Forum in EOS entitled "Lies, damned lies and statistics (in Geology)", Vermeesch (2009) claims that "statistical significant is not the same as geological significant", in other words, statistical tests may be misleading. In complete contradiction, we affirm that statistical tests are always informative. We trace the erroneous claim of Vermeesch (2009) to a mistake in the interpretation of the chi-square test. Furthermore, using the same catalog of 118,415 earthquakes of magnitude 4 or greater and occurring between Friday 1st January 1999 and Thursday, 1 January 2009 (USGS, http://earthquake.usgs.gov), we show that the null hypothesis that "the occurrence of earthquakes does not depend on the day of the week" cannot be rejected (p-value equal to p=0.46), when taking into account the two well-known effects of (i) catalog incompleteness and (ii) aftershock clustering. This corrects the p-value p=4.5 10^{-18} found by P. Vermeesch (2009), whose implementation of the chi-square test assumes that the 1...

  8. Deciding the weak definability of Büchi definable tree languages

    OpenAIRE

    Colcombet, Thomas; Kuperberg, Denis; Löding, Christof; Vanden Boom, Michael

    2013-01-01

    Weakly definable languages of infinite trees are an expressive subclass of regular tree languages definable in terms of weak monadic second-order logic, or equivalently weak alternating automata. Our main result is that given a Büchi automaton, it is decidable whether the language is weakly definable. We also show that given a parity automaton, it is decidable whether the language is recognizable by a nondeterministic co-Büchi automaton. The decidability proofs build on recent results abou...

  9. A Randomized Controlled Trial of Patient-Reported Outcomes With Tai Chi Exercise in Parkinson's Disease

    OpenAIRE

    Li, Fuzhong; Harmer, Peter; Liu, Yu; Eckstrom, Elizabeth; Fitzgerald, Kathleen; Stock, Ronald; Chou, Li-Shan

    2013-01-01

    A previous randomized, controlled trial of tai chi showed improvements in objectively measured balance and other motor-related outcomes in patients with Parkinson's disease. This study evaluated whether patient-reported outcomes could be improved through exercise interventions and whether improvements were associated with clinical outcomes and exercise adherence. In a secondary analysis of the tai chi trial, patient-reported and clinical outcomes and exercise adherence measures were compared ...

  10. Ground Reaction Forces and Plantar Pressure Distribution Generated by Two Tai Chi Movements

    OpenAIRE

    Wong, Shiu Hong Trevor

    2013-01-01

    Tai Chi Chuan, Tai Chi (TC) in short, is a popular form of Chinese martial arts which have been practised by millions of people and provides various health benefits, such as improving balance control, strengthening leg muscles, reducing fear of falling, enhancing flexibility and many more. The American Geriatrics Society and the British Geriatrics Society have recommended TC as a suitable exercise for preventing falls of older people. However, it is not clear which TC components are the most ...

  11. Water-based Tai Chi: theoretical benefits in musculoskeletal diseases. Current evidence

    OpenAIRE

    Macías-Hernández, Salvador Israel; Vázquez-Torres, Lucio; Morones-Alba, Juan Daniel; Coronado-Zarco, Roberto; de los Angeles Soria-Bastida, María; Cruz-Medina, Eva; Nava-Bringas, Tania Inés

    2015-01-01

    Tai Chi is a low-impact and moderate intensity exercise that has shown positive effects in patients with musculoskeletal disorders. Recently have been developed clinical studies on the benefits of Tai Chi techniques combined with hydrotherapy. Both types of treatment include physical training of balance, mobility, strength, coordination and sensory input that could complement each other. This report aims to present the current evidence about the benefits of the combination of water based Tai ...

  12. A systematic review of the health benefits of Tai Chi for students in higher education

    OpenAIRE

    Webster, Craig S.; Luo, Anna Y.; Krägeloh, Chris; Moir, Fiona; Henning, Marcus

    2015-01-01

    Background The poor health consequences of stress are well recognized, and students in higher education may be at particular risk. Tai Chi integrates physical exercise with mindfulness techniques and seems well suited to relieve stress and related conditions. Methods We conducted a systematic review of the health benefits of Tai Chi for students in higher education reported in the English and Chinese literature, using an evidence hierarchy approach, allowing the inclusion of studies additiona...

  13. On squares of representations of compact Lie algebras

    Energy Technology Data Exchange (ETDEWEB)

    Zeier, Robert, E-mail: robert.zeier@ch.tum.de [Department Chemie, Technische Universität München, Lichtenbergstrasse 4, 85747 Garching (Germany); Zimborás, Zoltán, E-mail: zimboras@gmail.com [Department of Computer Science, University College London, Gower St., London WC1E 6BT (United Kingdom)

    2015-08-15

    We study how tensor products of representations decompose when restricted from a compact Lie algebra to one of its subalgebras. In particular, we are interested in tensor squares which are tensor products of a representation with itself. We show in a classification-free manner that the sum of multiplicities and the sum of squares of multiplicities in the corresponding decomposition of a tensor square into irreducible representations has to strictly grow when restricted from a compact semisimple Lie algebra to a proper subalgebra. For this purpose, relevant details on tensor products of representations are compiled from the literature. Since the sum of squares of multiplicities is equal to the dimension of the commutant of the tensor-square representation, it can be determined by linear-algebra computations in a scenario where an a priori unknown Lie algebra is given by a set of generators which might not be a linear basis. Hence, our results offer a test to decide if a subalgebra of a compact semisimple Lie algebra is a proper one without calculating the relevant Lie closures, which can be naturally applied in the field of controlled quantum systems.

  14. On squares of representations of compact Lie algebras

    International Nuclear Information System (INIS)

    We study how tensor products of representations decompose when restricted from a compact Lie algebra to one of its subalgebras. In particular, we are interested in tensor squares which are tensor products of a representation with itself. We show in a classification-free manner that the sum of multiplicities and the sum of squares of multiplicities in the corresponding decomposition of a tensor square into irreducible representations has to strictly grow when restricted from a compact semisimple Lie algebra to a proper subalgebra. For this purpose, relevant details on tensor products of representations are compiled from the literature. Since the sum of squares of multiplicities is equal to the dimension of the commutant of the tensor-square representation, it can be determined by linear-algebra computations in a scenario where an a priori unknown Lie algebra is given by a set of generators which might not be a linear basis. Hence, our results offer a test to decide if a subalgebra of a compact semisimple Lie algebra is a proper one without calculating the relevant Lie closures, which can be naturally applied in the field of controlled quantum systems

  15. Sound field simulation and acoustic animation in urban squares

    Science.gov (United States)

    Kang, Jian; Meng, Yan

    2005-04-01

    Urban squares are important components of cities, and the acoustic environment is important for their usability. While models and formulae for predicting the sound field in urban squares are important for their soundscape design and improvement, acoustic animation tools would be of great importance for designers as well as for public participation process, given that below a certain sound level, the soundscape evaluation depends mainly on the type of sounds rather than the loudness. This paper first briefly introduces acoustic simulation models developed for urban squares, as well as empirical formulae derived from a series of simulation. It then presents an acoustic animation tool currently being developed. In urban squares there are multiple dynamic sound sources, so that the computation time becomes a main concern. Nevertheless, the requirements for acoustic animation in urban squares are relatively low compared to auditoria. As a result, it is important to simplify the simulation process and algorithms. Based on a series of subjective tests in a virtual reality environment with various simulation parameters, a fast simulation method with acceptable accuracy has been explored. [Work supported by the European Commission.

  16. Some Theoretical Essences of Lithuania Squares Formation

    Directory of Open Access Journals (Sweden)

    Gintautas Tiškus

    2016-04-01

    Full Text Available In the Lithuanian acts of law and in the scientific literature there are no clear criteria and notions to define a square. The unbuilt city space places or the gaps between buildings are often defined as the squares, which do not have clear limits or destination. The mandatory attributes of the place which is called the square are indicated in the article, the notion of square is defined. The article deals with Lithuanian squares theme, analyses the differences between representation and representativeness. The article aims to indicate an influence of city environmental context and monument in the square on its function. The square is an independent element of city plan structure, but it is not an independent element of city spatial structure. The space and environment of the square are related to each other not only by physical, aesthetical relations, but as well as by causalities, which may be named as the essences of squares’ formation. The interdisciplinary discourse analysis method is applied in the article.

  17. Lagrange’s Four-Square Theorem

    Directory of Open Access Journals (Sweden)

    Watase Yasushige

    2015-02-01

    Full Text Available This article provides a formalized proof of the so-called “the four-square theorem”, namely any natural number can be expressed by a sum of four squares, which was proved by Lagrange in 1770. An informal proof of the theorem can be found in the number theory literature, e.g. in [14], [1] or [23].

  18. CHI3L1 nuclear localization in monocyte derived dendritic cells.

    Science.gov (United States)

    Di Rosa, Michelino; Tibullo, Daniele; Saccone, Salvatore; Distefano, Gisella; Basile, Maria Sofia; Di Raimondo, Francesco; Malaguarnera, Lucia

    2016-02-01

    Chitinase-3-like-1 protein (CHI3L1) is a glycosyl hydrolase (GH) highly expressed in a variety of inflammatory diseases at infectious and non-infectious etiology. CHI3L1 is produced by a wide variety of cells including monocyte-derived macrophages cell lines such as polarized M1 and M2 type macrophages, osteoclasts and Kupffer cells. In this study we have examined the expression of CHI3L1 during the differentiation and maturation of dendritic cells. Magnetically-isolated peripheral blood monocytes were differentiated toward immature DCs (iDC) and mature DCs (mDCs) through a combination of factors and cytokines. Our result showed, for the first time, that CHI3L1 is expressed during the process of differentiation and maturation of dendritic cells in time dependent manner. Furthermore, the CHI3L1 is evenly distributed in cytoplasm and in the nucleus of both the iDCs and mDCs. These results suggest that CHI3L1 may play crucial role in the DCs immunoresponse. PMID:26466985

  19. Cross-ratio Identities and Higher-order Poles of CHY-integrand

    CERN Document Server

    Cardona, Carlos; Gomez, Humberto; Huang, Rijun

    2016-01-01

    The evaluation of generic Cachazo-He-Yuan(CHY)-integrands is a big challenge and efficient computational methods are in demand for practical evaluation. In this paper, we propose a systematic decomposition algorithm by using cross-ratio identities, which provides an analytic and easy to implement method for the evaluation of any CHY-integrand. This algorithm aims to decompose a given CHY-integrand containing higher-order poles as a linear combination of CHY-integrands with only simple poles in a finite number of steps, which ultimately can be trivially evaluated by integration rules of simple poles. To make the method even more efficient for CHY-integrands with large number of particles and complicated higher-order pole structures, we combine the $\\Lambda$-algorithm and the cross-ratio identities, and as a by-product it provides us a way to deal with CHY-integrands where the $\\Lambda$-algorithm was not applicable in its original formulation.

  20. Nonperturbative and spin effects in the central exclusive production of tensor \\chi_c(2^+) meson

    CERN Document Server

    Pasechnik, R S; Teryaev, O V

    2009-01-01

    We discuss central exclusive production (CEP) of the tensor $\\chi_c(2^{+})$ meson in proton-(anti)proton collisions at Tevatron, RHIC and LHC energies. The amplitude for the process is derived within the $k_t$-factorisation approach. Differential and total cross sections are calculated for several unintegrated gluon distributions (UGDFs). We compare exclusive production of all charmonium states $\\chi_c(0^+), \\chi_c(1^+)$ and $\\chi_c(2^+)$. Good description of the recent Tevatron data is achieved both with Martin-Ryskin phenomenological UGDF and UGDF based on unified BFKL-DGLAP approach. Unlike for Higgs production, the main contribution to the diffractive amplitude of heavy quarkonia comes from nonperturbative region of gluon transverse momenta $Q_{\\perp}<1 \\GeV$. At $y \\approx$ 0, we predict the contribution of $\\chi_c(1^+,2^+)$ to the $J/\\Psi + \\gamma$ channel to be larger than that of the $\\chi_c(0^+)$ one. This is partially due to a significant contribution from lower polarization states $\\lambda=0$ fo...

  1. Transgenic Indian Cotton (Gossypium hirsutum Harboring Rice Chitinase Gene (Chi II Confers Resistance to Two Fungal Pathogens

    Directory of Open Access Journals (Sweden)

    M. Ganesan

    2009-01-01

    Full Text Available Problem statement: The present investigation described a simple and reproducible protocol for transgenic cotton regeneration and characterization of chitinase (Chi II gene expression against two different fungal pathogens in cotton. Approach: Transgenic cotton (Gossypium hirsutum cv. SVPR2 plants were produced by pCambia-bar-Chi II (13.8 kb under the control of the CaMV 35S promoter, harbored in the strain LBA 4404 Agrobacterium tumefaciens by using shoot tip explants. Results: Finally, from the 10 experiments, 21.8% of transformation frequency was recorded. Segregation ratio of 3:1 was recorded in the T0 plant seeds. Polymerase chain reaction and southern blotting analysis were used to confirm the integration of Chi II transgene in the T0 plants genome of putative transgenics. Quantitiave and qualitative (SDS-PAGE analyses were also carried out to confirm the expression of chitinase enzyme in T0 plants. Further, randomly selected transgenic plants (T0 were analyzed for disease tolerance by evaluating them with spores of Fusarium oxysporum and Alternaria macrospora. All the selected PCR positive plants showed enhanced disease resistance against Fusarium wilt. The plants selected randomly showed an enhanced survival rate compared with the control when they were grown in earthen pots inoculated with 1×105 spores 100-1 g of soil mixture. Another four randomly selected plantlets were sprayed with spores of Alternaria macrospora in order to test their tolerance to Alternaria leaf spot disease. After 20 days of culture, the number of lesions per leaf and the lesion length per leaf spot in non-transferred leaves increased. In the case of transgenic plantlets, lesion formation was completely absent. Conclusion: The disease resistance against Fusarium wilt and Alternaria leaf spot in cotton strains would serve as good breeding materials for producing fungal disease resistant cotton varieties.

  2. Tai Chi Chuan Optimizes the Functional Organization of the Intrinsic Human Brain Architecture in Older Adults

    Directory of Open Access Journals (Sweden)

    Gao-Xia eWei

    2014-04-01

    Full Text Available Whether Tai Chi Chuan (TCC can influence the intrinsic functional architecture of the human brain remains unclear. To examine TCC-associated changes in functional connectomes, resting-state functional magnetic resonance images were acquired from 40 older individuals including 22 experienced TCC practitioners (experts and 18 demographically matched TCC-naïve healthy controls, and their local functional homogeneities across the cortical mantle were compared. Compared to the controls, the TCC experts had significantly greater and more experience-dependent functional homogeneity in the right postcentral gyrus (PosCG and less functional homogeneity in the left anterior cingulate cortex (ACC and the right dorsal lateral prefrontal cortex (DLPFC. Increased functional homogeneity in the PosCG was correlated with TCC experience. Intriguingly, decreases in functional homogeneity (improved functional specialization in the left ACC and increases in functional homogeneity (improved functional integration in the right PosCG both predicted performance gains on attention network behavior tests. These findings provide evidence for the functional plasticity of the brain’s intrinsic architecture toward optimizing locally functional organization, with great implications for understanding the effects of TCC on cognition, behavior and health in aging population.

  3. High Resolution Rapid Response Observations of Compact Radio Sources with the Ceduna Hobart Interferometer (CHI)

    Science.gov (United States)

    Blanchard, Jay M.; Lovell, James E. J.; Ojha, Roopesh; Kadler, Matthias; Dickey, John M.; Edwards, Philip G.

    2011-01-01

    Context. Frequent, simultaneous observations across the electromagnetic spectrum are essential to the study of a range of astrophysical phenomena including Active Galactic Nuclei. A key tool of such studies is the ability to observe an object when it flares i.e. exhibits a rapid and significant increase in its flux density. Aims. We describe the specific observational procedures and the calibration techniques that have been developed and tested to create a single baseline radio interferometer. that can rapidly observe a flaring object. This is the only facility that is dedicated to rapid high resolution radio observations of an object south of -30 degrees declination. An immediate application is to provide rapid contemporaneous radio coverage of AGN flaring at y-ray frequencies detected by the Fermi Gamma-ray Space Telescope. Methods. A single baseline interferometer was formed with radio telescopes in Hobart, Tasmania and Ceduna, South Australia. A software correlator was set up at the University of Tasmania to correlate these data. Results. Measurements of the flux densities of flaring objects can be made using our observing strategy within half an hour of a triggering event. These observations can be calibrated with amplitude errors better than 20%. Lower limits to the brightness temperatures of the sources can also be calculated using CHI. Key words. instrumentation:interferometers - galaxies:active - galaxies:jets - galaxies:nuclei quasars:general gamma rays:galaxies- 1.

  4. Use of a chiA probe for detection of chitinase genes in bacteria from the Chesapeake Bay

    Digital Repository Service at National Institute of Oceanography (India)

    Ramaiah, N.; Hill, R.T.; Chun, J.; Ravel, J.; Matte, M.H.; Straube, W.L.; Colwell, R.R.

    from several distantly re- lated bacteria facilitated selection of highly conserved re- gions of the chiA gene for design of PCR primers expected to have broad speci¢city for detection of chiA in a wide range of bacteria. Our aims were to construct a...,34]. In the present study, chiA gene-speci¢c PCR primers and a chiA gene probe were developed and their speci¢city veri¢ed using a large assemblage of reference strains. The chiA frag- ments ampli¢ed by PCR from representative strains were sequenced to con...

  5. Multisource Least-squares Reverse Time Migration

    KAUST Repository

    Dai, Wei

    2012-12-01

    Least-squares migration has been shown to be able to produce high quality migration images, but its computational cost is considered to be too high for practical imaging. In this dissertation, a multisource least-squares reverse time migration algorithm (LSRTM) is proposed to increase by up to 10 times the computational efficiency by utilizing the blended sources processing technique. There are three main chapters in this dissertation. In Chapter 2, the multisource LSRTM algorithm is implemented with random time-shift and random source polarity encoding functions. Numerical tests on the 2D HESS VTI data show that the multisource LSRTM algorithm suppresses migration artifacts, balances the amplitudes, improves image resolution, and reduces crosstalk noise associated with the blended shot gathers. For this example, multisource LSRTM is about three times faster than the conventional RTM method. For the 3D example of the SEG/EAGE salt model, with comparable computational cost, multisource LSRTM produces images with more accurate amplitudes, better spatial resolution, and fewer migration artifacts compared to conventional RTM. The empirical results suggest that the multisource LSRTM can produce more accurate reflectivity images than conventional RTM does with similar or less computational cost. The caveat is that LSRTM image is sensitive to large errors in the migration velocity model. In Chapter 3, the multisource LSRTM algorithm is implemented with frequency selection encoding strategy and applied to marine streamer data, for which traditional random encoding functions are not applicable. The frequency-selection encoding functions are delta functions in the frequency domain, so that all the encoded shots have unique non-overlapping frequency content. Therefore, the receivers can distinguish the wavefield from each shot according to the frequencies. With the frequency-selection encoding method, the computational efficiency of LSRTM is increased so that its cost is

  6. Goodness-of-fit tests for vector autoregressive models in time series

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    The paper proposes and studies some diagnostic tools for checking the goodness-of-fit of general parametric vector autoregressive models in time series. The resulted tests are asymptotically chi-squared under the null hypothesis and can detect the alternatives converging to the null at a parametric rate. The tests involve weight functions,which provides us with the flexibility to choose scores for enhancing power performance,especially under directional alternatives. When the alternatives are not directional,we construct asymptotically distribution-free maximin tests for a large class of alternatives. A possibility to construct score-based omnibus tests is discussed when the alternative is saturated. The power performance is also investigated. In addition,when the sample size is small,a nonparametric Monte Carlo test approach for dependent data is proposed to improve the performance of the tests. The algorithm is easy to implement. Simulation studies and real applications are carried out for illustration.

  7. Partial update least-square adaptive filtering

    CERN Document Server

    Xie, Bei

    2014-01-01

    Adaptive filters play an important role in the fields related to digital signal processing and communication, such as system identification, noise cancellation, channel equalization, and beamforming. In practical applications, the computational complexity of an adaptive filter is an important consideration. The Least Mean Square (LMS) algorithm is widely used because of its low computational complexity (O(N)) and simplicity in implementation. The least squares algorithms, such as Recursive Least Squares (RLS), Conjugate Gradient (CG), and Euclidean Direction Search (EDS), can converge faster a

  8. Around and Beyond the Square of Opposition

    CERN Document Server

    Béziau, Jean-Yves

    2012-01-01

    aiThe theory of oppositions based on Aristotelian foundations of logic has been pictured in a striking square diagram which can be understood and applied in many different ways having repercussions in various fields: epistemology, linguistics, mathematics, psychology. The square can also be generalized in other two-dimensional or multi-dimensional objects extending in breadth and depth the original theory of oppositions of Aristotle. The square of opposition is a very attractive theme which has been going through centuries without evaporating. Since 10 years there is a new growing interest for

  9. Power and sensitivity of alternative fit indices in tests of measurement invariance.

    Science.gov (United States)

    Meade, Adam W; Johnson, Emily C; Braddy, Phillip W

    2008-05-01

    Confirmatory factor analytic tests of measurement invariance (MI) based on the chi-square statistic are known to be highly sensitive to sample size. For this reason, G. W. Cheung and R. B. Rensvold (2002) recommended using alternative fit indices (AFIs) in MI investigations. In this article, the authors investigated the performance of AFIs with simulated data known to not be invariant. The results indicate that AFIs are much less sensitive to sample size and are more sensitive to a lack of invariance than chi-square-based tests of MI. The authors suggest reporting differences in comparative fit index (CFI) and R. P. McDonald's (1989) noncentrality index (NCI) to evaluate whether MI exists. Although a general value of change in CFI (.002) seemed to perform well in the analyses, condition specific change in McDonald's NCI values exhibited better performance than a single change in McDonald's NCI value. Tables of these values are provided as are recommendations for best practices in MI testing. PMID:18457487

  10. Wave-equation Q tomography and least-squares migration

    KAUST Repository

    Dutta, Gaurav

    2016-03-01

    This thesis designs new methods for Q tomography and Q-compensated prestack depth migration when the recorded seismic data suffer from strong attenuation. A motivation of this work is that the presence of gas clouds or mud channels in overburden structures leads to the distortion of amplitudes and phases in seismic waves propagating inside the earth. If the attenuation parameter Q is very strong, i.e., Q<30, ignoring the anelastic effects in imaging can lead to dimming of migration amplitudes and loss of resolution. This, in turn, adversely affects the ability to accurately predict reservoir properties below such layers. To mitigate this problem, I first develop an anelastic least-squares reverse time migration (Q-LSRTM) technique. I reformulate the conventional acoustic least-squares migration problem as a viscoacoustic linearized inversion problem. Using linearized viscoacoustic modeling and adjoint operators during the least-squares iterations, I show with numerical tests that Q-LSRTM can compensate for the amplitude loss and produce images with better balanced amplitudes than conventional migration. To estimate the background Q model that can be used for any Q-compensating migration algorithm, I then develop a wave-equation based optimization method that inverts for the subsurface Q distribution by minimizing a skeletonized misfit function ε. Here, ε is the sum of the squared differences between the observed and the predicted peak/centroid-frequency shifts of the early-arrivals. Through numerical tests on synthetic and field data, I show that noticeable improvements in the migration image quality can be obtained from Q models inverted using wave-equation Q tomography. A key feature of skeletonized inversion is that it is much less likely to get stuck in a local minimum than a standard waveform inversion method. Finally, I develop a preconditioning technique for least-squares migration using a directional Gabor-based preconditioning approach for isotropic

  11. Coupling parameter series expansion for fluid with square-well plus repulsive-square-barrier potential

    Directory of Open Access Journals (Sweden)

    Shiqi Zhou

    2013-10-01

    Full Text Available Monte Carlo simulations in the canonical ensemble are performed for fluid with potential consisting of a square-well plus a square-barrier to obtain thermodynamic properties such as pressure, excess energy, constant volume excess heat capacity, and excess chemical potential, and structural property such as radial distribution function. The simulations cover a wide density range for the fluid phase, several temperatures, and different combinations of the parameters defining the potential. These simulation data have been used to test performances of a coupling parameter series expansion (CPSE recently proposed by one of the authors [S. Zhou, Phys. Rev. E 74, 031119 (2006], and a traditional 2nd-order high temperature series expansion (HTSE based on a macroscopic compressibility approximation (MAC used with confidence since its introduction in 1967. It is found that (i the MCA-based 2nd-order HTSE unexpectedly and depressingly fails for most situations investigated, and the present simulation results can serve well as strict criteria for testing liquid state theories. (ii The CPSE perturbation scheme is shown to be capable of predicting very accurately most of the thermodynamic properties simulated, but the most appropriate level of truncating the CPSE differs and depends on the range of the potential to be calculated; in particular, the shorter the potential range is, the higher the most appropriate truncating level can be, and along with rising of the potential range the performance of the CPSE perturbation scheme will decrease at higher truncating level. (iii The CPSE perturbation scheme can calculate satisfactorily bulk fluid rdf, and such calculations can be done for all fluid states of the whole phase diagram. (iv The CPSE is a convergent series at higher temperatures, but show attribute of asymptotic series at lower temperatures, and as a result, the surest asymptotic value occurs at lower-order truncation.

  12. Four square mile survey pair count instructions

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This standard operating procedure (SOP) provides guidance for conducting bird pair count measurements on wetlands for the HAPETs Four-Square-Mile survey. This set...

  13. Elements with Square Roots in Finite Groups

    Institute of Scientific and Technical Information of China (English)

    M.S. Lucido; M.R. Pournaki

    2005-01-01

    In this paper, we study the probability that a randomly chosen element in a finite group has a square root, in particular the simple groups of Lie type of rank 1, the sporadic finite simple groups and the alternating groups.

  14. Number One Pery Square Wine List, 2013

    OpenAIRE

    Number One Pery Square

    2013-01-01

    Number One Pery Square is located in Pery Square, the Georgian Quarter, Limerick City, Co. Limerick. It now has its own kitchen garden right in the heart of the city. The chef is Alan Burns. The hotel has the Brasserie One Restaurant where the philosophy is to serve simple, sensibly priced dishes sometimes rustic, sometimes classic using the freshest of local ingredients. Brasserie One is a true classic Irish brasserie with strong French influences and the use of Irish artisan produce where p...

  15. Applications of square-related theorems

    Science.gov (United States)

    Srinivasan, V. K.

    2014-04-01

    The square centre of a given square is the point of intersection of its two diagonals. When two squares of different side lengths share the same square centre, there are in general four diagonals that go through the same square centre. The Two Squares Theorem developed in this paper summarizes some nice theoretical conclusions that can be obtained when two squares of different side lengths share the same square centre. These results provide the theoretical basis for two of the constructions given in the book of H.S. Hall and F.H. Stevens , 'A Shorter School Geometry, Part 1, Metric Edition'. In page 134 of this book, the authors present, in exercise 4, a practical construction which leads to a verification of the Pythagorean theorem. Subsequently in Theorems 29 and 30, the authors present the standard proofs of the Pythagorean theorem and its converse. In page 140, the authors present, in exercise 15, what amounts to a geometric construction, whose verification involves a simple algebraic identity. Both the constructions are of great importance and can be replicated by using the standard equipment provided in a 'geometry toolbox' carried by students in high schools. The author hopes that the results proved in this paper, in conjunction with the two constructions from the above-mentioned book, would provide high school students an appreciation of the celebrated theorem of Pythagoras. The diagrams that accompany this document are based on the free software GeoGebra. The author formally acknowledges his indebtedness to the creators of this free software at the end of this document.

  16. Diffractive performance of square Fresnel zone plates

    OpenAIRE

    Alda, Javier; Rico García, José María; Salgado Remacha, Francisco Javier; Sánchez Brea, Luis Miguel

    2009-01-01

    We analyze the optical behavior of square Fresnel zones plates. A theoretical analysis and numerical simulations based on the Rayleigh-Sommerfeld approach have been developed analyzing properties such as the depth of focus and the intensity of the focus in terms of the number of zones. In addition, an experimental verification has been performed using a Spatial Light Modulator to implement the designed square Fresnel zones plates.

  17. The square of opposition in orthomodular logic

    OpenAIRE

    Freytes, Hector; de Ronde, Christian; Domenech, Graciela

    2014-01-01

    In Aristotelian logic, categorical propositions are divided in Universal Affirmative, Universal Negative, Particular Affirmative and Particular Negative. Possible relations between two of the mentioned type of propositions are encoded in the square of opposition. The square expresses the essential properties of monadic first order quantification which, in an algebraic approach, may be represented taking into account monadic Boolean algebras. More precisely, quantifiers are considered as modal...

  18. Cutting sequences on square-tiled surfaces

    OpenAIRE

    Johnson, Charles C.

    2016-01-01

    We characterize cutting sequences of infinite geodesics on square-tiled surfaces by considering interval exchanges on specially chosen intervals on the surface. These interval exchanges can be thought of as skew products over a rotation, and we convert cutting sequences to symbolic trajectories of these interval exchanges to show that special types of combinatorial lifts of Sturmian sequences completely describe all cutting sequences on a square-tiled surface. Our results extend the list of f...

  19. The autonomic and rate pressure product responses of Tai Chi practitioners

    Directory of Open Access Journals (Sweden)

    Michael A Figueroa

    2012-01-01

    Full Text Available Background: Spectral analysis of autonomic nervous system activity can provide insight into cardiovascular function. Rate pressure product is the parameter often targeted pharmacologically to decrease the incidence of myocardial events. Aim: The purpose of this study was to investigate whether or not Tai Chi Chuan practitioners would demonstrate autonomic responses that would be more cardioprotective when compared to non-trained controls. Materials and Methods: This was a cross-sectional study that measured the autonomic responses and rate pressure product of 2 groups of subjects; a Tai Chi Chuan trained (n = 13 and non-trained sedentary controls (n = 13 at rest and during 2 stressor phases that simulated functional activities of daily living. Results: The Tai Chi group maintained a greater parasympathetic outflow at rest and during the isometric grip stressor phase (P<0.05. Sympathetic outflow, systolic blood pressure and rate pressure product were significantly lower in the Tai Chi group at rest, during the isometric grip and standing stressor phases (P<0.05. Conclusion: Although a cause-and-effect relationship cannot be concluded in this study, the Tai Chi group was able to demonstrate efficiency of the myocardium with suppressed rate pressure product values and autonomic responses that favored parasympathetic outflow. This type of training may complement non-pharmacological anti-hypertensive therapy.

  20. Polarized $\\chi_{c2}$-charmonium production in antiproton-nucleus interactions

    CERN Document Server

    Larionov, A B; Bleicher, M

    2014-01-01

    Starting from the Feynman diagram representation of multiple scattering we consider the polarized $\\chi_c$(1P)-charmonia production in antiproton-nucleus reactions close to the threshold ($p_{\\rm lab}=5-7$ GeV/c). The rescattering and absorption of the incoming antiproton and outgoing charmonium on nucleons are taken into account, including the possibility of the elastic and nondiagonal (flavor-conserving) scattering $\\chi_{cJ} N \\to \\chi_{cJ^\\prime} N$, $J,J^\\prime=0,1,2$. The elementary amplitudes of the latter processes are evaluated by expanding the physical $\\chi_c$-states in the Clebsch-Gordan series of the $c \\bar c$ states with fixed values of internal orbital angular momentum ($L_z$) and spin projections on the $\\chi_c$ momentum axis. The total interaction cross sections of these $c \\bar c$ states with nucleons have been calculated in previous works using the QCD factorization theorem and the nonrelativistic quarkonium model and turned out to be strongly $L_z$-dependent due to the transverse size dif...

  1. Dynamic mechanisms of the post-seismic deformation following large events:Case study of the 1999 Chi-Chi earthquake in Taiwan of China

    Institute of Scientific and Technical Information of China (English)

    ZHU ShouBiao; CAI YongEn

    2009-01-01

    The mechanism of postseismic deformation related to strong earthquakes is important in geodynamics,and presumably afterslip or viscoelastic relaxation is responsible for the postsesimic deformation.The 1999 Chi-Chi,Taiwan of China,earthquake occurred in the region where GPS observation station is most densely deployed in the world.The unprecedented GPS data provides a unique opportunity to study the physical processes of postseismic deformation.Here we assume that the interactions of viscoelastic relaxation,afterslip,fault zone collapse,poroelastic rebound,flow of underground fluids,and all these combined contribute to the surface displacements following the main shock.In order to know the essence of the postseismic deformation after the strong event,fault zone collapse,poroelastic rebound,flow of underground fluids,and so on,are represented equivalently by the variations of the focal medium properties.Therefore,the viscoelastic relaxation,afterslip,and the variations of the equivalent focal medium properties are inverted by applying the GPS temporal series measurement data with viscoelastic finite element method.Both the afterslip rate distribution along the fault and the afterslip evolution with time are obtained by means of inversion.Also,the preliminary result suggests that viscosities of the lower crust and the upper mantle in Taiwan region is 2.7×10~(18) and 4.2×10~(20) Pa.s,respectively.Moreover,the inversion results indicate that the afterslip contributing to postseismic deformation of 44.6% in 450 days after the Chi-Chi earthquake,with 34.7% caused by the viscous relaxation and 20.7% by other factors such as fault zone collapse,poroelastic rebound,and the flow of liquids.

  2. Dynamic mechanisms of the post-seismic deformation following large events:Case study of the 1999 Chi-Chi earthquake in Taiwan of China

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    The mechanism of postseismic deformation related to strong earthquakes is important in geodynamics, and presumably afterslip or viscoelastic relaxation is responsible for the postsesimic deformation. The 1999 Chi-Chi, Taiwan of China, earthquake occurred in the region where GPS observation station is most densely deployed in the world. The unprecedented GPS data provides a unique opportunity to study the physical processes of postseismic deformation. Here we assume that the interactions of viscoelastic relaxation, afterslip, fault zone collapse, poroelastic rebound, flow of underground fluids, and all these combined contribute to the surface displacements following the main shock. In order to know the essence of the postseismic deformation after the strong event, fault zone collapse, poroelastic rebound, flow of underground fluids, and so on, are represented equivalently by the variations of the focal medium properties. Therefore, the viscoelastic relaxation, afterslip, and the variations of the equivalent focal medium properties are inverted by applying the GPS temporal series measurement data with viscoelastic finite element method. Both the afterslip rate distribution along the fault and the afterslip evolution with time are obtained by means of inversion. Also, the preliminary result suggests that viscosities of the lower crust and the upper mantle in Taiwan region is 2.7×1018 and 4.2×1020 Pa·s, respectively. Moreover, the inversion results indicate that the afterslip contributing to postseismic deformation of 44.6% in 450 days after the Chi-Chi earthquake, with 34.7% caused by the viscous relaxation and 20.7% by other factors such as fault zone collapse, poroelastic rebound, and the flow of liquids.

  3. A randomized controlled trial of tai chi for long-term low back pain (TAI CHI): Study rationale, design, and methods

    OpenAIRE

    Hall Amanda M; Maher Chris G; Latimer Jane; Ferreira Manuela L; Lam Paul

    2009-01-01

    Abstract Background Low back pain persisting for longer than 3 months is a common and costly condition for which many current treatments have low-moderate success rates at best. Exercise is among the more successful treatments for this condition, however, the type and dosage of exercise that elicits the best results is not clearly defined. Tai chi is a gentle form of low intensity exercise that uses controlled movements in combination with relaxation techniques and is currently used as a safe...

  4. Short-range inverse-square law experiment in space

    Science.gov (United States)

    Paik, H. J.; Moody, M. V.

    2002-01-01

    Newton's inverse-square law is a cornerstone of General Relativity. Its validity has been demonstrated to better than one part in thousand in ranges greater than 1 cm. The range below 1 mm has been left largely unexplored, due to the difficulties associated with designing sensitive short-range experiments. However, the theoretical rationale for testing Newton's law at ranges below 1 mm has become very strong recently.

  5. Plane-wave Least-squares Reverse Time Migration

    KAUST Repository

    Dai, Wei

    2012-11-04

    Least-squares reverse time migration is formulated with a new parameterization, where the migration image of each shot is updated separately and a prestack image is produced with common image gathers. The advantage is that it can offer stable convergence for least-squares migration even when the migration velocity is not completely accurate. To significantly reduce computation cost, linear phase shift encoding is applied to hundreds of shot gathers to produce dozens of planes waves. A regularization term which penalizes the image difference between nearby angles are used to keep the prestack image consistent through all the angles. Numerical tests on a marine dataset is performed to illustrate the advantages of least-squares reverse time migration in the plane-wave domain. Through iterations of least-squares migration, the migration artifacts are reduced and the image resolution is improved. Empirical results suggest that the LSRTM in plane wave domain is an efficient method to improve the image quality and produce common image gathers.

  6. Some Properties of A Lack-of-Fit Test for a Linear Errors in Variables Model

    Institute of Scientific and Technical Information of China (English)

    Li-xing Zhu; Heng-jian Cui; K.W.Ng

    2004-01-01

    The relationship between the linear errors-in-variables model and the corresponding ordinary linear model in statistical inference is studied.It is shown that normality of the distribution of covariate is a necessary and su cient condition for the equivalence.Therefore,testing for lack-of-t in linear errors-in-variables model can be converted into testing for it in the corresponding ordinary linear model under normality assumption.A test of score type is constructed and the limiting chi-squared distribution is derived under the null hypothesis.Furthermore,we discuss the power of the test and the choice of the weight function involved in the test statistic.

  7. Towards ensemble asteroseismology of the young open clusters Chi Persei and NGC 6910

    CERN Document Server

    Saesen, S; Carrier, F; Michalska, G; Aerts, C; De Ridder, J; Briquet, M; Handler, G; Kolaczkowski, Z; Acke, B; Bauwens, E; Beck, P G; Blom, Y; Blommaert, J; Broeders, E; Cherix, M; Davignon, G; Debosscher, J; Degroote, P; Decin, L; Dehaes, S; De Meester, W; Deroo, P; Desmet, M; Drummond, R; Eggen, J R; Fu, J; Gazeas, K; Gelven, G A; Gielen, C; Huygen, R; Jiang, X; Kalomeni, B; Kim, S -L; Kim, D H; Kopacki, G; Kwon, J -H; Ladjal, D; Lee, C -U; Lee, Y -J; Lefever, K; Leitner, A; Lenz, P; Liakos, A; Lorenz, D; Narwid, A; Niarchos, P; Oestensen, R; Poretti, E; Prins, S; Provencal, J; Antolin, E Puga; Puschnig, J; Raskin, G; Reed, M D; Reyniers, M; Schmidt, E; Schmitzberger, L; Spano, M; Steininger, B; Steslicki, M; Uytterhoeven, K; Vanautgaerden, J; Vandenbussche, B; Van Helshoecht, V; Vanhollebeke, E; Van Winckel, H; Verhoelst, T; Vuckovic, M; Waelkens, C; Wolf, G W; Yakut, K; Zhang, C; Zima, W

    2010-01-01

    As a result of the variability survey in Chi Persei and NGC6910, the number of Beta Cep stars that are members of these two open clusters is increased to twenty stars, nine in NGC6910 and eleven in Chi Persei. We compare pulsational properties, in particular the frequency spectra, of Beta Cep stars in both clusters and explain the differences in terms of the global parameters of the clusters. We also indicate that the more complicated pattern of the variability among B type stars in Chi Persei is very likely caused by higher rotational velocities of stars in this cluster. We conclude that the sample of pulsating stars in the two open clusters constitutes a very good starting point for the ensemble asteroseismology of Beta Cep-type stars and maybe also for other B-type pulsators.

  8. Biostatistics with emphasis on life table survival rate calculations (including Kaplan Meier) and the logrank test

    International Nuclear Information System (INIS)

    Purpose/Objective: To explain some of the most useful statistical calculation procedures which are relevant to radiation oncologists and to provide insights on what tests and procedures should be used in various situations such as when survival rates and their associated standard errors have to be determined. To describe some of the problems and pitfalls in clinical trial designs which have to be overcome if a trial is to have the possibility of reaching a successful conclusion. To review methods of computing criteria to quantitatively describe criteria of success (eg. quality of life, long-term survival, cure) of radiation oncology and to suggest possible future statistical improvements in this area. Chi-Squared Test: The chi-squared test is probably the most useful of the tests of statistical significance for the radiation oncologist. Applications will be described, including goodness of fit tests and 2x2 contingency tables which are the simplest of the generalized nxm contingency tables. Degrees of Freedom and P<0.05 for Significance Testing: An Introduction will be given to the meaning of P<0.05 in relation to significance testing and the use of tables of critical values of a test statistic (eg. chi-squared) which are given as a function of degrees of freedom and P-values. Survival Rate Calculations for Grouped and Ungrouped Data: The life-table method (sometimes termed the actuarial method) will be explained for both grouped data (eg. survival times grouped in annual intervals for patients who have died and for those who are still alive or lost to follow-up) and for ungrouped data (when individual survival times are used). The method for ungrouped data is variously termed the Kaplan-Meier or Product Limit method. Logrank Test: This is the most useful test for comparison of the survival experience of two groups of patients and its use will be explained. In part the computation is similar to that for the Kaplan-Meier/Product Limit method

  9. Tai Chi for treating knee osteoarthritis: Designing a long-term follow up randomized controlled trial

    Directory of Open Access Journals (Sweden)

    Rones Ramel

    2008-07-01

    Full Text Available Abstract Background Knee Osteoarthritis (KOA is a major cause of pain and functional impairment among elders. Currently, there are neither feasible preventive intervention strategies nor effective medical remedies for the management of KOA. Tai Chi, an ancient Chinese mind-body exercise that is reported to enhance muscle function, balance and flexibility, and to reduce pain, depression and anxiety, may safely and effectively be used to treat KOA. However, current evidence is inconclusive. Our study examines the effects of a 12-week Tai Chi program compared with an attention control (wellness education and stretching on pain, functional capacity, psychosocial variables, joint proprioception and health status in elderly people with KOA. The study will be completed by July 2009. Methods/Design Forty eligible patients, age > 55 yr, BMI ≤ 40 kg/m2 with tibiofemoral osteoarthritis (American College of Rheumatology criteria are identified and randomly allocated to either Tai Chi (10 modified forms from classical Yang style Tai Chi or attention control (wellness education and stretching. The 60-minute intervention sessions take place twice weekly for 12 weeks. The study is conducted at an urban tertiary medical center in Boston, Massachusetts. The primary outcome measure is the Western Ontario and McMaster Universities (WOMAC pain subscale at 12 weeks. Secondary outcomes include weekly WOMAC pain, function and stiffness scores, patient and physician global assessments, lower-extremity function, knee proprioception, depression, self-efficacy, social support, health-related quality of life, adherence and occurrence of adverse events after 12, 24 and 48 weeks. Discussion In this article, we present the challenges of designing a randomized controlled trial with long-term follow up. The challenges encountered in this design are: strategies for recruitment, avoidance of selection bias, the actual practice of Tai Chi, and the maximization of adherence

  10. TAI CHI CHUAN: STATE OF THE ART IN INTERNATIONAL RESEARCH: VOL 52 (MEDICINE & SPORT SCIENCE

    Directory of Open Access Journals (Sweden)

    Youlian Hong

    2008-09-01

    Full Text Available DESCRIPTION This collection on the latest and practical research data about the characteristics and beneficial effects of Tai Chi Chuan on various physiological and pathological matters is published as the 52nd volume of Medicine and Sport Science Journal. PURPOSE To address the effects of Tai Chi Chuan in the fields of biomechanics and physiology, sensory motor control and fall prevention, psychology and social aspects, as well as various clinical applications. FEATURES The book is organised into four sections, each containing four to seven chapters: the first section focuses on biomechanical and physiological aspects of Tai Chi in seven chapters, the second section addresses the benefits of the sport in terms of sensory motor control and fall prevention in five chapters, the third section highlights the psychological and social aspects in four chapters, and in the last section the application of Tai Chi in clinical intervention such as in Parkinson's disease, Alzheimer's diseases, coronary heart disease, chronic heart failure, breast cancer, rheumatoid arthritis and diabetes is demonstrated in six chapters. AUDIENCE This is a thorough reference book for students, researchers, teachers and healthcare professionals in exercise science and medicine. In fact, anyone already practicing Tai Chi Chuan or considering it up would benefit from this book. ASSESSMENT This 52nd volume of Medicine and Sport Science Journal on Tai Chi Chuan is a valuable and essential source of information brought together by recognized researchers around the Globe. The book is for everybody who is interested in understanding the effects and application of this fascinating form of exercise which has been developed as a form of martial arts and used for health exercise for centuries in China.

  11. Electrical properties of resistive switches based on Ba{sub 1-{chi}S}r{sub {chi}T}iO{sub 3} thin films prepared by RF co-sputtering

    Energy Technology Data Exchange (ETDEWEB)

    Marquez H, A.; Hernandez R, E.; Zapata T, M. [IPN, Centro de Investigacion en Ciencia Aplicada y Tecnologia Avanzada, Calzada Legaria No. 694, Col. Irrigacion, 11500 Mexico D. F. (Mexico); Guillen R, J. [Instituto Tecnologico y de Estudios Superiores de Monterrey, Campus Tampico, Puerto Industrial, Altamira 89600, Tamaulipas (Mexico); Cruz, M. P. [UNAM, Centro de Nanociencias y Nanotecnologia, Km. 107 Carretera Tijuana-Ensenada, 22860 Ensenada, Baja California (Mexico); Calzadilla A, O. [Universidad de la Habana, Facultad de Fisica-IMRE, San Lazaro y L. Municipio Plaza de la Revolucion, La Habana, Cuba (Cuba); Melendez L, M., E-mail: amarquez@ipn.m [IPN, Centro de Investigacion y de Estudios Avanzados, Departamento de Fisica, A. P. 14-740, 07000 Mexico D. F. (Mexico)

    2010-07-01

    In this work, was proposed the use of Ba{sub 1-{chi}S}r{sub {chi}T}iO{sub 3}(0{<=}x{<=}1) thin films for the construction of metal-insulator-metal heterostructures; and their great potential for the development of non-volatile resistance memories (ReRAM) is shown. The deposition of Ba{sub 1-{chi}S}r{sub {chi}T}iO{sub 3} thin films was done by the RF co-sputtering technique using two magnetron sputtering cathodes with BaTiO{sub 3} and SrTiO{sub 3} targets. The chemical composition (x parameter) in the deposited Ba{sub 1-{chi}S}r{sub {chi}T}iO{sub 3} thin films was varied through the RF powder applied to the targets. The constructed metal-insulator-metal heterostructures were Al/Ba{sub 1-{chi}S}r{sub {chi}T}iO{sub 3}/nichrome. The I-V measurements of the heterostructures showed that their hysteretic characteristics change depending on the Ba/Sr ratio of the Ba{sub 1-{chi}S}r{sub {chi}T}iO{sub 3} thin films; the Ba/Sr ratio was determined by employing the energy dispersive spectroscopy; Sem micrographs showed that Ba{sub 1-{chi}S}r{sub {chi}T}iO{sub 3} thin films were uniform without cracks or pinholes. Additionally, the analysis of the X-ray diffraction results indicated the substitutional incorporation of Sr into the BaTiO{sub 3} lattice and the obtainment of crystalline films for the entire range of the x values. (Author)

  12. Tai Chi for osteopenic women: design and rationale of a pragmatic randomized controlled trial

    Directory of Open Access Journals (Sweden)

    Fischer Mary

    2010-03-01

    Full Text Available Abstract Background Post-menopausal osteopenic women are at increased risk for skeletal fractures. Current osteopenia treatment guidelines include exercise, however, optimal exercise regimens for attenuating bone mineral density (BMD loss, or for addressing other fracture-related risk factors (e.g. poor balance, decreased muscle strength are not well-defined. Tai Chi is an increasingly popular weight bearing mind-body exercise that has been reported to positively impact BMD dynamics and improve postural control, however, current evidence is inconclusive. This study will determine the effectiveness of Tai Chi in reducing rates of bone turnover in post-menopausal osteopenic women, compared with standard care, and will preliminarily explore biomechanical processes that might inform how Tai Chi impacts BMD and associated fracture risks. Methods/Design A total of 86 post-menopausal women, aged 45-70y, T-score of the hip and/or spine -1.0 and -2.5, have been recruited from primary care clinics of a large healthcare system based in Boston. They have been randomized to a group-based 9-month Tai Chi program plus standard care or to standard care only. A unique aspect of this trial is its pragmatic design, which allows participants randomized to Tai Chi to choose from a pre-screened list of community-based Tai Chi programs. Interviewers masked to participants' treatment group assess outcomes at baseline and 3 and 9 months after randomization. Primary outcomes are serum markers of bone resorption (C-terminal cross linking telopeptide of type I collagen, bone formation (osteocalcin, and BMD of the lumbar spine and proximal femur (dual-energy X-ray absorptiometry. Secondary outcomes include health-related quality-of-life, exercise behavior, and psychological well-being. In addition, kinetic and kinematic characterization of gait, standing, and rising from a chair are assessed in subset of participants (n = 16 to explore the feasibility of modeling skeletal

  13. Connor H. G. Patros: Psi Chi/APA Edwin B. Newman Graduate Research Award.

    Science.gov (United States)

    2015-11-01

    The Edwin B. Newman Graduate Research Award is given jointly by Psi Chi and APA. The award was established to recognize young researchers at the beginning of their professional lives and to commemorate both the 50th anniversary of Psi Chi and the 100th anniversary of psychology as a science (dating from the founding of Wundt's laboratory). The 2015 recipient is Connor H. G Patros. Patros was chosen for "an excellent research paper that examines the complex relationship between working memory, choice-impulsivity, and the attention-deficit/hyperactivity disorder (ADHD) phenotype." Patros's award citation, biography, and a selected bibliography are presented here. PMID:26618965

  14. Novel probe of new light Higgs bosons from bottomonium chi_{b0} decay

    CERN Document Server

    Godfrey, Stephen

    2015-01-01

    We calculate the branching ratios of chi_{b0} --> tau+ tau- via an s-channel Higgs boson and estimate the sensitivity to this process from Upsilon --> gamma chi_{b0} --> gamma tau+ tau-. We show that future running at the Upsilon(3S) at a very high luminosity super B factory can put significant constraints on the Type-II two Higgs doublet model when the discovered 125 GeV Higgs boson is the heavier of the two CP-even scalars.

  15. NLO corrections to $\\chi_{bJ}$ two-body exclusive decay processes

    CERN Document Server

    Chen, Long-Bin

    2014-01-01

    The next-to-leading order QCD corrections for $\\chi_{bJ}$, the p-wave bottomonium, to $J/\\psi$ pair decay processes were evaluated utilizing NRQCD factorization formalism. It was determined that the scale dependence was depressed with NLO corrections, and hence the uncertainties in the leading order results were greatly reduced. The total branch ratios were found to be the order of $10^{-5}$ for all three $\\chi_{bJ}\\rightarrow J/\\psi J/\\psi$ processes,indicating that they were observable in the LHC and super-B experiments.

  16. The Rise and Fall of Debris Disks: MIPS Observations of h and chi Persei and the Evolution of Mid-IR Emission from Planet Formation

    CERN Document Server

    Currie, Thayne; Balog, Zoltan; Rieke, George; Bragg, Ann; Bromley, Ben

    2007-01-01

    We describe Spitzer/MIPS observations of the double cluster, h and $\\chi$ Persei, covering a $\\sim$ 0.6 square-degree area surrounding the cores of both clusters. The data are combined with IRAC and 2MASS data to investigate $\\sim$ 616 sources from 1.25-24 $\\mu m$. We use the long-baseline $K_{s}$-[24] color to identify two populations with IR excess indicative of circumstellar material: Be stars with 24 $\\mu m$ excess from optically-thin free free emission and 17 fainter sources (J$\\sim$ 14-15) with [24] excess consistent with a circumstellar disk. The frequency of IR excess for the fainter sources increases from 4.5 $\\mu m$ through 24 $\\mu m$. The IR excess is likely due to debris from the planet formation process. The wavelength-dependent behavior is consistent with an inside-out clearing of circumstellar disks. A comparison of the 24 $\\mu m$ excess population in h and $\\chi$ Per sources with results for other clusters shows that 24 $\\mu m$ emission from debris disks 'rises' from 5 to 10 Myr, peaks at $\\si...

  17. Retrievable IVC Square Stent Filter: Experimental Study

    International Nuclear Information System (INIS)

    Purpose: In vitro and in vivo evaluation of a new retrievable, home-made, inferior vena cava (IVC) Square stent filter (SSF) with two trapping levels. Methods: In vitro, the SSF was compared in a flow model with the stainless steel Greenfield filter (SGF) for emboli- trapping efficiency by serially passing 300 emboli of 3 and 6 mm in diameter and 15-30 mm in length in each type of filter. Nine swine were used for the in vivo testing of the SSF for deployment and retrievability, emboli-trapping efficiency, stability, and self-centering ability and two were used (total of 11 swine) for testing repositioning and retrievability of the SSF at 2 weeks and for gross and histologic IVC changes at 2 months. Results: In vitro, the SSF and SGF had similar efficiency in trapping large emboli but the SSF had significantly better efficiency than the SGF for trapping all sizes of emboli (91.7% vs 81%), medium size emboli (93% vs 80%), and small emboli (86% vs 69%). Efficiency decreased in both filters from the first to the fifth embolus in each series but was still significantly better for the SSF. With the SSF, 89% of emboli were caught at the primary and 11% at the secondary filtration level. In the nine animals used for acute studies, the SSF was easily placed in all 27 attempts, assumed a central position 26 times, and was easily retrieved in 21 of 22 attempts. One tilted filter needed additional manipulation for retrieval. During emboli injection in five swine, the SSF had 97.2% emboli-trapping efficiency and demonstrated good stability. In the two animals used for longer-term evaluation, the filters were easily retrieved 2 weeks after implantation. Histologic evaluation at 2 months showed neointimal proliferation around the SSF wires in contact with the IVC wall, which was otherwise normal. Conclusion: The SSF is a promising filter. It is easy to place and retrieve, is stable after placement, and has high efficiency for trapping emboli. Promising results justify further

  18. Introduction of a tryptophan side chain into subsite +1 enhances transglycosylation activity of a GH-18 chitinase from Arabidopsis thaliana, AtChiC

    DEFF Research Database (Denmark)

    Umemoto, Naoyuki; Ohnuma, Takayuki; Mizuhara, Mamiko; Sato, Hirokazu; Skriver, Karen; Fukamizo, Tamo

    2013-01-01

    A tryptophan side chain was introduced into subsite +1 of family GH-18 (class V) chitinases from Nicotiana tabacum and Arabidopsis thaliana (NtChiV and AtChiC, respectively) by the mutation of a glycine residue to tryptophan (G74W-NtChiV and G75W-AtChiC). The specific activity toward glycol chitin...

  19. Gravity as the Square of Gauge Theory

    Science.gov (United States)

    Kiermaier, M.

    The BCJ squaring relations provide a simple prescription for thecomputation of gravity amplitudes in terms of gauge theory ingredients. Unlike the KLT relations, the squaring relations are directly applicable both at tree and loop level. We review the derivation of these relations from on-shell recursion relations, and discuss an off-shell approach to these relations in which the interactions of the gravity Lagrangian arise as the square of the gauge-theory interactions. This article is based on work with Zvi Bern, Tristan Dennen and Yu-tin Huang [Z. Bern, T. Dennen, Y.-t. Huang and M. Kiermaier, Phys. Rev. D textbf{82} (2010), 065003, arXiv:1004.0693 (Ref. 1))] which was presented at String Field Theory and Related Aspects 2010.

  20. New Squaring Schema for Residue Number System

    Directory of Open Access Journals (Sweden)

    Mehdi Hosseinzadeh

    2011-07-01

    Full Text Available Residue number systems are an uncommon and non weighted numerical system. Some of methods of this systems are widely used in applications such as: digital signal processing, digital filters, coding, digital communication, RSA, Adhoc networks, distributed Storage and Retrieval Systems, error detection and correction and error tolerable systems. Computing the square is one of the important problems in this system that are applied in DSP applications based on RNS and even in computing the product. There are many methods that can compute square but most of them have a low speed or need high space. A new approach is proposed in this paper that can decrease squaring speed to a transistor delay

  1. Least Squares Data Fitting with Applications

    DEFF Research Database (Denmark)

    Hansen, Per Christian; Pereyra, Víctor; Scherer, Godela

    that help readers to understand and evaluate the computed solutions • many examples that illustrate the techniques and algorithms Least Squares Data Fitting with Applications can be used as a textbook for advanced undergraduate or graduate courses and professionals in the sciences and in engineering....... predictively. The main concern of Least Squares Data Fitting with Applications is how to do this on a computer with efficient and robust computational methods for linear and nonlinear relationships. The presentation also establishes a link between the statistical setting and the computational issues. In a......As one of the classical statistical regression techniques, and often the first to be taught to new students, least squares fitting can be a very effective tool in data analysis. Given measured data, we establish a relationship between independent and dependent variables so that we can use the data...

  2. Least squares methods in physics and engineering

    International Nuclear Information System (INIS)

    These lectures deal with numerical methods representing the state of the art, including the available computer software. First a brief background of basic matrix factorizations is given. Dense linear problems are then treated, including methods for updating the solution when rows and variables are added or deleted. Special consideration is given to weighted least squares problems and constrained problems. Regularization of ill-posed problems are briefly surveyed. Sparse linear least squares problems are treated in some detail. Different ordering schemes, including ordering to block-angular form and nested dissection, and iterative methods are discussed. Finally a survey of methods for nonlinear least squares problems is given. The Gauss-Newton method is analyzed and its local convergence derived. Levenberg-Marquardt methods are discussed and different methods using second derivative information surveyed. Special methods are given for separable linear-nonlinear problems. (orig.)

  3. Mikulášek Square Brno

    OpenAIRE

    Kociánová, Lenka

    2014-01-01

    The goal of this project is to design Mikulášek Square in Brno - Starý Lískovec as a place of social activities, cultural events and active relaxation in connection with a park and green vegetation. The square is a place of social contact, place of everyday life and cultural events, public, living and generally a busy place. The park is more restful, green and natural place. The park is a green framework of social interaction and rest in the urban surroundings. However, both have something in...

  4. Limitation of the Least Square Method in the Evaluation of Dimension of Fractal Brownian Motions

    CERN Document Server

    Qiao, Bingqiang; Zeng, Houdun; Li, Xiang; Dai, Benzhong

    2015-01-01

    With the standard deviation for the logarithm of the re-scaled range $\\langle |F(t+\\tau)-F(t)|\\rangle$ of simulated fractal Brownian motions $F(t)$ given in a previous paper \\cite{q14}, the method of least squares is adopted to determine the slope, $S$, and intercept, $I$, of the log$(\\langle |F(t+\\tau)-F(t)|\\rangle)$ vs $\\rm{log}(\\tau)$ plot to investigate the limitation of this procedure. It is found that the reduced $\\chi^2$ of the fitting decreases with the increase of the Hurst index, $H$ (the expectation value of $S$), which may be attributed to the correlation among the re-scaled ranges. Similarly, it is found that the errors of the fitting parameters $S$ and $I$ are usually smaller than their corresponding standard deviations. These results show the limitation of using the simple least square method to determine the dimension of a fractal time series. Nevertheless, they may be used to reinterpret the fitting results of the least square method to determine the dimension of fractal Brownian motions more...

  5. Robust Satellite Techniques (RST) for monitoring earthquake prone areas by satellite TIR observations: The case of 1999 Chi-Chi earthquake (Taiwan)

    Science.gov (United States)

    Genzano, N.; Filizzola, C.; Paciello, R.; Pergola, N.; Tramutoli, V.

    2015-12-01

    different years (from 1995 to 2002). In this dataset the Chi-Chi earthquake (MW = 7.6) which occurred on September 20, 1999 represents the major, but not unique, event. The analysis shows that all identified SSTAs occur in the pre-fixed space-time window around (in terms of time and location) earthquakes with M > 4. The false positive rate remains zero even if only earthquakes with M > 4.5 are considered. In the case of the Chi-Chi earthquake, 3 SSTAs were identified (all within the established space-time correlation window), one of them appearing about 2 weeks before and very close to the epicentre of the earthquake just along the associated tectonic lineaments. The wide considered space-time window, together with the high seismicity of the considered area, surely positively conditioned the achieved results, so that further analyses should be carried out by using longer datasets and different geographic areas. However, also considering the coincidence with other (possible) precursor phenomena, independently reported (particularly within the iSTEP project) at the time of the Chi Chi earthquake, achieved results seem already sufficient (at least) to qualify TIR anomalies (identified by RST) among the parameters to be considered in the framework of a multi-parametric approach to a time-Dependent Assessment of Seismic Hazard (t-DASH).

  6. Cynthia J. Najdowski: Psi Chi/APA Edwin B. Newman Graduate Research Award

    Science.gov (United States)

    American Psychologist, 2012

    2012-01-01

    Presents a short biography of the winner of the American Psychological Association's Psi Chi/APA Edwin B. Newman Graduate Research Award. The 2012 winner is Cynthia J. Najdowski for an outstanding research paper that examines how jurors' judgments are influenced by a juvenile defendant's confession and status as intellectually disabled. Through…

  7. Gregory Daniel Webster: Psi Chi/APA Edwin B. Newman Graduate Research Award.

    Science.gov (United States)

    2006-11-01

    Presents a citation for Gregory Daniel Webster, who received the Psi Chi/APA Edwin B. Newman Graduate Research Award "for an outstanding research paper whose findings report that APA journal articles became shorter in length after the year 2000." A brief profile and a selected bibliography accompany the citation. ((c) 2006 APA, all rights reserved). PMID:17115835

  8. Towards the Reuse of Municipal Biowastes in Vietnam: a case study about Ho Chi Minh City

    NARCIS (Netherlands)

    Buuren, van J.C.L.; Thi, Le K.O.

    2006-01-01

    Table of contents: 1. Solid waste segragation at source in Ho Chi Minh City. 2. Survey of technical efficiency and economic viability of existing composting ventures and survey of the institutional and regulatory framework regarding composting in Vietnam. 3. Demand analysis of urban waste compost. 4

  9. Hannah Höchi ja feministide peavoolu poliitikat häiriv eraelu / Rebeka Põldsam

    Index Scriptorium Estoniae

    Põldsam, Rebeka

    2010-01-01

    Saksa kunstniku Hannah Höchi näitus "Personal is Political. Hannah Höch ja tema kunsti tõlgendus" Tallinna Kunstihoones 17. oktoobrini 2010, kuraator Reet Varblane. Eksponeeritakse ka Guerrilla Girlsi (USA), Martha Rosleri (USA), Shadi Ghadiriani (Iraan), Anna-Stina Treumundi (Eesti) jt. töid

  10. Diabetes Control among Vietnamese Patients in Ho Chi Minh City: An Observational Cross-Sectional Study

    Science.gov (United States)

    Yokokawa, Hirohide; Khue, Nguyen Thy; Goto, Aya; Nam, Tran Quang; Trung, Tran The; Khoa, Vo Tuan; Ngoc, Nguyen Thi Boi; Minh, Pham Nghiem; Vinh, Nguyen Quang; Okayama, Akira; Yasumura, Seiji

    2010-01-01

    The objective of this study was to assess the extent of diabetic control and its associated factors among Vietnamese patients with diabetes mellitus (DM). The study was conducted among 652 outpatients who were recruited at a public general hospital (People Hospital 115) and a private clinic (Medic Center) in Ho Chi Minh City, Vietnam. Median age…

  11. Chi Sigma Iota Chapter Leadership and Professional Identity Development in Early Career Counselors

    Science.gov (United States)

    Luke, Melissa; Goodrich, Kristopher M.

    2010-01-01

    As the academic and professional honor society of counseling, Chi Sigma Iota (CSI) has been recognized in developing advocacy, leadership, and professional identity in student and professional members. A qualitative, grounded theory study was conducted to investigate experiences of 15 early career counselors who were CSI chapter leaders as…

  12. Observation of Persistent Edge Current Driven by Coaxial Helicity Injection (CHI)

    International Nuclear Information System (INIS)

    Coaxial Helicity Injection, CHI, has been used on the National Spherical Torus Experiment (NSTX) [M. Ono et al., Nucl. Fusion 40 (2000) 557], the Helicity Injected Torus (HIT) [B.A. Nelson et al., Phys. Rev. Lett. 72 (1994) 3666] and HIT-II [T.R. Jarboe et al., Phys. Plasmas 5 (1998) 1807] to initiate plasma and to drive up to 400 kA of toroidal current. On HIT-II, CHI initiated discharges have been successfully coupled to ohmic sustainment [R. Raman et al., Phys. Plasmas 11 (2004) 2565]. This paper presents the first results on the use of CHI to demonstrate the persistence of edge current drive in a preestablished single-null diverted inductive discharge. Edge current drive has the potential to improve plasma stability limits [J.E. Menard et al., Nucl. Fusion 37 (1997) 595]. While most current drive methods drive current in the interior of the plasma, CHI is well suited for driving current in the edge plasma

  13. $\\chi$EFT studies of few-nucleon systems: a status report

    CERN Document Server

    Schiavilla, R

    2015-01-01

    A status report on $\\chi$EFT studies of few-nucleon electroweak structure and dynamics is provided, including electromagnetic form factors of few-nucleon systems, the $pp$ weak fusion and muon weak captures on deuteron and $^3$He, and a number of parity-violating processes induced by hadronic weak interactions.

  14. City networks and commodity chains: identifying global flows and local connections in Ho Chi Minh City

    DEFF Research Database (Denmark)

    Vind, Ingeborg; Fold, Niels

    2010-01-01

    Any analytical framework for understanding actual forms of the intensified incorporation of cities into the world economy needs to go beyond the exclusive focus on advanced producer services, which is characteristic of most of the World City Network (WCN) approach. Simultaneously, an account of t...... electronics industry located in Ho Chi Minh City and the agricultural sector in its rural hinterland, the Mekong Delta....

  15. Light stop decays into $W b \\tilde{\\chi}_1^0$ near the kinematic threshold

    CERN Document Server

    Grober, Ramona; Popenda, Eva; Wlotzka, Alexander

    2015-01-01

    We investigate the decays of the light stop in scenarios with the lightest neutralino $\\tilde{\\chi}_1^0$ being the lightest supersymmetric particle, including flavour-violating (FV) effects. We analyse the region where the three-body decay $\\tilde{t}_1\\to W b \\tilde{\\chi}_1^0$ is kinematically allowed and provide a proper description of the transition region between the three-body decay and the four-body decay $\\tilde{t}_1 \\to\\tilde{\\chi}_1^0 b f \\bar{f}'$. The improved treatment has been implemented in the Fortran package {\\tt SUSY-HIT} and is used for the analysis of this region. A scan over the parameter range including all relevant experimental constraints reveals that the FV two-body decay into charm and $\\tilde{\\chi}_1^0$ can be as important as the three-, respectively, four-body decays if not dominant and therefore should be taken into account in order to complete the experimental searches for the light stop.

  16. Effects of Tai Chi exercise on physical and psychological health of older people.

    Science.gov (United States)

    Blake, Holly; Hawley, Helen

    2012-02-01

    Tai Chi is a traditional Chinese form of conditioning exercise derived from martial arts and rooted in eastern philosophy and Chinese Medicine. Based on the inter-relatedness of mind, body and spirit this form of exercise focuses on producing an inner calmness which is thought to have both physical and psychological therapeutic value. This article provides a brief overview of selected current evidence examining the relationship between Tai Chi and physical, neurocognitive and psychosocial outcomes in older people. This is an emerging and growing area of research and improvements have often been reported in health functioning, physical and emotional health, reducing falls, fear of falling and risk of falls, and possibly enhancing cardiovascular functioning in older adults although the effects on bone density, cognitive and immunological functioning are less clear. Results overall are inconsistent and health improvements have not been evident in all studies. Tai Chi is becoming increasingly popular in practice, and more recent evidence is emerging which is based on experimental and longitudinal designs, although many of the proposed benefits of Tai Chi are yet to be validated in large, randomised controlled trials. PMID:21762093

  17. The efficacy of Tai Chi Chuan in older adults: a systematic review

    NARCIS (Netherlands)

    A.P. Verhagen (Arianne); M. Immink; A. van der Meulen; S.M. Bierma-Zeinstra (Sita)

    2004-01-01

    textabstractOBJECTIVES: The purpose of this study was to assess the effect of Tai Chi Chuan (TCC) on fall prevention, balance and cardiorespiratory functions in the elderly. METHODS: A systematic review was carried out according to the Cochrane standards. A computerized literature

  18. Tai Chi and Qi Gong for Health and Well-Being

    Medline Plus

    Full Text Available ... Legislation Advisory Council Job Opportunities All About NCCIH Health Topics A-Z # A B C D E ... Y Z Tai Chi and Qi Gong for Health and Well-Being Share: taichi_nccamIMG_2962.jpg © ...

  19. Effects of Aging and Tai Chi on a Finger-Pointing Task with a Choice Paradigm

    Directory of Open Access Journals (Sweden)

    William W. N. Tsang

    2013-01-01

    Full Text Available Background. This cross-sectional study examined the effect of aging on performing finger-pointing tasks involving choices and whether experienced older Tai Chi practitioners perform better than healthy older controls in such tasks. Methods. Thirty students and 30 healthy older controls were compared with 31 Tai Chi practitioners. All the subjects performed a rapid index finger-pointing task. The visual signal appeared randomly under 3 conditions: (1 to touch a black ball as quickly and as accurately as possible, (2 not to touch a white ball, (3 to touch only the white ball when a black and a white ball appeared simultaneously. Reaction time (RT of anterior deltoid electromyogram, movement time (MT from electromyogram onset to touching of the target, end-point accuracy from the center of the target, and the number of wrong movements were recorded. Results. Young students displayed significantly faster RT and MT, achieving significantly greater end-point accuracy and fewer wrong movements than older controls. Older Tai Chi practitioners had significantly faster MT than older controls. Conclusion. Finger-pointing tasks with a choice paradigm became slower and less accurate with age. Positive findings suggest that Tai Chi may slow down the aging effect on eye-hand coordination tasks involving choices that require more cognitive progressing.

  20. $\\chi$EFT studies of few-nucleon systems: a status report

    Energy Technology Data Exchange (ETDEWEB)

    Schiavilla, Rocco [Thomas Jefferson National Accelerator Facility (TJNAF), Newport News, VA (United States); Old Dominion Univ., Norfolk, VA (United States)

    2016-06-01

    A status report on $\\chi$EFT studies of few-nucleon electroweak structure and dynamics is provided, including electromagnetic elastic form factors of few-nucleon systems, the $pp$ weak fusion and muon weak captures on deuteron and $^3$He, and a number of parity-violating processes induced by hadronic weak interactions.

  1. Moving least-squares corrections for smoothed particle hydrodynamics

    Directory of Open Access Journals (Sweden)

    Ciro Del Negro

    2011-12-01

    Full Text Available First-order moving least-squares are typically used in conjunction with smoothed particle hydrodynamics in the form of post-processing filters for density fields, to smooth out noise that develops in most applications of smoothed particle hydrodynamics. We show how an approach based on higher-order moving least-squares can be used to correct some of the main limitations in gradient and second-order derivative computation in classic smoothed particle hydrodynamics formulations. With a small increase in computational cost, we manage to achieve smooth density distributions without the need for post-processing and with higher accuracy in the computation of the viscous term of the Navier–Stokes equations, thereby reducing the formation of spurious shockwaves or other streaming effects in the evolution of fluid flow. Numerical tests on a classic two-dimensional dam-break problem confirm the improvement of the new approach.

  2. Least-squares finite element methods for quantum chromodynamics

    Energy Technology Data Exchange (ETDEWEB)

    Ketelsen, Christian [Los Alamos National Laboratory; Brannick, J [PENN STATE UNIV; Manteuffel, T [UNIV OF CO.; Mccormick, S [UNIV OF CO.

    2008-01-01

    A significant amount of the computational time in large Monte Carlo simulations of lattice quantum chromodynamics (QCD) is spent inverting the discrete Dirac operator. Unfortunately, traditional covariant finite difference discretizations of the Dirac operator present serious challenges for standard iterative methods. For interesting physical parameters, the discretized operator is large and ill-conditioned, and has random coefficients. More recently, adaptive algebraic multigrid (AMG) methods have been shown to be effective preconditioners for Wilson's discretization of the Dirac equation. This paper presents an alternate discretization of the Dirac operator based on least-squares finite elements. The discretization is systematically developed and physical properties of the resulting matrix system are discussed. Finally, numerical experiments are presented that demonstrate the effectiveness of adaptive smoothed aggregation ({alpha}SA ) multigrid as a preconditioner for the discrete field equations resulting from applying the proposed least-squares FE formulation to a simplified test problem, the 2d Schwinger model of quantum electrodynamics.

  3. Extrapolation of in situ data from 1-km squares to adjacent squares using remote sensed imagery and airborne lidar data for the assessment of habitat diversity and extent.

    Science.gov (United States)

    Lang, M; Vain, A; Bunce, R G H; Jongman, R H G; Raet, J; Sepp, K; Kuusemets, V; Kikas, T; Liba, N

    2015-03-01

    Habitat surveillance and subsequent monitoring at a national level is usually carried out by recording data from in situ sample sites located according to predefined strata. This paper describes the application of remote sensing to the extension of such field data recorded in 1-km squares to adjacent squares, in order to increase sample number without further field visits. Habitats were mapped in eight central squares in northeast Estonia in 2010 using a standardized recording procedure. Around one of the squares, a special study site was established which consisted of the central square and eight surrounding squares. A Landsat-7 Enhanced Thematic Mapper Plus (ETM+) image was used for correlation with in situ data. An airborne light detection and ranging (lidar) vegetation height map was also included in the classification. A series of tests were carried out by including the lidar data and contrasting analytical techniques, which are described in detail in the paper. Training accuracy in the central square varied from 75 to 100 %. In the extrapolation procedure to the surrounding squares, accuracy varied from 53.1 to 63.1 %, which improved by 10 % with the inclusion of lidar data. The reasons for this relatively low classification accuracy were mainly inherent variability in the spectral signatures of habitats but also differences between the dates of imagery acquisition and field sampling. Improvements could therefore be made by better synchronization of the field survey and image acquisition as well as by dividing general habitat categories (GHCs) into units which are more likely to have similar spectral signatures. However, the increase in the number of sample kilometre squares compensates for the loss of accuracy in the measurements of individual squares. The methodology can be applied in other studies as the procedures used are readily available. PMID:25648761

  4. Immunosuppressive CD11b+Ly6Chi monocytes in pristane-induced lupus mouse model.

    Science.gov (United States)

    Ma, Huijuan; Wan, Suigui; Xia, Chang-Qing

    2016-06-01

    Myeloid-derived suppressor cells with immunosuppressive functions have been described to be associated with one of the mechanisms by which malignant tumors escape immune surveillance. However, little is known about the role of myeloid-derived suppressor cells in autoimmunity. In the current study, when we attempted to characterize the peritoneal cells in pristane-induced lupus model, as reported previously, we observed that there were markedly increased CD11b(+)Ly6C(hi) monocytes. Surprisingly, this type of monocytes was almost phenotypically identical to the reported monocytic myeloid-derived suppressor cells. Further analysis on how these CD11b(+)Ly6C(hi) cells affected T cell response showed that they strongly suppressed T cell proliferation in vitro in a manner dependent on cell-cell contact, NO, and PGE2. In addition, we found that CD11b(+)Ly6C(hi) monocytes inhibited Th1 differentiation but enhanced development of forkhead box p3(+)CD4(+) regulatory T cells. Consistent with the in vitro experimental results, the in vivo adoptive cell transfer study showed that infusion of pristane-treated syngeneic CD11b(+)Ly6C(hi) monocytes significantly suppressed the production of anti-keyhole limpet hemocyanin antibodies induced by keyhole limpet hemocyanin immunization. In addition, we found that CD11b(+)Ly6C(hi) monocytes were also increased significantly in spleen and peripheral blood and showed immunosuppressive characteristics similar to their peritoneal counterparts. Our findings indicate that CD11b(+)Ly6C(hi) monocytes in a pristane-induced lupus mouse model are monocytic myeloid-derived suppressor cells instead of inflammatory monocytes, as demonstrated previously. To our knowledge, this is the first to describe myeloid-derived suppressor cells in a pristane-induced lupus mouse model, which may lead to a better understanding of the role of CD11b(+)Ly6C(hi) monocytes in this specific pristane-induced lupus model. PMID:26657791

  5. Deformation analysis with Total Least Squares

    Directory of Open Access Journals (Sweden)

    M. Acar

    2006-01-01

    Full Text Available Deformation analysis is one of the main research fields in geodesy. Deformation analysis process comprises measurement and analysis phases. Measurements can be collected using several techniques. The output of the evaluation of the measurements is mainly point positions. In the deformation analysis phase, the coordinate changes in the point positions are investigated. Several models or approaches can be employed for the analysis. One approach is based on a Helmert or similarity coordinate transformation where the displacements and the respective covariance matrix are transformed into a unique datum. Traditionally a Least Squares (LS technique is used for the transformation procedure. Another approach that could be introduced as an alternative methodology is the Total Least Squares (TLS that is considerably a new approach in geodetic applications. In this study, in order to determine point displacements, 3-D coordinate transformations based on the Helmert transformation model were carried out individually by the Least Squares (LS and the Total Least Squares (TLS, respectively. The data used in this study was collected by GPS technique in a landslide area located nearby Istanbul. The results obtained from these two approaches have been compared.

  6. Iterative methods for weighted least-squares

    Energy Technology Data Exchange (ETDEWEB)

    Bobrovnikova, E.Y.; Vavasis, S.A. [Cornell Univ., Ithaca, NY (United States)

    1996-12-31

    A weighted least-squares problem with a very ill-conditioned weight matrix arises in many applications. Because of round-off errors, the standard conjugate gradient method for solving this system does not give the correct answer even after n iterations. In this paper we propose an iterative algorithm based on a new type of reorthogonalization that converges to the solution.

  7. Square root kalman filter with contaminated observations

    OpenAIRE

    Cipra, Tomas; Romera, Rosario; Rubio, A.

    1992-01-01

    The algorithm of square root Kalman filtering for the case of contaminated observations is described in the paper. This algorithm is suitable for the parallel computer implementation allowing to treat dynamic linear systems with large number of state variables in a robust recursive way.

  8. Kendall Square multiprocessor: Early experiences and performance

    Energy Technology Data Exchange (ETDEWEB)

    Dunigan, T.H.

    1992-04-01

    Initial performance results and early experiences are reported for the Kendall Square Research multiprocessor. The basic architecture of the shared-memory multiprocessor is described, and computational and I/O performance is measured for both serial and parallel programs. Experiences in porting various applications are described.

  9. Nonlinear Brownian motion - mean square displacement

    Directory of Open Access Journals (Sweden)

    W.Ebeling

    2004-01-01

    Full Text Available The stochastic dynamics of self-propelled Brownian particles is studied by means of the Langevin and the Fokker-Planck approach. We model the driving by a nonlinear friction function which has a negative part at small velocities, leading to active Brownian motion of the particles. The mean square displacement is estimated analytically and compared with numerical simulations.

  10. Clar sextets in square graphene antidot lattices

    DEFF Research Database (Denmark)

    Petersen, Rene; Pedersen, Thomas Garm; Jauho, Antti-Pekka

    2011-01-01

    A periodic array of holes transforms graphene from a semimetal into a semiconductor with a band gap tuneable by varying the parameters of the lattice. In earlier work only hexagonal lattices have been treated. Using atomistic models we here investigate the size of the band gap of a square lattice...

  11. An algorithm for nonlinear least squares

    Czech Academy of Sciences Publication Activity Database

    Balda, Miroslav

    Praha : Humusoft, 2007, s. 1-8. ISBN 978-80-7080-658-6. [Technical Computing Prague 2007. Praha (CZ), 14.11.2007] R&D Projects: GA ČR GA101/05/0199 Institutional research plan: CEZ:AV0Z20760514 Keywords : optimization * least squares * MATLAB Subject RIV: JC - Computer Hardware ; Software

  12. Chains of coupled square dielectric optical microcavities

    NARCIS (Netherlands)

    Hammer, Manfred

    2009-01-01

    Chains of coupled square dielectric cavities are investigated in a 2-D setting, by means of a quasi-analytical eigenmode expansion method. Resonant transfer of optical power can be achieved along quite arbitrary, moderately long rectangular paths (up to 9 coupled cavities are considered), even with

  13. Tai Chi on psychological well-being: systematic review and meta-analysis

    Directory of Open Access Journals (Sweden)

    Scott Tammy

    2010-05-01

    Full Text Available Abstract Background Physical activity and exercise appear to improve psychological health. However, the quantitative effects of Tai Chi on psychological well-being have rarely been examined. We systematically reviewed the effects of Tai Chi on stress, anxiety, depression and mood disturbance in eastern and western populations. Methods Eight English and 3 Chinese databases were searched through March 2009. Randomized controlled trials, non-randomized controlled studies and observational studies reporting at least 1 psychological health outcome were examined. Data were extracted and verified by 2 reviewers. The randomized trials in each subcategory of health outcomes were meta-analyzed using a random-effects model. The quality of each study was assessed. Results Forty studies totaling 3817 subjects were identified. Approximately 29 psychological measurements were assessed. Twenty-one of 33 randomized and nonrandomized trials reported that 1 hour to 1 year of regular Tai Chi significantly increased psychological well-being including reduction of stress (effect size [ES], 0.66; 95% confidence interval [CI], 0.23 to 1.09, anxiety (ES, 0.66; 95% CI, 0.29 to 1.03, and depression (ES, 0.56; 95% CI, 0.31 to 0.80, and enhanced mood (ES, 0.45; 95% CI, 0.20 to 0.69 in community-dwelling healthy participants and in patients with chronic conditions. Seven observational studies with relatively large sample sizes reinforced the beneficial association between Tai Chi practice and psychological health. Conclusions Tai Chi appears to be associated with improvements in psychological well-being including reduced stress, anxiety, depression and mood disturbance, and increased self-esteem. Definitive conclusions were limited due to variation in designs, comparisons, heterogeneous outcomes and inadequate controls. High-quality, well-controlled, longer randomized trials are needed to better inform clinical decisions.

  14. Graphs whose Complement and Square are Isomorphic (extended version)

    DEFF Research Database (Denmark)

    Pedersen, Anders Sune; Milanic, Martin; Verret, Gabriel; Pellicer, Daniel

    2013-01-01

    We study square-complementary graphs, that is, graphs whose comple- ment and square are isomorphic. We prove several necessary conditions for a graph to be square-complementary, describe ways of building new square-complementary graphs from existing ones, construct innite families of square......-complementary graphs, and characterize square-complementary graphs within various graph classes. The bipartite case turns out to be of particular interest....

  15. Mathematical Construction of Magic Squares Utilizing Base-N Arithmetic

    Science.gov (United States)

    O'Brien, Thomas D.

    2006-01-01

    Magic squares have been of interest as a source of recreation for over 4,500 years. A magic square consists of a square array of n[squared] positive and distinct integers arranged so that the sum of any column, row, or main diagonal is the same. In particular, an array of consecutive integers from 1 to n[squared] forming an nxn magic square is…

  16. An independence test for continuous and categorical ordinal data based on a sign correlation related to Kendall's tau

    CERN Document Server

    Bergsma, Wicher

    2010-01-01

    The standard two-variable chi-square test is typically consistent for all alternatives to independence, but effectively treats the data as nominal which may lead to loss of power for ordinal data. Alternatively, a test based on Kendall's tau does take ordinality into account, but only has power against a narrow set of alternatives. This paper introduces a new test aimed at filling this gap, i.e., it is designed for ordinal data and to have omnibus asymptotic power. Our test is a permutation test based on a modification of Kendall's tau, denoted $\\tau^*$. Based on partial proofs and numerical evidence, we conjecture $\\tau^*$ to be nonnegative, and zero if and only if independence holds. An interpretation of $\\tau^*$ in terms of concordance and discordance for sets of four observations is given. The new coefficient is a sign version of a correlation coefficient introduced by \\citeA{bergsma06}.

  17. Observation of chi(cJ) decaying into the p(p)over-barK(+)K(-) final state

    NARCIS (Netherlands)

    Ablikim, M.; Achasov, M. N.; Alberto, D.; An, L.; An, Q.; An, Z. H.; Bai, J. Z.; Baldini, R.; Ban, Y.; Becker, J.; Berger, N.; Bertani, M.; Bian, J. M.; Bondarenko, O.; Boyko, I.; Briere, R. A.; Bytev, V.; Cai, X.; Cao, G. F.; Cao, X. X.; Chang, J. F.; Chelkov, G.; Chen, G.; Chen, H. S.; Chen, J. C.; Chen, M. L.; Chen, S. J.; Chen, Y.; Chen, Y. B.; Cheng, H. P.; Chu, Y. P.; Cronin-Hennessy, D.; Dai, H. L.; Dai, J. P.; Dedovich, D.; Deng, Z. Y.; Denysenko, I.; Destefanis, M.; Ding, Y.; Dong, L. Y.; Dong, M. Y.; Du, S. X.; Fan, R. R.; Fang, J.; Fang, S. S.; Feng, C. Q.; Fu, C. D.; Fu, J. L.; Gao, Y.; Geng, C.; Goetzen, K.; Gong, W. X.; Greco, M.; Grishin, S.; Gu, M. H.; Gu, Y. T.; Guan, Y. H.; Guo, A. Q.; Guo, L. B.; Guo, Y. P.; Hao, X. Q.; Harris, F. A.; He, K. L.; He, M.; He, Z. Y.; Heng, Y. K.; Hou, Z. L.; Hu, H. M.; Hu, J. F.; Hu, T.; Huang, B.; Huang, G. M.; Huang, J. S.; Huang, X. T.; Huang, Y. P.; Hussain, T.; Ji, C. S.; Ji, Q.; Ji, X. B.; Ji, X. L.; Jia, L. K.; Jiang, L. L.; Jiang, X. S.; Jiao, J. B.; Jiao, Z.; Jin, D. P.; Jin, S.; Jing, F. F.; Kalantar-Nayestanaki, N.; Kavatsyuk, M.; Komamiya, S.; Kuehn, W.; Lange, J. S.; Leung, J. K. C.; Li, Cheng; Li, Cui; Li, D. M.; Li, F.; Li, G.; Li, H. B.; Li, J. C.; Li, Lei; Li, N. B.; Li, Q. J.; Li, W. D.; Li, W. G.; Li, X. L.; Li, X. N.; Li, X. Q.; Li, X. R.; Li, Z. B.; Liang, H.; Liang, Y. F.; Liang, Y. T.; Liao, G. R.; Liao, X. T.; Liu, B. J.; Liu, B. J.; Liu, C. L.; Liu, C. X.; Liu, C. Y.; Liu, F. H.; Liu, Fang; Liu, G. C.; Liu, H.; Liu, H. B.; Liu, H. M.; Liu, H. W.; Liu, J. P.; Liu, K.; Liu, K. Y.; Liu, Q.; Liu, S. B.; Liu, X.; Liu, X. H.; Liu, Y. B.; Liu, Y. W.; Liu, Yong; Liu, Z. A.; Liu, Z. Q.; Loehner, H.; Lu, G. R.; Lu, H. J.; Lu, J. G.; Lu, Q. W.; Lu, X. R.; Lu, Y. P.; Luo, C. L.; Luo, M. X.; Luo, T.; Luo, X. L.; Ma, C. L.; Ma, F. C.; Ma, H. L.; Ma, Q. M.; Ma, T.; Ma, X.; Ma, X. Y.; Maggiora, M.; Malik, Q. A.; Mao, H.; Mao, Y. J.; Mao, Z. P.; Messchendorp, J. G.; Min, J.; Mitchell, R. E.; Mo, X. H.; Muchnoi, N. Yu.; Nefedov, Y.; Ning, Z.; Olsen, S. L.; Ouyang, Q.; Pacetti, S.; Pelizaeus, M.; Peters, K.; Ping, J. L.; Ping, R. G.; Poling, R.; Pun, C. S. J.; Qi, M.; Qian, S.; Qiao, C. F.; Qin, X. S.; Qiu, J. F.; Rashid, K. H.; Rong, G.; Ruan, X. D.; Sarantsev, A.; Schulze, J.; Shao, M.; Shen, C. P.; Shen, X. Y.; Sheng, H. Y.; Shepherd, M. R.; Song, X. Y.; Sonoda, S.; Spataro, S.; Spruck, B.; Sun, D. H.; Sun, G. X.; Sun, J. F.; Sun, S. S.; Sun, X. D.; Sun, Y. J.; Sun, Y. Z.; Sun, Z. J.; Sun, Z. T.; Tang, C. J.; Tang, X.; Tang, X. F.; Tian, H. L.; Toth, D.; Varner, G. S.; Wan, X.; Wang, B. Q.; Wang, K.; Wang, L. L.; Wang, L. S.; Wang, M.; Wang, P.; Wang, P. L.; Wang, Q.; Wang, S. G.; Wang, X. L.; Wang, Y. D.; Wang, Y. F.; Wang, Y. Q.; Wang, Z.; Wang, Z. G.; Wang, Z. Y.; Wei, D. H.; Wen, Q. G.; Wen, S. P.; Wiedner, U.; Wu, L. H.; Wu, N.; Wu, W.; Wu, Z.; Xiao, Z. J.; Xie, Y. G.; Xu, G. F.; Xu, G. M.; Xu, H.; Xu, Y.; Xu, Z. R.; Xu, Z. Z.; Xue, Z.; Yan, L.; Yan, W. B.; Yan, Y. H.; Yang, H. X.; Yang, M.; Yang, T.; Yang, Y.; Yang, Y. X.; Ye, M.; Ye, M. H.; Yu, B. X.; Yu, C. X.; Yu, L.; Yuan, C. Z.; Yuan, W. L.; Yuan, Y.; Zafar, A. A.; Zallo, A.; Zeng, Y.; Zhang, B. X.; Zhang, B. Y.; Zhang, C. C.; Zhang, D. H.; Zhang, H. H.; Zhang, H. Y.; Zhang, J.; Zhang, J. W.; Zhang, J. Y.; Zhang, J. Z.; Zhang, L.; Zhang, S. H.; Zhang, T. R.; Zhang, X. J.; Zhang, X. Y.; Zhang, Y.; Zhang, Y. H.; Zhang, Z. P.; Zhang, Z. Y.; Zhao, G.; Zhao, H. S.; Zhao, Jiawei; Zhao, Jingwei; Zhao, Lei; Zhao, Ling; Zhao, M. G.; Zhao, Q.; Zhao, S. J.; Zhao, T. C.; Zhao, X. H.; Zhao, Y. B.; Zhao, Z. G.; Zhao, Z. L.; Zhemchugov, A.; Zheng, B.; Zheng, J. P.; Zheng, Y. H.; Zheng, Z. P.; Zhong, B.; Zhong, J.; Zhong, L.; Zhou, L.; Zhou, X. K.; Zhou, X. R.; Zhu, C.; Zhu, K.; Zhu, K. J.; Zhu, S. H.; Zhu, X. L.; Zhu, X. W.; Zhu, Y. S.; Zhu, Z. A.; Zhuang, J.; Zou, B. S.; Zou, J. H.; Zuo, J. X.; Zweber, P.

    2011-01-01

    First measurements of the decays of the three chi(cJ) states to p (p) over barK(+)K(-) final states are presented. Intermediate phi -> K+K- and Lambda(1520) -> pK(-) resonance states are observed, and branching fractions for chi(cJ) -> (p) over barK(+) Lambda(1520), Lambda(1520)(Lambda) over bar (15

  18. Enhancing the Psychological Well-Being of Elderly Individuals through Tai Chi Exercise: A Latent Growth Curve Analysis.

    Science.gov (United States)

    Li, Fuzhong; Duncan, Terry E.; Duncan, Susan C.; McAuley, Edward; Chaumeton, Nigel R.; Harmer, Peter

    2001-01-01

    Examined whether a Tai Chi exercise program enhanced the psychological well-being of 98 elderly individuals. Analyzed repeated measures data about participants using latent growth curve analysis. Results indicate the beneficial effects of participation in the Tai Chi program. Discusses implications related to the exercise-psychological health…

  19. Multi-source least-squares reverse time migration

    KAUST Repository

    Dai, Wei

    2012-06-15

    Least-squares migration has been shown to improve image quality compared to the conventional migration method, but its computational cost is often too high to be practical. In this paper, we develop two numerical schemes to implement least-squares migration with the reverse time migration method and the blended source processing technique to increase computation efficiency. By iterative migration of supergathers, which consist in a sum of many phase-encoded shots, the image quality is enhanced and the crosstalk noise associated with the encoded shots is reduced. Numerical tests on 2D HESS VTI data show that the multisource least-squares reverse time migration (LSRTM) algorithm suppresses migration artefacts, balances the amplitudes, improves image resolution and reduces crosstalk noise associated with the blended shot gathers. For this example, the multisource LSRTM is about three times faster than the conventional RTM method. For the 3D example of the SEG/EAGE salt model, with a comparable computational cost, multisource LSRTM produces images with more accurate amplitudes, better spatial resolution and fewer migration artefacts compared to conventional RTM. The empirical results suggest that multisource LSRTM can produce more accurate reflectivity images than conventional RTM does with a similar or less computational cost. The caveat is that the LSRTM image is sensitive to large errors in the migration velocity model. © 2012 European Association of Geoscientists & Engineers.

  20. The Spanish Square Kilometre Array White Book

    CERN Document Server

    Pulido, J A Acosta; Alberdi, A; Alcolea, J; Alfaro, E J; Alonso-Herrero, A; Anglada, G; Arnalte-Mur, P; Ascasibar, Y; Ascaso, B; Azulay, R; Bachiller, R; Baez-Rubio, A; Battaner, E; Blasco, J; Brook, C B; Bujarrabal, V; Busquet, G; Caballero-Garcia, M D; Carrasco-Gonzalez, C; Casares, J; Castro-Tirado, A J; Colina, L; Colomer, F; de Gregorio-Monsalvo, I; del Olmo, A; Desmurs, J-F; Diego, J M; Dominguez-Tenreiro, R; Estalella, R; Fernandez-Soto, A; Florido, E; Font, J; Font, J A; Fuente, A; Garcia-Burillo, S; Garcia-Benito, R; Garcia-Lorenzo, B; de Paz, A Gil; Girart, J M; Goicoechea, J R; Gomez, J F; Gonzalez-Garcia, M; Gonzalez-Martin, O; Gonzalez-Serrano, J I; Gorgas, J; Gorosabel, J; Guijarro, A; Guirado, J C; Hernandez-Garcia, L; Hernandez-Monteagudo, C; Herranz, D; Herrero-Illana, R; Hu, Y-D; Huelamo, N; Huertas-Company, M; Iglesias-Paramo, J; Jeong, S; Jimenez-Serra, I; Knapen, J H; Lineros, R A; Lisenfeld, U; Marcaide, J M; Marquez, I; Marti, J; Marti, J M; Martinez-Gonzalez, E; Martin-Pintado, J; Marti-Vidal, I; Masegosa, J; Mayen-Gijon, J M; Mezcua, M; Mimica, S/ Migliari P; Moldon, J; Morata, O; Negueruela, I; Oates, S R; Osorio, M; Palau, A; Paredes, J M; Perea, J; Perez-Gonzalez, P G; Perez-Montero, E; Perez-Torres, M A; Perucho, M; Planelles, S; Pons, J A; Prieto, A; Quilis, V; Ramirez-Moreta, P; Almeida, C Ramos; Rea, N; Ribo, M; Rioja, M J; Espinosa, J M Rodriguez; Ros, E; Rubiño-Martin, J A; Ruiz-Granados, B; Sabater, J; Sanchez, M A P; Usero, A; Verdes-Montenegro, L; Vidal-Garcia, A; Vielva, P; Vilchez, J; Zhang, B-B

    2015-01-01

    The Square Kilometre Array (SKA) is called to revolutionise essentially all areas of Astrophysics. With a collecting area of about a square kilometre, the SKA will be a transformational instrument, and its scientific potential will go beyond the interests of astronomers. Its technological challenges and huge cost requires a multinational effort, and Europe has recognised this by putting the SKA on the roadmap of the European Strategy Forum for Research Infrastructures (ESFRI). The Spanish SKA White Book is the result of the coordinated effort of 119 astronomers from 40 different research centers. The book shows the enormous scientific interest of the Spanish astronomical community in the SKA and warrants an optimum scientific exploitation of the SKA by Spanish researchers, if Spain enters the SKA project.

  1. Accelerator modes of square well system

    OpenAIRE

    Sankaranarayanan, R; Sheorey, V.B.

    2002-01-01

    We study accelerator modes of a particle, confined in an one-dimensional infinite square well potential, subjected to a time-periodic pulsed field. Dynamics of such a particle can be described by one generalization of the kicked rotor. In comparison with the kicked rotor, this generalization is shown to have a much larger parametric space for existence of the modes. Using this freedom we provide evidence that accelerator mode assisted anomalous transport is greatly enhanced when low order res...

  2. Coefficients of symmetric square L-functions

    Institute of Scientific and Technical Information of China (English)

    LAU; Yuk-Kam

    2010-01-01

    Let λsym2f(n) be the n-th coefficient in the Dirichlet series of the symmetric square L-function associated with a holomorphic primitive cusp form f.We prove Ω± results for λsym2f(n) and evaluate the number of positive(resp.,negative) λsym2f(n) in some intervals.

  3. Discrete least squares approximation with polynomial vectors

    OpenAIRE

    Van Barel, Marc; Bultheel, Adhemar

    1993-01-01

    We give a solution of a discrete least squares approximation problem in terms of orthogonal polynomial vectors. The degrees of the polynomial elements of these vectors can be different. An algorithm is constructed computing the coefficients of recurrence relations for the orthogonal polynomial vectors. In case the function values are prescribed in points on the real line or on the unit circle variants of the original algorithm can be designed which are an order of magnitude more efficient. Al...

  4. Nanoparticle formulation by Büchi B-90 Nano Spray Dryer for oral mucoadhesion

    Directory of Open Access Journals (Sweden)

    Harsha SN

    2015-01-01

    Full Text Available Sree N Harsha,1 Bander E Aldhubiab,1 Anroop B Nair,1 Ibrahim Abdulrahman Alhaider,1 Mahesh Attimarad,1 Katharigatta N Venugopala,1  Saminathan Srinivasan,2 Nagesh Gangadhar,2 Afzal Haq Asif3 1Department of Pharmaceutical Sciences, College of Clinical Pharmacy, King Faisal University, Al-Ahsa, Saudi Arabia; 2Department of Pharmaceutics, East Point College of Pharmacy, Bangalore, India; 3Department of Pharmacy Practice, College of Clinical Pharmacy, King Faisal University, Al-Ahsa, Saudi Arabia Abstract: Diabetes is considered one of the main threats to global public health in this era. It is increasing rapidly in every part of the world; the prevalence of the disease will grow to the point where 366 million people will be affected by 2030. The prevalence of diabetes mellitus (DM in the Saudi population is high, and the majority of patients suffer from type 2 DM. Marketed oral antidiabetic drugs have indicated poor tolerability during chronic treatments, and this contributes to the moderately large proportion of type 2 DM patients that remain inadequately managed. Vildagliptin nanospheres were prepared with aminated gelatin using a spray-drying method; narrow particle-size distribution was seen at 445 nm. The angle of repose was found to be θ <33.5°. The nanospheres appeared to be spherical with a smooth surface. The drug content and percentage yield of the nanospheres were found to be 76.2%±4.6% and 83%±2%, respectively. The nanosphere-swell profile was found to be 165%±7%. The pure drug was 100% dissolved in 30 minutes, and the nanosphere formulation took 12 hours to dissolve (97.5%±2%, and followed a Korsmeyer–Peppas kinetic model with an R2 of 0.9838. The wash-off test of nanospheres found that they exhibited an excellent mucoadhesive property at 86.7% for 8 hours. The stability-study data showed no changes in the physicochemical properties of the nanospheres, and suggested that the nanospheres be stored below room

  5. Self-avoiding walks crossing a square

    International Nuclear Information System (INIS)

    We study a restricted class of self-avoiding walks (SAWs) which start at the origin (0, 0), end at (L, L), and are entirely contained in the square [0, L] x [0, L] on the square lattice Z2. The number of distinct walks is known to grow as λL2+o(L2). We estimate λ = 1.744 550 ± 0.000 005 as well as obtaining strict upper and lower bounds, 1.628 1/3). We also consider the model in which a weight or fugacity x is associated with each step of the walk. This gives rise to a canonical model of a phase transition. For x 1/μ it grows as L2. Here μ is the growth constant of unconstrained SAWs in Z2. For x = 1/μ we provide numerical evidence, but no proof, that the average walk length grows as L4/3. Another problem we study is that of SAWs, as described above, that pass through the central vertex of the square. We estimate the proportion of such walks as a fraction of the total, and find it to be just below 80% of the total number of SAWs. We also consider Hamiltonian walks under the same restriction. They are known to grow as τL2+o(L2) on the same L x L lattice. We give precise estimates for τ as well as upper and lower bounds, and prove that τ < λ

  6. Advancing Astrophysics with the Square Kilometre Array

    CERN Document Server

    Fender, Rob; Govoni, Federica; Green, Jimi; Hoare, Melvin; Jarvis, Matt; Johnston-Hollitt, Melanie; Keane, Evan; Koopmans, Leon; Kramer, Michael; Maartens, Roy; Macquart, Jean-Pierre; Mellema, Garrelt; Oosterloo, Tom; Prandoni, Isabella; Pritchard, Jonathan; Santos, Mario; Seymour, Nick; Stappers, Ben; Staveley-Smith, Lister; Tian, Wen Wu; Umana, Grazia; Wagg, Jeff; Bourke, Tyler L; AASKA14

    2015-01-01

    In 2014 it was 10 years since the publication of the comprehensive ‘Science with the Square Kilometre Array’ book and 15 years since the first such volume appeared in 1999. In that time numerous and unexpected advances have been made in the fields of astronomy and physics relevant to the capabilities of the Square Kilometre Array (SKA). The SKA itself progressed from an idea to a developing reality with a baselined Phase 1 design (SKA1) and construction planned from 2017. To facilitate the publication of a new, updated science book, which will be relevant to the current astrophysical context, the meeting "Advancing Astrophysics with the Square Kilometre Array" was held in Giardina Naxos, Sicily. Articles were solicited from the community for that meeting to document the scientific advances enabled by the first phase of the SKA and those pertaining to future SKA deployments, with expected gains of 5 times the Phase 1 sensitivity below 350 MHz, about 10 times the Phase 1 sensitivity above 350 MHz and with f...

  7. Risk and Management Control: A Partial Least Square Modelling Approach

    DEFF Research Database (Denmark)

    Nielsen, Steen; Pontoppidan, Iens Christian

    and interrelations between risk and areas within management accounting. The idea is that management accounting should be able to conduct a valid feed forward but also predictions for decision making including risk. This study reports the test of a theoretical model using partial least squares (PLS) on survey data...... and a external attitude dimension. The results have important implications for both management control research and for the management control systems design for the way accountants consider the element of risk in their different tasks, both operational and strategic. Specifically, it seems that different risk...

  8. Global Climate Change and Solutions for Urban Sustainability of Ho Chi Minh City, Vietnam

    Directory of Open Access Journals (Sweden)

    Dao Phan

    2015-03-01

    Full Text Available Ho Chi Minh City (HCMC, the largest city in Vietnam, is steadily growing, certainly towards a mega city in the near future. Like other mega cities at the boom stage, it has to face with serious environmental matters insolvable for many years. The situation may be worse under the effects of global climate change, geological subsidence due to non-standard construction and sea level rise. The situation of HCMC can be damaged or even broken by resonant effects of unsolved environmental matters and latent impacts of climate change. This article shows the challenges to the urban sustainable development under the duo effect of urban environmental matters and climate change in Ho Chi Minh City. Opportunities and strategic directions to overcome the challenges are also analyzed and recommended.

  9. Study of \\chi_{bJ}(1P) Properties in the Radiative \\Upsilon(2S) Decays

    CERN Document Server

    Abdesselam, A; Adamczyk, K; Aihara, H; Said, S Al; Arinstein, K; Arita, Y; Asner, D M; Aso, T; Atmacan, H; Aulchenko, V; Aushev, T; Ayad, R; Aziz, T; Babu, V; Badhrees, I; Bahinipati, S; Bakich, A M; Bala, A; Ban, Y; Bansal, V; Barberio, E; Barrett, M; Bartel, W; Bay, A; Bedny, I; Behera, P; Belhorn, M; Belous, K; Berger, M; Besson, D; Bhardwaj, V; Bhuyan, B; Biswal, J; Bloomfield, T; Blyth, S; Bobrov, A; Bondar, A; Bonvicini, G; Bookwalter, C; Boulahouache, C; Bozek, A; Bračko, M; Breibeck, F; Brodzicka, J; Browder, T E; Waheed, E; Červenkov, D; Chang, M -C; Chang, P; Chao, Y; Chekelian, V; Chen, A; Chen, K -F; Chen, P; Cheon, B G; Chilikin, K; Chistov, R; Cho, K; Chobanova, V; Choi, S -K; Choi, Y; Cinabro, D; Crnkovic, J; Dalseno, J; Danilov, M; Dash, N; Di Carlo, S; Dingfelder, J; Doležal, Z; Dossett, D; Drásal, Z; Drutskoy, A; Dubey, S; Dutta, D; Dutta, K; Eidelman, S; Epifanov, D; Esen, S; Farhat, H; Fast, J E; Feindt, M; Ferber, T; Frey, A; Frost, O; Fulsom, B G; Gaur, V; Gabyshev, N; Ganguly, S; Garmash, A; Getzkow, D; Gillard, R; Giordano, F; Glattauer, R; Goh, Y M; Goldenzweig, P; Golob, B; Greenwald, D; Perdekamp, M Grosse; Grygier, J; Grzymkowska, O; Guo, H; Haba, J; Hamer, P; Han, Y L; Hara, K; Hara, T; Hasegawa, Y; Hasenbusch, J; Hayasaka, K; Hayashii, H; He, X H; Heck, M; Hedges, M T; Heffernan, D; Heider, M; Heller, A; Higuchi, T; Himori, S; Hirose, S; Horiguchi, T; Hoshi, Y; Hoshina, K; Hou, W -S; Hsiung, Y B; Hsu, C -L; Huschle, M; Hyun, H J; Igarashi, Y; Iijima, T; Imamura, M; Inami, K; Inguglia, G; Ishikawa, A; Itagaki, K; Itoh, R; Iwabuchi, M; Iwasaki, M; Iwasaki, Y; Iwata, S; Jacobs, W W; Jaegle, I; Jeon, H B; Joffe, D; Jones, M; Joo, K K; Julius, T; Kakuno, H; Kang, J H; Kang, K H; Kapusta, P; Kataoka, S U; Kato, E; Kato, Y; Katrenko, P; Kawai, H; Kawasaki, T; Keck, T; Kichimi, H; Kiesling, C; Kim, B H; Kim, D Y; Kim, H J; Kim, H -J; Kim, J B; Kim, J H; Kim, K T; Kim, M J; Kim, S H; Kim, S K; Kim, Y J; Kinoshita, K; Kleinwort, C; Klucar, J; Ko, B R; Kobayashi, N; Koblitz, S; Kodyš, P; Koga, Y; Korpar, S; Kotchetkov, D; Kouzes, R T; Križan, P; Krokovny, P; Kronenbitter, B; Kuhr, T; Kulasiri, L; Kumar, R; Kumita, T; Kurihara, E; Kuroki, Y; Kuzmin, A; Kvasnička, P; Kwon, Y -J; Lai, Y -T; Lange, J S; Lee, D H; Lee, I S; Lee, S -H; Leitgab, M; Leitner, R; Levit, D; Lewis, P; Li, C H; Li, H; Li, J; Li, L; Li, X; Li, Y; Gioi, L Li; Libby, J; Limosani, A; Liu, C; Liu, Y; Liu, Z Q; Liventsev, D; Loos, A; Louvot, R; Lubej, M; Lukin, P; Luo, T; MacNaughton, J; Masuda, M; Matsuda, T; Matvienko, D; Matyja, A; McOnie, S; Mikami, Y; Miyabayashi, K; Miyachi, Y; Miyake, H; Miyata, H; Miyazaki, Y; Mizuk, R; Mohanty, G B; Mohanty, S; Mohapatra, D; Moll, A; Moon, H K; Mori, T; Morii, T; Moser, H -G; Müller, T; Muramatsu, N; Mussa, R; Nagamine, T; Nagasaka, Y; Nakahama, Y; Nakamura, I; Nakamura, K R; Nakano, E; Nakano, H; Nakano, T; Nakao, M; Nakayama, H; Nakazawa, H; Nanut, T; Nath, K J; Natkaniec, Z; Nayak, M; Nedelkovska, E; Negishi, K; Neichi, K; Ng, C; Niebuhr, C; Niiyama, M; Nisar, N K; Nishida, S; Nishimura, K; Nitoh, O; Nozaki, T; Ogawa, A; Ogawa, S; Ohshima, T; Okuno, S; Olsen, S L; Ono, Y; Onuki, Y; Ostrowicz, W; Oswald, C; Ozaki, H; Pakhlov, P; Pakhlova, G; Pal, B; Palka, H; Panzenböck, E; Park, C -S; Park, C W; Park, H; Park, K S; Paul, S; Peak, L S; Pedlar, T K; Peng, T; Pesántez, L; Pestotnik, R; Peters, M; Petrič, M; Piilonen, L E; Poluektov, A; Prasanth, K; Prim, M; Prothmann, K; Pulvermacher, C; Purohit, M V; Rauch, J; Reisert, B; Ribežl, E; Ritter, M; Röhrken, M; Rorie, J; Rostomyan, A; Rozanska, M; Rummel, S; Ryu, S; Sahoo, H; Saito, T; Sakai, K; Sakai, Y; Sandilya, S; Santel, D; Santelj, L; Sanuki, T; Sasao, N; Sato, Y; Savinov, V; Schlüter, T; Schneider, O; Schnell, G; Schönmeier, P; Schram, M; Schwanda, C; Schwartz, A J; Schwenker, B; Seidl, R; Seino, Y; Semmler, D; Senyo, K; Seon, O; Seong, I S; Sevior, M E; Shang, L; Shapkin, M; Shebalin, V; Shen, C P; Shibata, T -A; Shibuya, H; Shinomiya, S; Shiu, J -G; Shwartz, B; Sibidanov, A; Simon, F; Singh, J B; Sinha, R; Smerkol, P; Sohn, Y -S; Sokolov, A; Soloviev, Y; Solovieva, E; Stanič, S; Starič, M; Steder, M; Strube, J F; Stypula, J; Sugihara, S; Sugiyama, A; Sumihama, M; Sumisawa, K; Sumiyoshi, T; Suzuki, K; Suzuki, K; Suzuki, S; Suzuki, S Y; Suzuki, Z; Takeichi, H; Takizawa, M; Tamponi, U; Tanaka, M; Tanaka, S; Tanida, K; Taniguchi, N; Taylor, G N; Tenchini, F; Teramoto, Y; Tikhomirov, I; Trabelsi, K; Trusov, V; Tse, Y F; Tsuboyama, T; Uchida, M; Uchida, T; Uehara, S; Ueno, K; Uglov, T; Unno, Y; Uno, S; Uozumi, S; Urquijo, P; Ushiroda, Y; Usov, Y; Vahsen, S E; Van Hulse, C; Vanhoefer, P; Varner, G; Varvell, K E; Vervink, K; Vinokurova, A; Vorobyev, V; Vossen, A; Wagner, M N; Waheed, E; Wang, C H; Wang, J; Wang, M -Z; Wang, P; Wang, X L; Watanabe, M; Watanabe, Y; Wedd, R; Wehle, S; White, E; Widmann, E; Wiechczynski, J; Williams, K M; Won, E; Yabsley, B D; Yamada, S; Yamamoto, H; Yamaoka, J; Yamashita, Y; Yamauchi, M; Yashchenko, S; Ye, H; Yelton, J; Yook, Y; Yuan, C Z; Yusa, Y; Zhang, C C; Zhang, L M; Zhang, Z P; Zhao, L; Zhilich, V; Zhukova, V; Zhulanov, V; Ziegler, M; Zivko, T; Zupanc, A; Zwahlen, N; Zyukova, O

    2016-01-01

    We report a study of radiative decays of \\chi_{bJ}(1P)(J=0,1,2) mesons into 74 hadronic final states comprising charged and neutral pions, kaons, protons; out of these, 41 modes are observed with at least 5 standard deviation significance. Our measurements not only improve the previous measurements by the CLEO Collaboration but also lead to first observations in many new modes. The large sample allows us to probe the total decay width of the \\chi_{b0}(1P). In the absence of a statistically significant result, a 90% confidence-level upper limit is set on the width at \\Gamma_{total}< 2.4 MeV. Our results are based on 24.7 fb^{-1} of e+e- collision data recorded by the Belle detector at the \\Upsilon(2S) resonance, corresponding to (157.8\\pm3.6)\\times10^6 \\Upsilon(2S) decays.

  10. Multi-Core Emptiness Checking of Timed Büchi Automata using Inclusion Abstraction

    DEFF Research Database (Denmark)

    Laarman, Alfons; Olesen, Mads Chr.; Dalsgaard, Andreas;

    2013-01-01

    the first parallel LTL model checking algorithm for timed automata. The algorithms are implemented in LTSmin, and experimental evaluations show the effectiveness and scalability of both contributions: subsumption halves the number of states in the real-world FDDI case study, and the multi......This paper contributes to the multi-core model checking of timed automata (TA) with respect to liveness properties, by investigating checking of TA Büchi emptiness under the very coarse inclusion abstraction or zone subsumption, an open problem in this field. We show that in general Büchi emptiness...... is not preserved under this abstraction, but some other structural properties are preserved. Based on those, we propose a variation of the classical nested depth-first search (NDFS) algorithm that exploits subsumption. In addition, we extend the multi-core cndfs algorithm with subsumption, providing...

  11. Evidence for $B^0 \\to \\chi_{c1} \\pi ^0$ at Belle

    CERN Document Server

    Kumar, R; Adachi, I; Aihara, H; Arinstein, K; Aushev, T; Aziz, T; Bakich, A M; Balagura, V; Bay, A; Bhardwaj, V; Bitenc, U; Bozek, A; Bracko, M; Browder, T E; Chen, A; Cheon, B G; Chistov, R; Cho, I S; Choi, Y; Dalseno, J; Dash, M; Drutskoy, A; Dungel, W; Eidelman, S; Gabyshev, N; Goldenzweig, P; Golob, B; Ha, H; Haba, J; Hayasaka, K; Hayashii, H; Hazumi, M; Horii, Y; Hoshi, Y; Hou, W S; Hsiung, Y B; Hyun, H J; Iijima, T; Inami, K; Ishikawa, A; Ishino, H; Itoh, R; Iwasaki, M; Kah, D H; Kang, J H; Katayama, N; Kawai, H; Kawasaki, T; Kichimi, H; Kim, S K; Kim, Y I; Kim, Y J; Kinoshita, K; Korpar, S; Krizan, P; Krokovny, P; Kuzmin, A; Kwon, Y J; Kyeong, S H; Lange, J S; Lee, J S; Lee, M J; Limosani, A; Lin, S W; Liventsev, D; Louvot, R; Mandl, F; Matyja, A; McOnie, S; Medvedeva, T; Miyabayashi, K; Miyake, H; Miyata, H; Miyazaki, Y; Mizuk, R; Mori, T; Nakamura, I; Nakano, E; Nakazawa, H; Nishida, S; Nitoh, O; Ogawa, S; Ohshima, T; Okuno, S; Ozaki, H; Pakhlov, P; Pakhlova, G; Park, C W; Park, H; Park, H K; Pestotnik, R; Piilonen, L E; Sahoo, H; Sakai, Y; Schneider, O; Sekiya, A; Senyo, K; Shapkin, M; Shiu, J G; Shwartz, B; Somov, A; Stanic, S; Staric, M; Sumiyoshi, T; Suzuki, S; Tanaka, M; Taylor, G N; Teramoto, Y; Trabelsi, K; Uehara, S; Unno, Y; Uno, S; Usov, Yu; Varner, G; Vervink, K; Wang, C C; Wang, C H; Wang, M Z; Wang, P; Watanabe, Y; Wedd, R; Won, E; Yamashita, Y; Zhang, C C; Zhang, Z P; Zhulanov, V; Zivko, T; Zupanc, A; Zyukova, O

    2008-01-01

    We present a measurement of the branching fraction for the Cabibbo- and color-suppressed $B^0 \\to \\chi_{c1}\\pi^0$ decay based on a data sample of $657\\times 10^6$ $B\\bar B$ events collected at the $\\Upsilon(4S)$ resonance with the Belle detector at the KEKB asymmetric-energy $e^+e^-$ collider. We observe a signal of $40\\pm9$ events with a significance of $4.7\\sigma$ including systematic uncertainties. The measured branching fraction is $\\mathcal {B}(B^0 \\to \\chi_{c1} \\pi^0) = (1.12\\pm 0.25(\\rm {stat.})\\pm 0.12({\\rm syst.}))\\times 10^{-5}$.

  12. Polynomial reduction and evaluation of tree- and loop-level CHY amplitudes

    CERN Document Server

    Zlotnikov, Michael

    2016-01-01

    We develop a polynomial reduction procedure that transforms any gauge fixed CHY amplitude integrand for $n$ scattering particles into a $\\sigma$-moduli multivariate polynomial of what we call the $\\textit{standard form}$. We show that a standard form polynomial must have a specific $\\textit{ladder type}$ monomial structure, which has finite size at any $n$, with highest multivariate degree given by $\\frac{(n-3)(n-4)}{2}$. This set of monomials spans a complete basis for polynomials with rational coefficients in kinematic data on the support of scattering equations. Subsequently, at tree and one-loop level, we employ the global residue theorem to derive a prescription that evaluates any CHY amplitude by means of collecting simple residues at infinity only. The prescription is then applied explicitly to some tree and one-loop amplitude examples.

  13. Influences of Seasoned Equity Offerings on Stock Return of Ho Chi Minh Market

    Directory of Open Access Journals (Sweden)

    Ho Viet Tien

    2013-01-01

    Full Text Available This paper investigated the impact of seasoned equity offerings (SEO on stock return of listed companies in Ho Chi Minh City market using the method “event study” which has been basically formed by Campbell, Lo, and MacKinlay (1997. The sample includes 332 SEOs from 2007 to 2010. The main findings show evidence that the Ho Chi Minh City market was not efficient in terms of the semi-strong form because the price has increased significantly on the ex-right date, day 0. In an opposite way, the market also reacted significantly negatively from T-4 to T-2. There are some significant impacts of timing on issue methods – equity right issues were in priority for favorable time and issues as “dividend by stocks” were chosen during unfavorable time.

  14. XAFS study of copper(II) complexes with square planar and square pyramidal coordination geometries

    Science.gov (United States)

    Gaur, A.; Klysubun, W.; Nitin Nair, N.; Shrivastava, B. D.; Prasad, J.; Srivastava, K.

    2016-08-01

    X-ray absorption fine structure of six Cu(II) complexes, Cu2(Clna)4 2H2O (1), Cu2(ac)4 2H2O (2), Cu2(phac)4 (pyz) (3), Cu2(bpy)2(na)2 H2O (ClO4) (4), Cu2(teen)4(OH)2(ClO4)2 (5) and Cu2(tmen)4(OH)2(ClO4)2 (6) (where ac, phac, pyz, bpy, na, teen, tmen = acetate, phenyl acetate, pyrazole, bipyridine, nicotinic acid, tetraethyethylenediamine, tetramethylethylenediamine, respectively), which were supposed to have square pyramidal and square planar coordination geometries have been investigated. The differences observed in the X-ray absorption near edge structure (XANES) features of the standard compounds having four, five and six coordination geometry points towards presence of square planar and square pyramidal geometry around Cu centre in the studied complexes. The presence of intense pre-edge feature in the spectra of four complexes, 1-4, indicates square pyramidal coordination. Another important XANES feature, present in complexes 5 and 6, is prominent shoulder in the rising part of edge whose intensity decreases in the presence of axial ligands and thus indicates four coordination in these complexes. Ab initio calculations were carried out for square planar and square pyramidal Cu centres to observe the variation of 4p density of states in the presence and absence of axial ligands. To determine the number and distance of scattering atoms around Cu centre in the complexes, EXAFS analysis has been done using the paths obtained from Cu(II) oxide model and an axial Cu-O path from model of a square pyramidal complex. The results obtained from EXAFS analysis have been reported which confirmed the inference drawn from XANES features. Thus, it has been shown that these paths from model of a standard compound can be used to determine the structural parameters for complexes having unknown structure.

  15. Design, Installation and Performance of the New insulator for NSTX CHI Experiments

    Energy Technology Data Exchange (ETDEWEB)

    Mueller, D; Chrzanowski, J; Gates, D; Menard, J; Raman, R; Jarboe, T R; Nelson, B A; Maqueda, R J; Schaffer, M J

    2008-03-05

    Coaxial Helicity Injection (CHI), a non-inductive method to initiate plasma and generate toroidal plasma current, is being investigated in the National Spherical Torus Experiment (NSTX). The center stack and outer vacuum vessel are separated by insulating gaps at the top and bottom of the slim central column so that a high voltage (up to 2 kV) can be applied between them from a pulsed power supply or a capacitor bank to initiate an arc discharge. In the presence of a suitable poloidal magnetic field, the discharge is initiated at the lower gap (the injector gap) and because of the strong toroidal field develops a helical structure resulting in substantial toroidal plasma current being driven. In NSTX, up to 390 kA of toroidal current has been generated for an injected current of 25 kA. The early investigations of CHI however frequently developed arcs across the insulator at the top of the machine (the absorber gap), which terminated the desired discharge. This arcing greatly restricted the operational space available for CHI studies. During 2002, the absorber region was modified to suppress these arcs. The new design includes a new ceramic insulator on the high field side of the absorber region with a much longer tracking distance between conducting elements at the different potentials. Furthermore, two new coils were installed near the absorber to provide the ability to minimize the poloidal field connecting the center stack and outer vacuum vessel. During the subsequent experimental campaign, CHI operation was less prone to arcing in the absorber and those arcs that did occur did not terminate the main discharge.)

  16. Frog value chain case study in Ho Chi Minh City Vietnam

    OpenAIRE

    Le, Minh Quoc

    2012-01-01

    Frog is valuable product in Vietnam but the natural frogs are overexploited thus, the new model to raising frog is desired. Many species of frogs are cultured in Vietnam, especially in Ho Chi Minh City, for trial of the adaptive ability of exotic species in Vietnam condition. Recently, the frogs’ species from Thailand and Taiwan are prepotent and spread out Vietnam. Nowadays, frog culture becomes one of the newest industries in Vietnam. With a short life cycle, frog culture is farming as econ...

  17. Knowledge Organization of Integrated Water Resources Management: A Case of Chi River Basin, Thailand

    OpenAIRE

    Nattapong Kaewboonma; Kulthida Tuamsuk; Wanida Kanarkard

    2013-01-01

    This study is a part of the research project on the Development of an Ontology-Based Semantic Search for Integrated Water Resources Management of the Chi River Basin (CRB), Thailand. The study aimed at developing the knowledge domain of water resources management for CRB. The research methods included document analysis and qualitative research by adopting Liou (1990)’s knowledge acquisition approach. Fifteen experts including ten experts in the areas of environmental engineerin...

  18. Users' Searching Behaviour in Using Online Databases at Vietnam National University - Ho Chi Minh City

    OpenAIRE

    Hong Sinh, Nguyen; Hong Nhung, Hoang Thi

    2012-01-01

    Purpose: This paper focuses on identifying the searching behaviors of the users, their difficulties as well as their expectations from library supports while using online databases at the Central Library of Vietnam National University – Ho Chi Minh city. Methods: Usage Reports of six online databases subscribed by the Central Library were analyzed and a survey by emailing users a questionnaire was conducted. Findings: The amount of usage increases yearly, however it is still low in comp...

  19. Tai Chi Chuan Optimizes the Functional Organization of the Intrinsic Human Brain Architecture in Older Adults

    OpenAIRE

    Jing Luo; Xi-Nian Zuo

    2014-01-01

    Whether Tai Chi Chuan (TCC) can influence the intrinsic functional architecture of the human brain remains unclear. To examine TCC-associated changes in functional connectomes, resting-state functional magnetic resonance images were acquired from 40 older individuals including 22 experienced TCC practitioners (experts) and 18 demographically matched TCC-naïve healthy controls, and their local functional homogeneities across the cortical mantle were compared. Compared to the controls, the TCC ...

  20. Tai Chi Chuan optimizes the functional organization of the intrinsic human brain architecture in older adults

    OpenAIRE

    Wei, Gao-Xia; Dong, Hao-Ming; Yang, Zhi; Luo, Jing; Zuo, Xi-Nian

    2014-01-01

    Whether Tai Chi Chuan (TCC) can influence the intrinsic functional architecture of the human brain remains unclear. To examine TCC-associated changes in functional connectomes, resting-state functional magnetic resonance images were acquired from 40 older individuals including 22 experienced TCC practitioners (experts) and 18 demographically matched TCC-naïve healthy controls, and their local functional homogeneities across the cortical mantle were compared. Compared to the controls, the TCC ...

  1. Formation of macrocyclic lactones in the Paternò–Büchi dimerization reaction

    OpenAIRE

    Manabu Abe; Yoshikazu Hiraga; Junya Arimura; Tsutomu Mizuta

    2011-01-01

    Furan-2-ylmethyl 2-oxoacetates 1a,b, in which the furan ring and the carbonyl moiety were embedded intramolecularly, were synthesized from commercially available furan-2-ylmethanol and their photochemical reaction (hν > 290 nm) was investigated. Twelve-membered macrocyclic lactones 2a,b with Ci symmetry including two oxetane-rings, which are the Paternò–Büchi dimerization products, were isolated in ca. 20% yield. The intramolecular cyclization products, such as 3-alkox...

  2. Energy and macronutrient intakes in preschool children in urban areas of Ho Chi Minh City, Vietnam

    OpenAIRE

    Sibbritt David W; Dibley Michael J; Huynh Dieu TT; Tran Hanh TM

    2008-01-01

    Abstract Background An increasing prevalence of overweight and obesity has been documented in preschool children in Ho Chi Minh City (HCMC), Vietnam. However, little is known about what preschool children in HCMC eat or how well their nutrient intake meets nutrient recommendations. This study aims to describe the energy and macronutrient intake and compare these nutrient intakes with the recommendations for Vietnamese children aged four to five years. Methods The data comes from the baseline ...

  3. Implications of a $\\chi(3.86)$ State for Theoretical Models

    CERN Document Server

    Tuan, S F

    2000-01-01

    Recent preliminary evidence for a $D \\bar{D}$ state $\\chi(3.86)$ raises extremely interesting implications for theoretical models, particularly those currently in vogue, e.g. the flux tube model and a molecular charmonium picture. We examine the experimental consequences as well as the possible unveiling of a strata of C-exotic states in heavy quarkonia systems by future facilities like BES Upgrade/Tau-Charm Factory and CLEO III/B-Factories.

  4. The pragmatic import of pronominal usage in chiShona discourse

    OpenAIRE

    Pedzisai Mashiri; Sinfree Makoni

    2011-01-01

    This article discusses the pragmatic significance of chiShona pronouns by examining the use of different pronouns: personal, enumerative, and demonstrative, and by demonstrating their address and referential value and social meanings. Two important issues are addressed.  First, we demonstrate that a purely grammatical analysis of pronouns, which emphasise the internal analysis and the anaphoric function of pronouns, fails to capture the complexity of pronominal usage in ordinary conversations...

  5. The efficacy of Tai Chi Chuan in older adults: a systematic review

    OpenAIRE

    Verhagen, Arianne; Immink, M.; van der Meulen, A; Bierma-zeinstra, Sita

    2004-01-01

    textabstractOBJECTIVES: The purpose of this study was to assess the effect of Tai Chi Chuan (TCC) on fall prevention, balance and cardiorespiratory functions in the elderly. METHODS: A systematic review was carried out according to the Cochrane standards. A computerized literature search was carried out. Studies were selected when they had an experimental design; the age of the study population was >50; one of the interventions was a form of TCC; and when falls, balance or cardiorespiratory f...

  6. Increased first and second pulse harmonics in Tai Chi Chuan practitioners

    OpenAIRE

    Lu, Wan-An; Chen, Yung-Sheng; Kuo, Cheng-Deng

    2016-01-01

    Background Tai Chi Chuan (TCC) is known to be a good calisthenics for people. This study examined the relationship between pulse harmonics and autonomic nervous modulation in TCC practitioners. Methods Power spectral measures of right pulse wave and heart rate variability (HRV) measures were compared between TCC practitioners and control subjects. Correlation analyses between pulse harmonics and HRV measures were performed using linear regression analysis. Results At baseline, the total power...

  7. Evaluating the effects of Tai Chi on physical fitness and mental health of the elderly

    OpenAIRE

    Nguyen, Manh Hung

    2013-01-01

    The aims of this study are to examine the effects of 24-form Tai Chi exercise in six months on physical fitness, blood pressure and perceived health as well as sleep quality, visual attention, and balance ability of older people living in dwelling community. This study is also aimed to compare differences in physical fitness and subjectively rated health between German and Vietnamese older adults in terms cross-cultural study between Vietnamese and German samples. The subjects were divided...

  8. Changes in heart-rate variability of survivors of nasopharyngeal cancer during Tai Chi Qigong practice

    OpenAIRE

    Fong, Shirley S.M.; Wong, Janet Y. H.; Chung, Louisa M. Y.; Yam, Timothy T.T.; Chung, Joanne W. Y.; Lee, Y.M.; Chow, Lina P. Y.; Luk, W. S.; Ng, Shamay S.M.

    2015-01-01

    [Purpose] To explore the changes in heart-rate variability (HRV) of survivors of nasopharyngeal cancer (NPC) before, during, and after a Tai Chi (TC) Qigong exercise. [Subjects and Methods] Eleven survivors of NPC participated voluntarily in the study. The heart rate of each participant was measured continuously for 1 minute before the TC Qigong intervention, during the 5-minute TC Qigong intervention, and for 1 minute after the intervention, using a Polar heart-rate monitor. Spectral HRV was...

  9. Tai Chi Chuan for Cardiac Rehabilitation in Patients with Coronary Arterial Disease

    Directory of Open Access Journals (Sweden)

    Rosane Maria Nery

    2014-07-01

    Full Text Available Background: Several studies have shown that Tai Chi Chuan can improve cardiac function in patients with heart disease. Objective: To conduct a systematic review of the literature to assess the effects of Tai Chi Chuan on cardiac rehabilitation for patients with coronary artery disease. Methods: We performed a search for studies published in English, Portuguese and Spanish in the following databases: MEDLINE, EMBASE, LILACS and Cochrane Register of Controlled Trials. Data were extracted in a standardized manner by three independent investigators, who were responsible for assessing the methodological quality of the manuscripts. Results: The initial search found 201 studies that, after review of titles and abstracts, resulted in a selection of 12 manuscripts. They were fully analyzed and of these, nine were excluded. As a final result, three randomized controlled trials remained. The studies analyzed in this systematic review included patients with a confirmed diagnosis of coronary artery disease, all were clinically stable and able to exercise. The three experiments had a control group that practiced structured exercise training or received counseling for exercise. Follow-up ranged from 2 to 12 months. Conclusion: Preliminary evidence suggests that Tai Chi Chuan can be an unconventional form of cardiac rehabilitation, being an adjunctive therapy in the treatment of patients with stable coronary artery disease. However, the methodological quality of the included articles and the small sample sizes clearly indicate that new randomized controlled trials are needed in this regard.

  10. An Effective Hybrid Artificial Bee Colony Algorithm for Nonnegative Linear Least Squares Problems

    Directory of Open Access Journals (Sweden)

    Xiangyu Kong

    2014-07-01

    Full Text Available An effective hybrid artificial bee colony algorithm is proposed in this paper for nonnegative linear least squares problems. To further improve the performance of algorithm, orthogonal initialization method is employed to generate the initial swarm. Furthermore, to balance the exploration and exploitation abilities, a new search mechanism is designed. The performance of this algorithm is verified by using 27 benchmark functions and 5 nonnegative linear least squares test problems. And the comparison analyses are given between the proposed algorithm and other swarm intelligence algorithms. Numerical results demonstrate that the proposed algorithm displays a high performance compared with other algorithms for global optimization problems and nonnegative linear least squares problems.

  11. Non-inductive plasma start-up on NSTX and projections to NSTX-U using transient CHI

    International Nuclear Information System (INIS)

    Transient coaxial helicity injection (CHI) in the National Spherical Torus Experiment (NSTX) has generated toroidal current on closed-flux surfaces without the use of the central solenoid. When induction from the central solenoid was added, CHI initiated discharges in NSTX achieved 1 MA of plasma current using 65% of the solenoid flux of standard induction-only discharges. In addition, the CHI-initiated discharges have lower density and a low normalized internal plasma inductance of 0.35, as desired for achieving advanced scenarios. Transient CHI will be used for non-inductive plasma start-up on the upgrade to NSTX (NSTX-U) that is now under construction. It will have numerous improvements that significantly enhance CHI start-up capability. The TSC code is now starting to be used for full discharge simulation, which includes solenoid-less start-up with CHI and subsequent non-inductive current ramp-up using neutral beams. These results suggest that the increased injector flux capability of NSTX-U should allow CHI start-up at more than the 400 kA level and that the new tangential neutral beam system on NSTX-U should be able to ramp the current to the 1 MA levels. (paper)

  12. A small RNA controls expression of the chitinase ChiA in Listeria monocytogenes.

    Directory of Open Access Journals (Sweden)

    Jesper S Nielsen

    Full Text Available In recent years, more than 60 small RNAs (sRNAs have been identified in the gram-positive human pathogen Listeria monocytogenes, but their putative roles and mechanisms of action remain largely unknown. The sRNA LhrA was recently shown to be a post-transcriptional regulator of a single gene, lmo0850, which encodes a small protein of unknown function. LhrA controls the translation and degradation of the lmo0850 mRNA by an antisense mechanism, and it depends on the RNA chaperone Hfq for efficient binding to its target. In the present study, we sought to gain more insight into the functional role of LhrA in L. monocytogenes. To this end, we determined the effects of LhrA on global-wide gene expression. We observed that nearly 300 genes in L. monocytogenes are either positively or negatively affected by LhrA. Among these genes, we identified lmo0302 and chiA as direct targets of LhrA, thus establishing LhrA as a multiple target regulator. Lmo0302 encodes a hypothetical protein with no known function, whereas chiA encodes one of two chitinases present in L. monocytogenes. We show here that LhrA acts as a post-transcriptional regulator of lmo0302 and chiA by interfering with ribosome recruitment, and we provide evidence that both LhrA and Hfq act to down-regulate the expression of lmo0302 and chiA. Furthermore, in vitro binding experiments show that Hfq stimulates the base pairing of LhrA to chiA mRNA. Finally, we demonstrate that LhrA has a negative effect on the chitinolytic activity of L. monocytogenes. In marked contrast to this, we found that Hfq has a stimulating effect on the chitinolytic activity, suggesting that Hfq plays multiple roles in the complex regulatory pathways controlling the chitinases of L. monocytogenes.

  13. Numerical simulations of square arrayed rod bundles

    International Nuclear Information System (INIS)

    Highlights: ► CFD simulations with square arrayed rod bundles. ► Mesh dependency and turbulence model study by comparison with experiments. ► Gibson and Launder Reynolds stress model shows good agreement with experiments. ► Effect of pitch to diameter ratio and Reynolds number is correctly captured. - Abstract: Computational fluid dynamics (CFD) simulations were performed with square arrayed rod bundles featuring pitch to diameter (P/D) ratio of 1.194 and 1.326 in order to find an optimal mesh and turbulence model for simulations with more complex geometries in the future. With the tighter lattice a mesh sensitivity and turbulence model study were accomplished and the post processed turbulence quantities, velocity field and wall shear stress were compared with experimental data ( Developed single phase turbulent flow through a square-pitch rod cluster. Nuclear Engineering and Design 60, 365–379.). The comparisons show that Reynolds-Averaged Navier–Stokes method with the Reynolds stress model of Gibson and Launder in conjunction with an appropriate mesh can provide reasonable agreement with the experiment for this lattice. For pure bundle simulations the body fitted structured meshes are suggested, since slightly better agreement can be captured considering all quantities with the same number of cells. Based on the drawn conclusions the procession was repeated for P/D = 1.326, where, due to lack of experiment, just the correct tendencies of the turbulence quantities and velocity field were established. The results show Reynolds number independency correctly and the increase of P/D issues in more similar flow to axisymmetric pipe flow.

  14. The chitinase C gene PsChiC from Pseudomonas sp. and its synergistic effects on larvicidal activity

    Directory of Open Access Journals (Sweden)

    Wanfang Zhong

    2015-09-01

    Full Text Available Pseudomonas sp. strain TXG6-1, a chitinolytic gram-negative bacterium, was isolated from a vegetable field in Taixing city, Jiangsu Province, China. In this study, a Pseudomonas chitinase C gene (PsChiC was isolated from the chromosomal DNA of this bacterium using a pair of specific primers. The PsChiC gene consisted of an open reading frame of 1443 nucleotides and encoded 480 amino acid residues with a calculated molecular mass of 51.66 kDa. The deduced PsChiC amino acid sequence lacked a signal sequence and consisted of a glycoside hydrolase family 18 catalytic domain responsible for chitinase activity, a fibronectin type III-like domain (FLD and a C-terminal chitin-binding domain (ChBD. The amino acid sequence of PsChiCshowed high sequence homology (> 95% with chitinase C from Serratia marcescens. SDS-PAGE showed that the molecular mass of chitinase PsChiC was 52 kDa. Chitinase assays revealed that the chitobiosidase and endochitinase activities of PsChiCwere 51.6- and 84.1-fold higher than those of pET30a, respectively. Although PsChiC showed little insecticidal activity towards Spodoptera litura larvae, an insecticidal assay indicated that PsChiC increased the insecticidal toxicity of SpltNPV by 1.78-fold at 192 h and hastened death. These results suggest that PsChiC from Pseudomonas sp. could be useful in improving the pathogenicity of baculoviruses.

  15. Django girls workshop at IdeaSquare

    CERN Document Server

    2016-01-01

    Short video highlights of the Django Girls coding workshop organized at IdeaSquare on Feb 26-27, 2016 by the Rosehipsters non profit organization, supported by the CERN diversity team and the IT department, attracting 39 women from 15 countries. The aim of the workshop was to introduce participants to the world of computer programming and technology by teaching them how to successfully create a blog application and deploy it to the internet. Most of the 16 volunteer mentors were female. Django Girls is a non-profit organization and a community that empowers and helps women to organize free, one-day programming workshops by providing tools, resources and support.

  16. Hangover Square by Patrick Hamilton:Mindreading

    OpenAIRE

    Russ, Tom C.

    2014-01-01

    Patrick Hamilton’s (1904–1962) books are filled with gin and jealousy and depict obsessive desire in oppressive circumstances. His early financial success funded his heavy drinking, but also allowed him to write some of the best fiction of the 20th century. Following a depressive illness towards the end of his short life he never wrote again, leaving his final series of novels unfinished, the villain forever escaping justice. Hangover Square, set on the eve of the Second World War, tells the ...

  17. An Overview of the Square Kilometre Array

    Science.gov (United States)

    Huynh, Minh T.; Lazio, Joseph

    2013-01-01

    The Square Kilometre Array (SKA) will be the premier instrument to study radiation at centimetre and metre wavelengths from the cosmos, and in particular hydrogen, the most abundant element in the universe. The SKA will probe the dawn of galaxy formation as well as allow advances in many other areas of astronomy, such as fundamental physics, astrobiology and cosmology. Phase 1, which will be about 10% of the full SKA collecting area, will be built in Australia and South Africa. This paper describes the key science drivers of the SKA, provides an update on recent SKA Organisation activities and summarises the baseline design for Phase 1.

  18. Transient Astrophysics with the Square Kilometre Array

    CERN Document Server

    Fender, Rob; Macquart, Jean-Pierre; Donnarumma, Immacolata; Murphy, Tara; Deller, Adam; Paragi, Zsolt; Chatterjee, Shami

    2015-01-01

    This chapter provides an overview of the possibilities for transient and variable-source astrophysics with the Square Kilometre Array. While subsequent chapters focus on the astrophysics of individual events, we focus on the broader picture, and how to maximise the science coming from the telescope. The SKA as currently designed will be a fantastic and ground-breaking facility for radio transient studies, but the scientifc yield will be dramatically increased by the addition of (i) near-real-time commensal searches of data streams for events, and (ii) on occasion, rapid robotic response to Target-of-Opprtunity style triggers.

  19. [Partial lease squares approach to functional analysis].

    Science.gov (United States)

    Preda, C

    2006-01-01

    We extend the partial least squares (PLS) approach to functional data represented in our models by sample paths of stochastic process with continuous time. Due to the infinite dimension, when functional data are used as a predictor for linear regression and classification models, the estimation problem is an ill-posed one. In this context, PLS offers a simple and efficient alternative to the methods based on the principal components of the stochastic process. We compare the results given by the PLS approach and other linear models using several datasets from economy, industry and medical fields. PMID:17124795

  20. The Square-Shoulder-Asakura-Oosawa model

    Science.gov (United States)

    Fantoni, Riccardo

    2016-09-01

    A new model for a colloidal size-asymmetric binary mixture is proposed: The Square-Shoulder-Asakura-Oosawa. This belongs to the larger class of non-additive hard-spheres models and has the property that its effective pair formulation is exact whenever the solvent particle fits inside the interstitial region of three touching solute particles. Therefore one can study its properties from the equivalent one-component effective problem. Some remarks on the phase diagram of this new model are also addressed.

  1. Leonardo Pisano (Fibonacci) the book of squares

    CERN Document Server

    Sigler, L E

    1987-01-01

    The Book of Squares by Fibonacci is a gem in the mathematical literature and one of the most important mathematical treatises written in the Middle Ages. It is a collection of theorems on indeterminate analysis and equations of second degree which yield, among other results, a solution to a problem proposed by Master John of Palermo to Leonardo at the Court of Frederick II. The book was dedicated and presented to the Emperor at Pisa in 1225. Dating back to the 13th century the book exhibits the early and continued fascination of men with our number system and the relationship among numbers

  2. 2D flow around stationary side-by-side square columns at low Reynolds number

    OpenAIRE

    Mengzhao, Guan; Shengwei, Ma; Siracusa, Francesca; Chang-Wei, Kang; Teck-Bin Arthur, Lim; Weymouth, Gabriel; Tutty, Owen; Mingyi, Tan; Hudson, Dominic; Kumar Jaiman, Rajeev; Chih-Hua, Wu

    2015-01-01

    Flow over two side-by-side square columns is studied numerically and experimentally at low Reynolds number (Re=100-200) to investigate the effects of the gap distance on the behaviour of the flow. Different gap distances between two square columns are simulated to analyse the interactions of laminar wakes with a gap flow. Four different flow regimes are observed based on different gap distance. Experimental test are performed to validate the simulations. A new water tank has been built specif...

  3. Test

    DEFF Research Database (Denmark)

    Bendixen, Carsten

    2014-01-01

    Bidrag med en kortfattet, introducerende, perspektiverende og begrebsafklarende fremstilling af begrebet test i det pædagogiske univers.......Bidrag med en kortfattet, introducerende, perspektiverende og begrebsafklarende fremstilling af begrebet test i det pædagogiske univers....

  4. Square tracking sensor for autonomous helicopter hover stabilization

    Science.gov (United States)

    Oertel, Carl-Henrik

    1995-06-01

    Sensors for synthetic vision are needed to extend the mission profiles of helicopters. A special task for various applications is the autonomous position hold of a helicopter above a ground fixed or moving target. As a proof of concept for a general synthetic vision solution a restricted machine vision system, which is capable of locating and tracking a special target, was developed by the Institute of Flight Mechanics of Deutsche Forschungsanstalt fur Luft- und Raumfahrt e.V. (i.e., German Aerospace Research Establishment). This sensor, which is specialized to detect and track a square, was integrated in the fly-by-wire helicopter ATTHeS (i.e., Advanced Technology Testing Helicopter System). An existing model following controller for the forward flight condition was adapted for the hover and low speed requirements of the flight vehicle. The special target, a black square with a length of one meter, was mounted on top of a car. Flight tests demonstrated the automatic stabilization of the helicopter above the moving car by synthetic vision.

  5. $J-\\psi$ Production via $\\chi_c$ Decays in 920 GeV pA Interactions

    CERN Document Server

    Abt, I; Adams, M; Albrecht, H; Amaral, V S; Amorim, A; Aplin, S J; Arefev, A; Arino, I; Atiya, M; Aushev, V M; Bagaturia, Yu S; Baghshetsyan, R; Balagura, V; Bargiotti, M; Barsuk, S; Barsukova, O; Bassetti, V; Bastos, J; Bauer, C; Bauer, T S; Beck, M; Belkov, A A; Belotelov, I; Belyaev, I; Berkhan, K; Bertin, A; Bobchenko, B M; Böcker, M; Bogatyrev, A; Böhm, G; Borgmeier, C; Brauer, M; Broemmelsiek, D R; Bruinsma, M; Bruschi, M; Buchholz, P; Büchler, M C; Buran, T; Capéans-Garrido, M; Capponi, M; Carvalho, J; Chamanina, J; Chen, B X; Chistov, R; Chmeissani, M; Christensen, A; Conde, P; Cruse, C; Dam, M; Danielsen, K M; Danilov, M; De Castro, S; Deckers, H; Dehmelt, K; Deppe, H; Dolgoshein, B A; Dong, X; Dreis, H B; Dressel, M; Dujmic, D; Eckmann, R; Egorytchev, V; Ehret, K; Eiges, V; Eisele, Franz; Emeliyanov, D; Erhan, S; Essenov, S; Fabbri, Franco Luigi; Faccioli, P; Fallot-Burghardt, W; Feuerstack-Raible, M; Flammer, J; Fleckenstein, H; Fominykh, B A; Fourletov, S; Fuljahn, T; Funcke, M; Galli, D; García, A; Garrido, L; Gascón, D; Gellrich, A; Gerndt, K E K; Giacobbe, B; Glass, J; Glebe, T; Goloubkov, D; Golutvin, A; Golutvin, I A; Gorbunov, I V; Gorisek, A; Gouchtchine, O; Goulart, D C; Gradl, S; Gradl, W; Guilitsky, Yu; Hamacher, T; Hansen, J D; Harr, R; Hast, C; Hausmann, S A; Hernández, J M; Hildebrandt, M; Hölscher, A; Höpfner, K; Hofmann, W; Hohlmann, M; Hott, T; Hulsbergen, W D; Husemann, U; Igonkina, O; Ispirian, M K; Issever, I; Itterbeck, H; Ivarsson, J; Jagla, T; Jia, Y; Jiang, C; Kaoukher, A; Kapitza, H; Karabekyan, S; Karchin, P; Karpenko, N; Ke, Z; Keller, S; Khasanov, F M; Kim, H; Kiryushin, Yu T; Kisel, I V; Klefenz, F; Knöpfle, K T; Kochetkov, V; Kolanoski, H; Korpar, S; Krauss, C; Kreuzer, P K; Krizan, P; Krücker, D; Kvaratskheliia, T; Lange, A; Lanyov, A V; Lau, K; Leffers, G; Legrand, I; Lewendel, B; Liu Ya Qian; Lohse, T; Loke, R; Lomonosov, B N; Lüdemann, J; Männer, R; Mankel, R; Marconi, U; Masciocchi, S; Massa, I; Matchikhilian, I; Medin, G; Medinnis, M; Mevius, M; Michetti, A; Mikhailov, Yu; Miquel, R; Mizuk, R; Mohapatra, A; Moshkin, A; Moshous, B; Muresan, R; Nam, S; Negodaev, M A; Negri, I; Nörenberg, M; Nowak, S; Núñez-Pardo de Vera, M T; Oest, T; Oliveira, A; Ouchrif, M; Ould-Saada, F; Padilla, C; Pakhlov, P; Pavlenko, Yu N; Peralta, D; Pernack, R; Perschke, T; Pestotnik, R; Petersen, B AA; Piccinini, M; Pleier, M A; Poli, M; Popov, V; Pose, A V; Pose, D; Pugatch, V; Pylypchenko, Y; Pyrlik, J; Ramachandran, S; Ratnikov, F; Reeves, K; Ressing, D; Riechmann, K; Rieling, J; Rietz, M; Riu, I; Robmann, P; Rosen, J; Rothe, C; Rückstuhl, W; Rusinov, V Yu; Rybnikov, V; Ryzhikov, D; Saadi-Ludemann, F; Samtleben, D; Sánchez, F; Sang, M; Saveliev, V; Sbrizzi, A; Schaller, S C; Schlein, Peter E; Schmelling, M; Schmidt, B; Schmidt, S; Schmidt-Parzefall, W; Schreiner, A T; Schröder, H; Schultz, H D; Schwanke, U; Schwartz, A J; Schwarz, A S; Schwenninger, B; Schwingenheuer, B; Schwitters, Roy F; Sciacca, F; Semenov, S; Semprini-Cesari, N; Sexauer, E; Seybold, L; Shiu, J; Shuvalov, S M; Siccama, I; Skrk, D; Sozuer, L; Soldatov, A; Solunin, S A; Somov, A; Somov, S V; Souvorov, V; Spahn, M; Spengler, J; Spighi, R; Spiridonov, A A; Spratte, S; Stanovnik, A; Staric, M; Saint-Denis, R; Stegmann, C; Steinbeck, S; Steinkamp, O; Stieler, D; Straumann, U; Sun, F; Sun, H; Symalla, M; Takach, S F; Tesch, N; Thurn, H; Tikhomirov, I; Titov, M L; Trunk, U; Truöl, P; Tsakov, I; Uwer, U; Vagnoni, V M; Van Eldik, C; Van Staa, R; Vasilev, Yu; Villa, M; Vitale, A; Vukotic, I; Wagner, G; Wagner, W; Wahlberg, H; Walenta, Albert H; Walter, M; Walter, T; Wang, J J; Wang, Y M; Wanke, R; Wegener, D; Werthenbach, U; Weyers, P J; Wolters, H; Wurth, R; Würtz, A; Xella, S M; Yang, J; Zaitsev, Yu; Zavertyaev, M V; Zech, G; Zeuner, T; Zhelezov, A; Zheng, Z; Zhu, Z; Zimmermann, R; Zivko, T; Zoccoli, A; Zweizig, J

    2003-01-01

    Using data collected by the HERA-B experiment, we have measured the fraction of J\\psi's produced via radiative chi_c decays in interactions of 920 GeV protons with carbon and titanium targets. We obtained R_{\\chi_c} = 0.32 \\pm 0.06_{stat} \\pm 0.04_{sys} for the fraction of J\\psi from chi_c decays averaged over proton-carbon and proton-titanium collisions. This result is in agreement with previous measurements and is compared with theoretical predictions.

  6. Categorization of Mechanics Problems by Students in Large Introductory Physics Courses: A Comparison with the Chi, Feltovich, and Glaser Study

    CERN Document Server

    Mason, Andrew

    2016-01-01

    With inspiration from the classic study by Chi, Feltovich, and Glaser [1], we asked introductory physics students in three introductory physics classes to categorize mechanics problems based upon similarity of solutions. To evaluate the effect of problem context on students' ability to categorize, two sets of problems were developed for categorization. Some problems in one of the problem sets that students were asked to categorize included those available from the prior study by Chi et al. Our findings, which contrast from those of Chi et al., suggest that there is a much wider distribution of expertise among introductory students.

  7. The Influence of Tai Chi Exercise on Proprioception in Patients with Knee Osteoarthritis: Results from a Pilot Randomized Controlled Trial

    OpenAIRE

    Schmid, Anna; McAlindon, Timothy; Schmid, Christopher H.; Wang, Chenchen

    2013-01-01

    Purpose: Previous long-term observational studies found that Tai Chi practitioners had better knee- joint proprioceptive acuity versus controls in an older population. We evaluated the effects of Tai Chi for knee- joint proprioception in knee osteoarthritis (OA) in a randomized controlled trial. Methods: We randomized 40 eligible individuals (age > 55, BMI ≤ 40 kg/m2 with knee pain on most days of the previous month and tibiofemoral OA (K/L grade ≥2) to Tai Chi (10 modified forms from clas...

  8. Update on the Square Kilometer Array

    Science.gov (United States)

    Tarter, Jill

    2002-01-01

    In August 2000 representatives of 24 groups in 10 countries signed a memorandum of understanding to continue cooperative technology development on five different antenna concepts intended to enable the cost-effective construction of a radio telescope array with one million square meters of collecting area; the Square Kilometer Array (SKA). The goal of this MOA is to find innovative ways of solving the many technical challenges posed by this mammouth array, and to drive down the costs so that this can realistically be afforded as a groundbased, international project for radio astronomy. The science drivers for this large instrument are diverse and very exciting; SETI being one of them. However, this means that the technical specifications are extremely challenging. There is historical reason to believe that these goals can be met. For the past six decades, the capability of radio astronomy facilities has been improving exponentially, and the SKA represents the logical extrapolation of this trend. In 2005 a selection of one or more of the current antenna concepts will be made, along with the choice of a suitable site and configuration for the array. Final detailed designs and prototyping will follow. Construction could start by the end of this decade. The SKA will permit SETI observations over a wider range of frequencies, and will offer a sensitivity that is two orders of magnitude better than current arrays. This improved performance justifies all the effort needed to overcome the technological, political, and bureaucratic challenges inherent in this international mega-science project.

  9. ON THE SEPARABLE NONLINEAR LEAST SQUARES PROBLEMS

    Institute of Scientific and Technical Information of China (English)

    Xin Liu; Yaxiang Yuan

    2008-01-01

    Separable nonlinear least squares problems are a special class of nonlinear least squares problems, where the objective functions are linear and nonlinear on different parts of variables. Such problems have broad applications in practice. Most existing algorithms for this kind of problems are derived from the variable projection method proposed by Golub and Pereyra, which utilizes the separability under a separate framework. However, the methods based on variable projection strategy would be invalid if there exist some constraints to the variables, as the real problems always do, even if the constraint is simply the ball constraint. We present a new algorithm which is based on a special approximation to the Hessian by noticing the fact that certain terms of the Hessian can be derived from the gradient. Our method maintains all the advantages of variable projection based methods, and moreover it can be combined with trust region methods easily and can be applied to general constrained separable nonlinear problems. Convergence analysis of our method is presented and numerical results are also reported.

  10. Total least squares for anomalous change detection

    Energy Technology Data Exchange (ETDEWEB)

    Theiler, James P [Los Alamos National Laboratory; Matsekh, Anna M [Los Alamos National Laboratory

    2010-01-01

    A family of difference-based anomalous change detection algorithms is derived from a total least squares (TLSQ) framework. This provides an alternative to the well-known chronochrome algorithm, which is derived from ordinary least squares. In both cases, the most anomalous changes are identified with the pixels that exhibit the largest residuals with respect to the regression of the two images against each other. The family of TLSQ-based anomalous change detectors is shown to be equivalent to the subspace RX formulation for straight anomaly detection, but applied to the stacked space. However, this family is not invariant to linear coordinate transforms. On the other hand, whitened TLSQ is coordinate invariant, and furthermore it is shown to be equivalent to the optimized covariance equalization algorithm. What whitened TLSQ offers, in addition to connecting with a common language the derivations of two of the most popular anomalous change detection algorithms - chronochrome and covariance equalization - is a generalization of these algorithms with the potential for better performance.

  11. Buckling strength of square composite plates with geometrical imperfections

    DEFF Research Database (Denmark)

    Berggreen, Christian; Jensen, Christian; Hayman, Brian

    responses were also calculated by means of geometrically non-linear finite element analysis. With the assumption of rotationally fixed edges, the calcu-lated elastic critical loads were significantly higher than those deduced from the measurements. Closer ex-amination revealed that the loaded edges of the......Tests have been performed on square composite plates under in-plane compression. Theplateshad a width-to-thickness ratio close to the value for which the elastic critical load and the load for compres-sive fibre failure over a complete section would be equal, giving the maximum sensitivity to...... plates rotated significantly during the tests. It was found nec-essary to include in the analysis the observed variation of edge rotation with applied in-plane displacement. Although material non-linearity was not modelled, some conclusions concerning the failure sequence were drawn from the analyses....

  12. Least squares deconvolution of the stellar intensity and polarization spectra

    CERN Document Server

    Kochukhov, O; Piskunov, N

    2010-01-01

    Least squares deconvolution (LSD) is a powerful method of extracting high-precision average line profiles from the stellar intensity and polarization spectra. Despite its common usage, the LSD method is poorly documented and has never been tested using realistic synthetic spectra. In this study we revisit the key assumptions of the LSD technique, clarify its numerical implementation, discuss possible improvements and give recommendations how to make LSD results understandable and reproducible. We also address the problem of interpretation of the moments and shapes of the LSD profiles in terms of physical parameters. We have developed an improved, multiprofile version of LSD and have extended the deconvolution procedure to linear polarization analysis taking into account anomalous Zeeman splitting of spectral lines. This code is applied to the theoretical Stokes parameter spectra. We test various methods of interpreting the mean profiles, investigating how coarse approximations of the multiline technique trans...

  13. Kinetic effects in diffusion on a disordered square lattice

    CERN Document Server

    Dikken, Robbert-Jan

    2016-01-01

    In this work, the effect of fluctuations in a disordered square lattice on diffusion of a test particle is studied using kinetic Monte Carlo simulations. Diffusion is relevant to a wide variety of problems, both within physics and outside of physics. Kinetic effects in diffusion are often hidden in a thermodynamical description of the problem. In this work, no assumptions based on energy are made, and diffusion occurs purely based on the attempt rate of the test particle and the occupation and fluctuation rate of the lattice. Although the average transition rate of the particle is the same for a static or fluctuating lattice with specific occupation, the diffusion constant is kinetically affected in a fluctuating, disordered lattice. If the lattice fluctuates faster than the attempt rate of the particle, diffusion is controlled by the attempt rate of the particle. However, if the lattice fluctuates slower than the attempt rate of the particle, diffusion is affected by the fluctuations. The slower the lattice ...

  14. Visualizations of Boger fluid flows in a 4:1 square/square contraction

    OpenAIRE

    Alves, Maria Arminda Costa; Pinho, Fernando Tavares de; Oliveira, Paulo Jorge dos Santos Pimentel de

    2010-01-01

    Visualizations of the 3-D flow in a 4:1 square/square sudden contraction for two viscoelastic Boger fluids and two Newtonian fluids were carried out at low Reynolds numbers. In these creeping flow conditions, the vortex length remained unchanged for Newtonian fluids, whereas a nonmonotonic variation with flow rate was observed for the Boger fluids. Initially, the corner vortex slightly increased with flow rate to a local peak at a Deborah number of De=6, before decreasing significantly to a m...

  15. Consumer Health Informatics in the Context of Engaged Citizens and eHealth Services - A New CHI Meta Model.

    Science.gov (United States)

    Wiesner, Martin; Griebel, Lena; Becker, Kurt; Pobiruchin, Monika

    2016-01-01

    Consumer Health Informatics (CHI) is a relatively new and interdisciplinary field in Medical Informatics. It focuses on consumer- rather than professional-centered services. However, the definitions and understanding of a) what is a "consumer"? or b) what is health technology in the context of CHI? and c) what factors and actors influence the usage of eHealth services? vary widely. The CHI special interest group (SIG) - associated with the German Association for Medical Informatics, Biometry and Epidemiology - conducted two workshops in 2015 to improve the common understanding on these topics. The workshop outcomes, the derived CHI-specific meta model and examples how to apply this model are presented in this paper. The model supports the definition of multi-actor contexts, as it not solely reflects the conventional patient-physician relationship but also allows for the description of second health market providers. PMID:27332268

  16. Ly6Chi Monocytes Provide a Link between Antibiotic-Induced Changes in Gut Microbiota and Adult Hippocampal Neurogenesis

    Directory of Open Access Journals (Sweden)

    Luisa Möhle

    2016-05-01

    Full Text Available Antibiotics, though remarkably useful, can also cause certain adverse effects. We detected that treatment of adult mice with antibiotics decreases hippocampal neurogenesis and memory retention. Reconstitution with normal gut flora (SPF did not completely reverse the deficits in neurogenesis unless the mice also had access to a running wheel or received probiotics. In parallel to an increase in neurogenesis and memory retention, both SPF-reconstituted mice that ran and mice supplemented with probiotics exhibited higher numbers of Ly6Chi monocytes in the brain than antibiotic-treated mice. Elimination of Ly6Chi monocytes by antibody depletion or the use of knockout mice resulted in decreased neurogenesis, whereas adoptive transfer of Ly6Chi monocytes rescued neurogenesis after antibiotic treatment. We propose that the rescue of neurogenesis and behavior deficits in antibiotic-treated mice by exercise and probiotics is partially mediated by Ly6Chi monocytes.

  17. The concentration of manufacturing industries in Vietnam with particular reference to Ho Chi Minh City and its surrounding.

    OpenAIRE

    Ercole, Roberto

    2014-01-01

    The research aims to invesDgate the economic agglomeration and concentration of manufacturing industries in Vietnam with particular reference to Ho Chi Minh and its surrounding provinces using a-spatial and spatial statistics.

  18. LUX Constraints on Magnetic Dark Matter in the $S\\bar{E} \\chi$y Model with(out) Naturality

    CERN Document Server

    Frandsen, Mads T; Shoemaker, Ian M; Svendsen, Ole

    2013-01-01

    We study phenomenological constraints in a simple $S\\bar{E} \\chi$y extension of the Standard Model (SM) with a 125 GeV Higgs, a vector-like heavy electron $(E)$, a complex scalar electron $(S)$ and a standard model singlet Dirac fermion $(\\chi)$. The interactions among the dark matter candidate $\\chi$ and the standard model particles occur via loop-induced processes involving the Yukawa interaction $S\\bar{E} \\chi$y. The model is an explicit perturbative realization of so-called magnetic dark matter. The field content allows for a cancelation of quadratic divergences in the scalar masses at one-loop, a phenomenon which we refer to as perturbative naturality. The basic model is constrained dominantly by direct detection experiments and its parameter space can be nearly entirely covered by up-coming ton-scale direct detection experiments. We conclude this work by discussing different variations of the model.

  19. Examining the measurement equivalence of the Conditional Reasoning Test for Aggression across U.S. and Croatian samples

    Directory of Open Access Journals (Sweden)

    Zvonimir Galić

    2014-06-01

    Full Text Available The Conditional Reasoning Test for Aggression (CRT-A; James et al., 2005 is based on the ideas that aggressive individuals use motive-based cognitive biases to see their behavior as reasonable and that those biases can be measured with specially designed inductive reasoning tasks. The test has shown promising psychometric characteristics for U. S. samples but has not been validated in other cultural contexts. In our study, we examined whether the items from the CRT-A were invariant across culture by testing whether these items displayed differential item functioning (DIF across Croatian (N=530 and U.S. (N=1479 samples. The Lord's Chi Square (Lord, 1980, the Raju UA index (Raju, 1988, the Mantel-Haenszel procedure (Mantel & Haenszel, 1959, and the logistic regression procedures (Swaminathan & Rogers, 1990 revealed that DIF was pervasive. Although an implicit measure of personality, the CRT-A seems susceptible to differential item functioning in another culture.

  20. Specific depletion of Ly6C(hi inflammatory monocytes prevents immunopathology in experimental cerebral malaria.

    Directory of Open Access Journals (Sweden)

    Beatrix Schumak

    Full Text Available Plasmodium berghei ANKA (PbA infection of C57BL/6 mice leads to experimental cerebral malaria (ECM that is commonly associated with serious T cell mediated damage. In other parasitic infection models, inflammatory monocytes have been shown to regulate Th1 responses but their role in ECM remains poorly defined, whereas neutrophils are reported to contribute to ECM immune pathology. Making use of the recent development of specific monoclonal antibodies (mAb, we depleted in vivo Ly6C(hi inflammatory monocytes (by anti-CCR2, Ly6G+ neutrophils (by anti-Ly6G or both cell types (by anti-Gr1 during infection with Ovalbumin-transgenic PbA parasites (PbTg. Notably, the application of anti-Gr1 or anti-CCR2 but not anti-Ly6G antibodies into PbTg-infected mice prevented ECM development. In addition, depletion of Ly6C(hi inflammatory monocytes but not neutrophils led to decreased IFNγ levels and IFNγ+CD8+ T effector cells in the brain. Importantly, anti-CCR2 mAb injection did not prevent the generation of PbTg-specific T cell responses in the periphery, whereas anti-Gr1 mAb injection strongly diminished T cell frequencies and CTL responses. In conclusion, the specific depletion of Ly6C(hi inflammatory monocytes attenuated brain inflammation and immune cell recruitment to the CNS, which prevented ECM following Plasmodium infection, pointing out a substantial role of Ly6C+ monocytes in ECM inflammatory processes.

  1. The effects of Tai-Chi-Soft-Ball training on physical functional health of Chinese older adult

    OpenAIRE

    Lam, Michael Huen Sum; Cheung, Siu Yin; Chow, Bik Chu

    2011-01-01

    This study was designed to investigate a 10-week training effects of Tai-Chi-Soft-Ball (TCSB), a novel Chinese exercise which combined the elements of Tai Chi and badminton, on physical functional health of private institutionalized older adults. Thirty-four participants were recruited in the training group with 60 minutes per session and two sessions per week TCSB training. Thirty-two participants were recruited simultaneously in the control group (no training). The measurements included the...

  2. A Study on the Biodiversity of Natural Food Production to Support Community Upstream of Chi Basin, Thailand

    OpenAIRE

    Pramuk Srichaiwong; Luckhana Kwewjai; Patarapong Kroeksakul

    2013-01-01

    This biodiversity study of natural food production to supporting the communities upstream of Chi River Basin aims at collecting the name and species of natural food plants in the forest around the upstream areas of Chi River Basin. This is a phenomenal study of species and potential benefits of forest food. Qualitative methodology was mainly used to collect data; the study relied on the knowledge of the local people had to recall the local data, which significantly focused on the species of n...

  3. To explore the prevention and treatment of Tai Chi Chuan Exercise on hypertension based on the theory of chaos

    Directory of Open Access Journals (Sweden)

    Xiang-Lin CHI

    2014-10-01

    Full Text Available In this paper,review and analysis of  the fluctuations of blood pressure and pathogenesis of hypertension were presented a review and analysed based on chaos theory. At the same time, we interpreted philosophically the special concept of Tai Chi Chuan Exercise. Furthermore, the possible mechanisms of prevention and treatment of Tai Chi Chuan on hypertension was reviewed on the basis of clinical research literature.

  4. Emotional agents at the square lattice

    CERN Document Server

    Czaplicka, Agnieszka; Holyst, Janusz A

    2010-01-01

    We introduce and investigate by numerical simulations a number of models of emotional agents at the square lattice. Our models describe the most general features of emotions such as the spontaneous emotional arousal, emotional relaxation, and transfers of emotions between different agents. Group emotions in the considered models are periodically fluctuating between two opposite valency levels and as result the mean value of such group emotions is zero. The oscillations amplitude depends strongly on probability ps of the individual spontaneous arousal. For small values of relaxation times tau we observed a stochastic resonance, i.e. the signal to noise ratio SNR is maximal for a non-zero ps parameter. The amplitude increases with the probability p of local affective interactions while the mean oscillations period increases with the relaxation time tau and is only weakly dependent on other system parameters. Presence of emotional antenna can enhance positive or negative emotions and for the optimal transition p...

  5. Magnetics calculations for an ELMO Bumpy Square

    International Nuclear Information System (INIS)

    Calculations have been carried out to determine the vacuum magnetic parameters, forces, and the use of trim coils in an ELMO Bumpy Square. A configuration having five mirror coils per side and an eight-coil high-field toroidal solenoid corner assembly was studied. Favorable magnetic parameters are achieved in the device. An on-axis mirror ratio of 1.9, a global mirror ratio of 3.6, and excellent centering of plasma pressure contours are achieved. Particle losses are also minimal (<5%). The magnetic forces acting between coils are comparable with those encountered in the EBT-I/S magnet configuration. Circular trim coils were found to be suitable for restoring hot electron ring locations that are displaced when the coil currents are varied for performing magnetic studies or for assessing the effects on the EBS of the global mirror ratio

  6. Vehicle detection using partial least squares.

    Science.gov (United States)

    Kembhavi, Aniruddha; Harwood, David; Davis, Larry S

    2011-06-01

    Detecting vehicles in aerial images has a wide range of applications, from urban planning to visual surveillance. We describe a vehicle detector that improves upon previous approaches by incorporating a very large and rich set of image descriptors. A new feature set called Color Probability Maps is used to capture the color statistics of vehicles and their surroundings, along with the Histograms of Oriented Gradients feature and a simple yet powerful image descriptor that captures the structural characteristics of objects named Pairs of Pixels. The combination of these features leads to an extremely high-dimensional feature set (approximately 70,000 elements). Partial Least Squares is first used to project the data onto a much lower dimensional sub-space. Then, a powerful feature selection analysis is employed to improve the performance while vastly reducing the number of features that must be calculated. We compare our system to previous approaches on two challenging data sets and show superior performance. PMID:20921579

  7. FLUID FLOW IN ROTATING HELICAL SQUARE DUCTS

    Institute of Scientific and Technical Information of China (English)

    Chen Hua-jun; Zhang Ben-zhao; Zhang Jin-suo

    2003-01-01

    A numerical study is made for a fully developed laminar flow in rotating helical pipes.Due to the rotation, the Coriolis force can also contribute to the secondary flow.The interaction between rotation, torsion, and curvature complicates the flow characteristics.The effects of rotation and torsion on the flow transitions are studied in details.The results show that there are obvious differences between the flow in rotating ducts and in helical ducts without rotation.Certain hitherto unknown flow patterns are found.The effects of rotation and torsion on the friction factor are also examined.Present results show the characteristics of the fluid flow in rotating helical square ducts.

  8. The Square Kilometre Array: An Engineering Perspective

    CERN Document Server

    Hall, Peter J

    2005-01-01

    This volume is an up-to-date and comprehensive overview of the engineering of the Square Kilometre Array (SKA), a revolutionary instrument which will be the world’s largest radio telescope. Expected to be completed by 2020, the SKA will be a pre-eminent tool in probing the Early Universe and in enhancing greatly the discovery potential of radio astronomy in many other fields. This book, containing 36 refereed papers written by leaders in SKA engineering, has been compiled by the International SKA Project Office and is the only contemporary compendium available. It features papers dealing with pivotal technologies such as antennas, RF systems and data transport. As well, overviews of important SKA demonstrator instruments and key system design issues are included. Practising professionals, and students interested in next-generation telescopes, will find this book an invaluable reference.

  9. Quantum mechanical streamlines. I - Square potential barrier

    Science.gov (United States)

    Hirschfelder, J. O.; Christoph, A. C.; Palke, W. E.

    1974-01-01

    Exact numerical calculations are made for scattering of quantum mechanical particles hitting a square two-dimensional potential barrier (an exact analog of the Goos-Haenchen optical experiments). Quantum mechanical streamlines are plotted and found to be smooth and continuous, to have continuous first derivatives even through the classical forbidden region, and to form quantized vortices around each of the nodal points. A comparison is made between the present numerical calculations and the stationary wave approximation, and good agreement is found between both the Goos-Haenchen shifts and the reflection coefficients. The time-independent Schroedinger equation for real wavefunctions is reduced to solving a nonlinear first-order partial differential equation, leading to a generalization of the Prager-Hirschfelder perturbation scheme. Implications of the hydrodynamical formulation of quantum mechanics are discussed, and cases are cited where quantum and classical mechanical motions are identical.

  10. Cosmology with the Square Kilometre Array

    CERN Document Server

    Rawlings, Steve

    2011-01-01

    We review how the Square Kilometre Array (SKA) will address fundamental questions in cosmology, focussing on its use for neutral Hydrogen (HI) surveys. A key enabler of its unique capabilities will be large (but smart) receptors in the form of aperture arrays. We outline the likely contributions of Phase-1 of the SKA (SKA1), Phase-2 SKA (SKA2) and pathfinding activities (SKA0). We emphasise the important role of cross-correlation between SKA HI results and those at other wavebands such as: surveys for objects in the EoR with VISTA and the SKA itself; and huge optical and near-infrared redshift surveys, such as those with HETDEX and Euclid. We note that the SKA will contribute in other ways to cosmology, e.g. through gravitational lensing and $H_{0}$ studies.

  11. Intrinsic mean-square displacements in proteins

    Science.gov (United States)

    Vural, Derya; Glyde, Henry R.

    2012-07-01

    The thermal mean-square displacement (MSD) of hydrogen in proteins and its associated hydration water is measured by neutron scattering experiments and used an indicator of protein function. The observed MSD as currently determined depends on the energy resolution width of the neutron scattering instrument employed. We propose a method for obtaining the intrinsic MSD of H in the proteins, one that is independent of the instrument resolution width. The intrinsic MSD is defined as the infinite time value of that appears in the Debye-Waller factor. The method consists of fitting a model to the resolution broadened elastic incoherent structure factor or to the resolution dependent MSD. The model contains the intrinsic MSD, the instrument resolution width, and a rate constant characterizing the motions of H in the protein. The method is illustrated by obtaining the intrinsic MSD of heparan sulphate (HS-0.4), ribonuclease A, and staphysloccal nuclase (SNase) from data in the literature.

  12. Domain wall brane in squared curvature gravity

    CERN Document Server

    Liu, Yu-Xiao; Zhao, Zhen-Hua; Li, Hai-Tao

    2011-01-01

    We suggest a thick braneworld model in the squared curvature gravity theory. Despite the appearance of higher order derivatives, the localization of gravity and various bulk matter fields is shown to be possible. The existence of the normalizable gravitational zero mode indicates that our four-dimensional gravity is reproduced. In order to localize the chiral fermions on the brane, two types of coupling between the fermions and the brane forming scalar is introduced. The first coupling leads us to a Schr\\"odinger equation with a volcano potential, and the other a P\\"oschl-Teller potential. In both cases, the zero mode exists only for the left-hand fermions. Several massive KK states of the fermions can be trapped on the brane, either as resonant states or as bound states.

  13. Intrinsic Mean Square Displacements in Proteins

    CERN Document Server

    Vural, Derya

    2012-01-01

    The thermal mean square displacement (MSD) of hydrogen in proteins and its associated hydration water is measured by neutron scattering experiments and used an indicator of protein function. The observed MSD as currently determined depends on the energy resolution width of the neutron scattering instrument employed. We propose a method for obtaining the intrinsic MSD of H in the proteins, one that is independent of the instrument resolution width. The intrinsic MSD is defined as the infinite time value of that appears in the Debye-Waller factor. The method consists of fitting a model to the resolution broadened elastic incoherent structure factor or to the resolution dependent MSD. The model contains the intrinsic MSD, the instrument resolution width and a rate constant characterizing the motions of H in the protein. The method is illustrated by obtaining the intrinsic MSD of heparan sulphate (HS-0.4), Ribonuclease A and Staphysloccal Nuclase (SNase) from data in the literature.

  14. Gravity as the Square of Gauge Theory

    CERN Document Server

    Bern, Zvi; Huang, Yu-tin; Kiermaier, Michael

    2010-01-01

    We explore consequences of the recently discovered duality between color and kinematics, which states that kinematic numerators in a diagrammatic expansion of gauge-theory amplitudes can be arranged to satisfy Jacobi-like identities in one-to-one correspondence to the associated color factors. Using on-shell recursion relations, we give a field-theory proof showing that the duality implies that diagrammatic numerators in gravity are just the product of two corresponding gauge-theory numerators, as previously conjectured. These squaring relations express gravity amplitudes in terms of gauge-theory ingredients, and are a recasting of the Kawai, Lewellen and Tye relations. Assuming that numerators of loop amplitudes can be arranged to satisfy the duality, our tree-level proof immediately carries over to loop level via the unitarity method. We then present a Yang-Mills Lagrangian whose diagrams through five points manifestly satisfy the duality between color and kinematics. The existence of such Lagrangians sugge...

  15. Healing and the mind/body arts: massage, acupuncture, yoga, t'ai chi, and Feldenkrais.

    Science.gov (United States)

    Wanning, T

    1993-07-01

    1. The health practitioner may encounter clients who are faced with problems that do not seem to respond to traditional health care. 2. One way that some choose to confront these systemic complaints is to employ some of the health traditions of other cultures and to view the body and mind as a balanced whole. 3. Massage, acupuncture and acupressure, t'ai chi, and Feldenkrais focus on the mind/body connection to facilitate healing through relaxation, pressure points, and movement. PMID:8338610

  16. Relations for Einstein-Yang-Mills amplitudes from the CHY representation

    CERN Document Server

    de la Cruz, Leonardo; Weinzierl, Stefan

    2016-01-01

    We show that a recently discovered relation, which expresses tree-level single trace Einstein-Yang-Mills amplitudes with one graviton and $(n-1)$ gauge bosons as a linear combination of pure Yang-Mills tree amplitudes with $n$ gauge bosons, can be derived from the CHY representation. In addition we show that there is a generalisation, which expresses tree-level single trace Einstein-Yang-Mills amplitudes with $r$ gravitons and $(n-r)$ gauge bosons as a linear combination of pure Yang-Mills tree amplitudes with $n$ gauge bosons. We present a general formula for this case.

  17. Production of chi mesons in 225 GeV/c π-Be interactions

    International Nuclear Information System (INIS)

    Gamma rays associated with psi mesons have been studied in 225 GeV/c π-Be interactions. The psi-γ mass spectrum shows an excess of 47 +- 11 events above background centered at 3.531 GeV/c2 with an rms width of 22.4 MeV. Attributing this excess of events to the decay chi → psi γ implies that 38 +- 9 % of all psi mesons are produced by this mechanism. The experimental setup and results are detailed

  18. The Role of M\\"obius Constants and Scattering Functions in CHY Scalar Amplitudes

    OpenAIRE

    Lam, C. S.; Yao, York-Peng

    2015-01-01

    The integrations leading to the Cachazo-He-Yuan (CHY) double-color $n$-point massless scalar amplitude are carried out one integral at a time. M\\"obius invariance dictates the final amplitude to be independent of the three M\\"obius constants $\\sigma_r, \\sigma_s, \\sigma_t$, but their choice affects integrations and the intermediate results. The effect of the M\\"obius constants, the two colors, and the scattering functions on each integration is investigated. A systematic way to carry out the $...

  19. Complementary and alternative treatment for neck pain: chiropractic, acupuncture, TENS, massage, yoga, Tai Chi, and Feldenkrais.

    Science.gov (United States)

    Plastaras, Christopher T; Schran, Seth; Kim, Natasha; Sorosky, Susan; Darr, Deborah; Chen, Mary Susan; Lansky, Rebecca

    2011-08-01

    Of the multitude of treatment options for the management of neck pain, no obvious single treatment modality has been shown to be most efficacious. As such, the clinician should consider alternative treatment modalities if a modality is engaging, available, financially feasible, potentially efficacious, and is low risk for the patient. As evidence-based medicine for neck pain develops, the clinician is faced with the challenge of which treatments to encourage patients to pursue. Treatment modalities explored in this article, including chiropractic, acupuncture, TENS, massage, yoga, Tai Chi, and Feldenkrais, represent reasonable complementary and alternative medicine methods for patients with neck pain. PMID:21824591

  20. Formation of macrocyclic lactones in the Paternò–Büchi dimerization reaction

    Directory of Open Access Journals (Sweden)

    Manabu Abe

    2011-02-01

    Full Text Available Furan-2-ylmethyl 2-oxoacetates 1a,b, in which the furan ring and the carbonyl moiety were embedded intramolecularly, were synthesized from commercially available furan-2-ylmethanol and their photochemical reaction (hν > 290 nm was investigated. Twelve-membered macrocyclic lactones 2a,b with Ci symmetry including two oxetane-rings, which are the Paternò–Büchi dimerization products, were isolated in ca. 20% yield. The intramolecular cyclization products, such as 3-alkoxyoxetane and 2,7-dioxabicyclo[2.2.1]hept-5-ene derivatives, were not detected in the photolysate.