WorldWideScience

Sample records for chi lecture interdisciplinary

  1. Globe Event | Lecture by Hervé Dessimoz and Thomas Büchi | 14 May

    CERN Multimedia

    Globe Info

    2013-01-01

    At the summit of Sustainable Development, by Hervé Dessimoz and Thomas Büchi.   Globe de la science et de l'innovation Route de Meyrin, 1211 Genève Tuesday 14 May 2013 at 8:30 p.m. The lecture will be in French Refuge du Goûter. Hervé Dessimoz and Thomas Büchi have been committed to sustainable development since the 2000s. They created the Palais de l’Équilibre at Expo.02. They designed an exhibition in conjunction with the Cité de la Science et de l’Industrie (Paris) to educate visitors about sustainable development. The pavilion was donated to CERN by the Swiss Confederation and rebuilt on the CERN site in 2004. It is now known as the Globe of Science and Innovation. The Refuge du Goûter, on the slopes of Mont Blanc, is the culmination of their research into sustainable development, with the aim of demonstrating that if we can construct a building at 3835 m which is a...

  2. ‘The concept of information in physics’: an interdisciplinary topical lecture

    Science.gov (United States)

    Dittrich, T.

    2015-01-01

    I present a didactical project, introducing the concept of information with all its interdisciplinary ramifications to students of physics and the neighbouring sciences. Proposed by Boltzmann as entropy, information has evolved into a common paradigm in science, economy, and culture, superseding energy in this role. As an integrating factor of the natural sciences at least, it lends itself as guiding principle for innovative teaching that transcends the frontiers of the traditional disciplines and emphasizes general viewpoints. Based on this idea, the postgraduate topical lecture presented here is intended to provide a firm conceptual basis, technically precise but versatile enough to be applied to specific topics from a broad range of fields. Basic notions of physics like causality, chance, irreversibility, symmetry, disorder, chaos, complexity can be reinterpreted on a common footing in terms of information and information flow. Dissipation and deterministic chaos, exemplifying information currents between macroscopic and microscopic scales, receive special attention. An important part is dedicated to quantum mechanics as an approach to physics that takes the finiteness of information systematically into account. Emblematic features like entanglement and non-locality appear as natural consequences. The course has been planned and tested for an audience comprising, besides physicists, students of other natural sciences as well as mathematics, informatics, engineering, sociology, and philosophy. I sketch history and objectives of this project, provide a resume of the course, report on experiences gained teaching it in various formats, and indicate possible future developments.

  3. ‘The concept of information in physics’: an interdisciplinary topical lecture

    International Nuclear Information System (INIS)

    I present a didactical project, introducing the concept of information with all its interdisciplinary ramifications to students of physics and the neighbouring sciences. Proposed by Boltzmann as entropy, information has evolved into a common paradigm in science, economy, and culture, superseding energy in this role. As an integrating factor of the natural sciences at least, it lends itself as guiding principle for innovative teaching that transcends the frontiers of the traditional disciplines and emphasizes general viewpoints. Based on this idea, the postgraduate topical lecture presented here is intended to provide a firm conceptual basis, technically precise but versatile enough to be applied to specific topics from a broad range of fields. Basic notions of physics like causality, chance, irreversibility, symmetry, disorder, chaos, complexity can be reinterpreted on a common footing in terms of information and information flow. Dissipation and deterministic chaos, exemplifying information currents between macroscopic and microscopic scales, receive special attention. An important part is dedicated to quantum mechanics as an approach to physics that takes the finiteness of information systematically into account. Emblematic features like entanglement and non-locality appear as natural consequences. The course has been planned and tested for an audience comprising, besides physicists, students of other natural sciences as well as mathematics, informatics, engineering, sociology, and philosophy. I sketch history and objectives of this project, provide a resume of the course, report on experiences gained teaching it in various formats, and indicate possible future developments. (paper)

  4. Interdisciplinary Subject "Yakugaku Nyumon" for First-year Students Constructed with Lectures and Problem-based Learning.

    Science.gov (United States)

    Yamaki, Kouya; Ueda, Masafumi; Ueda, Kumiko; Emoto, Noriaki; Mizutani, Nobuaki; Ikeda, Koji; Yagi, Keiko; Tanaka, Masafumi; Habu, Yasushi; Nakayama, Yoshiaki; Takeda, Norihiko; Moriwaki, Kensuke; Kitagawa, Shuji

    2016-01-01

    In 2013, Kobe Pharmaceutical University established "Yakugaku Nyumon", an interdisciplinary course, which consists of omnibus lectures and problem-based learning (PBL) on topics ranging from basic to clinical subjects. The themes of the PBL were original ones; "Study from package inserts of aspirin", which aimed to reinforce the contents of the interdisciplinary lectures, and "Let's think about aspirin derivatives (super-aspirin)", which aimed to engender an interest in studying pharmacy. The PBL featured questions from teachers to help with study and was therefore referred to as "question-led PBL" (Q-PBL). The Q-PBL regarding aspirin derivatives began with preparing answers to the questions for a small group discussion (SGD) as an assignment, followed by a SGD, a presentation, and peer-feedback. From an analysis of the questionnaire survey, it was found that students considered the Q-PBL satisfying and that they had achieved the 4 aims: (1) to increase the motivation to study, (2) to enhance an understanding of the relations and significance of basic and clinical sciences, (3) to comprehend the learning content, and (4) to recognize the importance of communication. The Q-PBL with assignments has two favorable points. One is that the first-year students can challenge difficult and high-level questions when they are given these as assignments. The other is that students, who are unfamiliar with SGD can engage in discussions with other students using the knowledge gained from the assignment. The introduction of omnibus lectures and Q-PBL, along with these improvements in theme, application, and review process, promises increased learning efficacy at the university. PMID:27374968

  5. Time, temporality, now. Experiencing time and concepts of time in an interdisciplinary perspective. Lectures.

    Science.gov (United States)

    Atmanspacher, H.; Ruhnau, E.

    The essays in this topical volume inquire into one of the most fundamental issues of philosophy and the cognitive and natural sciences: the riddle of time. The central feature is the tension between the experience and the conceptualization of time, reflecting an apparently unavoidable antinomy of subjective first-person accounts and objective traditional science. Is time based in the physics of inanimate matter, or does it originate in the operation of our minds? Is it essential for the constitution of reality, or is it just an illusion? Issues of time, temporality, and nowness are paradigms for interdisciplinary work in many contemporary fields of research. The authors of this volume discuss profoundly the mutual relationships and inspiring perspectives. They address a general audience with academic background knowledge.

  6. Teaching about Fascism: An Interdisciplinary Approach.

    Science.gov (United States)

    Hirshfield, Claire

    1980-01-01

    Describes a university course which teaches the history of fascism and nazism through interdisciplinary methods: philosophy, film, literature, and art. Visiting lecturers include survivors of concentration camps. (KC)

  7. Tai Chi and Qi Gong for Health and Well-Being

    Medline Plus

    Full Text Available ... Online Continuing Education Series Distinguished Lecture Series Integrated Medicine Research Lecture Series All Training Information News & Events ... features tai chi A practice in traditional Chinese medicine that uses a series of slow, gentle movements ...

  8. Interdisciplinary Curriculum

    OpenAIRE

    Ahmadi, P

    2009-01-01

    This paper includes discussions on the concept of interdisciplinary curriculum, interdisciplinary curriculum at different educational levels, interdisciplinary curriculum and structuralist philosophy, advantages and disadvantages of such curricula, interdisciplinary curriculum based on knowledge and process, interdisciplinary curriculum based on themes, an example of interdisciplinary curriculum, conclusion and proposals.

  9. Lecturing the lecturers

    Science.gov (United States)

    Osborne, Jonathan

    2010-02-01

    João Magueijo's article "Cargo-cult training" about the failings of compulsory educational training for lecturers (December 2009 pp16-17) is an illustration of why some university lecturers do need to be educated about education. His argument that we should use lectures because students like them ignores the large body of educational research stating that this is the least effective form of education. It might, as the well-known aphorism states, be a successful means of transferring the notes of the lecturer to the notes of the students without going through the minds of either, but the evidence shows that only 10% of students learn material in this way. Rather, all the educational literature points to the fact that interactive, discursive methods are much more likely to produce learning with understanding.

  10. The Lecture

    Science.gov (United States)

    Chaudhury, S. Raj

    2011-01-01

    Academic lectures for the purpose of instruction maintain an important presence in most colleges and universities worldwide. This chapter examines the current state of the lecture and how learning sciences research can inform the most effective use of this method. The author presents evidence that the lecture can be an effective element of…

  11. Interdisciplinary rehabilitation

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    @@ IntroductionInterdisciplinary rehabilitation, or care by a team of rehabilitation professionals, has been a core strategy of rehabilitation medicine since its beginning. As a result, quality assessments of these programs universally include evaluating the effectiveness of their interdisciplinary teams. Rehabilitation programs for individuals with physical and cognitive disabilities originally were institutionally based, an environment that facilitated the communication needed for interdisciplinary care. These programs addressed a full spectrum of problems, including health, physical functioning, psychological adjustment, social integration, and vocational or other significant role participation. The implementation of truly interdisciplinary programs has always been difficult because of this complexity, but recent restrictions in the resources available to provide rehabilitation have increased this difficulty. With less professional time available because of limited funds, the interdisciplinary process is being challenged to show its value, and to be as efficient as possible.This paper discusses the benefits to be gained through the interdisciplinary process, factors that reduce its cost effectiveness and strategies to maintain its advantages at the least possible cost.

  12. Rho Chi lecture. Pharmacy in a smaller world.

    Science.gov (United States)

    Weaver, L C

    1986-09-01

    Health care is a business. Pharmacy is in the health business. The health care delivery system in the U.S. is rapidly becoming a managed system by corporations. Further, these corporations are moving toward international markets where some already have considerable experience. There are many parts of the world not participating in these developments in health care. Some are just off our shores in the Caribbean Basin. A review of activities occurring in recent years by various groups suggests that more could be done. Two modest approaches are presented. Support of the American Association of Colleges of Pharmacy's "Pharmacy School Twinning Project" through which U.S. pharmacy schools would work with pharmacy schools in Central and South America is recommended. Also, national pharmacy associations jointly with pharmaceutical companies would work together using their expertise in continuing pharmacy education to develop new education models for the needy areas of the world. PMID:3757790

  13. Interdisciplinary Communication

    Directory of Open Access Journals (Sweden)

    Nagib Callaos

    2013-12-01

    Full Text Available Communication is fundamental in scientific practice and an integral part of academic work. The practice of communication cannot be neglected by those who are trying to advance scientific research. Effective means should continuously be identified in order to open channels of communication within and among disciplines, among scientists and between scientists and the general public.[1]The increasing importance of interdisciplinary communication has been pointed out by an increasing number of researchers and scholars, as well as in conferences and roundtables on the subject. Some authors even estimate that "interdisciplinary study represents the future of the university."[2] Since interdisciplinary study is "the most underthought critical, pedagogical and institutional concept in modern academy"[3] it is important to think and reflect, and even do some research, on this concept or notion. Research and practice based reflections with regards to this issue are important especially because the increasing complexity and proliferation of scientific research is generating countless specialties, sub-specialties and sub-sub-specialties, with their respective special languages; which were "created for discrete local areas of research based upon the disconnected branches of science."[4] On the other hand, scientific, technical and societal problems are requiring multi- or inter-disciplinary consideration. Consequently, interdisciplinary communication channels are being needed with urgency, and scientific research should be integrated, not just in the context of its discipline, but also in the context of related disciplines. Much more reflection and research should be done on this issue. Research on adequate research integration and communication is urgently required, i.e. meta-research efforts should be done in order to relate research results in an adequate and more useful way. This meta-research effort might be done in the context of each particular

  14. Special lecture

    International Nuclear Information System (INIS)

    In his special lecture, given at the Artsimovich-Kadomtsev Memorial Session of the 17th IAEA Fusion Energy Conference in Yokohama, October 1998, Prof. H. Yoshikawa stated that the fusion program had come to a crossroads. He was wondering whether the future would lead to cooperation between nations, striving to overcome the difficulties the world is confronted with, or if it would lead to despair

  15. Interdisciplinary technology

    Science.gov (United States)

    Nichols, Lester D.

    1993-01-01

    The 'computational test-cell' will enable the incorporation of new methodologies, such as concurrent engineering and probabilistic methods, into the propulsion design process. This will provide the capability to conduct credible, interdisciplinary analyses of new propulsion concepts and designs. Probabilistic methods can be used as the basis for reliability-based design. Recently methods have been devised that provide the capability of simulating the performance of propulsion systems at several levels of resolution. These methods make it possible to quantify uncertainty and to establish confidence bounds for the calculated values. The introduction of reliability-based design methodology along with probabilistic analyses will provide a tool to reduce the design space for new systems and to reduce our dependence on hardware testing for proof-of-concept and system integration demonstrations. The resulting simulations will reduce the need for testing and identify potential operational problems early in the design process. This capability will make it possible to compute the expected performance, stability, reliability, and life of propulsion components, subsystems, and systems at design and off-design conditions, to bring life cycle cost trade-offs early into the design process and to determine optimum designs to satisfy specified mission requirements.

  16. Summary Lecture

    Indian Academy of Sciences (India)

    J. O. Stenflo

    2000-09-01

    This summary lecture makes no attempt to summarize what was actually said at the meeting, since this is well covered by the other contributors. Instead I have structured my presentation in three parts: First I try to demonstrate why the Sun is unique by comparing it with laboratory plasmas. This is followed by some personal reminiscences that go back a significant fraction of the century. I conclude in the form of a poem about this memorable conference in honor of the centennial anniversary of the Kodaikanal Observatory.

  17. CHY formula and MHV amplitudes

    CERN Document Server

    Du, Yi-jian; Wu, Yong-shi

    2016-01-01

    In this paper, we study the relation between the Cachazo-He-Yuan (CHY) formula and the maximal-helicity-violating (MHV) amplitudes of Yang-Mills and gravity in four dimensions. We prove that only one special rational solution of the scattering equations found by Weinzierl support the MHV amplitudes. Namely, localized at this solution, the integrated CHY formula reproduces the Parke-Taylor formula for Yang-Mills amplitudes as well as the Hodges formula for gravitational amplitudes. This is achieved by developing techniques, in a manifestly M\\"obius covariant formalism, to explicitly compute relevant reduced Pfaffians/determinants. We observe and prove two interesting properties (or identities), which facilitate the computations. We also check that all the other $(n-3)!-1$ solutions to the scattering equations do not support the MHV amplitudes, and prove analytically that this is indeed true for the other special rational solution proposed by Weinzierl, that actually supports the anti-MHV amplitudes.

  18. The CHI 2013 interactive schedule

    DEFF Research Database (Denmark)

    Satyanarayan, Arvind; Strazzulla, Daniel; Klokmose, Clemens Nylandsted;

    2013-01-01

    available. The CHI'13 Interactive Schedule helps attendees navigate this wealth of video content in order to identify events they would like to attend. It consists of a number of large display screens throughout the conference venue which cycle through a video playlist of events. Attendees can interact with...... these displays using their mobile devices by either constructing custom video playlists or adding on-screen content to their personal schedule....

  19. CHY formula and MHV amplitudes

    Science.gov (United States)

    Du, Yi-Jian; Teng, Fei; Wu, Yong-Shi

    2016-05-01

    In this paper, we study the relation between the Cachazo-He-Yuan (CHY) formula and the maximal-helicity-violating (MHV) amplitudes of Yang-Mills and gravity in four dimensions. We prove that only one special rational solution of the scattering equations found by Weinzierl supports the MHV amplitudes. Namely, localized at this solution, the integrated CHY formula produces the Parke-Taylor formula for MHV Yang-Mills amplitudes as well as the Hodges formula for MHV gravitational amplitudes, with an arbitrary number of external gluons/gravitons. This is achieved by developing techniques, in a manifestly Möbius covariant formalism, to explicitly compute relevant reduced Pfaffians/determinants. We observe and prove two interesting properties (or identities), which facilitate the computations. We also check that all the other ( n - 3)! - 1 solutions to the scattering equations do not support the MHV amplitudes, and prove analytically that this is indeed true for the other special rational solution proposed by Weinzierl, that actually supports the anti-MHV amplitudes. Our results reveal a mysterious feature of the CHY formalism that in Yang-Mills and gravity theory, solutions of scattering equations, involving only external momenta, somehow know about the configuration of external polarizations of the scattering amplitudes.

  20. Tai Chi: Rx for Arthritic Knees

    Science.gov (United States)

    ... that tai chi can be effective in helping sleep, while reducing stress, anxiety and depression. "The mind component [of tai chi] promotes psychological well-being, life satisfaction, and improved perceptions of health," said Wang. Dr. Matthew Hepinstall, an ...

  1. Interdisciplinary Science and Policy

    OpenAIRE

    Levien, R.E.

    1981-01-01

    I am a mathematician by education and a manager of interdisciplinary policy research by experience. In this paper, I want to use the style of my discipline to express the lessons of my profession. Through a series of propositions, corollaries, and theorems I will try to demonstrate my thesis of relationship between interdisciplinary science and policy: interdisciplinary science is a necessary aid to policy, and special policies are needed, in turn, to achieve useful interdisciplinary science....

  2. Biomedical wellness by tai chi and sports

    Science.gov (United States)

    Chin, Daniel C.; Chin, Amita G.

    2011-06-01

    Tai-chi chuan is popular worldwide especially in China. People practice tai-chi chuan daily with faith believing that they will be rewarded with health and varieties of other rewords. The Tai Chi Chuan Theory by Master Chang and the Tai Chi Chuan Theory by Master Wang are translated to be the baseline of the tai-chi chuan. The theory described in these two papers clearly shows that the tai-chi power source is the combination of the two antigravity forces distinction by each foot. The ying, yang and hollowed, solid discussed in the papers are the properties and body relationship of the two antigravity forces. The antigravity forces presented inside of body are as air to the balloon termed chi. However chi could be generated by any muscle pressing; only the antigravity forces from feet are called nature chi that has the maximum strength of the person. When a person is soft, as an infant the nature chi will fulfill entire body with no time and effort. The sequence forms were designed for deploying the nature chi in speed and power. The combination of chi and tai-chi form make tai chi chuan supreme than other kinds of martial art. In the training process chi massages whole body many time for a sequence form practice that stimulate all organs and could lead to cure body diseases, lose weight, postpone aging process, and remove the aging symptoms. For the people practicing in the park daily with proper guidance they will fulfill their wishes. Tai chi exercise could also apply to other sports as in dancing and golfing they are discussed at the end of the paper.

  3. INTERDISCIPLINARY APPROACH TO TEACHING

    OpenAIRE

    N.A. Sevryuk

    2014-01-01

    Educational transformation in Russia allows using new methods in teaching and learning. One of which is the interdisciplinary approach. The article describes the definition of the interdisciplinary approach, shows the reasons why to teach with it, and explains the advantages of using it and how it helps students advance their thinking, cognitive development and other abilities. It also gives some interdisciplinary examples.

  4. The Use of Questions by Professors in Lectures Given in English: Influences of Disciplinary Cultures

    Science.gov (United States)

    Chang, Yu-Ying

    2012-01-01

    Several previous studies have investigated the use of questions to facilitate interactions in academic lectures in tertiary education. However, the issue of how disciplinary cultures influence the patterns of questions in lectures has received little attention. Therefore, this study aims to examine the interdisciplinary differences in professors'…

  5. Video Lecture Watching Behaviors of Learners in Online Courses

    Science.gov (United States)

    Ozan, Ozlem; Ozarslan, Yasin

    2016-01-01

    This paper examines learners' behaviors while watching online video lectures to understand learner preferences. 2927 students' 18,144 video events across 13 courses on Sakai CLE LMS, which were integrated with Kaltura Video Platform and Google Analytics, were analyzed. For the analysis of the quantitative data, one-way ANOVA, Chi-square test of…

  6. Homogeneity and heterogeneity in disciplinary discourse: tracking the management of intertextuality in undergraduate academic lectures

    OpenAIRE

    Endacott, Nicholas Mark

    2005-01-01

    Using a corpus of twenty-four lectures drawn from The BASE corpus*, this study is an analysis and inter-disciplinary comparison of the management of Intertextuality in the genre of the undergraduate lecture. Theorising Intertextuality as central within the discursive (re-)construction of disciplinary knowledge, the investigation of Intertextuality is viewed as the investigation of the discursively-mediated interaction(s) of a current lecturer with original knowledge-constituting discourses, a...

  7. Industry Lecture 2010

    DEFF Research Database (Denmark)

    Kragh, Helge

    2010-01-01

    Sammendrag af "Industry Lecture", Norsk Kjemisk Selskap, Universitetet i Oslo, givet 15/10 2010.......Sammendrag af "Industry Lecture", Norsk Kjemisk Selskap, Universitetet i Oslo, givet 15/10 2010....

  8. Incentives for interdisciplinary research

    OpenAIRE

    Pereira, Isabel Maria Medalho

    2008-01-01

    This paper is a positive analysis of the driving forces in interdisciplinary research. I take the perspective of a research institution that has to decide how to apply its resources among the production of two types of knowledge: specialized or interdisciplinary. Using a prize mechanism of compensation, I show that the choice of interdisciplinarity is compatible with profit maximization when the requirement for the production is sufficiently demanding, and when the new interdisciplinary field...

  9. Chi activity during transduction-associated recombination.

    OpenAIRE

    Dower, N. A.; Stahl, F. W.

    1981-01-01

    Chi is a genetic element that stimulates phage lambda recombination by the Escherichia coli recBC pathway during lytic infection [Stahl, F. W. (1979) Annu. Rev. Genet. 13, 7--24]. Herein we show that chi in lambda prophage influences exchange distribution in P1 phage-mediated transduction and in conjugation. This demonstration encourages the view that chi may influence genetic exchange in E. coli in the total absence of lambda.

  10. Tai Chi philosophy and nursing epistemology.

    Science.gov (United States)

    Alperson, Sunny Yim

    2008-01-01

    This article analyzes the philosophy underpinning Tai Chi practice in light of nursing epistemology. The first half of the article reviews the general characteristics of major Chinese philosophical traditions that have been merged in Tai Chi: Confucianism, Daoism, and Buddhism. In the second half, themes of integration and praxis in Tai Chi are linked with Carper's fundamental patterns of knowing in nursing. Tai Chi is a practical fusion of humanistic philosophy with an experiential dimension of movement in a nondualistic foundation. The author argues that TC philosophy can be applied to integrated knowledge development and nursing praxis. PMID:20531257

  11. Healing of subsurface damage after the 1999 Chi-Chi earthquake

    Science.gov (United States)

    Chen, K. H.; Rau, R.; Dreger, D. S.

    2009-12-01

    Observation of six M 4.6 repeating earthquakes in eastern Taiwan from 1991 to 2007 reveals a unique temporal and spatial variation in seismic wave character associated with the 1999 Mw 7.6 Chi-Chi earthquakes that occurred ~90 km away. Post-Chi-Chi events have reduced waveform similarity, suggesting a sudden change of seismic wave propagation properties after the Chi-Chi event. The changes in seismic character are widely distributed over Taiwan and remain significant in 5 years after Chi-Chi. Since 2004, the waveform similarity gradually recovered to the pre-Chi-Chi level. The most recent repeating event occurred on 15 November 2007 reveals only a subtle variation in seismic character compared to the pre-Chi-Chi event. This indicates that the damaged rock has been regaining the strength with time. The healing of subsurface damage zone, however, is not fully complete even 8 yr after the Chi-Chi earthquake. Using cross correlation function derived time-lag between the pre- and post- Chi-Chi events, we also identify a ~1 sec delay for the 2001 repeating event at a number of stations. Such a large delay shown in different parts of seismograms for different stations may indicate a broad range of fluid-filled scatterers along the travel path. For the station with the longest distance from the M 4.6 event (~200 km), PNG station on Penghu island off the western coast of Taiwan, the 1sec delay appears on early P wave coda. This suggests that the scatterers are likely located down to a depth of at least 20 km.

  12. CHI: A General Agent Communication Framework

    Energy Technology Data Exchange (ETDEWEB)

    Goldsmith, S.Y.; Phillips, L.R.; Spires, S.V.

    1998-12-17

    We have completed and exercised a communication framework called CHI (CLOS to HTML Interface) by which agents can communicate with humans. CHI follows HTTP (HyperText Transfer Protocol) and produces HTML (HyperText Markup Language) for use by WWW (World-Wide Web) browsers. CHI enables the rapid and dynamic construction of interface mechanisms. The essence of CHI is automatic registration of dynamically generated interface elements to named objects in the agent's internal environment. The agent can access information in these objects at will. State is preserved, so an agent can pursue branching interaction sequences, activate failure recovery behaviors, and otherwise act opportunistically to maintain a conversation. The CHI mechanism remains transparent in multi-agent, multi-user environments because of automatically generated unique identifiers built into the CHI mechanism. In this paper we discuss design, language, implementation, and extension issues, and, by way of illustration, examine the use of the general CHI/HCHI mechanism in a specific international electronic commerce system. We conclude that the CHI mechanism is an effective, efficient, and extensible means of the agent/human communication.

  13. Student to lecturer link

    OpenAIRE

    Asamoah, Andrea; Koumenides, Christos; Kousetti, Chrysovalanto; Handford, David

    2008-01-01

    Interactivity and feedback are key contributors to providing an effective learning environment for students. Lectures provide the main resource for university students to discover what is expected of them and to identify the key learning goals related to a course, from a lecturer. This paper focuses on resolving the problems and anxieties faced by first year Computer Science students at the University of Southampton, through various user-centred design methodologies. Lecturers are also consid...

  14. Data Mining: Lecture notes

    OpenAIRE

    Demsar, Janez

    2015-01-01

    This material contents the "handouts" given to students for data mining lecture held at the Department of Health Informatics at the University of Kyoto in July 2010. The informality of the "course", which took five two-hour lectures is reflected in informality of this text, too, as it even includes references to discussions at past lectures and so on. Some more material is available at http://www.ailab.si/janez/kyoto.

  15. Chi-Nu Level 2 Review

    Energy Technology Data Exchange (ETDEWEB)

    Haight, Robert Cameron [Los Alamos National Laboratory; Lee, Hye Young [Los Alamos National Laboratory; Mosby, Shea Morgan [Los Alamos National Laboratory; O' Donnell, John M. [Los Alamos National Laboratory; Solomon, Clell Jeffrey Jr. [Los Alamos National Laboratory; Taddeucci, Terry Nicholas [Los Alamos National Laboratory; Fotiadis, Nikolaos [Los Alamos National Laboratory; Devlin, Matthew James [Los Alamos National Laboratory; Ullmann, John Leonard [Los Alamos National Laboratory; Bredeweg, Todd Allen [Los Alamos National Laboratory; Jandel, Marian [Los Alamos National Laboratory; Nelson, Ronald Owen [Los Alamos National Laboratory; Wender, Stephen Arthur [Los Alamos National Laboratory; Neudecker, Denise [Los Alamos National Laboratory; Rising, Michael Evan [Los Alamos National Laboratory; White, Morgan Curtis [Los Alamos National Laboratory; Wu, Ching-Yen [Los Alamos National Laboratory; Bucher, Brian Michael [Los Alamos National Laboratory; Buckner, Matthew Quinn [Los Alamos National Laboratory; Henderson, Roger Alan [Los Alamos National Laboratory

    2015-09-18

    This series of slides presents information on Chi-Nu measurements and analysis of prompt fission neutron spectra (PFNS) for neutron energy below 1 MeV for 235U. A key focus of the Chi-Nu measurement is to address the energy dependence of the low-energy emissions. The 235U PFNS evaluation is in progress. Chi-Nu delivered preliminary experimental data and input for part of the old experimental data base. The 239Pu PFNS evaluation is finalized and submitted for testing. Data from 252Cf spontaneous fission will also be obtained.

  16. Consumer Health Informatics in the Context of Engaged Citizens and eHealth Services - A New CHI Meta Model.

    Science.gov (United States)

    Wiesner, Martin; Griebel, Lena; Becker, Kurt; Pobiruchin, Monika

    2016-01-01

    Consumer Health Informatics (CHI) is a relatively new and interdisciplinary field in Medical Informatics. It focuses on consumer- rather than professional-centered services. However, the definitions and understanding of a) what is a "consumer"? or b) what is health technology in the context of CHI? and c) what factors and actors influence the usage of eHealth services? vary widely. The CHI special interest group (SIG) - associated with the German Association for Medical Informatics, Biometry and Epidemiology - conducted two workshops in 2015 to improve the common understanding on these topics. The workshop outcomes, the derived CHI-specific meta model and examples how to apply this model are presented in this paper. The model supports the definition of multi-actor contexts, as it not solely reflects the conventional patient-physician relationship but also allows for the description of second health market providers. PMID:27332268

  17. Insects: An Interdisciplinary Unit

    Science.gov (United States)

    Leger, Heather

    2007-01-01

    The author talks about an interdisciplinary unit on insects, and presents activities that can help students practice communication skills (interpersonal, interpretive, and presentational) and learn about insects with hands-on activities.

  18. Effective Field Theory and $\\chi$pt

    OpenAIRE

    Holstein, Barry R.

    2000-01-01

    A brief introduction to the subject of chiral perturbation theory ($\\chi$pt) is given, including a discussion of effective field theory and application to the upcoming Bates virtual Compton scattering measurement.

  19. Academic Training Lecture - Regular lecture programme

    CERN Multimedia

    PH Department

    2011-01-01

    Wednesday 28, Thursday 29 and Friday 30 September 2011 Supersymmetric Recipes by Prof. Ben Allanech / University of Cambridge, UK  from 11:00 to 12:00 (Europe/Zurich) at CERN ( Main Auditorium, Bldg. 500 ) In these lectures, I shall describe the theory of supersymmetry accessible to people with a knowledge of basic quantum field theory. The lectures will contain recipes of how to calculate which interactions (and which special relations) are in supersymmetry, without providing detailed proofs of where they come from. We shall also cover: motivation for weak-scale supersymmetry and the minimal supersymmetric standard model.

  20. Lectures on combustion theory

    Energy Technology Data Exchange (ETDEWEB)

    Burstein, S.Z.; Lax, P.D.; Sod, G.A. (eds.)

    1978-09-01

    Eleven lectures are presented on mathematical aspects of combustion: fluid dynamics, deflagrations and detonations, chemical kinetics, gas flows, combustion instability, flame spread above solids, spark ignition engines, burning rate of coal particles and hydrocarbon oxidation. Separate abstracts were prepared for three of the lectures. (DLC)

  1. STUDENTS ATTITUDE TO INTERDISCIPLINARY RESEARCH

    OpenAIRE

    Ahrens, Andreas; Zaščerinska, Jeļena

    2015-01-01

    Interdisciplinary research helps to turn bi-modal nature of phenomenon into success as interdisciplinary research ensures the synergy between two contrasting modes or forms. However, students’ attitude to interdisciplinary research has not been analysed. The purpose of the contribution is to analyse students’ attitude to interdisciplinary research underpinning elaboration of a hypothesis on ensuring students’ positive attitude to interdisciplinary research within university studies. The meani...

  2. ACADEMIC TRAINING LECTURE

    CERN Multimedia

    Academic Training; Tel 73127

    2001-01-01

    28, 29, 30, 31 May and 1 June REGULAR LECTURE PROGRAMME From 11:00 hrs - Main Auditorium bldg. 500 Quantum computing and Quantum cryptography T. Hey / University of Southampton, GB, and D. Ross / CERN-TH This course will give both an overview and a detailed introduction to quantum computing and quantum cryptography. The first lecture will survey the field, starting from its origins in Feyman's lecture in 1981. The next three lectures will explain in detail the relevance of Bell states and the workings of Grover's Quantum Search and Shor's quantum factorization algorithms. In addition, an explanation of quantum teleportation will be given. The last lecture will survey the recent progress towards realizing working quantum computers and quantum cryptographic systems.

  3. Focus point: Solar Energy Partnership with Africa : An Inter-disciplinary Research Project

    OpenAIRE

    Düren, Michael; Speitkamp, Winfried

    2008-01-01

    In the summer of 2007 an inter-disciplinary working group was formed at the Justus-Liebig-University to sound out the opportunities and challenges of an energy partnership with Africa. In a series of interdisciplinary lectures and at a conference in June 2008 this subject was further explored. Additional conferences and workshops, as well as research projects on certain aspects of the subject will follow. Physicists, chemists, geographers, historians, political scientists, economists, a...

  4. ACADEMIC TRAINING LECTURE

    CERN Multimedia

    Academic Training; Tel. 73127

    2001-01-01

    12, 13, 14, 15 & 16 March REGULAR LECTURE PROGRAMME From 11:00 hrs - Main Auditorium bldg. 500 Telecommunication for the future Rob Parker / CERN-IT Few fields have experienced such a high level of technical advance over the last few decades as that of telecommunications. This lecture series will track the evolution of telecommunications systems since their inception, and consider how technology is likely to advance over the next years. A personal view will also be given of the effect of these innovations on our work and leisure activities.The lecture series will be aimed at an audience with no specific technical knowledge of telecommunications.

  5. $\\chi_{c1}$ and $\\chi_{c2}$ production at $e^+e^-$ colliders

    CERN Document Server

    Czyz, Henryk; Tracz, Szymon

    2016-01-01

    Direct, resonant production of the charmonium states $\\chi_{c1}$ and $\\chi_{c2}$ in electron-positron annihilation is investigated. Depending on details of the model, a sizeable variation of the prediction for the production cross section is anticipated. It is demonstrated that resonant production could be observed under favorable circumstances.

  6. Lectures on advances in combinatorics

    CERN Document Server

    Ahlswede, Rudolf

    2008-01-01

    The main focus of these lectures is basis extremal problems and inequalities – two sides of the same coin. Additionally they prepare well for approaches and methods useful and applicable in a broader mathematical context. Highlights of the book include a solution to the famous 4m-conjecture of Erdös/Ko/Rado 1938, one of the oldest problems in combinatorial extremal theory, an answer to a question of Erdös (1962) in combinatorial number theory "What is the maximal cardinality of a set of numbers smaller than n with no k+1 of its members pair wise relatively prime?", and the discovery that the AD-inequality implies more general and sharper number theoretical inequalities than for instance Behrend's inequality. Several concepts and problems in the book arise in response to or by rephrasing questions from information theory, computer science, statistical physics. The interdisciplinary character creates an atmosphere rich of incentives for new discoveries and lends Ars Combinatoria a special status in mathemat...

  7. 10 Suggestions for Enhancing Lecturing

    Science.gov (United States)

    Heitzmann, Ray

    2010-01-01

    Criticism of the lecture method remains a staple of discussion and writing in academia--and most of the time it's deserved! Those interested in improving this aspect of their teaching might wish to consider some or all of the following suggestions for enhancing lectures. These include: (1) Lectures must start with a "grabber"; (2) Lectures must be…

  8. Feynman Lectures on Computation

    CERN Document Server

    Feynman, Richard Phillips; Allen, Robin W

    1999-01-01

    "When, in 1984-86, Richard P. Feynman gave his famous course on computation at the California Institute of Technology, he asked Tony Hey to adapt his lecture notes into a book. Although led by Feynman,"

  9. Lectures on Unification

    OpenAIRE

    Ananthanarayan, B.

    1997-01-01

    In these lectures we review the motivation, principles of and (circumstantial) evidence for the program of unification of the fundamental forces. In an appendix, we review the group theory pertinent to the program.

  10. A Geminoid as Lecturer

    DEFF Research Database (Denmark)

    Abildgaard, Julie Rafn; Schärfe, Henrik

    2012-01-01

    In this paper we report our findings from an experiment with the teleoperated android Geminoid-DK. The geminoid took up the role of a university lecturer and delivered a 45 minute lecture in front of 150 freshmen students at Aalborg University. While considering the role of the geminoid in this e...... educational context, we report results relating to large-room teaching, as well as gender differences in the perception of the robot....

  11. Gain Shift Corrections at Chi-Nu

    Energy Technology Data Exchange (ETDEWEB)

    Brown, Tristan Brooks [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Univ. of Massachusetts, Lowell, MA (United States). Dept. of Physics and Applied Physics; Devlin, Matthew James [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2016-08-30

    Ambient conditions have the potential to cause changes in liquid scintillator detector gain that vary with time and temperature. These gain shifts can lead to poor resolution in both energy as well as pulse shape discrimination. In order to correct for these shifts in the Chi-Nu high energy array, a laser system has been developed for calibration of the pulse height signals.

  12. Tai Chi, Qi Gong and Reiki.

    Science.gov (United States)

    Chu, Dennis A

    2004-11-01

    Tai Chi, Qi Gong, and Reiki are complementary therapies that are gaining popularity with patients. Although these therapies seem simple and attractive in their philosophy and are easy to apply,more objective, well-designed research is needed to prove their efficacy and to gain acceptance from the medical community. PMID:15458751

  13. Tai Chi Chuan in Medicine and Health Promotion

    OpenAIRE

    Ching Lan; Ssu-Yuan Chen; Jin-Shin Lai; Alice May-Kuen Wong

    2013-01-01

    Tai Chi Chuan (Tai Chi) is a Chinese traditional mind-body exercise and recently, it becomes popular worldwide. During the practice of Tai Chi, deep diaphragmatic breathing is integrated into body motions to achieve a harmonious balance between body and mind and to facilitate the flow of internal energy (Qi). Participants can choose to perform a complete set of Tai Chi or selected movements according to their needs. Previous research substantiates that Tai Chi has significant benefits to heal...

  14. Lecture Quiz 3.0: A Gaming Platform for Lectures

    OpenAIRE

    Døvik, Kristian; Hestad, John Andre

    2011-01-01

    This thesis is the continuation of our specialization project, Lecture Quiz 2.5.This platform is a game-like system where lecturers can hold quizzes in lectures to increase student participation and interactivity.The current version is a finished lecture quiz system that can be used in lecture environments.Lecture Quiz 3.0 has moved away from earlier implementations, by centralizing and minimizing the effort to start and run quizzes.One focus was multi-platform and we developed the system to ...

  15. ACADEMIC TRAINING LECTURE

    CERN Multimedia

    Academic Training; Tel. 73127

    2001-01-01

    ACADEMIC TRAINING LECTURE 1, 2, 3, 4 and 5 October LECTURES FOR POSTGRADUATE STUDENTS From 10:00 hrs - Main Auditorium bldg. 500 1 Introduction to particle accelerators E.J.N. Wilson / CERN-AC , Head of the CERN Accelerator School This new series of lectures is intended for anyone with a technical or scientific background who would like to become familiar with the principles of accelerator design. It is a complement to last year's course and includes new lectures on present day accelerators, and their applications as well as colliders and neutrino factories. Beam dynamics, which was treated at length in last year's course, has been compressed into one lecture, intended as revision for those who followed earlier courses and an introduction for newcomers to the field. The course should not be missed by those who will attend the CAS Intermediate Accelerator School in Seville. 1-10 10:00 Present-day Accelerators 11:00 - Beam Dynamics 2-10 10:00 Accelerating Cavities 11:00 - Non-linear Dynamics 3-10 10:00 E...

  16. Effect of near-fault earthquake on bridges: lessons learned from Chi-Chi earthquake

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    The objective of this paper is to describe the lessons learned and actions that have been taken related to the seismicdesign of bridge structures after the Chi-Chi, Taiwan earthquake. Much variable near-fault ground motion data was collected fromthe rupture of Chelungpu fault during the Chi-Chi earthquake, allowing the seismic response of bridge structures subjected to thesenear-fault ground motions to be carefully examined. To study the near-fault ground motion effect on bridge seismic design codes, atwo-level seismic design of bridge structures was developed and implemented. This design code reflects the near-fault factors in theseismic design forces. Finally, a risk assessment methodology, based on bridge vulnerability, is also developed to assist in decisionsfor reducing seismic risk due to failure of bridges.

  17. A precursory ULF signature for the Chi-Chi earthquake in Taiwan

    Directory of Open Access Journals (Sweden)

    Y. Akinaga

    2001-01-01

    Full Text Available ULF emission data at Lunping (epicentral distance, 120 km have been analysed for the Chi-Chi earthquake (with magnitude 7.6 and depth of 11 km in Taiwan which occurred on 21 September 1999. Simple intensity analyses have not yielded any significant results but we have found, based on the analysis of polarization (the ratio of vertical magnetic field component Z to the horizontal component G, that the polarization (Z/G showed a significant enhancement for two months before the earthquake. This kind of temporal evolution of polarization seems to be very similar to previous results, so that it is highly likely that this phenomenon may be associated with the Chi-Chi earthquake. Also, the comparison of the results of polarization analyses, by changing the signal threshold, has given us an approximate intensity of the seismogenic emission of the order of the monthly mean value.

  18. Academic Training Lecture - Regular Programme

    CERN Multimedia

    PH Department

    2011-01-01

    Regular Lecture Programme 9 May 2011 ACT Lectures on Detectors - Inner Tracking Detectors by Pippa Wells (CERN) 10 May 2011 ACT Lectures on Detectors - Calorimeters (2/5) by Philippe Bloch (CERN) 11 May 2011 ACT Lectures on Detectors - Muon systems (3/5) by Kerstin Hoepfner (RWTH Aachen) 12 May 2011 ACT Lectures on Detectors - Particle Identification and Forward Detectors by Peter Krizan (University of Ljubljana and J. Stefan Institute, Ljubljana, Slovenia) 13 May 2011 ACT Lectures on Detectors - Trigger and Data Acquisition (5/5) by Dr. Brian Petersen (CERN) from 11:00 to 12:00 at CERN ( Bldg. 222-R-001 - Filtration Plant )

  19. chi_{c1} and chi_{c2} decay angular distributions at the Fermilab Tevatron

    CERN Document Server

    Kniehl, Bernd A; Palisoc, C P

    2003-01-01

    We consider the hadroproduction of chi_{c1} and chi_{c2} mesons and their subsequent radiative decays to J/psi mesons and photons in the factorization formalism of nonrelativistic quantum chromodynamics, and study the decay angular distributions, by means of helicity density matrices, in view of their sensitivity to color-octet processes. We present numerical results appropriate for the Fermilab Tevatron.

  20. Sustainability: an interdisciplinary guide

    OpenAIRE

    John Pezzey

    1992-01-01

    A definition of sustainability as maintaining 'utility' (average human wellbeing) over the very long term future is used to build ideas from physics, ecology, evolutionary biology, anthropology, history, philosophy, economics and psychology, into a coherent, interdisciplinary analysis of the potential for sustaining industrial civilisation. This potential is highly uncertain, because it is hard to know how long the 'technology treadmill', of substituting accumulated tools and knowledge for de...

  1. Lectures in accelerator theory

    International Nuclear Information System (INIS)

    Lecture I deals with the behavior of particles in the nonlinear field arising from the electromagnetic interaction of colliding beams. The case treated, that of counter-rotating proton beams crossing each other at a non-zero angle, has the simple feature that the force between the beam is one dimensional. In lecture II, an analysis of the development of traveling waves on particle beams is presented. The situation studied is that of a uniform beam current in a circular accelerator and the excitation for the coherent motion is induced by the resistivity of the vacuum chamber wall. Finally, in lecture III, a description of the current accumulation process used at the proton storage rings at CERN (The ISR) is given. Particle pulses of rather low average current are injected and stored along the length and width of the vacuum chamber. The efficiency is very high and large currents (over 40 amperes) have been achieved

  2. Lectures on functor homology

    CERN Document Server

    Touzé, Antoine

    2015-01-01

    This book features a series of lectures that explores three different fields in which functor homology (short for homological algebra in functor categories) has recently played a significant role. For each of these applications, the functor viewpoint provides both essential insights and new methods for tackling difficult mathematical problems. In the lectures by Aurélien Djament, polynomial functors appear as coefficients in the homology of infinite families of classical groups, e.g. general linear groups or symplectic groups, and their stabilization. Djament’s theorem states that this stable homology can be computed using only the homology with trivial coefficients and the manageable functor homology. The series includes an intriguing development of Scorichenko’s unpublished results. The lectures by Wilberd van der Kallen lead to the solution of the general cohomological finite generation problem, extending Hilbert’s fourteenth problem and its solution to the context of cohomology. The focus here is o...

  3. Albert Einstein memorial lectures

    CERN Document Server

    Mechoulam, Raphael; The Israel Academy for Sciences and Humanities

    2012-01-01

    This volume consists of a selection of the Albert Einstein Memorial Lectures presented annually at the Israel Academy of Sciences and Humanities. Delivered by eminent scientists and scholars, including Nobel laureates, they cover a broad spectrum of subjects in physics, chemistry, life science, mathematics, historiography and social issues. This distinguished memorial lecture series was inaugurated by the Israel Academy of Sciences and Humanities following an international symposium held in Jerusalem in March 1979 to commemorate the centenary of Albert Einstein's birth. Considering that Einstein's interests, activities and influence were not restricted to theoretical physics but spanned broad fields affecting society and the welfare of humankind, it was felt that these memorial lectures should be addressed to scientists, scholars and erudite laypersons rather than to physicists alone.

  4. Are radiography lecturers, leaders?

    International Nuclear Information System (INIS)

    This review article aims to explore the concept of radiography lecturers acting as leaders to their student followers. Through a brief review of the literature, a definition of leadership is suggested and some leadership theories explored. The path-goal theory, leader–member exchange theory and the contemporary theory of transformational leadership are examined more closely. Links between lecturer-leader behaviour and student motivation and learning are tentatively suggested with transformational leadership appearing to offer the optimal leadership style for lecturers to adopt. The paucity of literature relating directly to radiography is acknowledged and areas for further research are suggested. The article concludes with some of the author's practical ideas for incorporating transformational leadership styles and behaviours into radiography education today

  5. Lectures for CERN pensioners

    CERN Multimedia

    GS Department

    2009-01-01

    The CERN Medical Service and the Pensioners Association are pleased to invite CERN pensioners to a series of lectures given by professors and specialists from the Teaching Hospitals and the Faculty of Medicine of the University of Geneva on the following topic: PROMOTION OF OPTIMUM BRAIN AGEING The lectures will take place in the Main CERN Auditorium (Building 60) from 2.30 p.m. to 4.30 p.m. on the following dates: Thursday 15 January 2009: Diagnosing and treating Alzheimer’s disease Pr Gabriel GOLD Wednesday 25 February 2009: What is the brain reserve? Speaker’s name to be announced at a later date. The lectures will be given in French, with transparencies in English, and will be followed by a wide-ranging debate with the participants. CERN Medical Service - Pensioners Association - CERN-ESO (GAC-EPA)

  6. Twenty lectures on thermodynamics

    CERN Document Server

    Buchdahl, H A

    2013-01-01

    Twenty Lectures on Thermodynamics is a course of lectures, parts of which the author has given various times over the last few years. The book gives the readers a bird's eye view of phenomenological and statistical thermodynamics. The book covers many areas in thermodynamics such as states and transition; adiabatic isolation; irreversibility; the first, second, third and Zeroth laws of thermodynamics; entropy and entropy law; the idea of the application of thermodynamics; pseudo-states; the quantum-static al canonical and grand canonical ensembles; and semi-classical gaseous systems. The text

  7. ACADEMIC TRAINING LECTURE

    CERN Multimedia

    Academic Training; Tel. 73127

    2001-01-01

    26, 27, 28 February and 1, 2 March REGULAR LECTURE PROGRAMME From 11:00 hrs - Main Auditorium bldg. 500 Recent Results on CP Violation and B Physics P.F. HARRISON / QMW, London, UK With the advent of the asymmetric B factories in Japan and the US, exciting new results on CP Violation and B Physics are starting to be achieved. In these lectures, we review the existing experimental and phenomenological context of these measurements, we compare and contrast the new experimental facilities and discuss the implications of the recent results on our understanding. Finally we summarise the prospects for future developments.

  8. Lectures on quantum mechanics

    CERN Document Server

    Dirac, Paul A M

    2001-01-01

    The author of this concise, brilliant series of lectures on mathematical methods in quantum mechanics was one of the shining intellects in the field, winning a Nobel prize in 1933 for his pioneering work in the quantum mechanics of the atom. Beyond that, he developed the transformation theory of quantum mechanics (which made it possible to calculate the statistical distribution of certain variables), was one of the major authors of the quantum theory of radiation, codiscovered the Fermi-Dirac statistics, and predicted the existence of the positron.The four lectures in this book were delivered

  9. Lectures in general algebra

    CERN Document Server

    Kurosh, A G; Stark, M; Ulam, S

    1965-01-01

    Lectures in General Algebra is a translation from the Russian and is based on lectures on specialized courses in general algebra at Moscow University. The book starts with the basics of algebra. The text briefly describes the theory of sets, binary relations, equivalence relations, partial ordering, minimum condition, and theorems equivalent to the axiom of choice. The text gives the definition of binary algebraic operation and the concepts of groups, groupoids, and semigroups. The book examines the parallelism between the theory of groups and the theory of rings; such examinations show the

  10. Lectures on quark matter

    International Nuclear Information System (INIS)

    This set of lectures deals with the transition from nuclear matter to quark matter. The reader will learn not only about the theory of quark- gluon plasmas but also how they are obtained in the laboratory through heavy-ion collisions or where they can be found in astrophysical objects such as compact stars. The book fills a gap between well-known textbook material and the research literature and is thus perfectly suited for postgraduate students who wish to enter this field, for lecturers looking for advanced material for their courses and for scientists in search of a modern source of reference on these topics

  11. Barbed congruence of the asymmetric chi calculus

    Institute of Scientific and Technical Information of China (English)

    DONG Xiao-ju; FU Yu-xi

    2006-01-01

    The chi calculus is a model of mobile processes. It has evolved from the pi-calculus with motivations from simplification and communication-as-cut-elimination. This paper studies the chi calculus in the framework incorporating asymmetric communication. The major feature of the calculus is the identification of two actions:x/x and τ. The investigation on the barbed bisimilarity shows how the property affects the observational theory.Based on the definition of the barbed bisimilarity, the simulation properties of the barbed bisimilarity are studied. It shows that the algebraic properties of the barbed bisimilarity have changed greatly compared with the chi calculus. Although the definition of the barbed bisimilarity is very simple, the property of closeness under contexts makes it difficult to understand the barbed bisimilarity directly. Therefore an open style definition of the barbed bisimilarity is given, which is a context free description of barbed bisimilarity. Its definition is complex,but it is a well-behaved relation for it coincides with the barbed bisimilarity. It also helps to build an axiomatization system for the barbed congruence. Besides the axioms for the strong barbed bisimilarity, the paper proposes a new tau law and four new update laws for the barbed congruence. Both the operational and algebraic properties of the enriched calculus improve the understanding of the bisimulation behaviors of the model.

  12. Public Lecture: Human Space Exploration

    CERN Document Server

    CERN. Geneva

    2015-01-01

    Should you wish to attend to this lecture only (and not the full colloquium), please register here: https://indico.cern.ch/event/386996/registration/ Participants to the full colloquium are automatically registered to the public lectures.

  13. The Computer-based Lecture

    OpenAIRE

    Wofford, Marcia M; Spickard, Anderson W; Wofford, James L

    2001-01-01

    Advancing computer technology, cost-containment pressures, and desire to make innovative improvements in medical education argue for moving learning resources to the computer. A reasonable target for such a strategy is the traditional clinical lecture. The purpose of the lecture, the advantages and disadvantages of “live” versus computer-based lectures, and the technical options in computerizing the lecture deserve attention in developing a cost-effective, complementary learning strategy that...

  14. Lectures on pulsed NMR

    International Nuclear Information System (INIS)

    These lectures discuss some recent developments in pulsed NMR, emphasizing fundamental principles with selected illustrative applications. Major topics covered include multiple-quantum spectroscopy, spin decoupling, the interaction of spins with a quantized field, adiabatic rapid passage, spin temperature and statistics of cross-polarization, coherent averaging, and zero field NMR. 32 refs., 56 figs

  15. Lectures on pulsed NMR

    International Nuclear Information System (INIS)

    These lectures discuss some recent developments in pulsed NMR, emphasizing fundamental principles with selected illustrative applications. Major topics covered include multiple-quantum spectroscopy, spin decoupling, the interaction of spins with a quantized field, adiabatic rapid passage, spin temperature and statistics of cross-polarization, coherent averaging, and zero field NMR. 55 figs

  16. Summer Student Lecture Programme

    CERN Multimedia

    2004-01-01

    Main Auditorium, bldg. 500 DATE TIME LECTURER TITLE Monday 2 August 09:15 - 10:00 P. Wells (CERN) The Higgs Saga at LEP 10:15 - 11:00 G. Cowan (Univ. of London) Introduction to Statistics (2/3) 11:15 - 12:00 G. Cowan (Univ. of London) Introduction to Statistics (3/3) DATE TIME LECTURER TITLE Tuesday 3 August 09:15 - 10:00 P. Sphicas (CERN) Trigger and Data Acquisition Systems (1/2) 10:15 - 11:00 R. Jacobsen (LBLN) From Raw Data to Physics Results (1/2) 11:15 - 12:00 R. Jacobsen (LBLN) G. Cowan (University of London) Discussion Session DATE TIME LECTURER TITLE Wednesday 4 August 09:15 - 10:00 P. Sphicas (CERN) Trigger and Data Acquisition Systems (2/2) 10:15 - 11:00 R. Jacobsen (LBLN) From Raw Data to Physics Results (2/2) 11:15 - 12:00 N. Palanque-Delabrouille (CEA) Astroparticle Physics (1/3) DATE TIME LECTURER TITLE Thursday 5 August 09:15 - 10:00 N. Palanque-Delabrouille (CEA) Astroparticle Physics (2/3) 10:15 - 11:00 N. Palanque-Delabrouille (CEA) A...

  17. ACADEMIC TRAINING LECTURE

    CERN Multimedia

    Academic Training; Tel. 73127

    2001-01-01

    1, 2, 3, 4 and 5 October LECTURES FOR POSTGRADUATE STUDENTS From 10:00 hrs - Main Auditorium bldg. 500 1 Introduction to particle accelerators E.J.N. Wilson / CERN-AC , Head of the CERN Accelerator School This new series of lectures is intended for anyone with a technical or scientific background who would like to become familiar with the principles of accelerator design. It is a complement to last year's course and includes new lectures on present day accelerators, and their applications as well as colliders and neutrino factories. Beam dynamics, which was treated at length in last year's course, has been compressed into one lecture, intended as revision for those who followed earlier courses and an introduction for newcomers to the field. The course should not be missed by those who will attend the CAS Intermediate Accelerator School in Seville. 1-10 10:00 Present-day Accelerators 11:00 - Beam Dynamics 2-10 10:00 Accelerating Cavities 11:00 - Non-linear Dynamics 3-10 10:00 Electron Dynamics 11:00 - ...

  18. Usage Reporting on Recorded Lectures

    NARCIS (Netherlands)

    Gorissen, Pierre; Bruggen, Jan van; Jochems, Wim

    2012-01-01

    This study analyses the interactions of students with the recorded lectures. We report on an analysis of students' use of recorded lectures at two Universities in the Netherlands. The data logged by the lecture capture system (LCS) is used and combined with collected survey data. We describe the pro

  19. In Defence of the Lecture

    Science.gov (United States)

    Webster, R. Scott

    2015-01-01

    In response to the lecture format coming under "attack" and being replaced by online materials and smaller tutorials, this paper attempts to offer not only a defence but also to assert that the potential value of the lecture is difficult to replicate through other learning formats. Some of the criticisms against lectures will be…

  20. Dicty_cDB: CHI518 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHI518 (Link to dictyBase) - - - Contig-U11768-1 CHI518P (Link to Original ... CVRY YFKALVYSGKINKANLGMTKLPPPTKKMTKAAREALGSE--- ---skw *rnh*yqtnr*ckr*yfngscsfeccne*rskt*hcls*swscfgssnd*s ...

  1. Dicty_cDB: CHI394 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHI394 (Link to dictyBase) - - - Contig-U16405-1 CHI394P (Link to Original ... sntvedctfdasglvyypkvynlkyskktkniw*ryshywlif kiiwws*fpy *fh*ck*tfcc--- ---TTFIGVRSGPSTTLTYIKPMISEIPTIENKIEK ...

  2. Assessment of quantity and quality of lecturers for effective implementation of theNigeriacertificate in education physics curriculum

    OpenAIRE

    Abdulrasaq Oladimeji Akanbi; Esther Ore Omosewo

    2014-01-01

    The study assesses the quantity and quality of lecturers for effective implementation of the NCE Physics curriculum in the Federal andStateCollegesof Education inNigeria. The sample was drawn from twoFederalCollegesof Education and twoStateCollegesof Education in all the six geo-political zones inNigeria. 60 lecturers were purposively sampled from 24 colleges of education. The instrument used was Lecturers’ questionnaire (LVENPC). Frequency counts, percentages, charts and chi-square analysis ...

  3. Epistemic dependence in interdisciplinary groups

    DEFF Research Database (Denmark)

    Andersen, Hanne; Wagenknecht, Susann

    2013-01-01

    In interdisciplinary research scientists have to share and integrate knowledge between people and across disciplinary boundaries. An important issue for philosophy of science is to understand how scientists who work in these kinds of environments exchange knowledge and develop new concepts and...... theories across diverging fields. There is a substantial literature within social epistemology that discusses the social aspects of scientific knowledge, but so far few attempts have been made to apply these resources to the analysis of interdisciplinary science. Further, much of the existing work either...... engage in when participating in interdisciplinary research in a group, and we compare our findings with those of other studies in interdisciplinary research....

  4. Feynman Lectures on Gravitation

    International Nuclear Information System (INIS)

    In the early 1960s Feynman lectured to physics undergraduates and, with the assistance of his colleagues Leighton and Sands, produced the three-volume classic Feynman Lectures in Physics. These lectures were delivered in the mornings. In the afternoons Feynman was giving postgraduate lectures on gravitation. This book is based on notes compiled by two students on that course: Morinigo and Wagner. Their notes were checked and approved by Feynman and were available at Caltech. They have now been edited by Brian Hatfield and made more widely available. The book has a substantial preface by John Preskill and Kip Thorne, and an introduction entitled 'Quantum Gravity' by Brian Hatfield. You should read these before going on to the lectures themselves. Preskill and Thorne identify three categories of potential readers of this book. 1. Those with a postgraduate training in theoretical physics. 2. 'Readers with a solid undergraduate training in physics'. 3. 'Admirers of Feynman who do not have a strong physics background'. The title of the book is perhaps misleading: readers in category 2 who think that this book is an extension of the Feynman Lectures in Physics may be disappointed. It is not: it is a book aimed mainly at those in category 1. If you want to get to grips with gravitation (and general relativity) then you need to read an introductory text first e.g. General Relativity by I R Kenyon (Oxford: Oxford University Press) or A Unified Grand Tour of Theoretical Physics by Ian D Lawrie (Bristol: IoP). But there is no Royal Road. As pointed out in the preface and in the introduction, the book represents Feynman's thinking about gravitation some 40 years ago: the lecture course was part of his attempts to understand the subject himself, and for readers in all three categories it is this that makes the book one of interest: the opportunity to observe how a great physicist attempts to tackle some of the hardest challenges of physics. However, the book was written 40

  5. Feynman Lectures on Gravitation

    Energy Technology Data Exchange (ETDEWEB)

    Borcherds, P

    2003-05-21

    In the early 1960s Feynman lectured to physics undergraduates and, with the assistance of his colleagues Leighton and Sands, produced the three-volume classic Feynman Lectures in Physics. These lectures were delivered in the mornings. In the afternoons Feynman was giving postgraduate lectures on gravitation. This book is based on notes compiled by two students on that course: Morinigo and Wagner. Their notes were checked and approved by Feynman and were available at Caltech. They have now been edited by Brian Hatfield and made more widely available. The book has a substantial preface by John Preskill and Kip Thorne, and an introduction entitled 'Quantum Gravity' by Brian Hatfield. You should read these before going on to the lectures themselves. Preskill and Thorne identify three categories of potential readers of this book. 1. Those with a postgraduate training in theoretical physics. 2. 'Readers with a solid undergraduate training in physics'. 3. 'Admirers of Feynman who do not have a strong physics background'. The title of the book is perhaps misleading: readers in category 2 who think that this book is an extension of the Feynman Lectures in Physics may be disappointed. It is not: it is a book aimed mainly at those in category 1. If you want to get to grips with gravitation (and general relativity) then you need to read an introductory text first e.g. General Relativity by I R Kenyon (Oxford: Oxford University Press) or A Unified Grand Tour of Theoretical Physics by Ian D Lawrie (Bristol: IoP). But there is no Royal Road. As pointed out in the preface and in the introduction, the book represents Feynman's thinking about gravitation some 40 years ago: the lecture course was part of his attempts to understand the subject himself, and for readers in all three categories it is this that makes the book one of interest: the opportunity to observe how a great physicist attempts to tackle some of the hardest challenges of physics

  6. Measurement of chi(3510) and chi(3555) production in 190 GeV/c piminus-beryllium interactions

    International Nuclear Information System (INIS)

    Charmonium production in 190 GeV/c π--Be interactions has been observed. The states chi(3510) and chi(3555) are seen through their radiative decay into J/Psi, and are found to correspond to 0.29 +- 0.09 of total J/Psi production for J/Psi's with x/sub f/ > 0.2. The rate of production for the two chi states appears as Bsigma(chi(3555))/Bsigma(chi(3510) = 0.60 +- 0.35. The fraction of J/Psi's produced through chi decay appears to rise with higher x/sub f/. For J/Psi's with x/sub f/ > 0.42, chi decay is responsible for 0.345 +- 0.09 of the total J/Psi sample, with the two states produced at the rate Bsigma(chi(3555))/Bsigma(3510) = 0.82 +- 0.45

  7. Interdisciplinary education in optics and photonics based on microcontrollers

    Science.gov (United States)

    Dreßler, Paul; Wielage, Heinz-Hermann; Haiss, Ulrich; Vauderwange, Oliver; Curticapean, Dan

    2014-07-01

    Not only is the number of new devices constantly increasing, but so is their application complexity and power. Most of their applications are in optics, photonics, acoustic and mobile devices. Working speed and functionality is achieved in most of media devices by strategic use of digital signal processors and microcontrollers of the new generation. Considering all these premises of media development dynamics, the authors present how to integrate microcontrollers and digital signal processors in the curricula of media technology lectures by using adequate content. This also includes interdisciplinary content that consists of using the acquired knowledge in media software. These entries offer a deeper understanding of photonics, acoustics and media engineering.

  8. An 8-week interdisciplinary learning module, which focuses on innovation and entrepreneurship

    DEFF Research Database (Denmark)

    Sørensen, Brigitte; Andersen, Helle Tvorup; Duus, Lene;

    2015-01-01

    ' development of individual competencies in relation to particular communication, the technological capabilities and complexity in interdisciplinary cooperation and collaboration in general. The innovative learning methods are extended use of blended learning, much fewer lectures and more student activity......Background In Denmark all the Professional bachelor degree educations have a common interdisciplinary module. UCN has five different bachelors degree in health. The five kinds of student spent 8 weeks together, learning about interdisciplinary and health. The learning modules are coordinated by a...... team with members from the five educations. The team has developed an 8 -week learning mod-ule, which focuses on innovation and entrepreneurship. The interdisciplinary module has an inno-vative didactic design using blended learning as the overarching principle. Relevance Our workshop contributes to...

  9. Exploring Tablet PC Lectures: Lecturer Experiences and Student Perceptions in Biomedicine

    Science.gov (United States)

    Choate, Julia; Kotsanas, George; Dawson, Phillip

    2014-01-01

    Lecturers using tablet PCs with specialised pens can utilise real-time changes in lecture delivery via digital inking. We investigated student perceptions and lecturer experiences of tablet PC lectures in large-enrolment biomedicine subjects. Lecturers used PowerPoint or Classroom Presenter software for lecture preparation and in-lecture pen-based…

  10. Lectures on Classical Integrability

    CERN Document Server

    Torrielli, Alessandro

    2016-01-01

    We review some essential aspects of classically integrable systems. The detailed outline of the lectures consists of: 1. Introduction and motivation, with historical remarks; 2. Liouville theorem and action-angle variables, with examples (harmonic oscillator, Kepler problem); 3. Algebraic tools: Lax pairs, monodromy and transfer matrices, classical r-matrices and exchange relations, non-ultralocal Poisson brackets, with examples (non-linear Schroedinger model, principal chiral field); 4. Features of classical r-matrices: Belavin-Drinfeld theorems, analyticity properties, and lift of the classical structures to quantum groups; 5. Classical inverse scattering method to solve integrable differential equations: soliton solutions, spectral properties and the Gel'fand-Levitan-Marchenko equation, with examples (KdV equation, Sine-Gordon model). Prepared for the Durham Young Researchers Integrability School, organised by the GATIS network. This is part of a collection of lecture notes.

  11. Lectures on Quantum Gravity

    CERN Document Server

    Gomberoff, Andres

    2006-01-01

    The 2002 Pan-American Advanced Studies Institute School on Quantum Gravity was held at the Centro de Estudios Cientificos (CECS),Valdivia, Chile, January 4-14, 2002. The school featured lectures by ten speakers, and was attended by nearly 70 students from over 14 countries. A primary goal was to foster interaction and communication between participants from different cultures, both in the layman’s sense of the term and in terms of approaches to quantum gravity. We hope that the links formed by students and the school will persist throughout their professional lives, continuing to promote interaction and the essential exchange of ideas that drives research forward. This volume contains improved and updated versions of the lectures given at the School. It has been prepared both as a reminder for the participants, and so that these pedagogical introductions can be made available to others who were unable to attend. We expect them to serve students of all ages well.

  12. Lectures on radiation protection

    International Nuclear Information System (INIS)

    All important subjects of radiation protection are presented in concise form; the explanations may serve as lecture manuscripts. The lectures are divided into 16 to 19 teaching units. Each teaching unit is supplemented by a slide to be projected on a screen while the text is read. This method of visual teaching has already been tried with good results in medicine and medical engineering. Pictures of the slides are given in the text so that the book may also be used for self-studies. The main facts are summarized at the end of each lesson. The finished book will consist of 8 lessons; the first three of these discuss 1. Radiation effects and hazards 2. Dose definitions and units and their role in radiology and radiation protection 3. Dose limits and legal specifications. (orig.)

  13. ACADEMIC TRAINING LECTURE

    CERN Multimedia

    Françoise Benz

    2002-01-01

    18, 19, 20, 21, 22 November LECTURE FOR POSTGRADUATE STUDENTS From 11:00 hrs - Main Auditorium bldg. 500 Telling the Truth with Statistics R. Barlow / Univ. of Manchester, UK This course of lectures will cover probability, distributions, fitting, errors and confidence levels, for practising High Energy Physicists who need to use Statistical techniques to express their results. Concentrating on these appropriate specialist techniques means that they can be covered in appropriate depth, while assuming only the knowledge and experience of a typical Particle Physicist. The different definitions of probability will be explained, and it will be appear why this basic subject is so controversial; there are several viewpoints and it is important to understand them all, rather than abusing the adherents of different beliefs. Distributions will be covered: the situations they arise in, their useful properties, and the amazing result of the Central Limit Theorem. Fitting a parametrisation to a set of data is one of the m...

  14. ACADEMIC TRAINING LECTURE

    CERN Multimedia

    Academic Training; Tel. 73127

    2001-01-01

    23, 24, 25, 26 and 27 April REGULAR LECTURE PROGRAMME From 11:00 hrs - Main Auditorium bldg. 500, on 23 April from 11:15 to 12:15 hrs Searches for Dark Matter F. Feinstein / CPPM, Marseille, F The fact that the mass of the visible stars could not account for the gravitational cohesion of the galaxy clusters was the first manifestation of non-radiating matter in the Universe. Since then, many observations imply that most of the matter is indeed dark. Its nature is still unknown and likely to have several contributions. Recent results indicate that most of it may not be composed of normal matter. These lectures will review the experimental methods, which have been developed to unravel this 70-year long mystery and confront their results with the current theoretical framework of cosmology.

  15. Lectures on dark matter

    International Nuclear Information System (INIS)

    These lectures concentrate on evolution and generation of dark matter perturbations. The purpose of the lectures is to present, in a systematic way, a comprehensive review of the cosmological parameters that can lead to observable effects in the dark matter clustering properties. We begin by reviewing the relativistic linear perturbation theory formalism. We discuss the gauge issue and derive Einstein's and continuity equations for several popular gauge choices. We continue by developing fluid equations for cold dark matter and baryons and Boltzmann equations for photons, massive and massless neutrinos. We then discuss the generation of initial perturbations by the process of inflation and the parameters of that process that can be extracted from the observations. Finally we discuss evolution of perturbations in various regimes and the imprint of the evolution on the dark matter power spectrum both in the linear and in the nonlinear regime. (author)

  16. Globe: Lecture series

    CERN Multimedia

    2007-01-01

    The LHC: an accelerator of science This series of lectures is all about understanding the scientific and technological challenges of the phenomenal LHC project and assessing its innovations through their everyday applications. Come and take a sneak preview of the LHC! Communicate: the Grid, a computer of global dimensions François Grey, head of communication in CERN’s Information Technology Department How will it be possible for the 15 million billion bytes of data generated by the LHC every year to be handled and stored by a computer that doesn’t have to be the size of a skyscraper? The computer scientists have the answer: the Grid, which will harness the power of tens of thousands of computers all over the world by creating a network of computers and making them operate as one. >>> Lectures are free and require no specialist knowledge. In french. 
 >>> By reservation only: tel. +41 (0)22 767 76 76

  17. Lecture 2: Software Security

    CERN Document Server

    CERN. Geneva

    2013-01-01

    Computer security has been an increasing concern for IT professionals for a number of years, yet despite all the efforts, computer systems and networks remain highly vulnerable to attacks of different kinds. Design flaws and security bugs in the underlying software are among the main reasons for this. This lecture addresses the following question: how to create secure software? The lecture starts with a definition of computer security and an explanation of why it is so difficult to achieve. It then introduces the main security principles (like least-privilege, or defense-in-depth) and discusses security in different phases of the software development cycle. The emphasis is put on the implementation part: most common pitfalls and security bugs are listed, followed by advice on best practice for security development, testing and deployment. Sebastian Lopienski is CERN’s deputy Computer Security Officer. He works on security strategy and policies; offers internal consultancy and audit services; develops and ...

  18. CHY-Graphs on a Torus

    CERN Document Server

    Cardona, Carlos

    2016-01-01

    Recently, we proposed a new approach using a punctured Elliptic curve in the CHY framework in order to compute one-loop scattering amplitudes. In this note, we further develop this approach by introducing a set of connectors, which become the main ingredient to build integrands on $\\mathfrak{M}_{1,n}$, the moduli space of n-punctured Elliptic curves. As a particular application, we study the $\\Phi^3$ bi-adjoint scalar theory. We propose a set of rules to construct integrands on $\\mathfrak{M}_{1,n}$ from $\\Phi^ 3$ integrands on $\\mathfrak{M}_{0,n}$, the moduli space of n-punctured spheres. We illustrate these rules by computing a variety of $\\Phi^3$ one-loop Feynman diagrams. Conversely, we also provide another set of rules to compute the corresponding CHY-integrand on $\\mathfrak{M}_{1,n}$ by starting instead from a given $\\Phi^ 3$ one-loop Feynman diagram. In addition, our results can easily be extended to higher loops.

  19. ACADEMIC TRAINING LECTURE

    CERN Multimedia

    Academic Training; Tel. 73127

    2001-01-01

    9, 10 and 11 May REGULAR LECTURE PROGRAMME From 10:00 to 12:00 hrs on 9 and 10 May and on 11 May from 11:00 to 12:00 hrs - Main Auditorium bldg. 500 Cosmology and Particle Physics K. Olive / CERN-TH A general overview of the standard big bang model will be presented with special emphasis on astro-particle physics. Specific topics will include: Inflation, Baryoogenesis, Nucleosynthesis and Dark Matter.

  20. The family lecture.

    Science.gov (United States)

    Rose, Nancy E

    2002-10-01

    SUMMARY This paper describes a lecture about my extended family, in which I discuss a variety of configurations consisting of lesbian, gay, and bisexual adults, and our children. It raises an array of issues, including alternative insemination, biological and nonbiological parentage, donors and birthmothers, adoption, co-parenting and blended families, significant others, and gay marriage and domestic partnership. It helps many students obtain both a more expansive sense of family and adeeper understanding of homophobia. PMID:24804601

  1. Lectures on knot homology

    CERN Document Server

    Nawata, Satoshi

    2015-01-01

    We provide various formulations of knot homology that are predicted by string dualities. In addition, we also explain the rich algebraic structure of knot homology which can be understood in terms of geometric representation theory in these formulations. These notes are based on lectures in the workshop "Physics and Mathematics of Link Homology" at Centre de Recherches Math\\'ematiques, Universit\\'e de Montr\\'eal.

  2. ACADEMIC TRAINING LECTURE

    CERN Multimedia

    Academic Training; Tel. 73127

    2001-01-01

    2, 3, 4, 5 and 6 April REGULAR LECTURE PROGRAMME From 11:00 hrs - Main Auditorium bldg. 500 New Developments in Supersymmetry S. Raby / CERN-TH Introduction to supersymmetric grand unified theories. An introduction to the MSSM and different mechanisms for supersymmetry breaking. Then the details of SU(5) and SO(10) unification, the new gauge sector beyond the standard model, representations of quarks and leptons. Gauge and Yukawa coupling unification and some predictions.

  3. B.Gregory Lecture

    CERN Multimedia

    Jacob,M

    1987-01-01

    Troisième série de "Gregory lectures" en mémoire de B.Gregory (1919-1977),DG de 1965 à 1970. La première conférence B.Gregory a été donné par le Prof.V.Weisskopf, son prédécesseur. Chris Greeg (?)de Berkley prend aussi la parole

  4. Lectures on String Theory

    OpenAIRE

    Tong, David

    2009-01-01

    This is a one semester course on bosonic string theory aimed at beginning graduate students. The lectures assume a working knowledge of quantum field theory and general relativity. Contents: 1. The Classical String 2. The Quantum String 3. Open Strings and D-Branes 4. Introducing Conformal Field Theory 5. The Polyakov Path Integral and Ghosts 6. String Interactions 7. The Low-Energy Effective Action 8. Compactification and T-Duality

  5. An LHC Lecture

    CERN Document Server

    Plehn, Tilman

    2009-01-01

    When we try to advance from a solid knowledge of field theory to LHC physics we usually encounter a frustrating problem: in particular Higgs physics and QCD techniques appear as a impenetrable granite block of phenomenological know-how, common lores, and historically grown intuition what works and what does not. I hope this lecture can drill a few holes into the rock and put you into a position to digest advanced writeups as well as some first research papers on the topic.

  6. Lectures on Geometric Quantization

    OpenAIRE

    Śniatycki, Jędrzej

    2016-01-01

    These lectures notes are meant as an introduction to geometric quantization. In Section 1, I begin with presentation of the historical background of quantum mechanics. I continue with discoveries in the theory of representations of Lie groups, which lead to emergence of geometric quantization as a part of pure mathematics. This presentation is very subjective, flavored by my own understanding of the role of geometric quantization in quantum mechanics and representation theory. Sectio...

  7. Summer Student Lecture Programme

    CERN Multimedia

    2004-01-01

    Main Auditorium, bldg. 500 More Information DATE TIME LECTURER TITLE Wednesday 7 July 09:15 - 10:00 L. Fayard, O. Ullaland, D. Heagerty (CERN) Programme Presentation Workshops presentation Information on Computing Rules 10:15 - 11:00 R. Aymar (CERN) Introduction to CERN (1/2) 11:15 - 12:00 J. Engelen (CERN) Introduction to CERN (2/2) 15:00 - 16:30 H. Menzel (CERN) An Introduction to Radiation Protection DATE TIME LECTURER TITLE Thursday 8 july 09:15 - 10:00 L. Di Lella (CERN) Introduction to Particle Physics (1/4) 10:15 - 11:00 L. Di Lella (CERN) Introduction to Particle Physics (2/4) 11:15 - 12:00 P. Chomaz (GANIL / CERN) Fundamental questions in modern nuclear physics: The challenge of exotic nuclei (1/2) DATE TIME LECTURER TITLE Friday 9 July 09:15 - 10:00 L. Di Lella (CERN) Introduction to Particle Physics (3/4) 10:15 - 11:00 P. Chomaz (GANIL / CERN) Fundamental questions in modern nuclear physics: The challenge of exotic nuclei (2/2) 11:15 - 12:00 P....

  8. Most recent Web Lectures

    CERN Multimedia

    Steven Goldfarb

    Web Archives of ATLAS Plenary Sessions, Workshops, Meetings, and Tutorials recorded over the past two years are available via the University of Michigan portal here. Most recent additions include the ROOT Workshop held at CERN on March 26-27, the Physics Analysis Tools Workshop held in Bergen, Norway on April 23-27, and the CTEQ Workshop: "Physics at the LHC: Early Challenges" held at Michigan State University on May 14-15. Viewing requires a standard web browser with RealPlayer plug-in (included in most browsers automatically) and works on any major platform. Lectures can be viewed directly over the web or downloaded locally. In addition, you will find access to a variety of general tutorials and events via the portal. Suggestions for events or tutorials to record in 2007, as well as feedback on existing archives is always welcome. Please contact us at wlap@umich.edu. Thank you and enjoy the lectures! The Michigan Web Lecture Team Tushar Bhatnagar, Steven Goldfarb, Jeremy Herr, Mitch McLachlan, Homer A....

  9. ACADEMIC TRAINING LECTURE

    CERN Multimedia

    Academic Training; Tel. 73127

    2001-01-01

    5, 6, 7, 8 and 9 March REGULAR LECTURE PROGRAMME From 11:00 hrs - Main Auditorium bldg. 500 Tracking at the LHC K. Safarik / CERN-EP The lecture will start with a short history of particle tracking in high-energy physics. Then we will concentrate on tracking in the LHC experiments. We will discuss various tracking devices proposed for these experiments, dividing them into two large groups: solid state detectors and gas detectors. Their characteristics, as well as their behaviour in different external conditions (i.e. magnetic field, radiation) will be compared. Furthermore, we will turn to the question: how to design a tracker using these various technologies, what are the essential parameters to be taken into account and we will apply these considerations to the proposed the LHC detectors. The last part of the lecture will be devoted to tracking software. We will mention simulation and concentrate on track finding and reconstruction, reviewing different algorithms prototyped for the LHC experiments. We will ...

  10. Lectures for CERN pensioners

    CERN Multimedia

    SC Unit

    2008-01-01

    The CERN Medical Service and the Pensioners Association are pleased to invite CERN pensioners to a series of lectures given by professors and specialists from the Teaching Hospitals and the Faculty of Medicine of the University of Geneva on the following topic: PROMOTION OF OPTIMUM BRAIN AGEING The lectures will take place in the Main CERN Auditorium (Building 60) from 2.30 p.m. to 4.30 p.m. on the following dates: Wednesday 12 November 2008: Assessing the extent of brain ageing Dr Dina ZEKRY Friday 12 December 2008: Can memory decline be prevented? Pr Jean-Pierre MICHEL Thursday 15 January 2009: Diagnosing and treating Alzheimer’s disease Pr Gabriel GOLD Wednesday 25 February 2009: What is the brain reserve? Speaker’s name to be announced at a later date The lectures will be given in French, with transparencies in English, and will be followed by a wide-ranging debate with the participants. CERN Medical Service - Pensioners Association - CERN-ESO (GAC-EPA)

  11. Promoting Interdisciplinary Research among Faculty

    Science.gov (United States)

    Novak, Elena; Zhao, Weinan; Reiser, Robert A.

    2014-01-01

    With the growing recognition of the importance of interdisciplinary research, many faculty have increased their efforts to form interdisciplinary research teams. Oftentimes, attempts to put together such teams are hampered because faculty have a limited picture of the research interests and expertise of their colleagues. This paper reports on…

  12. Interdisciplinary aspects of turbulence

    CERN Document Server

    Kupka, Friedrich

    2008-01-01

    What do combustion engines, fusion reactors, weather forecast, ocean flows, our sun, and stellar explosions in outer space have in common? Of course, the physics and the length and time scales are vastly different in all cases, but it is also well known that in all of them, on some relevant length scales, the material flows that govern the dynamical and/or secular evolution of the systems are chaotic and often unpredictable: they are said to be turbulent. The interdisciplinary aspects of turbulence are brought together in this volume containing chapters written by experts from very different fields, including geophysics, astrophysics, and engineering. It covers several subjects on which considerable progress was made during the last decades, from questions concerning the very nature of turbulence to some practical applications. These subjects include: a basic introduction into turbulence, statistical mechanics and nonlinear dynamics, turbulent convection in stars, atmospheric turbulence in the context of nume...

  13. Biomagnetism an interdisciplinary approach

    CERN Document Server

    Romani, Gian-Luca; Kaufman, Lloyd; Modena, Ivo

    1983-01-01

    Biomagnetism is the study of magnetic fields that originate in biological systems. This is a relatively new discipline that has attracted considerable interest throughout the scientific commu- ty. The study of biomagnetic fields requires the use of techniques and concepts drawn from widely disparate scientific disciplines. To make these techniques and concepts available to a wide spectrum of the scientific community, a NATO Advanced study Institute on B- magnetism was held near Frascati at Grottaferrata, Italy, in S- tember 1982. This volume is based on the lectures delivered by scholars representing many different scientific areas, ranging from solid state physics to psychology. It attempts to preserve the - herent development of concepts drawn from physiology, psychology, biology, physics, medicine, occupational health and geology that was evident during the Institute. The reader will quickly become aware that the progress in biomagnetism over the past decade was due principally to the efforts of interdisci...

  14. Interdisciplinary Astronomy Activities

    Science.gov (United States)

    Nerantzis, Nikolaos; Mitrouda, Aikaterini; Reizopoulou, Ioanna; Sidiropoulou, Eirini; Hatzidimitriou, Antonios

    2016-04-01

    On November 9th, 2015, three didactical hours were dedicated to Interdisciplinary Astronomy Activities (http://wp.me/p6Hte2-1I). Our students and their teachers formed three groups and in rotation, were engaged with the following activities: (a) viewing unique images of the Cosmos in the mobile planetarium STARLAB (http://www.planitario.gr/tholos-starlab-classic-standard.html), (b) watching the following videos: Journey to the end of the universe (https://youtu.be/Ufl_Nwbl8xs), Rosetta update (https://youtu.be/nQ9ivd7wv30), The Solar System (https://youtu.be/d66dsagrTa0), Ambition the film (https://youtu.be/H08tGjXNHO4) in the school's library. Students and teachers were informed about our solar system, the Rosetta mission, the universe, etc. and (c) tactile activities such as Meet our home and Meet our neighbors (http://astroedu.iau.org, http://nuclio.org/astroneighbours/resources) and the creation of planets' 3D models (Geology-Geography A' Class Student's book, pg.15). With the activities above we had the pleasure to join the Cosmic Light Edu Kit / International Year of Light 2015 program. After our Interdisciplinary Astronomy Activities, we did a "small" research: our students had to fill an evaluation about their educational gains and the results can be found here http://wp.me/p6Hte2-2q. Moreover, we discussed about Big Ideas of Science (http://wp.me/p3oRiZ-dm) and through the "big" impact of the Rosetta mission & the infinity of our universe, we print posters with relevant topics and place them to the classrooms. We thank Rosa Doran (Nuclio - President of the Executive Council) for her continuous assistance and support on innovative science teaching proposals. She is an inspiration.

  15. Teaching Anthropogenic Climate Change through Interdisciplinary Collaboration: Helping Students Think Critically about Science and Ethics in Dialogue

    Science.gov (United States)

    Todd, Claire; O'Brien, Kevin J.

    2016-01-01

    Anthropogenic climate change is a complicated issue involving scientific data and analyses as well as political, economic, and ethical issues. In order to capture this complexity, we developed an interdisciplinary student and faculty collaboration by (1) offering introductory lectures on scientific and ethical methods to two classes, (2) assigning…

  16. The 1979 Bernard Gregory lectures

    International Nuclear Information System (INIS)

    This volume contains the texts of the lectures given by Professor V.F. Weisskopf at CERN and in Paris in the autumn of 1979, as the first Gregory lecturer. The titles of the three different texts are 'Growing up with Field Theory', 'Recent Trends in Particle Physics' and 'L'Art et la Science'. While the latter lecture was given in French, an English text here follows the French one. The volume starts with a short biographical note about Bernard Gregory. (orig.)

  17. Assessment of Learning Activities in Interdisciplinary Courses

    Directory of Open Access Journals (Sweden)

    M. Ghahramani

    2010-10-01

    Full Text Available The purpose of this study was to examine the notion of evaluation of interdisciplinary courses. To this end, relevant literature and theoretical framework was reviewed . The paper specifically focused on assessment and measurement of learning activities in interdisciplinary courses. The main question addressed here was what the major criteria are for assessment of assignment in interdisciplinary courses .Given the significance of the notion of “interdisciplinary understanding “. this paper mainly focused on elaborating on this concept . therefore , interdisciplinary understanding was presented at four levels including : naive interdisciplinary understanding ,novice interdisciplinary understanding ,apprentice interdisciplinary understanding and master interdisciplinary understanding.Further, four dimensions of interdisciplinary understanding including: purposefulness,disciplinary grounding, intégration and critical awareness were discussed . Finally , the matrix of assessment of interdisciplinary assignment was developed on the basis of its levels and dimensions.

  18. A Study on Near-Fault Mortality from the 1999 Chi-Chi, Taiwan Earthquake

    Science.gov (United States)

    Pai, C.; Tien, Y.; Teng, T.

    2004-12-01

    A new approach for estimating the relations between mortality and strong shaking from the 1999 Chi-Chi, Taiwan earthquake is introduced. We have finished the database giving the attributes of victims through a compilation of various after-earthquake survey documents. This survey was a comprehensive filed visit confirming exact locations of victims and their possible cause of death. Among the total 2492 victims of the Chi-Chi earthquake, 2039 victims (81.8% of the total) were located by using GPS. Through the attributive database of victims, digital maps and Geographic Information Systems, we can easily map the spatial distribution and the cause of death data of victims with accuracy of the smallest administrative districts in Taiwan. Moreover, a regression analysis gives correlated equations for the mortality as functions of the distance to the Chelungpu fault. We find that the percentage of the mortality M can be expressed as:\\[M=\\frac{(1.626+0.0007\\timesd)} {(1+0.0125\\timesd)}\\] Here d is the closest distance to the fault in meter. As expected, the shorter distance to the Chelungpu fault causes the higher mortality. We device three disastrous levels and then suggest the orders and scopes of the earthquake disaster rescue according to the regression curve of the mortality and the closest distance to the fault. The difference in mortality between hanging-wall and footwall areas is also discussed and different regression curves of hanging-wall and footwall areas are suggested. In near-fault regions, the mortality for the residents lived in hanging-wall block (1348) is significantly higher than that in the footwall block (557). The death ratio of hanging-wall vs. footwall block is approximately 2.4:1. Finally, we gathered the data of the peak ground acceleration (PGA) data for the mainshock of Chi-Chi earthquake at the 63 seismic stations on both sides of the causal fault. The regression curve of the PGA and mortality as functions of the closest distance to the

  19. Lectures on electromagnetism

    CERN Document Server

    Das, Ashok

    2013-01-01

    These lecture notes on electromagnetism have evolved from graduate and undergraduate EM theory courses given by the author at the University of Rochester, with the basics presented with clarity and his characteristic attention to detail. The thirteen chapters cover, in logical sequence, topics ranging from electrostatics, magnetostatics and Maxwell's equations to plasmas and radiation. Boundary value problems are treated extensively, as are wave guides, electromagnetic interactions and fields. This second edition comprises many of the topics expanded with more details on the derivation of vari

  20. ACADEMIC TRAINING LECTURE

    CERN Multimedia

    Academic Training; Tel. 73127

    2001-01-01

    26, 27, 28, 29 and 30 March REGULAR LECTURE PROGRAMME From 11:00 hrs - Main Auditorium bldg. 500 Introduction to General Relativity and Black Holes T. Damour / IHES, Bures-sur-Yvette, F. Conceptual foundations of General Relativity (GR). Uniqueness of GR. Mathematical framework: tensor calculus, Riemannian geometry, connection, 'spin' connection, curvature, Cartan's form calculus. Hilbert-Einstein action, Einstein equations. Weak gravitational fields. Post Newtonian Approximation. Gravitanional Waves. Exact solutions. Killing vectors. Experimental tests. Black Holes: extensions of the Schwarzschild solution; Kerr-Newman holes; no-hair theorems; energtics of black holes; the membrane approach; quantum mechanics of black holes; Bekenstein entropy; Hawking temperature; black holes and string theory.

  1. Lectures in particle physics

    CERN Document Server

    Green, Dan

    1994-01-01

    The aim of this book on particle physics is to present the theory in a simple way. The style and organization of the material is unique in that intuition is employed, not formal theory or the Monte Carlo method. This volume attempts to be more physical and less abstract than other texts without degenerating into a presentation of data without interpretation.This book is based on four courses of lectures conducted at Fermilab. It should prove very useful to advanced undergraduates and graduate students.

  2. Joseph Mountin Lecture

    Centers for Disease Control (CDC) Podcasts

    2009-10-26

    In this podcast, William H. Foege, MD, MPH delivers the 29th Annual Joseph W. Mountin Lecture. Dr. Foege was a key leader in the smallpox effort and worked as an epidemiologist in the successful eradication campaign in the 1970s. Dr. Foege became chief of the Smallpox Eradication Program at CDC, and was appointed director of CDC in 1977.  Created: 10/26/2009 by Centers for Disease Control and Prevention (CDC).   Date Released: 10/29/2009.

  3. Tai Chi and Qi Gong for Health and Well-Being

    Medline Plus

    Full Text Available ... Resources CME/CEU and Online Lectures Online Continuing Education Series Distinguished Lecture Series Integrated Medicine Research Lecture Series All Training Information News & Events Press ...

  4. Tai Chi and Qi Gong for Health and Well-Being

    Medline Plus

    Full Text Available ... Process More Training Resources CME/CEU and Online Lectures Online Continuing Education Series Distinguished Lecture Series Integrated Medicine Research Lecture Series All Training ...

  5. Bi-normalized response spectral characteristics of the 1999 Chi-Chi earthquake

    Institute of Scientific and Technical Information of China (English)

    徐龙军; 谢礼立

    2004-01-01

    To develop uniform and seismic environment-dependent design spectrum, common acceleration response spectral characteristics need to be identified. In this paper, a bi-normalized response spectrum (BNRS) is proposed, which is defined as a spectrum of peak response acceleration normalized with respect to peak acceleration of the excitation plotted vs. the natural period of the system normalized with respect to the spectrum predominant period, Tp. Based on a statistical analysis of records from the 1999 Chi-Chi earthquake, the conventionally normalized response spectrum(NRS) and the BNRS are examined to account for the effects of soil conditions, epicentral distance, hanging wall and damping. It is found that compared to the NRS, the BNRS is much less dependent on these factors. Finally, some simple relationships between the BNRS tor a specified damping ratio and that for a damping ratio of 5%, and between the spectra predominant period and epicentral distance for different soil types are provided.

  6. A $\\chi^2$ veto for continuous wave searches

    CERN Document Server

    de la Jordana, Llucia Sancho

    2008-01-01

    $\\chi^2$ vetoes are commonly used in searching for gravitational waves, in particular for broad-band signals, but they can also be applied to narrow-band continuous wave signals, such as those expected from rapidly rotating neutron stars. In this paper we present a $\\chi^2$ veto adapted to the Hough transform searches for continuous gravitational wave signals; we characterize the $\\chi^2$-significance plane for different frequency bands; and discuss the expected performance of this veto in LIGO analysis.

  7. O Tai Chi Chuan na percussão

    OpenAIRE

    Teixeira, Mário Jorge Peixoto

    2013-01-01

    A good motricity and a strong psyche that allow for excellence in performance are essential in musical execution. Since Tai Chi Chuan is an activity that implies a considerable psychomotor and psychological development, it is the aim of this thesis to assess whether the practice of Tai Chi Chuan can be an optimising factor in a percussionist’s performance. Based on the outstanding physical and psychological effects that result from the practice of Tai Chi Chuan and the ce...

  8. ACADEMIC TRAINING LECTURE

    CERN Multimedia

    Academic Training; Tel. 73127

    2001-01-01

    14, 15 and 16 May REGULAR LECTURE PROGRAMME 14, 15 May from 10:00 to 12:00 hrs - Main Auditorium bldg. 500 16 May from 11:00 to 12:00 hrs - Council Chamber, bldg 503 Modern Signal Processing: Wavelets vs. Fourier M. Vetterli / EPFL, Lausanne, CH and UC Berkeley Wavelets have established themselves as an important tool in modern signal processing as well as in applied mathematics. This is linked to several facts, among others: i. New theoretical advances have been achieved, like new forms of 4 time-frequency bases for signal analysis. ii. Efficient computational algorithms are available. iii. Many applications either used similar ideas, like for example the concept of multiresolution, or took advantage of the unified framework provided by wavelets. This combination of elegant theory, efficient algorithms, and successful applications makes the field of wavelets and signal processing quite exciting. It is the purpose of these lectures to establish the theory necessary to understand wavelets and related construct...

  9. SUMMER STUDENT LECTURE PROGRAMME

    CERN Document Server

    Françoise Benz

    2002-01-01

    SUMMER STUDENT LECTURE PROGRAMME Main Auditorium, bldg. 500   DATE TIME LECTURER TITLE Monday 29 July 09:15 - 10:00 R. RATTAZZI Beyond the Standard Model (3/3) 10:15 - 11:00 P. WELLS Experimental test of the SM - LEP (3/3) 11:15 - 12:00 P. WELLS Discussion Session 14:00 - 16:00 R. ASSMANN The CLIC Concept for a Future Particle Collider at the Energy Frontier Tuesday 30 July 09:15 - 10:00 F. ANTINORI Heavy Ions (1/2) 10:15 - 12:00 F. DYDAK Neutrino Physics (1&2/4) Wednesday 31 July  09:15 - 10:00 F. ANTINORI Heavy Ions (2/2) 10:15 - 11:00 F. DYDAK Neutrino Physics (3/4) 11:15 - 12:00 F. DYDAK / F. ANTINORI Discussion Session Thursday 1 August 09:15 - 10:00 T. NAKADA CP Violation (1/4) 10:15 - 11:00 F. DYDAK Neutrino Physics (4/4) 11:15 - 12:00 F. BEDESCHI Experimental test of the SM Tevatron (1/2) Friday 2 August 09:15 - 10:00 T. NAKADA CP Violation (2/4) 10:15 ? 11:00 F. BEDESCHI Experimental test of the SM Tevatron (2/2) 11:15 ? 12:00 F. BEDESCHI / T. NAKADA Di...

  10. SUMMER STUDENT LECTURE PROGRAMME

    CERN Multimedia

    Françoise Benz

    2002-01-01

    Main Auditorium, bldg. 500   DATE TIME LECTURER TITLE Monday 5 August 09:15-10:00 F. GIANOTTI LHC Physics (1/3) 10:15-12:00 T. NAKADA CP Violation (3&4/4) Tuesday 6 August 09:15-10:00 F. GIANOTTI LHC Physics (2/3) 10:15-11:00 R. JACOBSEN From Raw Data to Physics Results (1/3) 11:15-12:00 R. JACOBSEN / T. NAKADA Discussion Session Wednesday 7 August 09:15-10:00 F. GIANOTTI LHC Physics (3/3) 10:15-11:00 R. JACOBSEN From Raw Data to Physics Results (2/3) 11:15-12:00 J. LESGOURDES Cosmology (1/4) 14:00-16:00 C. BENVENUTI Basic Science, Society, and Technological Innovation (Council Chamber, bldg. 503) Thursday 8 August 09:15-10:00 J. LESGOURDES Cosmology (2/4) 10:15-11:00 R. JACOBSEN From Raw Data to Physics Results (3/3) 11:15-12:00 J. CARR / J. LESGOURDES Discussion Session Friday 9 August 09:15-11:00 J. LESGOURDES Cosmology (3&4/4) 11:15-12:00 C. JARLSKOG Historic Lecture 14:00-16:00 Course Review Monday 12 August 09:15-12:00 Students Sessi...

  11. ACADEMIC TRAINING LECTURE

    CERN Multimedia

    Academic Training; Tel. 73127

    2001-01-01

    14, 15 and 16 May REGULAR LECTURE PROGRAMME 14, 15 May from 10:00 to 12:00 hrs - Main Auditorium bldg. 500 16 May from 11:00 to 12:00 hrs - Council Chamber, bldg 503 Modern Signal Processing: Wavelets vs. Fourier M. Vetterli / EPFL, Lausanne, CH and UC Berkeley Wavelets have established themselves as an important tool in modern signal processing as well as in applied mathematics. This is linked to several facts, among others: New theoretical advances have been achieved, like new forms of 4 time-frequency bases for signal analysis. Efficient computational algorithms are available. Many applications either used similar ideas, like for example the concept of multiresolution, or took advantage of the unified framework provided by wavelets. This combination of elegant theory, efficient algorithms, and successful applications makes the field of wavelets and signal processing quite exciting. It is the purpose of these lectures to establish the theory necessary to understand wavelets and related constructions. A...

  12. Lectures on Quantum Mechanics

    CERN Document Server

    Basdevant, Jean-Louis

    2007-01-01

    Beautifully illustrated and engagingly written, Lectures on Quantum Mechanics presents theoretical physics with a breathtaking array of examples and anecdotes. Basdevant's style is clear and stimulating, in the manner of a brisk classroom lecture that students can follow with ease and enjoyment. Here is a sample of the book's style, from the opening of Chapter 1: "If one were to ask a passer-by to quote a great formula of physics, chances are that the answer would be 'E = mc2'. Nevertheless, the formula 'E=hV' which was written in the same year 1905 by the same Albert Einstein, and which started quantum theory, concerns their daily life considerably more. In fact, of the three watershed years for physics toward the beginning of the 20th century - 1905: the Special Relativity of Einstein, Lorentz and Poincaré; 1915: the General Relativity of Einstein, with its extraordinary reflections on gravitation, space and time; and 1925: the full development of Quantum Mechanics - it is surely the last which has the mos...

  13. Lectures on Yangian symmetry

    Science.gov (United States)

    Loebbert, Florian

    2016-08-01

    In these introductory lectures we discuss the topic of Yangian symmetry from various perspectives. Forming the classical counterpart of the Yangian and an extension of ordinary Noether symmetries, first the concept of nonlocal charges in classical, two-dimensional field theory is reviewed. We then define the Yangian algebra following Drinfel’d's original motivation to construct solutions to the quantum Yang–Baxter equation. Different realizations of the Yangian and its mathematical role as a Hopf algebra and quantum group are discussed. We demonstrate how the Yangian algebra is implemented in quantum, two-dimensional field theories and how its generators are renormalized. Implications of Yangian symmetry on the two-dimensional scattering matrix are investigated. We furthermore consider the important case of discrete Yangian symmetry realized on integrable spin chains. Finally we give a brief introduction to Yangian symmetry in planar, four-dimensional super Yang–Mills theory and indicate its impact on the dilatation operator and tree-level scattering amplitudes. These lectures are illustrated by several examples, in particular the two-dimensional chiral Gross–Neveu model, the Heisenberg spin chain and { N }=4 superconformal Yang–Mills theory in four dimensions.

  14. How interdisciplinary is nanotechnology?

    International Nuclear Information System (INIS)

    Facilitating cross-disciplinary research has attracted much attention in recent years, with special concerns in nanoscience and nanotechnology. Although policy discourse has emphasized that nanotechnology is substantively integrative, some analysts have countered that it is really a loose amalgam of relatively traditional pockets of physics, chemistry, and other disciplines that interrelate only weakly. We are developing empirical measures to gauge and visualize the extent and nature of interdisciplinary interchange. Such results speak to research organization, funding, and mechanisms to bolster knowledge transfer. In this study, we address the nature of cross-disciplinary linkages using 'science overlay maps' of articles, and their references, that have been categorized into subject categories. We find signs that the rate of increase in nano research is slowing, and that its composition is changing (for one, increasing chemistry-related activity). Our results suggest that nanotechnology research encompasses multiple disciplines that draw knowledge from disciplinarily diverse knowledge sources. Nano research is highly, and increasingly, integrative-but so is much of science these days. Tabulating and mapping nano research activity show a dominant core in materials sciences, broadly defined. Additional analyses and maps show that nano research draws extensively upon knowledge presented in other areas; it is not constricted within narrow silos.

  15. [Geriatrics - an interdisciplinary challenge].

    Science.gov (United States)

    Nau, Roland; Djukic, Marija; Wappler, Manfred

    2016-06-01

    The care of elderly patients will continue to challenge the healthcare system over the next decades. As a rule geriatric patients suffer from multimorbidities with complex disease patterns, and the ability to cope with everyday life is severely reduced. Treatment is provided by a multiprofessional geriatric team, and the primary goal is improvement of functional status, quality of life in the social environment and autonomy by employing a holistic approach. In Germany geriatric care is provided by physicians from various medical specialties (e.g. general practitioners, internists, neurologists and psychiatrists). In the training for the subspecialty clinical geriatrics, these specialties enjoy equal rights. Recent efforts to establish a qualification as physician for internal medicine and geriatrics have initiated a discussion to make the suitability for qualification as a geriatrician dependent on the medical specialty. Geriatric patients benefit from multidisciplinary cooperation. Neurologists possess great expertise in the treatment of patients with dementia, depression, delirium, consequences of degenerative spinal cord diseases and vertebral bone fractures, stroke, Parkinson's syndrome, epileptic seizures, vertigo and dizziness, neuropathies, lesions of peripheral nerves and in the multimodal therapy of pain. To function in a position of responsibility in a geriatric department, neurologists need skills in general internal medicine. These are acquired either on a geriatric ward or during specialization as a neurologist by full time secondment to large neurological or interdisciplinary intensive care units. PMID:27167886

  16. LEAH interdisciplinary training program.

    Science.gov (United States)

    Robbins, Cynthia L; Rickert, Vaughn D

    2016-08-01

    This article describes the Leadership Education in Adolescent Health (LEAH) interdisciplinary training program in the United States. The Maternal and Child Health Bureau authorized by legislation provides monies to train leaders in adolescent health through a competitive grant process. Currently, seven academic medical centers have funding to provide leadership in adolescent health (LEAH) training in five core disciplines: medicine, nursing, psychology, social work and nutrition. LEAH training programs both ensure high clinical competence in core disciplines serving adolescents and prepare trainees for leadership positions in adolescent health and public health care realms. Together, these programs trained almost 1000 long-term trainees across these five disciplines, and graduates from these programs are working in 45 of the 50 states within the United States. About 90% of these graduates are working with maternal and child/adolescent health populations, and almost all have held leadership positions in the areas of public health, advocacy, public policy, academic medical centers and/or clinical care settings. PMID:26115496

  17. Silence in Interdisciplinary Research Collaboration

    NARCIS (Netherlands)

    Verouden, Nick W.; Sanden, van der Maarten C.A.; Aarts, Noelle

    2016-01-01

    Solving publicly important issues asks for the development of socio-technical approaches, which demands collaboration between researchers with different perspectives, values, and interests. In these complex interdisciplinary collaborations, the course of communication is of utmost importance, inc

  18. Tai Chi Chuan in Medicine and Health Promotion

    Directory of Open Access Journals (Sweden)

    Ching Lan

    2013-01-01

    Full Text Available Tai Chi Chuan (Tai Chi is a Chinese traditional mind-body exercise and recently, it becomes popular worldwide. During the practice of Tai Chi, deep diaphragmatic breathing is integrated into body motions to achieve a harmonious balance between body and mind and to facilitate the flow of internal energy (Qi. Participants can choose to perform a complete set of Tai Chi or selected movements according to their needs. Previous research substantiates that Tai Chi has significant benefits to health promotion, and regularly practicing Tai Chi improves aerobic capacity, muscular strength, balance, health-related quality of life, and psychological well-being. Recent studies also prove that Tai Chi is safe and effective for patients with neurological diseases (e.g., stroke, Parkinson's disease, traumatic brain injury, multiple sclerosis, cognitive dysfunction, rheumatological disease (e.g., rheumatoid arthritis, ankylosing spondylitis, and fibromyalgia, orthopedic diseases (e.g., osteoarthritis, osteoporosis, low-back pain, and musculoskeletal disorder, cardiovascular diseases (e.g., acute myocardial infarction, coronary artery bypass grafting surgery, and heart failure, chronic obstructive pulmonary diseases, and breast cancers. Tai Chi is an aerobic exercise with mild-to-moderate intensity and is appropriate for implementation in the community. This paper reviews the existing literature on Tai Chi and introduces its health-promotion effect and the potential clinical applications.

  19. Dicty_cDB: CHI194 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 58.1 V112D8 mTn-3xHA/lacZ Insertion Library, strain Y2278 Saccharomyces cerevisiae genomic 5', genomic survey se...) Frame A: ksnfi*ii*knk*ynikndiisnylmy*gn*ndlktstrsi*kkyknsnkeiisinwfsd nwyifsictsmvfvtnwmdiygysmlwiilcwvcmw...uolar 4.0 %: nuclear 4.0 %: vesicles of secretory system >> prediction for CHI194 is end 5' end seq. ID CHI194F 5' end se...CTTT TAATGGTTTAGTTTATAATCATTCATTTGCTGCTAGAAATTATTTGGATCTTTATAGAGT TGCTTTATTATCAAANNAATAAAATTAAATCATT Length of 3' end se...q. 754 Connected seq. ID CHI194P Connected seq. >CHI194P.Seq AAATCAAA

  20. Graphs with $\\chi=\\Delta$ have big cliques

    OpenAIRE

    Cranston, Daniel W.; Rabern, Landon

    2013-01-01

    Brooks' Theorem states that if a graph has $\\Delta\\ge 3$ and $\\omega \\le \\Delta$, then $\\chi \\le \\Delta$. Borodin and Kostochka conjectured that if $\\Delta\\ge 9$ and $\\omega\\le \\Delta-1$, then $\\chi\\le \\Delta-1$. We show that if $\\Delta\\ge 13$ and $\\omega \\le \\Delta-4$, then $\\chi\\le \\Delta-1$. For a graph $G$, let $\\mathcal{H}$ denote the subgraph of $G$ induced by vertices of degree $\\Delta$. We also show that if $\\omega\\le \\Delta-1$ and $\\omega(\\mathcal{H})\\le \\Delta-6$, then $\\chi\\le \\Del...

  1. Search for B --> chi_c K(*) decays

    CERN Document Server

    Aubert, B; Abrams, G S; Adye, T; Ahmed, S; Alam, M S; Albert, J; Aleksan, Roy; Allison, J; Allmendinger, T; Altenburg, D; Andreotti, M; Angelini, C; Anulli, F; Aston, D; Azzolini, V; Baak, M; Back, J J; Bailey, S; Baldini-Ferroli, R; Band, H R; Banerjee, Sw; Barate, R; Bard, D J; Barlow, N R; Barlow, R J; Barrett, M; Bartoldus, R; Batignani, G; Bauer, J M; Beck, T W; Bellini, F; Benayoun, M; Berger, N; Bernard, D; Berryhill, J W; Best, D; Bettarini, S; Bettoni, D; Bevan, A J; Bhimji, W; Bianchi, F; Biasini, M; Blanc, F; Blaylock, G; Blinov, A E; Blinov, V E; Bloom, P; Bóna, M; Bondioli, M; Bonneaud, G R; Borgland, A W; Bosisio, L; Boutigny, D; Bowerman, D A; Boyarski, A M; Boyd, J T; Bozzi, C; Brandenburg, G; Brandt, T; Brau, J E; Breon, A B; Briand, H; Brochard, F; Brose, J; Brown, C L; Brown, C M; Brown, D; Brown, D N; Bruinsma, M; Brunet, S; Bucci, F; Buchanan, C; Buchmüller, O L; Bulten, H; Burchat, Patricia R; Button-Shafer, J; Buzzo, A; Côté, D; Cahn, R N; Calabrese, R; Calcaterra, A; Calderini, G; Campagnari, C; Capra, R; Carpinelli, M; Cartaro, C; Cavallo, N; Cavoto, G; Chaisanguanthum, K S; Chao, M; Charles, E; Charles, M J; Chauveau, J; Chavez, C A; Chen, A; Chen, E; Chen, J C; Chen, S; Cheng, B; Cheng, C H; Chevalier, N; Christ, S; Cibinetto, G; Clark, P J; Claus, R; Cochran, J; Colecchia, F; Coleman, J P; Contri, R; Convery, M R; Cormack, C M; Cossutti, F; Cottingham, W N; Couderc, F; Covarelli, R; Cowan, G; Crawley, H B; Cremaldi, L M; Cristinziani, M; Crosetti, G; Çuhadar-Dönszelmann, T; Dahmes, B; Dallapiccola, C; Danielson, N; Dasu, S; Datta, M; Dauncey, P D; David, P; Davier, M; Davis, C L; Day, C T; De Groot, N; De Nardo, Gallieno; Del Buono, L; Della Ricca, G; Di Lodovico, F; Dickopp, M; Dittongo, S; Dong, D; Dorfan, J; Dorigo, A; Druzhinin, V P; Dubois-Felsmann, G P; Dujmic, D; Dunwoodie, W M; Dvoretskii, A; Eckmann, R; Edwards, A J; Egede, U; Eichenbaum, A M; Eigen, G; Eisner, A M; Elmer, P; Elsen, E E; Emery, S; Ernst, J A; Eschenburg, V; Eschrich, I; Fabozzi, F; Faccini, R; Fan, S; Farbin, A; Feltresi, E; Ferrarotto, F; Ferroni, F; Field, R C; Finocchiaro, G; Flack, R L; Flächer, H U; Flood, K T; Ford, K E; Ford, W T; Forster, I J; Forti, F; Fortin, D; Foulkes, S D; Franek, B J; Frey, R; Fritsch, M; Fry, J R; Gabathuler, Erwin; Gaidot, A; Gaillard, J M; Gaillard, J R; Galeazzi, F; Gallo, F; Gamba, D; Gamet, R; Gan, K K; Ganzhur, S F; Gary, J W; Gaspero, M; Gatto, C; Geddes, N I; Gill, M S; Giorgi, M A; Giraud, P F; Giroux, X; Gladney, L; Glanzman, T; Godang, R; Goetzen, K; Golubev, V B; Gopal, G P; Gowdy, S J; Graham, M; Grancagnolo, S; Green, M G; Greene, M G; Grenier, G J; Grenier, P; Gritsan, A V; Grosdidier, G; Groysman, Y; Guo, Q H; Hadavand, H K; Hadig, T; Haire, M; Halyo, V; Hamel de Monchenault, G; Hamon, O; Harrison, P F; Harrison, T J; Hart, A J; Hart, P A; Hartfiel, B L; Harton, J L; Hast, C; Hauke, A; Hawkes, C M; Hearty, C; Held, T; Hertzbach, S S; Heusch, C A; Hicheur, A; Hill, E J; Hitlin, D G; Höcker, A; Hodgkinson, M C; Hollar, J J; Honscheid, K; Hrynóva, T; Hufnagel, D; Hulsbergen, W D; Hutchcroft, D E; Igonkina, O; Innes, W R; Ivanchenko, V N; Izen, J M; Jackson, P D; Jackson, P S; Jacobsen, R G; Jawahery, A; Jayatilleke, S M; Jessop, C P; John, M J J; Johnson, J R; Judd, D; Kadel, R W; Kadyk, J; Kagan, H; Karyotakis, Yu; Kass, R; Kelly, M P; Kelsey, M H; Kerth, L T; Khan, A; Kim, H; Kim, P; Kirkby, D; Kitayama, I; Knecht, N S; Koch, H; Kocian, M L; Kofler, R; Kolomensky, Yu G; Koptchev, V B; Kovalskyi, D; Kowalewski, R V; Kozanecki, Witold; Kravchenko, E A; Krishnamurthy, M; Kroeger, R; Kroseberg, J; Kukartsev, G; Kutter, P E; Kyberd, P; Lacker, H M; Lae, C K; Lafferty, G D; Lamsa, J; Lanceri, L; Lange, D J; Langenegger, U; Lankford, A J; Laplace, S; Latham, T E; Lau, Y P; Lavin, D; Lazzaro, A; Le Diberder, F R; Lees, J P; Legendre, M; Leith, D W G S; Lepeltier, V; Leruste, P; Lewandowski, B; Li Gioi, L; Li, H; Libby, J; Lillard, V; Lista, L; Liu, R; LoSecco, J M; Lo Vetere, M; Lockman, W S; Lombardo, V; London, G W; Long, O; Lou, X C; Lu, A; Lü, C; Luitz, S; Luppi, E; Lusiani, A; Lüth, V; Lutz, A M; Lynch, G; Lynch, H L; Lyon, A J; MacFarlane, D B; Macri, M; Malcles, J; Mallik, U; Mancinelli, G; Mandelkern, M A; Manfredi, P F; Mangeol, D J J; Marchiori, G; Margoni, M; Marsiske, H; Martínez-Vidal, F; Mattison, T S; Mayer, B; Mazur, M A; Mazzoni, M A; McKenna, J A; McMahon, T R; Meadows, B T; Messner, R; Meyer, T I; Meyer, W T; Miftakov, V; Mihályi, A; Mir, L M; Mohanty, G B; Mohapatra, A K; Mommsen, R K; Monge, M R; Monorchio, D; Moore, T B; Morandin, M; Morgan, S E; Morganti, M; Morganti, S; Morii, M; Morton, G W; Muheim, F; Müller, D R; Müller-Pfefferkorn, R; Narsky, I; Nash, J A; Nauenberg, U; Neal, H; Negrini, M; Neri, N; Nesom, G; Nicholson, H; Nikolich, M B; Nogowski, R; O'Grady, C P; Ocariz, J; Oddone, P J; Ofte, I; Olaiya, E O; Olivas, A; Olsen, J; Onuchin, A P; Orimoto, T J; Otto, S; Ozcan, V E; Paar, H P; Paick, K; Palano, A; Palombo, F; Pan, Y; Panetta, J; Panvini, R S; Paoloni, E; Paolucci, P; Parry, R J; Passaggio, S; Patel, P M; Patrignani, C; Patteri, P; Payne, D J; Pelizaeus, M; Perazzo, A; Perl, M; Peruzzi, I M; Petersen, B A; Petersen, T C; Petrak, S; Petzold, A; Piatenko, T; Piccolo, D; Piccolo, M; Piemontese, L; Pierini, M; Pioppi, M; Piredda, G; Pivk, M; Plaszczynski, S; Playfer, S; Pompili, A; Poropat, P; Porter, F C; Posocco, M; Potter, C T; Prell, S; Prepost, R; Pripstein, M; Pulliam, T; Purohit, M V; Qi, N D; Rahatlou, S; Rahimi, A M; Rama, M; Rankin, P; Ratcliff, B N; Raven, G; Re, V; Reidy, J; Ricciardi, S; Richman, J D; Ritchie, J L; Rizzo, G; Roat, C; Roberts, D A; Robertson, S H; Robutti, E; Roe, N A; Röthel, W; Ronan, Michael T; Roney, J M; Rong, G; Roodman, A; Roos, L; Rosenberg, E I; Rotondo, M; Rubin, A E; Ryd, A; Saeed, M A; Safai-Tehrani, F; Saleem, M; Salnikov, A A; Salvatore, F; Samuel, A; Sanders, D A; Sandrelli, F; Santroni, A; Saremi, S; Sarti, A; Satpathy, A; Schalk, T; Schindler, R H; Schott, G; Schrenk, S; Schubert, J; Schubert, Klaus R; Schumm, B A; Schune, M H; Schwiening, J; Schwierz, R; Schwitters, R F; Sciacca, C; Sciolla, G; Seiden, A; Sekula, S J; Serednyakov, S I; Sharma, V; Shelkov, V G; Shen, B C; Simani, M C; Simi, G; Simonetto, F; Sinev, N B; Skovpen, Yu I; Sloane, R J; Smith, A J S; Smith, J G; Snoek, H L; Snyder, A; Sobie, R J; Soffer, A; Soha, A; Sokoloff, M D; Solodov, E P; Spaan, B; Spanier, S M; Spradlin, P; Stängle, H; Steinke, M; Stelzer, J; Stoker, D P; Stroili, R; Strom, D; Stugu, B; Su, D; Sullivan, M K; Summers, D J; Sundermann, J E; T'Jampens, S; Tan, P; Tantot, L; Taras, P; Taylor, F; Taylor, G P; Telnov, A V; Teodorescu, L; Ter-Antonian, R; Therin, G; Thiebaux, C; Thiessen, D; Tiozzo, G; Tisserand, V; Toki, W H; Torrence, E; Tosi, S; Touramanis, C; Treadwell, E; Vasileiadis, G; Vasseur, G; Vavra, J; Verderi, M; Verkerke, W; Vitale, L; Voci, C; Voena, C; Vuagnin, G; Wagner, G; Wagner, S R; Wagoner, D E; Waldi, R; Walsh, J; Wang, K; Wang, P; Wappler, F R; Watson, A T; Weaver, M; Weidemann, A W; Weinstein, A J R; Wenzel, W A; Wilden, L; Williams, D C; Williams, J C; Willocq, S; Wilson, F F; Wilson, J R; Wilson, M G; Wilson, R J; Winter, M A; Wisniewski, W J; Wittgen, M; Won, E; Wong, Q K; Wormser, G; Wright, D H; Wright, D M; Wu, J; Wu, S L; Xie, Y; Yamamoto, R K; Yang, S; Yarritu, A K; Ye, S; Yéche, C; Yi, J; Young, C C; Yu, Z; Yumiceva, F X; Yushkov, A N; Zallo, A; Zeng, Q; Zghiche, A; Zhang, J; Zhang, L; Zhao, H W; Zhu, Y S; Zito, M; De Sangro, R; La Vaissière, C de

    2004-01-01

    We report on the search for the factorization suppressed decays B -> chi_c0 K(*) and B -> chi_c2 K(*), with chi_c0 and chi_c2 decaying into J/psi gamma. We use a sample of 124 million BBbar events collected with the BABAR detector at the PEP-II storage ring at the Stanford Linear Accelerator Center. No significant signal is found and upper bounds for the branching fractions are obtained. All results are preliminary.

  2. Multicultural Interdisciplinary Handbook Outcomes Overview

    OpenAIRE

    Francisco José GARCÍA-PEÑALVO

    2012-01-01

    La ponencia “Multicultural Interdisciplinary Handbook Outcomes Overview” fue impartida el 10 de octubre de 2012 en Valencia en el contexto de la Conferencia Internacional ReAct: Re-activating teachers and learners. El objetivo de la misma fue introducir los resultados del proyecto europeo MIH (Multicultural Interdisciplinary Handbook: Tools for Learning History and Geography in a Multicultural Perspective (MIH) - Comenius Multilateral Project 502461-LLP-1-2009-1-ES-COMENIUS-CMP) y del proy...

  3. OECD Approach to Interdisciplinary Studies

    OpenAIRE

    M. R. Dehshiri

    2010-01-01

    The present article endeavours to examine, through a descriptive and analytical methodology, the approach taken by the Organization for Economic Cooperation and Development (OECD), regarding interdisciplinary studies in the field of Higher Education. The research explains the programmes and policies of this organization in the area of Higher Education and discusses the process of the evolution of interdisciplinary towards transdisciplinarity in the surveys and researches conducted by the orga...

  4. chi_c0 and chi_c2 Decays into eta eta, eta eta', and eta' eta' Final States

    CERN Document Server

    Adams, G S; Cummings, J P; Danko, I; Napolitano, J; He, Q; Insler, J; Muramatsu, H; Park, C S; Thorndike, E H; Yang, F; Coan, T E; Gao, Y S; Artuso, M; Blusk, S; Butt, J; Li, J; Menaa, N; Mountain, R; Nisar, S; Randrianarivony, K; Sia, R; Skwarnicki, T; Stone, S; Wang, J C; Zhang, K; Csorna, S E; Bonvicini, G; Cinabro, D; Dubrovin, M; Lincoln, A; Asner, D M; Edwards, K W; Briere, R A; Chen, J; Ferguson, T; Tatishvili, G T; Vogel, H; Watkins, M E; Rosner, J L; Adam, N E; Alexander, J P; Berkelman, K; Cassel, D G; Duboscq, J E; Ecklund, K M; Ehrlich, R; Fields, L; Galik, R S; Gibbons, L; Gray, R; Gray, S W; Hartill, D L; Heltsley, B K; Hertz, D; Jones, C D; Kandaswamy, J; Kreinick, D L; Kuznetsov, V E; Mahlke-Krüger, H; Onyisi, P U E; Patterson, J R; Peterson, D; Pivarski, J; Riley, D; Ryd, A; Sadoff, A J; Schwarthoff, H; Shi, X; Stroiney, S; Sun, W M; Wilksen, T; Weinberger, M; Athar, S B; Patel, R; Potlia, V; Yelton, J; Rubin, P; Cawlfield, C; Eisenstein, B I; Karliner, I; Kim, D; Lowrey, N; Naik, P; Sedlack, C; Selen, M; White, E J; Wiss, J; Mitchell, R E; Shepherd, M R; Besson, D; Pedlar, T K; Cronin-Hennessy, D; Gao, K Y; Hietala, J; Kubota, Y; Klein, T; Lang, B W; Poling, R; Scott, A W; Smith, A; Zweber, P; Dobbs, S; Metreveli, Z V; Seth, K K; Tomaradze, A G; Ernst, J; Severini, H; Dytman, S A; Love, W; Savinov, V; Aquines, O; Li, Z; López, A; Mehrabyan, S S; Méndez, H; Ramírez, J; Huang, G S; Miller, D H; Pavlunin, V; Sanghi, B; Shipsey, I P J; Xin, B; al, et

    2006-01-01

    Using a sample of 3 x 10^6 psi(2S) decays collected by the CLEO III and CLEO_c detector configurations, we present results of a study of \\chi_{c0} and \\chi_{c2} decays into eta-eta, eta-etaprime, and etaprime-etaprime final states. We find B(chi_{c0} -> eta-eta)= (0.31+-0.05+-0.04+-0.02)%, B(chi_{c0} -> eta-etaprime) etaprime-etaprime) = (0.17 +- 0.04 +-0.02 +-0.01)%. We also present upper limits for the decays of \\chi_{c2} into these final states. These results give information on the decay mechanism of \\chi_c states into pseudoscalars.

  5. Technology Lecturer Turned Technology Teacher

    Science.gov (United States)

    Lee, Kerry

    2009-01-01

    This case study outlines a program developed by a group of 6 teachers' college lecturers who volunteered to provide a technology program to year 7 & 8 children (11- and 12-year-olds) for a year. This involved teaching technology once a week. As technology education was a new curriculum area when first introduced to the college, few lecturers had…

  6. Three lectures on Newton's laws

    OpenAIRE

    Kokarev, Sergey S.

    2009-01-01

    Three small lectures are devoted to three Newton's laws, lying in the foundation of classical mechanics. These laws are analyzed from the viewpoint of our contemporary knowledge about space, time and physical interactions. The lectures were delivered for students of YarGU in RSEC "Logos".

  7. Community Recovery and Sustainable Development in the Region of Seismic Center in Taiwan after the 1999 CHI-CHI Earthquake

    OpenAIRE

    Hsiu-Jen Jennifer, Yeh

    2006-01-01

    International audience The major purpose of this study is to evaluate the progress of community recovery and sustainable development of the region of seismic centre in Taiwan after the 1999 Chi-Chi Earthquake. Data analyzed in this study were collected from a face-to-face interview survey conducted in the research site of Tzu-Shan Town, Nan-Tau County, an area close to the epicentre of Chi-Chi Town, Nan-Tau County. The analysis of this study indicates that before the earthquake the residen...

  8. Lecture Notes: Approximate Molecular Orbital Theory

    DEFF Research Database (Denmark)

    Spanget-Larsen, Jens

    2015-01-01

    Lecture Notes for the introductory course "Quantum Chemistry & Spectroscopy" (Dept. Science, Roskilde University)......Lecture Notes for the introductory course "Quantum Chemistry & Spectroscopy" (Dept. Science, Roskilde University)...

  9. Lectures on quantum information

    International Nuclear Information System (INIS)

    Quantum Information Processing is a young and rapidly growing field of research at the intersection of physics, mathematics, and computer science. Its ultimate goal is to harness quantum physics to conceive - and ultimately build - 'quantum' computers that would dramatically overtake the capabilities of today's 'classical' computers. One example of the power of a quantum computer is its ability to efficiently find the prime factors of a large integer, thus shaking the supposedly secure foundations of standard encryption schemes. This comprehensive textbook on the rapidly advancing field introduces readers to the fundamental concepts of information theory and quantum entanglement, taking into account the current state of research and development. It thus covers all current concepts in quantum computing, both theoretical and experimental, before moving on to the latest implementations of quantum computing and communication protocols. With its series of exercises, this is ideal reading for students and lecturers in physics and informatics, as well as experimental and theoretical physicists, and physicists in industry. (orig.)

  10. ACADEMIC TRAINING LECTURE

    CERN Multimedia

    Academic Training; Tel. 73127

    2001-01-01

    21, 22, 23 November LECTURES FOR POSTGRADUATE STUDENTS From 11:00 hrs - Council Chamber bldg. 503 on 21 November Auditorium, bldg 500 on 22, 23 November Introduction to symmetry breaking phenomena in physics E. Brezin / ENS, Paris, F. The notion of broken symmetries started slowly to emerge in the 19th century. The early studies of Pasteur on the parity asymmetry of life, the studies of Curie on piezoelectricity and on the symmetries of effects versus the symmetry of causes (which clearly excluded spontaneous symmetry breaking), are important historical landmarks. However the possibility of spontaneous symmetry breaking within the usual principles of statistical mechanics, waited for the work of Peierls and Onsager. The whole theory of phase transitions and critical phenomena, as well as the construction of field theoretic models as long distance limit of yet unknown physics, relies nowadays on the concept of criticality associated to spontaneous symmetry breaking. The phenomena of Goldstone bosons, of Meissn...

  11. Göttingen Lectures

    CERN Document Server

    Woyczyński, Wojbor A

    1998-01-01

    These lecture notes are woven around the subject of Burgers' turbulence/KPZ model of interface growth, a study of the nonlinear parabolic equation with random initial data. The analysis is conducted mostly in the space-time domain, with less attention paid to the frequency-domain picture. However, the bibliography contains a more complete information about other directions in the field which over the last decade enjoyed a vigorous expansion. The notes are addressed to a diverse audience, including mathematicians, statisticians, physicists, fluid dynamicists and engineers, and contain both rigorous and heuristic arguments. Because of the multidisciplinary audience, the notes also include a concise exposition of some classical topics in probability theory, such as Brownian motion, Wiener polynomial chaos, etc.

  12. Acoustics lecturing in Mexico

    Science.gov (United States)

    Beristain, Sergio

    2002-11-01

    Some thirty years ago acoustics lecturing started in Mexico at the National Polytechnic Institute in Mexico City, as part of the Bachelor of Science degree in Communications and Electronics Engineering curricula, including the widest program on this field in the whole country. This program has been producing acoustics specialists ever since. Nowadays many universities and superior education institutions around the country are teaching students at the B.Sc. level and postgraduate level many topics related to acoustics, such as Architectural Acoustics, Seismology, Mechanical Vibrations, Noise Control, Audio, Audiology, Music, etc. Also many institutions have started research programs in related fields, with participation of medical doctors, psychologists, musicians, engineers, etc. Details will be given on particular topics and development.

  13. ACADEMIC TRAINING LECTURE

    CERN Multimedia

    Academic Training; Tel. 73127

    2001-01-01

    8, 9, 10, 11 and 12 October LECTURES FOR POSTGRADUATE STUDENTS From 10:00 hrs - Main Auditorium bldg. 500 Introduction to Field Theory R. Kleiss / University of Nijmegen, NL Starting from the notion of path integrals as developed by Feynman, we discuss field theory in zero spacetime dimensions. The concepts of perturbation expansions, connected amplitudes, Feynman diagrams, classical solutions, renormalization and the effective action are developed. The model is extended to four spacetime dimensions, and the full Feynman rules for relativisitc scalar theory derived. The S matrix and the concept of unitarity are discussed, leading to the amputation rules for S matrix elements from considerations of unitarity. The rules are extended to include particles with spin-1/2 and spin-1. The high-energy behaviour of the theory is discussed as a method to derive the gauge symmetry of the various models.

  14. Erice lectures on cosmology

    International Nuclear Information System (INIS)

    This chapter presents lectures on big-bang cosmology; contents of the universe (especially neutrinos); matterantimatter asymmetry; and mysteries in the sky. Discusses dynamic equations of cosmology; the relation to Hubble parameters; simple solutions; the global structure of the universe (fixed cosmic time); global structure (dynamics); red-shift; observational handles on closure questions; notable events in universal history; neutrino decoupling; density of the neutrino gas; the mass limit on cosmologically stable neutrinos; nucleosynthesis; neutrino stability; neutrino mass and galaxy formation; evidence for asymmetry; requirements for a theory of asymmetry; a simple scenario (drift and decay); microscopics; thermalization; horizons; background radiation; a large entropy; monopoles; and a cosmological constant. Presents discussions featuring D'Hoker, Wilczek, Teller and others

  15. Lectures de Jacques Proust

    OpenAIRE

    Bonnet, Jean-Claude

    2009-01-01

    Il y aura bientôt quatre ans déjà que Jacques Proust nous a quittés, le 19 septembre 2005. L’année qui suivit fut marquée par des évocations du disparu dignes en tout point de lui : celle de Georges Benrekassa icimême (RDE n° 40-41), celles de Yoichi Sumi et de Hisayasu Nakagawa (accompagnées d’une bibliographie de Muriel Brot) dans Dix-huitième siècle (n° 38).Avec ces Lectures de Jacques Proust (et prochainement un Sillages de Jacques Proust édité par Marie Leca-Tsiomis) s’ouvre une autre sé...

  16. ACADEMIC TRAINING LECTURE

    CERN Multimedia

    Academic Training; Tel. 73127

    2001-01-01

    11, 12, 13, 14 and 15 June REGULAR LECTURE PROGRAMME From 11:00 hrs - Main Auditorium bldg. 500 What have we learned from LEP J. Ellis / CERN-TH The basic formalism of the Standard Model will be reviewed, and the limited state of our knowledge before the start-up of LEP will be recalled. Neutrino counting at LEP will be compared with astrophysical and cosmological constraints. The interpretation of precision electroweak data will be discussed, including their predictions for the top quark and the Higgs boson, and the hints they offer for the future direction beyond the Standard Model: probably a weakly-interacting theory that may be extrapolated up to a grand unification scale. Topics in QCD and heavy-flavour physics will be discussed briefly, and topics in W physics at greater length. Direct LEP searches for the Higgs boson and supersymmetric particles will be discussed, and the prospects for their discoveries at future accelerators will be previewed.

  17. Optimising Lecture Time

    DEFF Research Database (Denmark)

    Holst-Christensen, Bo

    interest in getting a degree, they prefer the educators to do the work for them. The focus of my experiments have therefore been to develop teaching techniques that ensures that the students study efficiently and at the same time moves the task of identifying which parts of the subjects that are giving the...... the students more actively in choosing teaching techniques - on a day to day basis. The result is that I now have more active students, that help me to ensure that they get the information and help they need. This also results in a much more efficient use of the time we spend together....... students problems from the educator to the students. By using techniques that put more weight on student participation, cooperation and preparation, I have been able to cut significantly down on the time used for lecturing, allowing more time for student work and reflection. As an example by getting the...

  18. ACADEMIC TRAINING LECTURE

    CERN Multimedia

    Academic Training; Tel. 73127

    2001-01-01

    19, 20, 21, 22 and 23 February REGULAR LECTURE PROGRAMME From 11:00 hrs - 19, 20 and 21 February Main Auditorium bldg. 500, 22 and 23 February Council Chamber, bldg 503 Introduction to Cryogenic Engineering J.G. Weisend / SLAC, Stanford, USA Cryogenic engineering is an important speciality at CERN. With the construction of LHC, this technology will have an even greater impact on machine operations. The goal of the course is to give people not working in cryogenics an appreciation of the basic principals and problems associated with the field. The course will also provide a foundation for future learning in cryogenics. Topics to be covered will include: properties of cryogenic fluids and materials, refrigeration, cryostat design, instrumentation, safety and propertiesof He II. Examples of working cryogenic systems, many of them from high energy physics, will be presented.

  19. Lecture on Thermal Radiation

    Science.gov (United States)

    Dennis, Brian R.

    2006-01-01

    This lecture will cover solar thermal radiation, particularly as it relates to the high energy solar processes that are the subject of this summer school. After a general review of thermal radiation from the Sun and a discussion of basic definitions, the various emission and absorption mechanisms will be described including black-body emission, bremsstrahlung, free-bound, and atomic line emissions of all kinds. The bulk of the time will be spent discussing the observational characteristics of thermal flare plasma and what can be learned about the flare energy release process from observations of the thermal radiation at all wavelengths. Information that has been learned about the morphology, temperature distribution, and composition of the flare plasma will be presented. The energetics of the thermal flare plasma will be discussed in relation to the nonthermal energy of the particles accelerated during the flare. This includes the total energy, the radiated and conductive cooling processes, and the total irradiated energy.

  20. Lectures in Micro Meteorology

    DEFF Research Database (Denmark)

    Larsen, Søren Ejling

    material. The original report includes pages of course material, directly copied from other people’s publications, used during the lectures. Therefore this report is an internal report only. In the present report these copied pages have en removed in respect for the rights of the original authors....... available in meteorology at that time did not include enough of the special flavor of micro meteorology that characterized the work of the meteorology group at Risø (presently of the Institute of wind energy of the Danish Technical University). This work was focused on Boundary layer flows and turbulence...... not resisted adding more recent work, if ongoing projects made it easy. In the course I have tried to present the details of the basic material, trying to avoid the well known sentence of “It is easily seen—“. But I have been less thorough and pedagogical, when presenting the more illustrative...

  1. Artsimovich memorial lecture

    International Nuclear Information System (INIS)

    After half a century of work, mastering on earth thermonuclear fusion to produce energy is becoming a realistic challenge: despite its scientific and technological complexity, considerable progress has been obtained without encountering insurmountable roadblocks. Such progress is due for a great part to all the pioneers, as Academician Lev Andreevich Artsimovich, who, with their talents and a visionary mind, internationally promoted the civil use of thermonuclear fusion, a source which could help to face the long term energy demand. To honour their faith and their investment in this challenge which would solve humankind energy needs on a millenary scale, I will try in this Artsimovich Memorial Lecture to: situate the fusion contribution in the future energy mix contemplated today ; survey the state of the art of fusion physics and technology fields, giving some examples; underline the next priority, to study a burning plasma, launching the construction of the International Thermonuclear Experimental Reactor (ITER) as soon as possible

  2. Lectures on Yangian Symmetry

    CERN Document Server

    Loebbert, Florian

    2016-01-01

    In these introductory lectures we discuss the topic of Yangian symmetry from various perspectives. Forming the classical counterpart of the Yangian and an extension of ordinary Noether symmetries, first the concept of nonlocal charges in classical, two-dimensional field theory is reviewed. We then define the Yangian algebra following Drinfeld's original motivation to construct solutions to the quantum Yang-Baxter equation. Different realizations of the Yangian and its mathematical role as a Hopf algebra and quantum group are discussed. We demonstrate how the Yangian algebra is implemented in quantum, two-dimensional field theories and how its generators are renormalized. Implications of Yangian symmetry on the two-dimensional scattering matrix are investigated. We furthermore consider the important case of discrete Yangian symmetry realized on integrable spin chains. Finally we give a brief introduction to Yangian symmetry in planar, four-dimensional super Yang-Mills theory and indicate its impact on the dila...

  3. Lectures on LHC physics

    CERN Document Server

    Plehn, Tilman

    2015-01-01

    With the discovery of the Higgs boson, the LHC experiments have closed the most important gap in our understanding of fundamental interactions, confirming that such interactions between elementary particles can be described by quantum field theory, more specifically by a renormalizable gauge theory. This theory is a priori valid for arbitrarily high energy scales and does not require an ultraviolet completion. Yet, when trying to apply the concrete knowledge of quantum field theory to actual LHC physics - in particular to the Higgs sector and certain regimes of QCD - one inevitably encounters an intricate maze of phenomenological know-how, common lore and other, often historically developed intuitions about what works and what doesn’t. These lectures cover three aspects to help understand LHC results in the Higgs sector and in searches for physics beyond the Standard Model: they discuss the many facets of Higgs physics, which is at the core of this significantly expanded second edition; then QCD, to the deg...

  4. Lectures on algebraic statistics

    CERN Document Server

    Drton, Mathias; Sullivant, Seth

    2009-01-01

    How does an algebraic geometer studying secant varieties further the understanding of hypothesis tests in statistics? Why would a statistician working on factor analysis raise open problems about determinantal varieties? Connections of this type are at the heart of the new field of "algebraic statistics". In this field, mathematicians and statisticians come together to solve statistical inference problems using concepts from algebraic geometry as well as related computational and combinatorial techniques. The goal of these lectures is to introduce newcomers from the different camps to algebraic statistics. The introduction will be centered around the following three observations: many important statistical models correspond to algebraic or semi-algebraic sets of parameters; the geometry of these parameter spaces determines the behaviour of widely used statistical inference procedures; computational algebraic geometry can be used to study parameter spaces and other features of statistical models.

  5. Dicty_cDB: CHI458 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHI458 (Link to dictyBase) - - - Contig-U15607-1 CHI458P (Link to Original ... n*il nnnnynknnhqkhtlkkhkn*nkkkke*nn*kkiekimfqkv*lk*mis *qnlnh*ikll nlfhqmvivyikqlqtny*likilmkkrvkvmqrn*eq* ...

  6. Model Waveform Accuracy Requirements for the $\\chi^2$ Discriminator

    CERN Document Server

    Lindblom, Lee

    2016-01-01

    This paper derives accuracy standards for model gravitational waveforms required to ensure proper use of the $\\chi^2$ discriminator test in gravitational wave (GW) data analysis. These standards are different from previously established requirements for detection and waveform parameter measurement based on signal-to-noise optimization. We present convenient formulae both for evaluating and interpreting the contribution of model errors to measured $\\chi^2$ values. Motivated by these formula, we also present an enhanced, complexified variant of the standard $\\chi^2$ statistic used in GW searches. While our results are not directly relevant to current searches (which use the $\\chi^2$ test only to veto signal candidates with extremely high $\\chi^2$ values), they could be useful in future GW searches and as figures of merit for model gravitational waveforms.

  7. INTERDISCIPLINARY MODULE IN PREVENTION AND HEALTH PROMOTION IN POPULATION HEALTH FOR OCCUPATIONAL THERAPY AND PHYSIOTHERAPY STUDENTS

    DEFF Research Database (Denmark)

    Brandt, Jørgen

    2007-01-01

    PURPOSE: The purpose is to provide physiotherapy and occupational therapy students at the University College Cvu vita in Holstebro, Denmark, the opportunity to develop competences for interdisciplinary working situations concerning promotion of population health. RELEVANCE: The Danish Ministry of...... and occupational health. The occupational therapy and physiotherapy students are mixed in interdisciplinary groups of 4-5 students connected to a private company or a public institution. Together the group and the company/institution formulate work related, or population health related issues and co......-operate towards appropriate solutions. The groups suggest and present preventive and health promotion solutions and strategies especially designed for this particular situation. The groups are supervised by an interdisciplinary team of occupational therapy and physiotherapy lecturers. In addition to the...

  8. Women, Minorities, and Interdisciplinary Research

    Science.gov (United States)

    Pfirman, S.; Rhoten, D.

    2007-05-01

    Two major issues face the scientific enterprise: the need to engage the next generation of scientists and the recognition that research frontiers don't necessarily fall within disciplinary lines. While research has focused on each of these trends independently, surprisingly few studies have considered how intellectual preferences for and professional consequences of interdisciplinary science might be influenced by one's gender. This presentation assembles some of the first empirical data on gender and interdisciplinarity, showing that women appear to be disproportionately involved in interdisciplinary science. It considers what draws women in this direction and explores the implications of such a tendency. Interdisciplinary research may present a promising angle by which to engage women in the scientific enterprise, and institutions interested in increasing interdisciplinary research may have a greater chance for success if they involve women. Similarly, institutions interested in increasing their diversity may have a greater chance for success if they value interdisciplinary scholarship, which is still an issue on most campuses where disciplinary departments dominate.

  9. Boundary breaking for interdisciplinary learning

    Directory of Open Access Journals (Sweden)

    Adi Kidron

    2015-10-01

    Full Text Available The purpose of this work is to contribute to the body of knowledge on processesby which students develop interdisciplinary understanding of contents, as well as to suggest technology-enhanced means for supporting them in these processes in the context of higher education. In doing so, we suggest a rethinking of three traditional practices that tend to characterise typical higher education instruction: (1 compartmentalisation of disciplines; (2 traditional pedagogy; and (3 traditional hierarchies based on levels of expertise. Our high-level conjecture was that meaningful dialogue with peers and experts supports both the deepening of ideas in one knowledge domain and the formation of connections between ideas from several domains, both of which are required for the development of interdisciplinary understanding. We developed the Boundary Breaking for Interdisciplinary Learning (BBIL model, which harnesses technology to break boundaries between disciplines, learners and organisational levels of hierarchy. Findings indicate that 36 undergraduate students who participated in an interdisciplinary online course that implemented the BBIL model have significantly improved their interdisciplinary understanding of the course contents. This study illustrates how innovative use of available, free and low-cost technology can produce a ‘positive disruption’ in higher education instruction.

  10. Lecturing with a Virtual Whiteboard

    Science.gov (United States)

    Milanovic, Zoran

    2006-09-01

    Recent advances in computer technology, word processing software, and projection systems have made traditional whiteboard lecturing obsolete. Tablet personal computers connected to display projectors and running handwriting software have replaced the marker-on-whiteboard method of delivering a lecture. Since the notes can be saved into an electronic file, they can be uploaded to a class website to be perused by the students later. This paper will describe the author's experiences in using this new technology to deliver physics lectures at an engineering school. The benefits and problems discovered will be reviewed and results from a survey of student opinions will be discussed.

  11. The Oskar Klein Memorial Lectures

    CERN Document Server

    1991-01-01

    The Oskar Klein Memorial Lectures, instituted in 1988 and supported by the Royal Swedish Academy of Sciences through its Nobel Committee for Physics, are given at Stockholm University in Sweden, where Oskar Klein was professor in Theoretical Physics 1930-1962.Volume 1 contains the 1988 lectures on "Symmetry and Physics" and "From the Bethe-Hulthén Hypothesis to the Yang-Baxter Equation," given by C N Yang, Nobel Prize winner (1957) and professor at the State University of New York at Stony Brook. The 1989 lectures on "Beyond the Standard Models," referring to models for cosmology and elementar

  12. Science, technology and society for our century [inaugural lecture, 16 April 2013

    OpenAIRE

    Johnston, S.F.

    2013-01-01

    The links between science and technology, on the one hand, and wider society, on the other, have been the focus of growing attention over the past two generations. This inaugural lecture by Sean Johnston, Professor of Science, Technology and Society at the University of Glasgow’s School of Interdisciplinary Studies, will explore the recent history of this relationship and discuss why the social implications of science and technology have become increasingly contentious. Illustrated by career...

  13. Exploring Peer Learning: Student to Student, Lecturer to Lecturer

    OpenAIRE

    Peter Petocz; Michael Duke; Ayse Bilgin; Anna Reid

    2012-01-01

    This article explores how lecturers in statistics have adopted a model for a student peer learning project initially established in a music school. The exploration shows how disciplinary differences generate different peer learning approaches between students and how a team of lecturers has adapted a project from one discipline and institution to another. In essence, it explores the nature of peer learning from the perspective of student peers, including the extra insight that is available fr...

  14. Site responses in the Taipei basin during the 1999 Chi-Chi, Taiwan earthquake sequence

    International Nuclear Information System (INIS)

    On September 20, 1999 a magnitude ML 7.3 earthquake struck Taichung and Nantou in central Taiwan. Taipei basin located more than 100 km from the epicenter but also had many buildings damaged during the earthquake. In this study we use the main shock and aftershocks data of Chi-Chi earthquake to analyze the site effect of Taipei basin. The results show that the dominant low frequency band response is located in the western part of Taipei basin and Songshan area; the main high frequency band response areas are near the edge of basin. Another hand, comparing the results of amplification pattern with the location of damaged buildings found that the tall damaged buildings are located at the high response areas of low frequency band and the low-rise damaged structures are located at the high response areas of higher frequency band. From these results we can find the relationship between the site amplification and damaged structure distribution in the Taipei basin area during earthquakes. (authors)

  15. City as an Interdisciplinary Phenomenon

    Directory of Open Access Journals (Sweden)

    S. A. Riazi

    2013-01-01

    Full Text Available Interdisciplinary as a new approach to the problems of science and knowledge, has a wide range, but there is no consensus on its epistemological range and ontological domain. Among the different and various problems, there is a general agreement on “City” as a field of study as an interdisciplinary phenomenon. At least, three important disciplines, geography, architecture and social sciences, have engaged in analyzing this phenomenon by using each other’s methods, indicators, and objects. The extensive scientific branches of city have attracted the attentions of phenomenologists, engineers, economists, politicians, researchers of cultural studies, environment, and media. In this paper, the interdisciplinary aspect of city is reviewed by focusing on its connection with space, media, politics, economic and culture.

  16. City evacuations an interdisciplinary approach

    CERN Document Server

    Binner, Jane; Branicki, Layla; Galla, Tobias; Jones, Nick; King, James; Kolokitha, Magdalini; Smyrnakis, Michalis

    2015-01-01

    Evacuating a city is a complex problem that involves issues of governance, preparedness education, warning, information sharing, population dynamics, resilience and recovery. As natural and anthropogenic threats to cities grow, it is an increasingly pressing problem for policy makers and practitioners.   The book is the result of a unique interdisciplinary collaboration between researchers in the physical and social sciences to consider how an interdisciplinary approach can help plan for large scale evacuations.  It draws on perspectives from physics, mathematics, organisation theory, economics, sociology and education.  Importantly it goes beyond disciplinary boundaries and considers how interdisciplinary methods are necessary to approach a complex problem involving human actors and increasingly complex communications and transportation infrastructures.   Using real world case studies and modelling the book considers new approaches to evacuation dynamics.  It addresses questions of complexity, not only ...

  17. Tai Chi Chuan Exercise for Patients with Cardiovascular Disease

    Directory of Open Access Journals (Sweden)

    Ching Lan

    2013-01-01

    Full Text Available Exercise training is the cornerstone of rehabilitation for patients with cardiovascular disease (CVD. Although high-intensity exercise has significant cardiovascular benefits, light-to-moderate intensity aerobic exercise also offers health benefits. With lower-intensity workouts, patients may be able to exercise for longer periods of time and increase the acceptance of exercise, particularly in unfit and elderly patients. Tai Chi Chuan (Tai Chi is a traditional Chinese mind-body exercise. The exercise intensity of Tai Chi is light to moderate, depending on its training style, posture, and duration. Previous research has shown that Tai Chi enhances aerobic capacity, muscular strength, balance, and psychological well-being. Additionally, Tai Chi training has significant benefits for common cardiovascular risk factors, such as hypertension, diabetes mellitus, dyslipidemia, poor exercise capacity, endothelial dysfunction, and depression. Tai Chi is safe and effective in patients with acute myocardial infarction (AMI, coronary artery bypass grafting (CABG surgery, congestive heart failure (HF, and stroke. In conclusion, Tai Chi has significant benefits to patients with cardiovascular disease, and it may be prescribed as an alternative exercise program for selected patients with CVD.

  18. Dos and don'ts of reduced chi-squared

    CERN Document Server

    Andrae, Rene; Melchior, Peter

    2010-01-01

    Reduced chi-squared is a very popular method for model assessment, model comparison, convergence diagnostic, and error estimation in astronomy. In this manuscript, we discuss the pitfalls involved in using reduced chi-squared. There are two independent problems: (a) The number of degrees of freedom can only be estimated for linear models. Concerning nonlinear models, the number of degrees of freedom is unknown, i.e., it is not possible to compute the value of reduced chi-squared. (b) Due to random noise in the data, also the value of reduced chi-squared itself is subject to noise, i.e., the value is uncertain. This uncertainty impairs the usefulness of reduced chi-squared for differentiating between models or assessing convergence of a minimisation procedure. The impact of noise on the value of reduced chi-squared is surprisingly large, in particular for small data sets, which are very common in astrophysical problems. We conclude that reduced chi-squared can only be used with due caution for linear models, w...

  19. Making Interdisciplinary Subjects Relevant to Students: An Interdisciplinary Approach

    Science.gov (United States)

    Yang, Min

    2009-01-01

    This paper examines issues relating to the design/redesign of the pedagogy of interdisciplinary undergraduate subjects. Examples include: (a) law subjects for students in Business Management or Building and Surveying; (b) "English Communication for Business" for students in English; and (c) "Information technology in Business" for students in…

  20. AMUM LECTURE: Therapeutic ultrasound

    Science.gov (United States)

    Crum, Lawrence A.

    2004-01-01

    The use of ultrasound in medicine is now quite commonplace, especially with the recent introduction of small, portable and relatively inexpensive, hand-held diagnostic imaging devices. Moreover, ultrasound has expanded beyond the imaging realm, with methods and applications extending to novel therapeutic and surgical uses. These applications broadly include: tissue ablation, acoustocautery, lipoplasty, site-specific and ultrasound mediated drug activity, extracorporeal lithotripsy, and the enhancement of natural physiological functions such as wound healing and tissue regeneration. A particularly attractive aspect of this technology is that diagnostic and therapeutic systems can be combined to produce totally non-invasive, imageguided therapy. This general lecture will review a number of these exciting new applications of ultrasound and address some of the basic scientific questions and future challenges in developing these methods and technologies for general use in our society. We shall particularly emphasize the use of High Intensity Focused Ultrasound (HIFU) in the treatment of benign and malignant tumors as well as the introduction of acoustic hemostasis, especially in organs which are difficult to treat using conventional medical and surgical techniques.

  1. Lectures on Bound states

    CERN Document Server

    Hoyer, Paul

    2016-01-01

    Even a first approximation of bound states requires contributions of all powers in the coupling. This means that the concept of "lowest order bound state" needs to be defined. In these lectures I discuss the "Born" (no loop, lowest order in $\\hbar$) approximation. Born level states are bound by gauge fields which satisfy the classical field equations. As a check of the method, Positronium states of any momentum are determined as eigenstates of the QED Hamiltonian, quantized at equal time. Analogously, states bound by a strong external field $A^\\mu(\\xv)$ are found as eigenstates of the Dirac Hamiltonian. Their Fock states have dynamically created $e^+e^-$ pairs, whose distribution is determined by the Dirac wave function. The linear potential of $D=1+1$ dimensions confines electrons but repels positrons. As a result, the mass spectrum is continuous and the wave functions have features of both bound states and plane waves. The classical solutions of Gauss' law are explored for hadrons in QCD. A non-vanishing bo...

  2. John Adams Lecture

    CERN Multimedia

    PH Department

    2010-01-01

    13 December 2010 14:30 - Council Chamber, Bldg.503-1-001 Accelerator Breakthroughs, Achievements and Lessons from the Tevatron Collider V. Shiltsev / Fermilab’s Accelerator Physics Centre This year we celebrate the 25th anniversary of the first proton-antiproton collisions in the Tevatron. For two and a half decades the Tevatron at Fermilab (Batavia, IL, USA) was a centerpiece of the US and world’s High Energy Physics as the world’s highest energy particle collider at 1.8 TeV center of mass energy. While funding agencies are deciding on a 3-year extension of the Collider Run II operation through 2014, we – in this 2010 John Adams Lecture - will take a look in exciting story of the Tevatron: the story of long preparations, great expectations, numerous difficulties, years of “blood and sweat”, continuous upgrades, exceeding original goals (by a factor of 400) and high emotions. An accelerator scientist prospective will be given on a wide spectrum o...

  3. SUMMER STUDENT LECTURE PROGRAMME

    CERN Document Server

    Françoise Benz

    2002-01-01

    Main Auditorium, bldg. 500   DATE TIME LECTURER TITLE Monday 22 July 09:15 - 10:00 A. PICH Standard Model (6/8) 10:15 - 11:00 J. CARR  Astroparticles (1/3) 11:15 - 12:00 J. SHIERS Computing (1/3) Tuesday 23 July 09:15 - 10:00 A. PICH Standard Model (7/8) 10:15 - 11:00 J. CARR  Astroparticles (2/3) 11:15 - 12:00 J. SHIERS Computing (2/3) Wednesday 24July 09:15 - 10:00 A. PICH Standard Model (8/8) 10:15 - 11:00 J. CARR  Astroparticles (3/3) 11:15 - 12:00 Discussion Session 14:00 - 16:00 O. GROBNER UHV Technology Thursday 25 July (Theory Auditorium) 09:15 - 10:00 R. RATTAZZI Beyond the Standard Model (1/3) (TH) 10:15 - 11:00 P. WELLS Experimental test of the SM - LEP (1/3) (TH) 11:15 - 12:00 J. SHIERS Computing (3/3) (TH) Friday 26 July 09:15 - 10:00 R. RATTAZZI Beyond the Standard Model (2/3) 10:15 - 11:00 P. WELLS Experimental test of the SM - LEP (2/3) 11:15 - 12:00 Discussion Session Monday 29 July 09:15 - 10:00  R...

  4. SUMMER STUDENT LECTURE PROGRAMME

    CERN Document Server

    Françoise Benz

    2002-01-01

    Main Auditorium, bldg. 500   DATE TIME LECTURER TITLE Monday 15 July 09:15 - 10:00 A. PICH Standard Model (1/8) 10:15 - 11:00 O. BRÜNING Accelerators (1/5) 11:15 - 12:00 C. GASPAR Trigger and Data Acquisition (1/3) Tuesday 16 July 09:15 - 10:00 A. PICH Standard Model (2/8) 10:15 - 11:00 O. BRÜNING Accelerators (2/5) 11:15 - 12:00 C. GASPAR Trigger and Data Acquisition (2/3) Wednesday 17 July 09:15 - 10:00 A. PICH Standard Model (3/8) 10:15 - 11:00 O. BRÜNING Accelerators (3/5) 11:15 - 12:00 Discussion Session Thursday 18 July 09:15 - 10:00 A. PICH Standard Model (4/8) 10:15 - 11:00 O. BRÜNING Accelerators (4/5) 11:15 - 12:00 C. GASPAR Trigger and Data Acquisition (3/3) Friday 19 July 09:15 - 10:00 A. PICH Standard Model (5/8) 10:15 - 11:00 O. BRÜNING Accelerators (5/5) 11:15 - 12:00 Discussion Session Monday 22 July 09:15 - 10:00 A. PICH Standard Model (6/8) 10:15 - 11:00 T. WENAUS From Raw Data to Physics ...

  5. SUMMER STUDENT LECTURE PROGRAMME

    CERN Multimedia

    Françoise Benz

    2002-01-01

    Main Auditorium, bldg. 500   DATE TIME LECTURER TITLE Monday 8 July 09:15 - 10:00 R. KLEISS Fundamental Concepts of Particle Physics (1/6) 10:15 - 11:00 C. JORAM Particle Detectors (2/5) 11:15 - 12:00 M. FRANKLIN Classic Experiments (1/3) 14:00 - 15:00 M. LINDROOS Isolde 15:30 - 16:30 M. LINDROOS Visit of the Experiment Tuesday 9 july 09:15 - 10:00 R. KLEISS Fundamental Concepts of Particle Physics (2/6) 10:15 - 11:00 C. JORAM Particle Detectors (3/5) 11:15 - 12:00 M. FRANKLIN Classic Experiments (2/3) Wednesday 10 July 09:15 - 10:00 R. KLEISS Fundamental Concepts of Particle Physics (3/6) 10:15 - 11:00 C. JORAM Particle Detectors (4/5) 11:15 - 12:00 Discussion Session Thursday 11 July 09:15 - 10:00 R. KLEISS Fundamental Concepts of Particle Physics (4/6) 10:15 - 11:00 C. JORAM Particle Detectors (5/5) 11:15 - 12:00 M. FRANKLIN Classic Experiments (3/3) Friday 12 July 09:15 - 11:00 R. KLEISS Fundamental Concepts of Particle Physics (5&6/6) 11:15 ...

  6. SUMMER STUDENT LECTURE PROGRAMME

    CERN Document Server

    Françoise Benz

    2002-01-01

    Main Auditorium, bldg. 500   DATE TIME LECTURER TITLE Wednesday 3 July 09:15 - 10:00 L. FAYARD, O. ULLALAND Presentation of the Summer Student Programm 10:15 - 12:00 L. MAIANI Introduction to CERN (1&2/2) 14:00 - 15:00 G. Stevenson Radiation Protection (Council Chamber, bldg.503) Thursday 4 July 09:15 - 11:00 F. CLOSE Introduction to Particle Physics for non Physics Students (1&2/4) 11:15 - 12:00 C. JORAM Particle Detectors (1/5) Friday 5 July 09:15 - 11:00 F. CLOSE Introduction to Particle Physics for non Physics Students (3&4/4) 11:15 - 12:00 Discussion Session Monday 8 July 09:15 - 10:00 R. KLEISS Fundamental Concepts of Particle Physics (1/6) 10:15 - 11:00 C. JORAM Particle Detectors (2/5) 11:15 - 12:00 M. FRANKLIN Classic Experiments (1/3) 14:00 - 15:00 M. LINDROOS Isolde 15:30 - 16:30 M. LINDROOS Visit of the Experiment Tuesday 9 july 09:15 - 10:00 R. KLEISS Fundamental Concepts of Particle Physics (2/6) 10:15 - 11:00 C. JORAM Part...

  7. ACADEMIC TRAINING LECTURE

    CERN Multimedia

    Academic Training; Tel. 73127

    2001-01-01

    27, 28, 29 June and 2, 3 July REGULAR LECTURE PROGRAMME From 11:00 hrs - Council Chamber bldg. 503 on 27, 28, 29 June and Auditorium, bldg 500 on 2, 3 July Particle Identification at the LHC P. Eerola / Lund University, SE The LHC experiments will explore new frontiers of particle physics. To maximize the physics potential of LHC, we need identification of leptons, hadrons, photons and 'invisible' particles. This is realized through reconstruction of electrons and muons, charged particle tracking and identification, b- and tau-tagging, and jet reconstruction. In addition, missing energy has to be measured in order to look for signatures of invisible particles. The experimental conditions posed by the collider, which will be operating at higher energy and luminosity than the present ones, are demanding. A large dynamical range is required in order to measure energies and momenta ranging from below one GeV to several TeVs. The detectors should be able to cope with the 40 MHz collision rate, with a large number ...

  8. Lectures on quantum mechanics

    International Nuclear Information System (INIS)

    Quantum mechanics represents the central revolution of modern natural science and reaches in its importance farely beyond physics. Neither chemistry nor biology on the molecular scale would be understandable without it. Modern information technology from the laptop over the mobile telephone and the flat screen until the supercomputer would be unthinkable without quantum-mechanical effects. It desribes the world on the atomic and subatomic scale and is by this the starting point of our modern worldview. The Nobel-prize carrier Steven Weinberg has done ever among others by his theory of the unification of the weak and the electromagnetic interaction one of the most important contributions to this revolution. In this book he reproduces his personal view of quantum mechanics, which captivates by its strictly logic construction, precise linguistic representation, and mathematical clearness and completeness. This book appeals to studyings of natural sciences, especially of physics. Accompanied is the test by exercise problems, which allow the studying to apply immediately the knowledge, but also test their understanding. Because of its precision and clearness ''Lectures on Quantum Mechanics'' by Weinberg is also essentially suited for the self-study.

  9. SUMMER STUDENT LECTURE PROGRAMME

    CERN Multimedia

    Academic Training; Tel. 73127

    2001-01-01

    Main Auditorium bldg. 500 Date Time Lecturer Title Monday 16 July 9:15 10:15 11:15 A. Pich O. Brüning / CERN C. Gaspar / CERN Particle Physics: the Standard Model (1/8) Accelerators (1/5) Trigger and Data Acquisition (1/3) Tuesday 17 July 9:15 10:15 11:15 A. Pich O. Brüning / CERN C. Gaspar / CERN Particle Physics: the Standard Model (2/8) Accelerators (2/5) Trigger and Data Acquisition (2/3) Wednesday 18 July 9:15 10:15 11:15 A. Pich O. Brüning / CERN A. Pich and O. Brüning Particle Physics: the Standard Model (3/8) Accelerators (3/5) Discussion Session Thursday 19 July 9:15 10:15 11:15 A. Pich O. Brüning / CERN C. Gaspar / CERN Particle Physics: the Standard Model (4/8) Accelerators (4/5) Trigger and Data Acquisition (3/3) Friday 20 July 9:15 10:15 11:15 A. Pich O. Brüning / CERN A. Pich and O. Brüning Particle Physics: the Standard Model (5/8) Accelerators (5/5) Discussion Session Monday 23 July 9:15 10:15 11:15 A. Pich R. Jacobse...

  10. SUMMER STUDENT LECTURE PROGRAMME

    CERN Multimedia

    Academic Training; Tel. 73127

    2001-01-01

    Main Auditorium bldg. 500 Date Time Lecturer Title Monday 23 July 9:15 10:15 11:15 A. Pich R. Jacobsen / LBLN, Berkeley (USA) T. Cass / CERN Particle Physics: the Standard Model (6/8) From Raw Data to Physics Results (1/3) Computing at CERN (1/3) Tuesday 24 July 9:15 10:15 11:15 A. Pich R. Jacobsen / LBLN, Berkeley (USA) T. Cass / CERN Particle Physics: the Standard Model (7/8) From Raw Data to Physics Results (2/3) Computing at CERN (2/3) Wednesday 25 July 9:15 10:15 11:15 A. Pich R. Jacobsen / LBLN, Berkeley (USA) A. Pich and R. Jacobsen J. Tuckmantel / CERN Particle Physics: the Standard Model (8/8) From Raw Data to Physics Results (3/3) Discussion Session Superconducting cavities Thursday 26 July 9:15 10:15 11:15 T. Nakada / CERN P. Wells / CERN T. Cass / CERN Violation of Particle Anti-particle Symmetry (1/3) LEP Physics (1/4) Computing at CERN (3/3) Friday 27July 9:15 10:15 11:15 T. Nakada / CERN P. Wells / CERN T. Nakada; T. Cass T. Nakada in main auditorium T. Cass in TH auditorium Violati...

  11. Power plants 2010. Lectures

    International Nuclear Information System (INIS)

    The proceedings include the following lectures: Facing the challenges - new structures for electricity production. Renewable energies in Europe - chances and challenges. Nuclear outlook in the UK. Sustainable energy for Europe. Requirements of the market and the grid operator at the electricity production companies. Perspectives for the future energy production. Pumped storage plants - status and perspectives. Nuclear power/renewable energies -partners or opponents? New fossil fired power stations in Europe - status and perspectives. Nuclear energy: outlook for new build and lifetime extension in Europe. Biomass in the future European energy market - experiences for dong energy. Meeting the EU 20:20 renewable energy targets: the offshore challenges. DESERTEC: sustainable electricity for Europe, Middle East and North Africa. New power plants in Europe - a challenge for project and quality management. Consideration of safely in new build activities of power plants. Challenges to an integrated development in Maasvlakte, Netherlands. Power enhancement in EnBW power plants. Operational experiences of CCS pilot plants worldwide. Two years of operational experiences with Vattenfall's oxyfuel pilot plant. Pre-conditions for CCS. Storage technologies for a volatile generation. Overview: new generation of gas turbines.

  12. SUMMER STUDENT LECTURE PROGRAMME

    CERN Multimedia

    Academic Training; Tel. 73127

    2001-01-01

    Main Auditorium bldg. 500 Date Time Lecturer Title Wednesday 4 July 9:15 10:15 11:15 14:00 15:00 15:45 L. Maiani / CERN L. Maiani / CERN M. Franklin / CERN G. Stevenson M. Diemoz O. Ullaland Introduction to CERN & Particle Physics (1/2) Introduction to CERN & Particle Physics (2/2) Classic Experiments (1/3) CERN Radiation Protection CERN Information on Activities CERN Intro to workshops Thursday 5 July 9:15 10:15 11:15 14:00 15:00 16:30 M. Franklin / CERN M. Franklin / CERN M. Franklin / CERN F. Close F. Close   Classic Experiments (2/3) Classic Experiments (3/3) Discussion session Particle Physics (for non-physics students) (1/4) Particle Physics (for non-physics students) (2/4) Welcome Drink Friday 6 July 9:15 10:15 F. Close F. Close Particle Physics (for non-physics students) (3/4) Particle Physics (for non-physics students) (4/4) Monday 9 July 9:15 10:15 11:15 R. Kleiss / CERN L. Rolandi / CERN L. Rolandi / CERN Fundamental Concepts of Particle Physics (1/6) Big Experime...

  13. SUMMER STUDENT LECTURE PROGRAMME

    CERN Multimedia

    Academic Training; Tel. 73127

    2001-01-01

    Main Auditorium bldg. 500 Date Time Lecturer Title Wednesday 4 July 9:15 10:15 11:15 14:00 15:00 15:45 L. Maiani / CERN L. Maiani / CERN M. Franklin / CERN G. Stevenson M. Diemoz O. Ullaland Introduction to CERN & Particle Physics (1/2) Introduction to CERN & Particle Physics (2/2) Classic Experiments (1/3) CERN Radiation Protection CERN Information on Activities CERN Intro to workshops Thursday 5 July 9:15 10:15 11:15 14:00 15:00 16:30 M. Franklin / CERN M. Franklin / CERN M. Franklin / CERN F. Close F. Close   Classic Experiments (2/3) Classic Experiments (3/3) Discussion session Particle Physics (for non-physics students) (1/4) Particle Physics (for non-physics students) (2/4) Welcome Drink Friday 6 July 9:15 10:15 F. Close F. Close Particle Physics (for non-physics students) (3/4) Particle Physics (for non-physics students) (4/4) Further information can be obtained on the web at the following URL: http://cern.web.cern.ch/CERN/Divisions/PE/HRS/Recruitment/sum_prog99.html

  14. SUMMER STUDENT LECTURE PROGRAMME

    CERN Multimedia

    Academic Training; Tel. 73127

    2001-01-01

    Main Auditorium bldg. 500 Date Time Lecturer Title Monday 9 July 9:15 10:15 11:15 R. Kleiss / CERN L. Rolandi / CERN L. Rolandi / CERN Fundamental Concepts of Particle Physics (1/6) Big Experiments Discussion Session Tuesday 10 July 9:15 10:15 11:15 R. Kleiss / CERN R. Kleiss / CERN C. Joram Fundamental Concepts of Particle Physics (2/6) Fundamental Concepts of Particle Physics (3/6) Particle Detectors (1/5) Wednesday 11 July 9:15 10:15 11:15 R. Kleiss / CERN C. Joram / CERN R. Kleiss / C. Joram Fundamental Concepts of Particle Physics (4/6) Particle Detectors (2/5) Discussion Session Thursday 12 July 9:15 10:15 11:15 R. Kleiss / CERN C. Joram / CERN C. Joram / CERN Fundamental Concepts of Particle Physics (5/6) Particle Detectors (3/5) Particle Detectors (4/5) Friday 13 July 9:15 10:15 11:15 R. Kleiss / CERN C. Joram / CERN R. Kleiss / C. Joram Fundamental Concepts of Particle Physics (6/6) Particle Detectors (5/5) Discussion Session Monday 16 July 9:15 10:15 11:15 A. Pich O. Brüning C...

  15. ACADEMIC TRAINING LECTURE

    CERN Multimedia

    Academic Training; Tel. 73127

    2001-01-01

    14, 15, 16, 17, 18 January LECTURES FOR POSTGRADUATE STUDENTS From 11:00 hrs - Auditorium, bldg 500 Superconducting materials suitable for magnets D.C. Larbalestier / Univ. of Wisconsin, USA The range of materials available for superconducting magnets is steadily expanding, even as the choice of material becomes potentially more complex. When virtually all magnets were cooled by helium at ~2-5 K it was easy to separate the domain of Nb-Ti from those of Nb3Sn applications and very little surprise that more than 90% of all magnets are still made from Nb-Ti. But the development of useful conductors of the Bi-Sr-Ca-Cu-O and YBa2Cu3Ox high temperature superconductors, coupled to the recent discovery of the 39 K superconductor MgB2 and the developing availability of cryocoolers suggests that new classes of higher temperature, medium field magnets based on other than Nb-based conductors could become available in the next 5-10 years. My talks will discuss the essential physics and materials science of these 5 classes...

  16. ACADEMIC TRAINING LECTURE

    CERN Multimedia

    Academic Training; Tel. 73127

    2002-01-01

    14, 15, 16, 17, 18 January LECTURE SERIES From 11:00 hrs - Auditorium, bldg 500 Superconducting materials suitable for magnets D.C. Larbalestier / Univ. of Wisconsin, USA The range of materials available for superconducting magnets is steadily expanding, even as the choice of material becomes potentially more complex. When virtually all magnets were cooled by helium at ~2-5 K it was easy to separate the domain of Nb-Ti from those of Nb3Sn applications and very little surprise that more than 90% of all magnets are still made from Nb-Ti. But the development of useful conductors of the Bi-Sr-Ca-Cu-O and YBa2Cu3Ox high temperature superconductors, coupled to the recent discovery of the 39 K superconductor MgB2 and the developing availability of cryocoolers suggests that new classes of higher temperature, medium field magnets based on other than Nb-based conductors could become available in the next 5-10 years. My talks will discuss the essential physics and materials science of these 5 classes of material - Nb-Ti...

  17. Designing video lectures for MOOC

    OpenAIRE

    Soares, Filomena; Lopes, Ana Paula; Vieira, Isabel

    2015-01-01

    Educational videos differ from other teaching and learning technologies as they allow the benefit of using visual perception. Video lectures are not new to education, however with the use of innovative video technologies they can improve academic outcomes and extend the reach of education. They may offer extraordinary new experiences for higher education institutions (HEI). Through them lecturers can provide information and contents to students, and if ...

  18. Dicty_cDB: CHI575 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHI575 (Link to dictyBase) - - - Contig-U16427-1 - (Link to Original site) ... yfg*ytlyiyiiq*nviffrtdfrkdgfhr*ry*ihgns*sck*irkryf*ngs ... nl*k*ncykiisins*fsk*csrkcc*mfrfin*ks*rftsnrny*yiik ... n--- Homology vs CSM-cDNA Score E Sequences producing s ignificant alignments: (bits) Value CHI575 (CHI575 ... 003.10. 2 Homology vs DNA Score E Sequences producing s ignificant alignments: (bits) Value N AC116956 |AC ... 12. 7 Homology vs Protein Score E Sequences producing s ignificant alignments: (bits) Value (Q86KD1) RecNa ...

  19. Exploring the Possibilities of Interdisciplinary Teaming.

    Science.gov (United States)

    Clark, Sally N.; Clark, Donald C.

    1997-01-01

    Discusses careful planning, enlightened leadership, informed and enthusiastic teachers, and continuous evaluation as prerequisites for successful interdisciplinary teamwork. Suggests that interdisciplinary teaming allows better use of faculty members' skills, and provides better strategies for dealing with diversified populations, better…

  20. Interdisciplinary Collaboration in EHDI Programs

    Science.gov (United States)

    Nelson, Lauri; Houston, K. Todd; Hoffman, Jeff; Bradham, Tamala S.

    2011-01-01

    State coordinators of early hearing detection and intervention (EHDI) programs were asked to complete a strengths, weaknesses, opportunities, and threats, or SWOT, analysis that consisted of 12 evaluative areas of EHDI programs. For the interdisciplinary area, 47 coordinators responded with 224 items, and themes were identified within each SWOT…

  1. Olympic Games: An Interdisciplinary Model.

    Science.gov (United States)

    Tuning, William A.

    1981-01-01

    The 1980 Morley Olympics at May Morley Elementary School is an example of a successful special event in which sport served as the launching pad for an interdisciplinary educational experience. Teachers developed special classroom activities featuring the Olympic Games. Students registered as competitors from several countries. (JN)

  2. Interdisciplinary Science Research and Education

    Science.gov (United States)

    MacKinnon, P. J.; Hine, D.; Barnard, R. T.

    2013-01-01

    Science history shows us that interdisciplinarity is a spontaneous process that is intrinsic to, and engendered by, research activity. It is an activity that is done rather than an object to be designed and constructed. We examine three vignettes from the history of science that display the interdisciplinary process at work and consider the…

  3. Epistemological Pluralism: Reorganizing Interdisciplinary Research

    Directory of Open Access Journals (Sweden)

    F. Stuart Chapin III

    2008-12-01

    Full Text Available Despite progress in interdisciplinary research, difficulties remain. In this paper, we argue that scholars, educators, and practitioners need to critically rethink the ways in which interdisciplinary research and training are conducted. We present epistemological pluralism as an approach for conducting innovative, collaborative research and study. Epistemological pluralism recognizes that, in any given research context, there may be several valuable ways of knowing, and that accommodating this plurality can lead to more successful integrated study. This approach is particularly useful in the study and management of social–ecological systems. Through resilience theory's adaptive cycle, we demonstrate how a focus on epistemological pluralism can facilitate the reorganization of interdisciplinary research and avoid the build-up of significant, but insufficiently integrative, disciplinary-dominated research. Finally, using two case studies—urban ecology and social–ecological research in Alaska—we highlight how interdisciplinary work is impeded when divergent epistemologies are not recognized and valued, and that by incorporating a pluralistic framework, these issues can be better explored, resulting in more integrated understanding.

  4. Use of dipole sum rules to estimate upper and lower bounds for radiative and total widths of chi (3414), chi (3508), and chi (3552)

    International Nuclear Information System (INIS)

    Upper and lower bounds on the widths for chi/sub J/→γpsi (3095) can be estimated by assuming E1 transitions and approximate Russell-Saunders coupling for the cc-bar system. Experimental widths for psi (3684) →γchi/sub J/ the lower bound more restrictive, giving radiative widths of 160→240, 230→400, and 280→480 keV for 3414-, 3508-, and 3552-MeV states, respectively. Cascade branching ratio data permit estimation of the total widths as >1.6, 0.3-1.5, and 0.6-4 MeV, respectively

  5. Tai chi: physiological characteristics and beneficial effects on health

    OpenAIRE

    Li, J.; Hong, Y.; Chan, K.

    2001-01-01

    Objectives—To assess the characteristic effects of Tai Chi Chuan (TCC) exercise on metabolism and cardiorespiratory response, and to measure its effect on cardiorespiratory function, mental control, immune capacity, and the prevention of falls in elderly people.

  6. Dicty_cDB: CHI228 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHI228 (Link to dictyBase) - - - Contig-U16517-1 - (Link to Original site) ... *edmqvqv* ekviy*elkiffhlqevllnvvykvfqifilninhyymif*ivf *rtn*kkplihtyqql nqerdhkm*lylwlvvslmkrh*pftllil*ilv ...

  7. Tai Chi Chuan Exercise for Patients with Cardiovascular Disease

    OpenAIRE

    Ching Lan; Ssu-Yuan Chen; May-Kuen Wong; Jin Shin Lai

    2013-01-01

    Exercise training is the cornerstone of rehabilitation for patients with cardiovascular disease (CVD). Although high-intensity exercise has significant cardiovascular benefits, light-to-moderate intensity aerobic exercise also offers health benefits. With lower-intensity workouts, patients may be able to exercise for longer periods of time and increase the acceptance of exercise, particularly in unfit and elderly patients. Tai Chi Chuan (Tai Chi) is a traditional Chinese mind-body exercise. T...

  8. Tai Chi Quan and Stroke Prevention and Rehabilitation

    OpenAIRE

    Yoshinaga, Shuri; Cai, Dingfang

    2013-01-01

    Stroke is a major cause of mortality and disability across the globe and remains the third leading cause of death in China, with the total stroke incidence increasing 6.7% annually from 1984 to 2004. The prevention of strokes is more important than their treatment. Tai Chi Quan is a slow and graceful Chinese exercise that includes a form of mindful meditation known for its health benefits. Many studies have shown that Tai Chi Quan not only improves gait, balance cap...

  9. Dicty_cDB: CHI718 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHI718 (Link to dictyBase) - G20569 DDB0188420 Contig-U11787-1 CHI718P (Lin ... 4 (Q9QZ71) RecName: Full=Xenotropic and polytropic retrovirus ... rece... 82 2e-14 (Q9R031) RecName: Full=Xenotropic ... and polytropic retrovirus ... rece... 82 2e-14 AF131096_1( AF131096 |pid:none) M ...

  10. 42 CFR 460.102 - Interdisciplinary team.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 4 2010-10-01 2010-10-01 false Interdisciplinary team. 460.102 Section 460.102... ELDERLY (PACE) PACE Services § 460.102 Interdisciplinary team. (a) Basic requirement. A PACE organization must meet the following requirements: (1) Establish an interdisciplinary team at each Pace center...

  11. Disciplinary Foundations for Solving Interdisciplinary Scientific Problems

    Science.gov (United States)

    Zhang, Dongmei; Shen, Ji

    2015-10-01

    Problem-solving has been one of the major strands in science education research. But much of the problem-solving research has been conducted on discipline-based contexts; little research has been done on how students, especially individuals, solve interdisciplinary problems. To understand how individuals reason about interdisciplinary problems, we conducted an interview study with 16 graduate students coming from a variety of disciplinary backgrounds. During the interviews, we asked participants to solve two interdisciplinary science problems on the topic of osmosis. We investigated participants' problem reasoning processes and probed in their attitudes toward general interdisciplinary approach and specific interdisciplinary problems. Through a careful inductive content analysis of their responses, we studied how disciplinary, cognitive, and affective factors influenced their interdisciplinary problems-solving. We found that participants' prior discipline-based science learning experiences had both positive and negative influences on their interdisciplinary problem-solving. These influences were embodied in their conceptualization of the interdisciplinary problems, the strategies they used to integrate different disciplinary knowledge, and the attitudes they had toward interdisciplinary approach in general and specific interdisciplinary problems. This study sheds light on interdisciplinary science education by revealing the complex relationship between disciplinary learning and interdisciplinary problem-solving.

  12. CHI '13 Extended Abstracts on Human Factors in Computing Systems

    DEFF Research Database (Denmark)

    The CHI Papers and Notes program is continuing to grow along with many of our sister conferences. We are pleased that CHI is still the leading venue for research in human-computer interaction. CHI 2013 continued the use of subcommittees to manage the review process. Authors selected the subcommit......The CHI Papers and Notes program is continuing to grow along with many of our sister conferences. We are pleased that CHI is still the leading venue for research in human-computer interaction. CHI 2013 continued the use of subcommittees to manage the review process. Authors selected the...... tremendous amount of work from all areas of the human-computer interaction community. As co-chairs of the process, we are amazed at the ability of the community to organize itself to accomplish this task. We would like to thank the 2680 individual reviewers for their careful consideration of these papers. We...... that you enjoy these papers and notes, which represent the best research in human-computer interaction....

  13. Nobel Lecture. Aquaporin water channels.

    Science.gov (United States)

    Agre, Peter

    2004-06-01

    Thank you very much. I am humbled, I am delighted; I am honored. This is every scientist's dream: to give the Nobel Lecture in Stockholm. But I would not be honest if I did not tell you that I am having a little anxiety being on this platform. I have lectured a number of times in Sweden, and I thought I would share with you some events preceding a special lecture that I gave here a few years ago. Arriving at Arlanda Airport, I waited in line at the Pass Control behind a group of businessmen in suits with briefcases. I heard the first in line asked by the control officer to state the purpose of his visit to Sweden. When the man replied "business," the officer approved and stamped his passport. One at a time, each stepped forward and was asked the same thing; each answered "business" and was approved. Eventually it was my turn, and I was dressed in rumpled clothes after spending the night in the Economy Minus section of an SAS jetliner. The officer asked me the purpose of my visit, and I said "I am here to give the von Euler Lecture at Karolinska Institute." The officer immediately looked up, stared at me, and asked, "Are you nervous?" At that point I became intensely nervous and said "Yes, I am a little nervous." The officer looked up again and stated "Well, you should be!" So if the lecturers look a little nervous, the problem is at Arlanda. PMID:16209125

  14. Practical strategies for effective lectures.

    Science.gov (United States)

    Lenz, Peter H; McCallister, Jennifer W; Luks, Andrew M; Le, Tao T; Fessler, Henry E

    2015-04-01

    Lecturing is an essential teaching skill for scientists and health care professionals in pulmonary, critical care, and sleep medicine. However, few medical or scientific educators have received training in contemporary techniques or technology for large audience presentation. Interactive lecturing outperforms traditional, passive-style lecturing in educational outcomes, and is being increasingly incorporated into large group presentations. Evidence-based techniques range from the very simple, such as inserting pauses for audience discussion, to more technologically advanced approaches such as electronic audience response systems. Alternative software platforms such as Prezi can overcome some of the visual limits that the ubiquitous PowerPoint imposes on complex scientific narratives, and newer technology formats can help foster the interactive learning environment. Regardless of the technology, adherence to good principles of instructional design, multimedia learning, visualization of quantitative data, and informational public speaking can improve any lecture. The storyline must be clear, logical, and simplified compared with how it might be prepared for scientific publication. Succinct outline and summary slides can provide a roadmap for the audience. Changes of pace, and summaries or other cognitive breaks inserted every 15-20 minutes can renew attention. Graphics that emphasize clear, digestible data graphs or images over tables, and simple, focused tables over text slides, are more readily absorbed. Text slides should minimize words, using simple fonts in colors that contrast to a plain background. Adherence to these well-established principles and addition of some new approaches and technologies will yield an engaging lecture worth attending. PMID:25746051

  15. The colour scenario: an interdisciplinary analysis for a interdisciplinary topic

    OpenAIRE

    Vezzani, Valentina; Bisson, Mario

    2010-01-01

    The topic of this research is about the exploration of the actual colour scenario, from an Italian perspective analysis to an international one, with the aim to understand the characteristics and the needs of a complex system of disciplines and relationships that depends on the interdisciplinary character of the matter. The understanding of the colour scenario, then representing it, is the first step to understand and promote a common colour knowledge, comprehensible and useful for all those ...

  16. Effects of the hanging wall and footwall on peak acceleration during the Jiji (Chi-Chi), Taiwan Province, earthquake

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    The M=7.6 Jiji (Chi-Chi) earthquake, Taiwan Province, on September 21, 1999 (local time) is a thrust fault style earthquake. The empirical attenuation relations of the horizontal and vertical peak ground accelerations (PGA) for the Jiji (Chi-Chi) earthquake are developed by regression method. By examining the residuals from the Jiji (Chi-Chi) earthquake-specific peak acceleration attenuation relations, it is found that there are systematic differences between PGA on the hanging-wall and footwall. The recorded peak accelerations are higher on the hanging-wall and lower on the footwall. The clear asymmetry of PGA distribution to the surface rupture trace can also be seen from the PGA contour map. These evidences indicate that the PGA attenuates faster on the hanging-wall than on the footwall. In the study of near-source strong motion, seismic hazard assessment, scenario earthquake and seis-mic disaster prediction, the style-of-faulting must be considered in order that the attenuation model can reflect the characteristic of ground motion in various seismic environmental regions.

  17. An interdisciplinary approach to teaching in a multi-disciplinary context - A model for teaching geociences?

    Science.gov (United States)

    Salmun, H.

    2015-12-01

    As a major component of an NSF-funded STEM program, a seminar-style course called the Catalyst Seminar was developed and offered over three consecutive semesters. The program included undergraduate students in the geosciences, computer science, mathematics and physics. The Catalyst Seminar was designed to expose scholars to the interdisciplinary research options and careers in these disciplines. The Seminar also provided a venue for scholars to meet regularly, build a sense of community and to engage in research projects that would enhance their preparation for multi and interdisciplinary careers in the sciences. The first semester of the Seminar was devoted to Exposure and Connections, accomplished through lectures by invited speakers on topics related to the disciplines participating in the Program. Scholars were required to read journal articles related to the lectures and to write a final short paper reflecting on the experience, all activities that are known to students at this level. Overall, this was a somewhat passive learning approach to research in classrooms. In the following two semesters a more active approach to engage students in interdisciplinary research was used. Students were asked to take ownership of their learning process through disciplinary and interdisciplinary engagement in a project. In one semester this process was guided by the seminar coordinator who was in charge of selecting and leading the 'research project' which although challenging to scholars, was 'safe' enough that answers were readily available. In the other semester the approach was student-centered, with a coordinator that merely facilitated the formation of interdisciplinary research teams that took complete charge of the entire research enterprise. I will discuss our observations and assessment of the outcomes of this instructional experience with relation to the teaching of geoscience, in particular to attracting students into this field.

  18. Lectures on Conformal Field Theory

    CERN Document Server

    Qualls, Joshua D

    2015-01-01

    These lectures notes are based on courses given at National Taiwan University, National Chiao-Tung University, and National Tsing Hua University in the spring term of 2015. Although the course was offered primarily for graduate students, these lecture notes have been prepared for a more general audience. They are intended as an introduction to conformal field theories in various dimensions, with applications related to topics of particular interest: topics include the conformal bootstrap program, boundary conformal field theory, and applications related to the AdS/CFT correspondence. We assume the reader to be familiar with quantum mechanics at the graduate level and to have some basic knowledge of quantum field theory. Familiarity with string theory is not a prerequisite for this lectures, although it can only help.

  19. Physiological responses to Tai Chi in stable patients with COPD.

    Science.gov (United States)

    Qiu, Zhi-Hui; Guo, Hong-Xi; Lu, Gan; Zhang, Ning; He, Bai-Ting; Zhou, Lian; Luo, Y M; Polkey, M I

    2016-01-15

    We compared the physiological work, judged by oxygen uptake, esophageal pressure swing and diaphragm electromyography, elicited by Tai Chi compared with that elicited by constant rate treadmill walking at 60% of maximal load in eleven patients with COPD (Mean FEV1 61% predicted, FEV1/FVC 47%). Dynamic hyperinflation was assessed by inspiratory capacity and twitch quadriceps tension (TwQ) elicited by supramaximal magnetic stimulation of the femoral nerve was also measured before and after both exercises. The EMGdi and esophageal pressure at the end of exercise were similar for both treadmill exercise and Tai Chi (0.109±0.047 mV vs 0.118±0.061 mV for EMGdi and 22.3±7.1 cmH2O vs 21.9±8.1 cmH2O for esophageal pressure). Moreover the mean values of oxygen uptake during Tai Chi and treadmill exercise did not differ significantly: 11.3 ml/kg/min (51.1% of maximal oxygen uptake derived from incremental exercise) and 13.4 ml/kg/min (52.5%) respectively, p>0.05. Respiratory rate during Tai Chi was significantly lower than that during treadmill exercise. Both Tai Chi and treadmill exercise elicited a fall in IC at end exercise, indicating dynamic hyperinflation, but this was statistically significant only after treadmill exercise. TwQ decreased significantly after Tai Chi but not after treadmill. We conclude that Tai Chi constitutes a physiologically similar stimulus to treadmill exercise and may therefore be an acceptable modality for pulmonary rehabilitation which may be culturally more acceptable in some parts of the world. PMID:26549554

  20. Theology and psychology – the interdisciplinary work of Fraser Watts

    Directory of Open Access Journals (Sweden)

    Willem J. Smith

    2005-10-01

    Full Text Available In the preface to his book, Theology and Psychology, Fraser Watts, a lecturer in Theology and Natural Science at the University of Cambridge, states that he approaches “… the interface between theology and psychology by looking at each discipline from the perspective of the other. This includes a religious perspective on several current hot topics in psychology, such as evolution, neuroscience, and computer intelligence. I also consider theological topics like divine action, salvation history and eschatology, in each case using the psychological perspective in a different way”. By taking an interdisciplinary approach, Watts aims at proposing a psychology of religious experience. He considers theology to be the rational reflection on the Christian tradition. When exponents of this tradition are in dialogue with exponents of psychology, the focus falls on human nature. Watts admits that a certain lack of competence in one of the two disciplines can be a problem when working in an interdisciplinary way. However, he is willing to take the risk. Watts worked in psychology for 25 years and was also involved with a medical research council, before taking up a position at the Faculty of Divinity, University of Cambridge.

  1. Active Learning Techniques Applied to an Interdisciplinary Mineral Resources Course.

    Science.gov (United States)

    Aird, H. M.

    2015-12-01

    An interdisciplinary active learning course was introduced at the University of Puget Sound entitled 'Mineral Resources and the Environment'. Various formative assessment and active learning techniques that have been effective in other courses were adapted and implemented to improve student learning, increase retention and broaden knowledge and understanding of course material. This was an elective course targeted towards upper-level undergraduate geology and environmental majors. The course provided an introduction to the mineral resources industry, discussing geological, environmental, societal and economic aspects, legislation and the processes involved in exploration, extraction, processing, reclamation/remediation and recycling of products. Lectures and associated weekly labs were linked in subject matter; relevant readings from the recent scientific literature were assigned and discussed in the second lecture of the week. Peer-based learning was facilitated through weekly reading assignments with peer-led discussions and through group research projects, in addition to in-class exercises such as debates. Writing and research skills were developed through student groups designing, carrying out and reporting on their own semester-long research projects around the lasting effects of the historical Ruston Smelter on the biology and water systems of Tacoma. The writing of their mini grant proposals and final project reports was carried out in stages to allow for feedback before the deadline. Speakers from industry were invited to share their specialist knowledge as guest lecturers, and students were encouraged to interact with them, with a view to employment opportunities. Formative assessment techniques included jigsaw exercises, gallery walks, placemat surveys, think pair share and take-home point summaries. Summative assessment included discussion leadership, exams, homeworks, group projects, in-class exercises, field trips, and pre-discussion reading exercises

  2. Eight lectures on theoretical physics

    CERN Document Server

    Planck, Max

    1997-01-01

    In 1909 the great German physicist and Nobel Prize winner Max Planck (1858-1947) delivered a series of eight lectures at Columbia University giving a fascinating overview of the new state of physics, which he had played a crucial role in bringing about. The first, third, fifth, and sixth lectures present his account of the revolutionary developments occasioned when he first applied the quantum hypothesis to blackbody radiation. The reader is given an invaluable opportunity to witness Planck's thought processes both on the level of philosophical principles as well as their application to physi

  3. Removing Barriers to Interdisciplinary Research

    CERN Document Server

    Jacobs, Naomi

    2010-01-01

    A significant amount of high-impact contemporary scientific research occurs where biology, computer science, engineering and chemistry converge. Although programmes have been put in place to support such work, the complex dynamics of interdisciplinarity are still poorly understood. In this paper we interrogate the nature of interdisciplinary research and how we might measure its "success", identify potential barriers to its implementation, and suggest possible mechanisms for removing these impediments.

  4. Interdisciplinary approach in translation didactics

    OpenAIRE

    Lee Jahnke, Hannelore

    2011-01-01

    The question why interdisciplinary research and approach in translation didactics has become essential and of interest to translation studies will be outlined prior to highlighting three to our thinking major disciplines of interest. Those are: 1. cognitive and affective sciences with a specific interest of evaluation methods and the implicit and explicit knowledge; 2. cognitive sciences and neurosciences leading to a more proficient structuring of a course; 3. research in comp...

  5. Corporate Knowledge Management: Interdisciplinary Approach

    OpenAIRE

    Andrei Kapterev

    2012-01-01

    Governing the professional and intellectual potential – interdisciplinary field of scientific research and a systematic process of creating, using and developing the innovation technologies of transforming the individual knowledge and specialists’ experience in such a way that would apply the knowledge and experience to the processes, services and products offered by an organization to reach its strategic goals. From the technological standpoint, governing the professional and intellectual po...

  6. Structural Narratology and Interdisciplinary Studies

    Directory of Open Access Journals (Sweden)

    A. Mohammadi Kalesar

    2016-02-01

    Full Text Available The aim of this paper is to investigate the relationship between structural narratology and interdisciplinary studies. We will try to answer two main questions: What factors have been effective in narratology’s orientation toward interdisciplinary studies? Is this tendency the result of a possibility in narration or a methodological necessity? The movement of narratology to interdisciplinary is observable not only in new narratological tendencies but also in changes in structural theories. Therefore, this article will trace the roots of this tendency in the revises and critiques of these theories until 1970s. By tracing these changes it can be realized that the theories of structural narrotology have broken with idea of independence and self-sufficiency of literature and embraced other disciplines. The main factors in these changes are: attention to cultural elements and reading process in the perception of narrative structure. These considerations have been accompanied by some results; first, the main targets of narratology changed from investigating textual properties to reading and understanding the narration process; second, some disciplines and fields related to culture and mind studies found their way into narratology.

  7. Structural Narratology and Interdisciplinary Studies

    Directory of Open Access Journals (Sweden)

    A. Mohammadi Kalesar

    2016-01-01

    Full Text Available The aim of this paper is to investigate the relationship between structural narratology and interdisciplinary studies. We will try to answer two main questions: What factors have been effective in narratology’s orientation toward interdisciplinary studies? Is this tendency the result of a possibility in narration or a methodological necessity? The movement of narratology to interdisciplinary is observable not only in new narratological tendencies but also in changes in structural theories. Therefore, this article will trace the roots of this tendency in the revises and critiques of these theories until 1970s. By tracing these changes it can be realized that the theories of structural narrotology have broken with idea of independence and self-sufficiency of literature and embraced other disciplines. The main factors in these changes are: attention to cultural elements and reading process in the perception of narrative structure. These considerations have been accompanied by some results; first, the main targets of narratology changed from investigating textual properties to reading and understanding the narration process; second, some disciplines and fields related to culture and mind studies found their way into narratology.

  8. Public Lecture: The Odyssey of Voyager

    CERN Document Server

    CERN. Geneva

    2015-01-01

    Should you wish to attend to this lecture only (and not the full colloquium), please register here: https://indico.cern.ch/event/387001/registration/ Participants to the full colloquium are automatically registered to the public lectures.

  9. A comparative assessment of nursing students' cognitive knowledge of blood transfusion using lecture and simulation.

    Science.gov (United States)

    Flood, Lisa S; Higbie, Julie

    2016-01-01

    Professional nurses must have the knowledge and skills to safely administer blood products and monitor for life-threatening complications. Nurse educators should ensure that student nurses also learn how to safely administer blood products; however students rarely have the opportunity to witness and manage adverse transfusion reactions. Despite the low incidence of rare adverse transfusion reactions, nursing students must be able to immediately recognize transfusion reactions, implement appropriate interventions, and communicate effectively with health care providers. To reinforce blood transfusion knowledge, practice technical skills, and promote management of adverse reactions, a human patient simulation experience was created for baccalaureate nursing students to provide application of related classroom content. Using a quasi-experimental design, students who received a related didactic lecture preceding the simulation were compared with students who did not receive the lecture. The lecture group's pre/posttest mean scores (n = 42) were significantly higher than the no lecture group's mean scores (n = 44). This simulation design included proper blood administration procedures, patient monitoring, management of transfusion reactions, and practice with interdisciplinary communication. Participation in a human patient simulation following a related didactic lecture may be useful to strengthen cognitive learning and help bridge the didactic-clinic gap. PMID:26073762

  10. Lectures on the inverse scattering method

    International Nuclear Information System (INIS)

    In a series of six lectures an elementary introduction to the theory of inverse scattering is given. The first four lectures contain a detailed theory of solitons in the framework of the KdV equation, together with the inverse scattering theory of the one-dimensional Schroedinger equation. In the fifth lecture the dressing method is described, while the sixth lecture gives a brief review of the equations soluble by the inverse scattering method. (author)

  11. Consumer Acceptance of Functional Foods in Ho Chi Minh City

    Directory of Open Access Journals (Sweden)

    Duy Tung BUI

    2015-11-01

    Full Text Available The aim of this paper is to identify and evaluate the underlying factors affecting consumer acceptance of functional foods. The contribution of this study is to better understand customer willingness to buy such products in Ho Chi Minh City by shedding light on how socio-demographic, cognitive and attitudinal determinants affect consumer's choices of foods. We conducted a survey using 217 respondents from Ho Chi Minh City. Next, we develop a binary-probit model to quantify the impact of each factor on consumer acceptance. The results show that having a sick relative, beliefs in health benefits positively affect acceptance level. Other than that, old people in Ho Chi Minh City tend to reject the use of functional foods. However, when they are provided with enough knowledge, they are the most intensive buyers of these products. Implications and further researches are also discussed.

  12. Koshiba, Tanaka give Nobel lectures

    CERN Multimedia

    2002-01-01

    Masatoshi Kosiba and Koichi Tanaka presented lectures in English on Sunday, touching on topics ranging from particle physics, to teamwork to commemorate their reception of this year's Nobel Prize for Physics and Chemistry. The two will receive their respective prizes in an awards ceremony scheduled for Tuesday (1 page).

  13. Applied Fluid Mechanics. Lecture Notes.

    Science.gov (United States)

    Gregg, Newton D.

    This set of lecture notes is used as a supplemental text for the teaching of fluid dynamics, as one component of a thermodynamics course for engineering technologists. The major text for the course covered basic fluids concepts such as pressure, mass flow, and specific weight. The objective of this document was to present additional fluids…

  14. Lecture notes on ideal magnetohydrodynamics

    International Nuclear Information System (INIS)

    Notes, prepared for a course of lectures held at the Instituto de Fisica, Universidade Estadual de Campinas, Brazil (June-August 1978). An extensive theoretical treatment of the behaviour of hot plasmas caught in equations and mathematical models is presented in 12 chapters

  15. Lecture notes on plasma physics

    International Nuclear Information System (INIS)

    The lectures cover the following topics in plasma physics: electrostatic plasma oscillations as described by the linearized Vlasov equation; properties of dielectric functions; the fluctuation dissipation theorem; 'dressed-particle' approach to plasma fluctuations; electron waves in a strongly magnetized plasma; propagation of ion acoustic density perturbations as described by the linearized ion Vlasov equation assuming Boltzmann distributed electrons; nonlinear waves. (Auth.)

  16. Metallurgy department publications and lectures 1987

    International Nuclear Information System (INIS)

    A presentation (including abstract) of scientific and technical publications and lectures by the staff of the Metallurgy Department during 1987 is given. The list comprises journal papers, conference papers, reports, lectures and poster presentations in the following categories: Publications, Lectures and Poster Presentations. (author)

  17. Text of simulation science open lecture 2003

    International Nuclear Information System (INIS)

    Simulation Science Open Lecture 2003 was held October 14-16, 2003 at Theory and Computer Simulation Research Center, National Institute for Fusion Science (NIFS). Unix and Fortran were introduced at the Lecture. The MHD simulation, plasma particle simulation, and visualization for numerical data were lectured, and CompleXcope (virtual reality system) tour was included. Twenty participants attended. (author)

  18. Three lectures on particle physics and cosmology

    International Nuclear Information System (INIS)

    The particle physics-cosmology connection is reviewed. In the first lecture the standard big bang model, including inflation and baryosynthesis, is outlined. In the second lecture dark matter and some prospects for its detection are discussed. The third lecture explores the role of flat directions in cosmology. 112 refs., 11 figs., 6 tabs. (author)

  19. A CHI wiggler ubitron amplifier experiment: Wiggler characterization

    Energy Technology Data Exchange (ETDEWEB)

    Taccetti, J.M.; Jackson, R.H.; Freund, H.P. [Naval Research Lab., Washington, DC (United States)] [and others

    1995-12-31

    A 35 GHz CHI (Coaxial Hybrid Iron) wiggler ubitron amplifier experiment is under construction at the Naval Research Laboratory. The CHI wiggler configuration has the potential of generating high wiggler magnetic fields at short periods with excellent beam focusing and transport properties. This makes it a desirable configuration for the generation of high power coherent radiation in relatively compact systems. The CHI wiggler consists of alternating rings of magnetic and non-magnetic materials concentric with a central rod of similar alternating design but shifted along the axis by half a period. Once inserted in a solenoidal magnetic field, the CHI structure deforms the axial field to create a radial field oscillating with the same periodicity as the rings. An annular electron beam is propagated through the coaxial gap where the oscillating radial field imparts an azimuthal wiggle motion. The principal goals of the experiment are to investigate the performance tradeoffs involved in the CHI configuration for high frequency amplifiers operating at low voltages with small wiggler periods. The nominal design parameters are a center frequency of 35 GHz, wiggler period of 0.75 cm, and beam voltage of approximately 150 kV. Calculations have shown an intrinsic (untapered) efficiency of {approximately} 7% when operating at 6.3 kG axial field (wiggler field, B{sub w}{approximately}1270 G). The calculated gain was 36 dB, saturating at a distance of 46 cm. These parameters yield an instantaneous amplifier bandwidth of {approximately} 25%. There appears to be room for further improvement in efficiency, a matter which will be scrutinized more closely in the final design. A prototype CHI wiggler is presently being fabricated for use in conjunction with an existing 30 kG superconducting solenoid. The performance properties of the prototype will be characterized and compared with linear and non-linear calculations.

  20. Observation of B0 -> chi_c0 K*0 and Evidence of B+ -> chi_c0 K*+

    Energy Technology Data Exchange (ETDEWEB)

    Aubert, : B.

    2008-08-13

    The authors present the observation of the decay B{sup 0} {yields} {chi}{sub c0}K*{sup 0} as well as evidence of B{sup +} {yields} {chi}{sub c0}K*{sup +}, with an 8.9 and a 3.6 standard deviation significance, respectively, using a data sample of 454 million {Upsilon}(4S) {yields} B{bar B} decays collected with the BABAR detector at the PEP-II B meson factory located at the Standard Linear Accelerator Center (SLAC). The measured branching fractions are: {Beta}(B{sup 0} {yields} {chi}{sub c0}K*{sup 0}) = (1.7 {+-} 0.3 {+-} 0.2) x 10{sup -4} and {Beta}(B{sup +} {yields} {chi}{sub c0}K*{sup +}) = (1.4 {+-} 0.5 {+-} 0.2) x 10{sup -4}, where the first quoted errors are statistical and the second are systematic. They obtain a branching fraction upper limit of {Beta}(B{sup +} {yields} {chi}{sub c0}K*{sup +}) < 2.1 x 10{sup -4} at the 90% confidence level.

  1. Students Prefer Audience Response System for Lecture Evaluation

    Directory of Open Access Journals (Sweden)

    Joseph W Turban

    2011-12-01

    Full Text Available Objectives: Student evaluation of courses is an important component of overall course evaluation. The extent of student participation in the evaluation may be related to the ease of the evaluation process. The standard evaluation format is a paper form. This study examines medical students preference of utilizing Audience Response System compared to a paper method. Methods: Following several medical school lectures, students were queried if they preferred Audience Response System versus a paper method, and if they would prefer using Audience Response System more for future course evaluations. Results: 391 students were queried. Overall response rate was 94%. Using a five point Likert scale, 299 out of 361 (82% responded they agreed, or strongly agreed with the statement “We should use ARS more. . .” When asked which format they preferred to use for evaluation, 299/367 (81% responded Audience Response System, 31 (8% preferred paper, and 37 (10% were not sure, or had no opinion (chi squared = 378.936, df2, p<0.0001. Conclusion: The medical students surveyed showed a strong preference for utilizing Audience Response System as a course evaluation modality, and desired its continued use in medical school. Audience Response System should be pursued as a lecture evaluation modality, and its use in medical school education should be encouraged.

  2. Chi-squared goodness of fit tests with applications

    CERN Document Server

    Balakrishnan, N; Nikulin, MS

    2013-01-01

    Chi-Squared Goodness of Fit Tests with Applications provides a thorough and complete context for the theoretical basis and implementation of Pearson's monumental contribution and its wide applicability for chi-squared goodness of fit tests. The book is ideal for researchers and scientists conducting statistical analysis in processing of experimental data as well as to students and practitioners with a good mathematical background who use statistical methods. The historical context, especially Chapter 7, provides great insight into importance of this subject with an authoritative author team

  3. Dicty_cDB: CHI642 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHI642 (Link to dictyBase) - - - Contig-U14351-1 CHI642E (Link to Original ... 37 (Q4G069) RecName: Full=Regulator of microtubule dynamics ... protein... 154 3e-36 AF151848_1( AF151848 |pid:non ... 36 (Q96DB5) RecName: Full=Regulator of microtubule dynamics ... protein... 153 5e-36 (Q5R8E4) RecName: Full=Regula ...

  4. The Shape of the Noncentral Chi-square Density

    CERN Document Server

    Yu, Yaming

    2011-01-01

    A noncentral chi-square density is log-concave if the degree of freedom is nu>=2. We complement this known result by showing that, for each 00 such that the chi-square with nu degrees of freedom and noncentrality parameter lambda has a decreasing density if lambda <= lambda_nu, and is bi-modal otherwise. The critical lambda_nu is characterized by an equation involving a ratio of modified Bessel functions. When an interior mode exists we derive precise bounds on its location.

  5. Chi-squared and Associations in Tabular Audiology Data

    OpenAIRE

    Muhammad N. Anwar; Michael P. Oakes; Ken McGarry

    2010-01-01

    In this paper, we have used the chi-squared test and Yule’s Q measure to discover associations in tables of patient audiology data. These records are examples of heterogeneous medical records, since they contain audiograms, textual notes and typical relational fields. In our first experiment we used the chi-squared measure to discover associations between the different fields of audiology data such as patient gender and patient age with diagnosis. Then, in our second experiment we used Yule’s...

  6. Dicty_cDB: CHI478 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHI478 (Link to dictyBase) - G01678 DDB0185605 Contig-U11784-1 CHI478P (Lin ... lis melanin b... 82 4e-14 ( P07524 ) RecName: Full=Tyrosinase ; EC=1.14.18.1; AltNam... 81 9e-14 AP009493_2447( A ... us subsp. gri... 80 2e-13 ( P06845 ) RecName: Full=Tyrosinase ; EC=1.14.18.1; AltNam... 79 4e-13 A24089( A24089 ) ...

  7. Going Beyond the Lecture Class - Is it Worth it?

    Science.gov (United States)

    Funaro, G. M.; Paytan, A.; Arrigo, K. R.; Chandran, R.; Schindell, J.

    2001-12-01

    Lectures, labs, and seminars dominate the course offerings at most American universities. Students have been learning successfully from these teaching methods for hundreds of years. Alternatively, in order to provide a more personally meaningful learning experience, educational researchers espouse a constructivist approach to learning. To demonstrate this approach, we will describe a case study of two courses, marine chemistry and biological oceanography, that were taught as a single interdisciplinary experience by Stanford University faculty. The courses incorporated an innovative curriculum using active learning methodologies including problem-based learning and teamwork, a set of interactive and facilitative teaching practices, customized technology that worked in the background to make the course effective and efficient, and a goal to reveal the interdisciplinary nature of the content in the two courses. Videotapes of group problem solving revealed that students displayed higher order thinking skills. Students indicated in focus groups that teamwork provided a motivating, rich, learning environment. The communication technology supported both the faculty in the delivery and assessment of the course and the students in communicating with their teams. The technology was the glue that made the course work effectively and efficiently. The overall learning experience can be best expressed by the students themselves who said they felt like they were participating in "real science" for the first time.

  8. Ten principles of good interdisciplinary team work

    OpenAIRE

    Nancarrow, S.A.; Booth, A; Ariss, S.; Smith, T; Enderby, P; Roots, A.

    2013-01-01

    Background Interdisciplinary team work is increasingly prevalent, supported by policies and practices that bring care closer to the patient and challenge traditional professional boundaries. To date, there has been a great deal of emphasis on the processes of team work, and in some cases, outcomes. Method This study draws on two sources of knowledge to identify the attributes of a good interdisciplinary team; a published systematic review of the literature on interdisciplinary team ...

  9. Interdisciplinary in the Information Field

    DEFF Research Database (Denmark)

    Madsen, Dorte

    2012-01-01

    be seen as embedded in disciplines, with their theories, concepts, approaches and assumptions. It is argued that a theoretically based distinction between multi-, inter- and transdisciplinarity is important as a foundation for a discussion of a conceptual framework for the Information Field. It is shown...... how interdisciplinary theory may inform the development of a shared conceptual framework for the Information Field. A continuum of integration from multi- to inter- to transdisciplinarity is useful for a distinction of different degrees of synthesis, as common conceptual frameworks tend...... to be associated with transdisciplinarity, which represents the greatest synthesis of approach....

  10. Measurement of hadronic production of the chi /sub 1//sup ++/(3507) and the chi /sub 2//sup ++/(3553) through their radiative decay to J/ psi

    CERN Document Server

    Lemoigne, Y; Barate, R; Bareyre, P; Bonamy, P; Borgeaud, P; Brabson, B B; Crittenden, R R; David, M; Duane, A; Gentit, F X; Heinz, R M; King, G J; Krider, J; Laurens, G; Marshall, T; McEwen, J G; Namjoshi, R; Nandi, B C; Pietrzyk, B; Villet, G; Websdale, D M; Wiejak, J; Zaninotti, S

    1982-01-01

    The chi /sub 1//sup ++/(3507) and the chi /sub 2//sup ++/(3553) states have been observed in the Goliath spectrometer at the CERN SPS in 185 GeV/c\\pi^{-}-Be collisions. Their radiative decays contribute 27.7% (for the chi /sub 1//sup ++/) and 12.8% (for the chi /sub 2//sup ++/) to J/ psi production. At this energy, their cross sections are 65+or-19 nb and 96+or-29 nb, respectively.

  11. Anomalous effect in Schumann resonance phenomena observed in Japan, possibly associated with the Chi-chi earthquake in Taiwan

    Directory of Open Access Journals (Sweden)

    M. Hayakawa

    2005-06-01

    Full Text Available The Schumann resonance phenomenon has been monitored at Nakatsugawa (near Nagoya in Japan since the beginning of 1999, and due to the occurance of a severe earthquake (so-called Chi-chi earthquake on 21 September 1999 in Taiwan we have examined our Schumann resonance data at Nakatsugawa during the entire year of 1999. We have found a very anomalous effect in the Schumann resonance, possibly associated with two large land earthquakes (one is the Chi-chi earthquake and another one on 2 November 1999 (Chia-yi earthquake with a magnitude again greater than 6.0. Conspicuous effects are observed for the larger Chi-chi earthquake, so that we summarize the characteristics for this event. The anomaly is characterized mainly by the unusual increase in amplitude of the fourth Schumann resonance mode and a significant frequency shift of its peak frequency (~1.0Hz from the conventional value on the By magnetic field component which is sensitive to the waves propagating in the NS meridian plane. Anomalous Schumann resonance signals appeared from about one week to a few days before the main shock. Secondly, the goniometric estimation of the arrival angle of the anomalous signal is found to coincide with the Taiwan azimuth (the unresolved dual direction indicates toward South America. Also, the pulsed signals, such as the Q-bursts, were simultaneously observed with the "carrier" frequency around the peak frequency of the fourth Schumann resonance mode. The anomaly for the second event for the Chia-yi earthquake on 2 November had much in common. But, most likely due to a small magnitude, the anomaly appears one day before and lasts until one day after the main shock, with the enhancement at the fourth Schumann resonance mode being smaller in amplitude than the case of the Chi-chi earthquake. Yet, the other characteristics, including the goniometric direction finding result, frequency shift, etc., are nearly the same. Although the emphasis of

  12. Programme Note: Realities and Opportunities in Ho Chi Minh City.

    Science.gov (United States)

    Franchet, Chi Nguyen

    1996-01-01

    The current status of street children in Ho Chi Minh City, Vietnam, is characterized by marginalization from society through street vending, begging, theft, and prostitution. Evaluation of a drop-in center serving children without family linkages indicates need for needs assessments, follow-up activities, measurement of individual child progress,…

  13. Modulational instability in the nonlocal chi(2)-model

    DEFF Research Database (Denmark)

    Wyller, John Andreas; Krolikowski, Wieslaw; Bang, Ole;

    2007-01-01

    are recovered as the asymptotic limit of one of the branches of the plane waves (i.e. the adiabatic branch or the acoustic branch) of the full chi((2))-model by means of a singular perturbational approach. It is also proven that the stability results for the adiabatic branch continuously approach...

  14. Escape angles in bulk chi((2)) soliton interactions

    DEFF Research Database (Denmark)

    Johansen, Steffen Kjær; Bang, Ole; Sørensen, Mads Peter

    2002-01-01

    We develop a theory for nonplanar interaction between two identical type I spatial solitons propagating at opposite, but arbitrary transverse angles in quadratic nonlinear (or so-called chi((2))) bulk, media. We predict quantitatively the outwards escape angle, below which the solitons turn aroun...

  15. Dicty_cDB: CHI113 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHI113 (Link to dictyBase) - - - Contig-U14338-1 - (Link to Original site) ... 37591_59( DQ437591 |pid:none) Variola virus strain Sumatra ... 1970... 33 3.0 AL844504_205( AL844504 |pid:none) P ...

  16. Dicty_cDB: CHI816 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHI816 (Link to dictyBase) - G20190 DDB0202068 Contig-U14357-1 - (Link to O ... BD080275 |BD080275.1 Transgenic plant with altered morphology ... and endo-1,4-beta-glucanase gene, promoter and pro ...

  17. Bisimulation Lattice of Asymmetric Chi Calculus with Mismatch

    Institute of Scientific and Technical Information of China (English)

    Dong Xiaoju(董笑菊); Zhong Farong; Fu Yuxi

    2003-01-01

    This paper carries out a systematic investigation into the bisimulation lattice of asymmetric chi calculus with a mismatch combinator. It is shown that all the sixty three L-bisimilarities collapse to twelve distinct relations and they form a bisimulation lattice with respect to set inclusion. The top of the lattice coincides with the barbed bisimilarity.

  18. Dicty_cDB: CHI610 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHI610 (Link to dictyBase) - - - Contig-U14350-1 - (Link to Original site) ... CFFFFFWI*kk--- Translated Amino Acid sequence (All Frames ) Frame A: nsnthlthysqkkk**ink**in*ink*nfihi*lnfls* ...

  19. Measurement of $\\chi_{c1}$ and $\\chi_{c2}$ production with $\\sqrt{s}=7$ TeV $pp$ collisions at ATLAS

    CERN Document Server

    Aad, Georges; Abbott, Brad; Abdallah, Jalal; Abdel Khalek, Samah; Abdinov, Ovsat; Aben, Rosemarie; Abi, Babak; Abolins, Maris; AbouZeid, Ossama; Abramowicz, Halina; Abreu, Henso; Abulaiti, Yiming; Acharya, Bobby Samir; Adamczyk, Leszek; Adams, David; Addy, Tetteh; Adelman, Jahred; Adomeit, Stefanie; Adye, Tim; Aefsky, Scott; Agatonovic-Jovin, Tatjana; Aguilar-Saavedra, Juan Antonio; Agustoni, Marco; Ahlen, Steven; Ahmad, Ashfaq; Ahmadov, Faig; Aielli, Giulio; Åkesson, Torsten Paul Ake; Akimoto, Ginga; Akimov, Andrei; Alam, Muhammad Aftab; Albert, Justin; Albrand, Solveig; Alconada Verzini, Maria Josefina; Aleksa, Martin; Aleksandrov, Igor; Alessandria, Franco; Alexa, Calin; Alexander, Gideon; Alexandre, Gauthier; Alexopoulos, Theodoros; Alhroob, Muhammad; Aliev, Malik; Alimonti, Gianluca; Alio, Lion; Alison, John; Allbrooke, Benedict; Allison, Lee John; Allport, Phillip; Allwood-Spiers, Sarah; Almond, John; Aloisio, Alberto; Alon, Raz; Alonso, Alejandro; Alonso, Francisco; Altheimer, Andrew David; Alvarez Gonzalez, Barbara; Alviggi, Mariagrazia; Amako, Katsuya; Amaral Coutinho, Yara; Amelung, Christoph; Ammosov, Vladimir; Amor Dos Santos, Susana Patricia; Amorim, Antonio; Amoroso, Simone; Amram, Nir; Amundsen, Glenn; Anastopoulos, Christos; Ancu, Lucian Stefan; Andari, Nansi; Andeen, Timothy; Anders, Christoph Falk; Anders, Gabriel; Anderson, Kelby; Andreazza, Attilio; Andrei, George Victor; Anduaga, Xabier; Angelidakis, Stylianos; Anger, Philipp; Angerami, Aaron; Anghinolfi, Francis; Anisenkov, Alexey; Anjos, Nuno; Annovi, Alberto; Antonaki, Ariadni; Antonelli, Mario; Antonov, Alexey; Antos, Jaroslav; Anulli, Fabio; Aoki, Masato; Aperio Bella, Ludovica; Apolle, Rudi; Arabidze, Giorgi; Aracena, Ignacio; Arai, Yasuo; Arce, Ayana; Arfaoui, Samir; Arguin, Jean-Francois; Argyropoulos, Spyridon; Arik, Engin; Arik, Metin; Armbruster, Aaron James; Arnaez, Olivier; Arnal, Vanessa; Arslan, Ozan; Artamonov, Andrei; Artoni, Giacomo; Asai, Shoji; Asbah, Nedaa; Ask, Stefan; Åsman, Barbro; Asquith, Lily; Assamagan, Ketevi; Astalos, Robert; Astbury, Alan; Atkinson, Markus; Atlay, Naim Bora; Auerbach, Benjamin; Auge, Etienne; Augsten, Kamil; Aurousseau, Mathieu; Avolio, Giuseppe; Azuelos, Georges; Azuma, Yuya; Baak, Max; Bacci, Cesare; Bach, Andre; Bachacou, Henri; Bachas, Konstantinos; Backes, Moritz; Backhaus, Malte; Backus Mayes, John; Badescu, Elisabeta; Bagiacchi, Paolo; Bagnaia, Paolo; Bai, Yu; Bailey, David; Bain, Travis; Baines, John; Baker, Oliver Keith; Baker, Sarah; Balek, Petr; Balli, Fabrice; Banas, Elzbieta; Banerjee, Swagato; Banfi, Danilo; Bangert, Andrea Michelle; Bansal, Vikas; Bansil, Hardeep Singh; Barak, Liron; Baranov, Sergei; Barber, Tom; Barberio, Elisabetta Luigia; Barberis, Dario; Barbero, Marlon; Barillari, Teresa; Barisonzi, Marcello; Barklow, Timothy; Barlow, Nick; Barnett, Bruce; Barnett, Michael; Baroncelli, Antonio; Barone, Gaetano; Barr, Alan; Barreiro, Fernando; Barreiro Guimarães da Costa, João; Bartoldus, Rainer; Barton, Adam Edward; Bartos, Pavol; Bartsch, Valeria; Bassalat, Ahmed; Basye, Austin; Bates, Richard; Batkova, Lucia; Batley, Richard; Battistin, Michele; Bauer, Florian; Bawa, Harinder Singh; Beau, Tristan; Beauchemin, Pierre-Hugues; Beccherle, Roberto; Bechtle, Philip; Beck, Hans Peter; Becker, Anne Kathrin; Becker, Sebastian; Beckingham, Matthew; Beddall, Andrew; Beddall, Ayda; Bedikian, Sourpouhi; Bednyakov, Vadim; Bee, Christopher; Beemster, Lars; Beermann, Thomas; Begel, Michael; Behr, Katharina; Belanger-Champagne, Camille; Bell, Paul; Bell, William; Bella, Gideon; Bellagamba, Lorenzo; Bellerive, Alain; Bellomo, Massimiliano; Belloni, Alberto; Beloborodova, Olga; Belotskiy, Konstantin; Beltramello, Olga; Benary, Odette; Benchekroun, Driss; Bendtz, Katarina; Benekos, Nektarios; Benhammou, Yan; Benhar Noccioli, Eleonora; Benitez Garcia, Jorge-Armando; Benjamin, Douglas; Bensinger, James; Benslama, Kamal; Bentvelsen, Stan; Berge, David; Bergeaas Kuutmann, Elin; Berger, Nicolas; Berghaus, Frank; Berglund, Elina; Beringer, Jürg; Bernard, Clare; Bernat, Pauline; Bernhard, Ralf; Bernius, Catrin; Bernlochner, Florian Urs; Berry, Tracey; Berta, Peter; Bertella, Claudia; Bertolucci, Federico; Besana, Maria Ilaria; Besjes, Geert-Jan; Bessidskaia, Olga; Besson, Nathalie; Bethke, Siegfried; Bhimji, Wahid; Bianchi, Riccardo-Maria; Bianchini, Louis; Bianco, Michele; Biebel, Otmar; Bieniek, Stephen Paul; Bierwagen, Katharina; Biesiada, Jed; Biglietti, Michela; Bilbao De Mendizabal, Javier; Bilokon, Halina; Bindi, Marcello; Binet, Sebastien; Bingul, Ahmet; Bini, Cesare; Bittner, Bernhard

    2014-01-01

    The prompt and non-prompt production cross-sections for the $\\chi_{c1}$ and $\\chi_{c2}$ charmonium states are measured in $pp$ collisions at $\\sqrt{s}=7$ TeV with the ATLAS detector at the LHC using 4.5 fb-1 of integrated luminosity. The $\\chi_{c}$ states are reconstructed through the radiative decay $\\chi_{c}\\rightarrow J/\\psi\\,\\gamma$ (with $J/\\psi\\rightarrow\\mu^{+}\\mu^{-}$) where photons are reconstructed from $\\gamma\\rightarrow e^{+}e^{-}$ conversions. The production rate of the $\\chi_{c2}$ state relative to the $\\chi_{c1}$ state is measured for prompt and non-prompt $\\chi_{c}$ as a function of $J/\\psi$ transverse momentum. The prompt $\\chi_{c}$ cross-sections are combined with existing measurements of prompt $J/\\psi$ production to derive the fraction of prompt $J/\\psi$ produced in feed-down from $\\chi_{c}$ decays. The fractions of $\\chi_{c1}$ and $\\chi_{c2}$ produced in $b$-hadron decays are also measured. In addition to measurements of inclusive $\\chi_{c}$ production, the branching fraction ${\\cal B}(B^...

  20. A Theoretical and Empirical Analysis of Challenges and motivations of Interdisciplinary Studies Implying on Interdisciplinary Methodology

    Directory of Open Access Journals (Sweden)

    M. Fatehrad

    2012-01-01

    Full Text Available Purpose, although literature has focused on explaining theoretical background in the area of interdisciplinary studies, a few empirical studies has paid attention to the main reasons of performing interdisciplinary projects. To fill the research gap, current study tries to identify challenges and motivations of interdisciplinary studies for researchers to participate in interdisciplinary projects. The main purposes of the research are: 1 identifying the challenges and motivations of interdisciplinary studies implying on interdisciplinary methodology, 2 determining the degree of importance of the above elements regarding interdisciplinary studies. Methodology, current study is an exploratory in terms of methodology, descriptive in terms of research design, and development in terms of purpose. This study employing an interdisciplinary team firstly investigated theoretical background and prior research on interdisciplinary studies, identified challenges and motivations of the studies. Secondly, a structured interview performed with five interdisciplinary researchers. To investigate the identified elements empirically, a self-administrated questionnaire was used based on the literature and interviews. The questionnaire was distributed among 64 researchers from different disciplines who had experienced interdisciplinary activities. Data was analyzed by confirmatory factor analysis, composite reliability, one-sample t-test, Friedman test and analysis of variance (ANOVA using LISREL and SPSS. Results indicated that recognized motivations except for public learning and satisfying psychological needs, and identified challenges have considerable effect on performing interdisciplinary studies.

  1. Interdisciplinary Approach in Engineering Education

    Directory of Open Access Journals (Sweden)

    Anda Zeidmane

    2011-04-01

    Full Text Available The analysis of the scientific literature available on the types of general competences and their classification caused the authors to conclude that it is necessary to implement interdisciplinary approach in engineering education to develop competences necessary for engineers to make them competitive in the labour market. The attention should be paid to a professional foreign language, computer literacy and educational psychology recommendations. To improve professional foreign language skills, CLIL (Content and Language Integrated Learning method should be integrated in the study process of engineering education. In order to develop information literacy competence, it is important to create a single e-study environment. The academic staff, developing study subjects for engineering programmes, should focus on the study content and study methods. As regards the content, the compromise should be sought between fundamental acquisition of the knowledge of the subject matter, the know-how of the application of this knowledge as well as the use of brand new software in the calculations. The paper presents the examples of the application of the interdisciplinary approach in the universities, where the authors of the paper are affiliated: the LUA (Latvia University of Agriculture and the RTU (Riga Technical University, respectively.

  2. Kindergarten Quantum Mechanics: Lecture Notes

    International Nuclear Information System (INIS)

    These lecture notes survey some joint work with Samson Abramsky as it was presented by me at several conferences in the summer of 2005. It concerns 'doing quantum mechanics using only pictures of lines, squares, triangles and diamonds'. This picture calculus can be seen as a very substantial extension of Dirac's notation, and has a purely algebraic counterpart in terms of so-called Strongly Compact Closed Categories (introduced by Abramsky and I which subsumes my Logic of Entanglement. For a survey on the 'what', the 'why' and the 'hows' I refer to a previous set of lecture notes. In a last section we provide some pointers to the body of technical literature on the subject

  3. Lectures on Dark Matter Physics

    CERN Document Server

    Lisanti, Mariangela

    2016-01-01

    Rotation curve measurements from the 1970s provided the first strong indication that a significant fraction of matter in the Universe is non-baryonic. In the intervening years, a tremendous amount of progress has been made on both the theoretical and experimental fronts in the search for this missing matter, which we now know constitutes nearly 85% of the Universe's matter density. These series of lectures, first given at the TASI 2015 summer school, provide an introduction to the basics of dark matter physics. They are geared for the advanced undergraduate or graduate student interested in pursuing research in high-energy physics. The primary goal is to build an understanding of how observations constrain the assumptions that can be made about the astro- and particle physics properties of dark matter. The lectures begin by delineating the basic assumptions that can be inferred about dark matter from rotation curves. A detailed discussion of thermal dark matter follows, motivating Weakly Interacting Massive P...

  4. Three Lectures on Hadron Physics

    CERN Document Server

    Roberts, Craig D

    2015-01-01

    These lectures explain that comparisons between experiment and theory can expose the impact of running couplings and masses on hadron observables and thereby aid materially in charting the momentum dependence of the interaction that underlies strong-interaction dynamics. The series begins with a primer on continuum QCD, which introduces some of the basic ideas necessary in order to understand the use of Schwinger functions as a nonperturbative tool in hadron physics. It continues with a discussion of confinement and dynamical symmetry breaking (DCSB) in the Standard Model, and the impact of these phenomena on our understanding of condensates, the parton structure of hadrons, and the pion electromagnetic form factor. The final lecture treats the problem of grand unification; namely, the contemporary use of Schwinger functions as a symmetry-preserving tool for the unified explanation and prediction of the properties of both mesons and baryons. It reveals that DCSB drives the formation of diquark clusters in bar...

  5. ACADEMIC TRAINING LECTURES-QUESTIONNAIRE

    CERN Multimedia

    Françoise Benz

    2004-01-01

    ACADEMIC TRAINING Françoise Benz tel. 73127 academic.training@cern.ch SUGGEST AND WIN! Its time to plan the 2004-2005 lecture series. From today until March 19 you have the chance to give your contribution to planning for next year's Academic Training Lecture Series. At the web site: http://cern.ch/Academic.Training/questionnaire you will find questionnaires proposing topics in high energy physics, applied physics and science and society. Answering the questionnaire will help ensure that the selected topics are as close as possible to your interests. In particular requests and comments from students will be much appreciated. To encourage your contribution, the AT Committee will reward one lucky winner with a small prize, a 50 CHF coupon for a book purchase at the CERN bookshop.

  6. Welding and cutting '93. Lectures

    International Nuclear Information System (INIS)

    This volume contains 46 lectures on the following ten groups of subjects: New knowledge and experience for welding firms; European welding process testing; welding developments in Europe - process and equipment; progress in material technique; accreditation and certification in the Single European Market; development of equipment in welding and cutting techniques; quality assurance in welding technique; welding additives and welding aid materials; work and health protection in welding technique; training and qualification of personnel; basis of welding technique in Europe - test technique. (MM)

  7. Lectures on Dark Matter Physics

    OpenAIRE

    Lisanti, Mariangela

    2016-01-01

    Rotation curve measurements from the 1970s provided the first strong indication that a significant fraction of matter in the Universe is non-baryonic. In the intervening years, a tremendous amount of progress has been made on both the theoretical and experimental fronts in the search for this missing matter, which we now know constitutes nearly 85% of the Universe's matter density. These series of lectures, first given at the TASI 2015 summer school, provide an introduction to the basics of d...

  8. MGMT 30100: Management Career Lectures

    OpenAIRE

    Landis, Maureen Huffer

    2014-01-01

    Abstract: Management Career Lectures (MGMT 30100) is designed to help undergraduate management students with their overall career/professional development whether that focus on internship/job search processes or graduate school attendance. The course also supports the development, refinement and enrichment of the competencies within the “Launching Business Leaders” initiative. Students develop skills useful for the internship/job search process, gain knowledge that benefits short and long-ter...

  9. Academic Training Lecture - Regular Programme

    CERN Multimedia

    PH Department

    2010-01-01

    Tuesday 25 & Wednesday 26 May 2010 from 11:00 to 12:30 - Main Auditorium, Bldg. 500-1-001 Baryon Asymmetry of the Universe by Prof. Hitoshi Murayama (University of California, Berkeley) In two lectures, the following topics will be discussed: (1) Why baryon asymmetry is a problem at all (2) Review of the Sakharov's conditions (3) Why old models based on GUT did not work (4) Electroweak baryogenesis (5) Leptogenesis (6) Connections to the near-future experiments

  10. The Feynman lectures on physics

    International Nuclear Information System (INIS)

    This set of lectures tries to elucidate from the beginning those features of the quantum mechanics which are most general. The first lectures tackle head on the ideas of a probability amplitude, the interference of amplitudes, the abstract notion of a state, and the superposition and resolution of states - and the Dirac notation is used from the start. In each instance the ideas are introduced together with a detailed discussion of some specific examples - to try to make the physical ideas as real as possible. The time dependence of states including states of definite energy comes next, and the ideas are applied at once to the study of two-state systems. A detailed discussion of the ammonia maser provides the framework for the introduction to radiation absorption and induced transitions. The lectures then go on to consider more complex systems, leading to a discussion of the propagation of electrons in a crystal, and to a rather complete treatment of the quantum mechanics of angular momentum. Our introduction to quantum mechanics ends in Chapter 20 with a discussion of the Schroedinger wave function, its differential equation, and the solution for the hydrogen atom. The last Chapter of this volume is not intended to be a part of the 'course.' It is a 'seminar' on superconductivity and was given in the spirit of some of the entertainment lectures of the first two volumes, with the intent of opening to the students a broader view of the relation of what they were learning to the general culture of physics. Feynman's 'epilogue' serves as the period to the three-volume series

  11. Lecture Notes in Lie Groups

    OpenAIRE

    Ivancevic, Vladimir G.; Ivancevic, Tijana T.

    2011-01-01

    These lecture notes in Lie Groups are designed for a 1--semester third year or graduate course in mathematics, physics, engineering, chemistry or biology. This landmark theory of the 20th Century mathematics and physics gives a rigorous foundation to modern dynamics, as well as field and gauge theories in physics, engineering and biomechanics. We give both physical and medical examples of Lie groups. The only necessary background for comprehensive reading of these notes are advanced calculus ...

  12. Trieste lectures on mirror symmetry

    International Nuclear Information System (INIS)

    These are pedagogical lectures on mirror symmetry given at the Spring School in ICTP, Trieste, March 2002. The focus is placed on worldsheet descriptions of the physics related to mirror symmetry. We start with the introduction to general aspects of (2,2) supersymmetric field theories in 1 + 1 dimensions. We next move on to the study and applications of linear sigma model. Finally, we provide a proof of mirror symmetry in a class of models. (author)

  13. Linking Laboratories to the Lecture

    Science.gov (United States)

    Robertson, Charles

    1997-04-01

    Most introductory physics courses include both laboratory experiments and lecture. However, the two are often taught as separate courses with little coordination of their curricula. We have addressed this problem by developing laboratory exercises which support, and are supported by, learning in other parts of the course. An example will show how the curriculum in different segments of our course reinforce each other in an attempt to increase student learning.

  14. Three Lectures on Hadron Physics

    Science.gov (United States)

    Roberts, Craig D.

    2016-04-01

    These lectures explain that comparisons between experiment and theory can expose the impact of running couplings and masses on hadron observables and thereby aid materially in charting the momentum dependence of the interaction that underlies strong-interaction dynamics. The series begins with a primer on continuum QCD, which introduces some of the basic ideas necessary in order to understand the use of Schwinger functions as a nonperturbative tool in hadron physics. It continues with a discussion of confinement and dynamical symmetry breaking (DCSB) in the Standard Model, and the impact of these phenomena on our understanding of condensates, the parton structure of hadrons, and the pion electromagnetic form factor. The final lecture treats the problem of grand unification; namely, the contemporary use of Schwinger functions as a symmetry-preserving tool for the unified explanation and prediction of the properties of both mesons and baryons. It reveals that DCSB drives the formation of diquark clusters in baryons and sketches a picture of baryons as bound-states with Borromean character. Planned experiments are capable of validating the perspectives outlined in these lectures.

  15. Measurement of the $\\chi_b(3P)$ mass and of the relative rate of $\\chi_{b1}(1P)$ and $\\chi_{b2}(1P)$ production

    CERN Document Server

    Aaij, Roel; Adinolfi, Marco; Affolder, Anthony; Ajaltouni, Ziad; Akar, Simon; Albrecht, Johannes; Alessio, Federico; Alexander, Michael; Ali, Suvayu; Alkhazov, Georgy; Alvarez Cartelle, Paula; Alves Jr, Antonio Augusto; Amato, Sandra; Amerio, Silvia; Amhis, Yasmine; An, Liupan; Anderlini, Lucio; Anderson, Jonathan; Andreassen, Rolf; Andreotti, Mirco; Andrews, Jason; Appleby, Robert; Aquines Gutierrez, Osvaldo; Archilli, Flavio; Artamonov, Alexander; Artuso, Marina; Aslanides, Elie; Auriemma, Giulio; Baalouch, Marouen; Bachmann, Sebastian; Back, John; Badalov, Alexey; Baesso, Clarissa; Baldini, Wander; Barlow, Roger; Barschel, Colin; Barsuk, Sergey; Barter, William; Batozskaya, Varvara; Battista, Vincenzo; Bay, Aurelio; Beaucourt, Leo; Beddow, John; Bedeschi, Franco; Bediaga, Ignacio; Belogurov, Sergey; Belous, Konstantin; Belyaev, Ivan; Ben-Haim, Eli; Bencivenni, Giovanni; Benson, Sean; Benton, Jack; Berezhnoy, Alexander; Bernet, Roland; Bettler, Marc-Olivier; van Beuzekom, Martinus; Bien, Alexander; Bifani, Simone; Bird, Thomas; Bizzeti, Andrea; Bjørnstad, Pål Marius; Blake, Thomas; Blanc, Frédéric; Blouw, Johan; Blusk, Steven; Bocci, Valerio; Bondar, Alexander; Bondar, Nikolay; Bonivento, Walter; Borghi, Silvia; Borgia, Alessandra; Borsato, Martino; Bowcock, Themistocles; Bowen, Espen Eie; Bozzi, Concezio; Brambach, Tobias; van den Brand, Johannes; Bressieux, Joël; Brett, David; Britsch, Markward; Britton, Thomas; Brodzicka, Jolanta; Brook, Nicholas; Brown, Henry; Bursche, Albert; Busetto, Giovanni; Buytaert, Jan; Cadeddu, Sandro; Calabrese, Roberto; Calvi, Marta; Calvo Gomez, Miriam; Campana, Pierluigi; Campora Perez, Daniel; Carbone, Angelo; Carboni, Giovanni; Cardinale, Roberta; Cardini, Alessandro; Carson, Laurence; Carvalho Akiba, Kazuyoshi; Casse, Gianluigi; Cassina, Lorenzo; Castillo Garcia, Lucia; Cattaneo, Marco; Cauet, Christophe; Cenci, Riccardo; Charles, Matthew; Charpentier, Philippe; Chefdeville, Maximilien; Chen, Shanzhen; Cheung, Shu-Faye; Chiapolini, Nicola; Chrzaszcz, Marcin; Ciba, Krzystof; Cid Vidal, Xabier; Ciezarek, Gregory; Clarke, Peter; Clemencic, Marco; Cliff, Harry; Closier, Joel; Coco, Victor; Cogan, Julien; Cogneras, Eric; Cojocariu, Lucian; Collins, Paula; Comerma-Montells, Albert; Contu, Andrea; Cook, Andrew; Coombes, Matthew; Coquereau, Samuel; Corti, Gloria; Corvo, Marco; Counts, Ian; Couturier, Benjamin; Cowan, Greig; Craik, Daniel Charles; Cruz Torres, Melissa Maria; Cunliffe, Samuel; Currie, Robert; D'Ambrosio, Carmelo; Dalseno, Jeremy; David, Pascal; David, Pieter; Davis, Adam; De Bruyn, Kristof; De Capua, Stefano; De Cian, Michel; De Miranda, Jussara; De Paula, Leandro; De Silva, Weeraddana; De Simone, Patrizia; Decamp, Daniel; Deckenhoff, Mirko; Del Buono, Luigi; Déléage, Nicolas; Derkach, Denis; Deschamps, Olivier; Dettori, Francesco; Di Canto, Angelo; Dijkstra, Hans; Donleavy, Stephanie; Dordei, Francesca; Dorigo, Mirco; Dosil Suárez, Alvaro; Dossett, David; Dovbnya, Anatoliy; Dreimanis, Karlis; Dujany, Giulio; Dupertuis, Frederic; Durante, Paolo; Dzhelyadin, Rustem; Dziurda, Agnieszka; Dzyuba, Alexey; Easo, Sajan; Egede, Ulrik; Egorychev, Victor; Eidelman, Semen; Eisenhardt, Stephan; Eitschberger, Ulrich; Ekelhof, Robert; Eklund, Lars; El Rifai, Ibrahim; Elsasser, Christian; Ely, Scott; Esen, Sevda; Evans, Hannah Mary; Evans, Timothy; Falabella, Antonio; Färber, Christian; Farinelli, Chiara; Farley, Nathanael; Farry, Stephen; Fay, Robert; Ferguson, Dianne; Fernandez Albor, Victor; Ferreira Rodrigues, Fernando; Ferro-Luzzi, Massimiliano; Filippov, Sergey; Fiore, Marco; Fiorini, Massimiliano; Firlej, Miroslaw; Fitzpatrick, Conor; Fiutowski, Tomasz; Fontana, Marianna; Fontanelli, Flavio; Forty, Roger; Francisco, Oscar; Frank, Markus; Frei, Christoph; Frosini, Maddalena; Fu, Jinlin; Furfaro, Emiliano; Gallas Torreira, Abraham; Galli, Domenico; Gallorini, Stefano; Gambetta, Silvia; Gandelman, Miriam; Gandini, Paolo; Gao, Yuanning; García Pardiñas, Julián; Garofoli, Justin; Garra Tico, Jordi; Garrido, Lluis; Gaspar, Clara; Gauld, Rhorry; Gavardi, Laura; Gavrilov, Gennadii; Geraci, Angelo; Gersabeck, Evelina; Gersabeck, Marco; Gershon, Timothy; Ghez, Philippe; Gianelle, Alessio; Gianì, Sebastiana; Gibson, Valerie; Giubega, Lavinia-Helena; Gligorov, Vladimir; Göbel, Carla; Golubkov, Dmitry; Golutvin, Andrey; Gomes, Alvaro; Gotti, Claudio; Grabalosa Gándara, Marc; Graciani Diaz, Ricardo; Granado Cardoso, Luis Alberto; Graugés, Eugeni; Graziani, Giacomo; Grecu, Alexandru; Greening, Edward; Gregson, Sam; Griffith, Peter; Grillo, Lucia; Grünberg, Oliver; Gui, Bin; Gushchin, Evgeny; Guz, Yury; Gys, Thierry; Hadjivasiliou, Christos; Haefeli, Guido; Haen, Christophe; Haines, Susan; Hall, Samuel; Hamilton, Brian; Hampson, Thomas; Han, Xiaoxue; Hansmann-Menzemer, Stephanie; Harnew, Neville; Harnew, Samuel; Harrison, Jonathan; He, Jibo; Head, Timothy; Heijne, Veerle; Hennessy, Karol; Henrard, Pierre; Henry, Louis; Hernando Morata, Jose Angel; van Herwijnen, Eric; Heß, Miriam; Hicheur, Adlène; Hill, Donal; Hoballah, Mostafa; Hombach, Christoph; Hulsbergen, Wouter; Hunt, Philip; Hussain, Nazim; Hutchcroft, David; Hynds, Daniel; Idzik, Marek; Ilten, Philip; Jacobsson, Richard; Jaeger, Andreas; Jalocha, Pawel; Jans, Eddy; Jaton, Pierre; Jawahery, Abolhassan; Jing, Fanfan; John, Malcolm; Johnson, Daniel; Jones, Christopher; Joram, Christian; Jost, Beat; Jurik, Nathan; Kandybei, Sergii; Kanso, Walaa; Karacson, Matthias; Karbach, Moritz; Karodia, Sarah; Kelsey, Matthew; Kenyon, Ian; Ketel, Tjeerd; Khanji, Basem; Khurewathanakul, Chitsanu; Klaver, Suzanne; Klimaszewski, Konrad; Kochebina, Olga; Kolpin, Michael; Komarov, Ilya; Koopman, Rose; Koppenburg, Patrick; Korolev, Mikhail; Kozlinskiy, Alexandr; Kravchuk, Leonid; Kreplin, Katharina; Kreps, Michal; Krocker, Georg; Krokovny, Pavel; Kruse, Florian; Kucewicz, Wojciech; Kucharczyk, Marcin; Kudryavtsev, Vasily; Kurek, Krzysztof; Kvaratskheliya, Tengiz; La Thi, Viet Nga; Lacarrere, Daniel; Lafferty, George; Lai, Adriano; Lambert, Dean; Lambert, Robert W; Lanfranchi, Gaia; Langenbruch, Christoph; Langhans, Benedikt; Latham, Thomas; Lazzeroni, Cristina; Le Gac, Renaud; van Leerdam, Jeroen; Lees, Jean-Pierre; Lefèvre, Regis; Leflat, Alexander; Lefrançois, Jacques; Leo, Sabato; Leroy, Olivier; Lesiak, Tadeusz; Lespinasse, Mickael; Leverington, Blake; Li, Yiming; Likhomanenko, Tatiana; Liles, Myfanwy; Lindner, Rolf; Linn, Christian; Lionetto, Federica; Liu, Bo; Lohn, Stefan; Longstaff, Iain; Lopes, Jose; Lopez-March, Neus; Lowdon, Peter; Lu, Haiting; Lucchesi, Donatella; Luo, Haofei; Lupato, Anna; Luppi, Eleonora; Lupton, Oliver; Machefert, Frederic; Machikhiliyan, Irina V; Maciuc, Florin; Maev, Oleg; Malde, Sneha; Malinin, Alexander; Manca, Giulia; Mancinelli, Giampiero; Mapelli, Alessandro; Maratas, Jan; Marchand, Jean François; Marconi, Umberto; Marin Benito, Carla; Marino, Pietro; Märki, Raphael; Marks, Jörg; Martellotti, Giuseppe; Martens, Aurelien; Martín Sánchez, Alexandra; Martinelli, Maurizio; Martinez Santos, Diego; Martinez Vidal, Fernando; Martins Tostes, Danielle; Massafferri, André; Matev, Rosen; Mathe, Zoltan; Matteuzzi, Clara; Mazurov, Alexander; McCann, Michael; McCarthy, James; McNab, Andrew; McNulty, Ronan; McSkelly, Ben; Meadows, Brian; Meier, Frank; Meissner, Marco; Merk, Marcel; Milanes, Diego Alejandro; Minard, Marie-Noelle; Moggi, Niccolò; Molina Rodriguez, Josue; Monteil, Stephane; Morandin, Mauro; Morawski, Piotr; Mordà, Alessandro; Morello, Michael Joseph; Moron, Jakub; Morris, Adam Benjamin; Mountain, Raymond; Muheim, Franz; Müller, Katharina; Mussini, Manuel; Muster, Bastien; Naik, Paras; Nakada, Tatsuya; Nandakumar, Raja; Nasteva, Irina; Needham, Matthew; Neri, Nicola; Neubert, Sebastian; Neufeld, Niko; Neuner, Max; Nguyen, Anh Duc; Nguyen, Thi-Dung; Nguyen-Mau, Chung; Nicol, Michelle; Niess, Valentin; Niet, Ramon; Nikitin, Nikolay; Nikodem, Thomas; Novoselov, Alexey; O'Hanlon, Daniel Patrick; Oblakowska-Mucha, Agnieszka; Obraztsov, Vladimir; Oggero, Serena; Ogilvy, Stephen; Okhrimenko, Oleksandr; Oldeman, Rudolf; Onderwater, Gerco; Orlandea, Marius; Otalora Goicochea, Juan Martin; Owen, Patrick; Oyanguren, Maria Arantza; Pal, Bilas Kanti; Palano, Antimo; Palombo, Fernando; Palutan, Matteo; Panman, Jacob; Papanestis, Antonios; Pappagallo, Marco; Pappalardo, Luciano; Parkes, Christopher; Parkinson, Christopher John; Passaleva, Giovanni; Patel, Girish; Patel, Mitesh; Patrignani, Claudia; Pearce, Alex; Pellegrino, Antonio; Pepe Altarelli, Monica; Perazzini, Stefano; Perret, Pascal; Perrin-Terrin, Mathieu; Pescatore, Luca; Pesen, Erhan; Petridis, Konstantin; Petrolini, Alessandro; Picatoste Olloqui, Eduardo; Pietrzyk, Boleslaw; Pilař, Tomas; Pinci, Davide; Pistone, Alessandro; Playfer, Stephen; Plo Casasus, Maximo; Polci, Francesco; Poluektov, Anton; Polycarpo, Erica; Popov, Alexander; Popov, Dmitry; Popovici, Bogdan; Potterat, Cédric; Price, Eugenia; Prisciandaro, Jessica; Pritchard, Adrian; Prouve, Claire; Pugatch, Valery; Puig Navarro, Albert; Punzi, Giovanni; Qian, Wenbin; Rachwal, Bartolomiej; Rademacker, Jonas; Rakotomiaramanana, Barinjaka; Rama, Matteo; Rangel, Murilo; Raniuk, Iurii; Rauschmayr, Nathalie; Raven, Gerhard; Reichert, Stefanie; Reid, Matthew; dos Reis, Alberto; Ricciardi, Stefania; Richards, Sophie; Rihl, Mariana; Rinnert, Kurt; Rives Molina, Vincente; Roa Romero, Diego; Robbe, Patrick; Rodrigues, Ana Barbara; Rodrigues, Eduardo; Rodriguez Perez, Pablo; Roiser, Stefan; Romanovsky, Vladimir; Romero Vidal, Antonio; Rotondo, Marcello; Rouvinet, Julien; Ruf, Thomas; Ruiz, Hugo; Ruiz Valls, Pablo; Saborido Silva, Juan Jose; Sagidova, Naylya; Sail, Paul; Saitta, Biagio; Salustino Guimaraes, Valdir; Sanchez Mayordomo, Carlos; Sanmartin Sedes, Brais; Santacesaria, Roberta; Santamarina Rios, Cibran; Santovetti, Emanuele; Sarti, Alessio; Satriano, Celestina; Satta, Alessia; Saunders, Daniel Martin; Savrina, Darya; Schiller, Manuel; Schindler, Heinrich; Schlupp, Maximilian; Schmelling, Michael; Schmidt, Burkhard; Schneider, Olivier; Schopper, Andreas; Schune, Marie Helene; Schwemmer, Rainer; Sciascia, Barbara; Sciubba, Adalberto; Semennikov, Alexander; Sepp, Indrek; Serra, Nicola; Serrano, Justine; Sestini, Lorenzo; Seyfert, Paul; Shapkin, Mikhail; Shapoval, Illya; Shcheglov, Yury; Shears, Tara; Shekhtman, Lev; Shevchenko, Vladimir; Shires, Alexander; Silva Coutinho, Rafael; Simi, Gabriele; Sirendi, Marek; Skidmore, Nicola; Skwarnicki, Tomasz; Smith, Anthony; Smith, Edmund; Smith, Eluned; Smith, Jackson; Smith, Mark; Snoek, Hella; Sokoloff, Michael; Soler, Paul; Soomro, Fatima; Souza, Daniel; Souza De Paula, Bruno; Spaan, Bernhard; Sparkes, Ailsa; Spradlin, Patrick; Sridharan, Srikanth; Stagni, Federico; Stahl, Marian; Stahl, Sascha; Steinkamp, Olaf; Stenyakin, Oleg; Stevenson, Scott; Stoica, Sabin; Stone, Sheldon; Storaci, Barbara; Stracka, Simone; Straticiuc, Mihai; Straumann, Ulrich; Stroili, Roberto; Subbiah, Vijay Kartik; Sun, Liang; Sutcliffe, William; Swientek, Krzysztof; Swientek, Stefan; Syropoulos, Vasileios; Szczekowski, Marek; Szczypka, Paul; Szumlak, Tomasz; T'Jampens, Stephane; Teklishyn, Maksym; Tellarini, Giulia; Teubert, Frederic; Thomas, Christopher; Thomas, Eric; van Tilburg, Jeroen; Tisserand, Vincent; Tobin, Mark; Tolk, Siim; Tomassetti, Luca; Tonelli, Diego; Topp-Joergensen, Stig; Torr, Nicholas; Tournefier, Edwige; Tourneur, Stephane; Tran, Minh Tâm; Tresch, Marco; Trisovic, Ana; Tsaregorodtsev, Andrei; Tsopelas, Panagiotis; Tuning, Niels; Ubeda Garcia, Mario; Ukleja, Artur; Ustyuzhanin, Andrey; Uwer, Ulrich; Vagnoni, Vincenzo; Valenti, Giovanni; Vallier, Alexis; Vazquez Gomez, Ricardo; Vazquez Regueiro, Pablo; Vázquez Sierra, Carlos; Vecchi, Stefania; Velthuis, Jaap; Veltri, Michele; Veneziano, Giovanni; Vesterinen, Mika; Viaud, Benoit; Vieira, Daniel; Vieites Diaz, Maria; Vilasis-Cardona, Xavier; Vollhardt, Achim; Volyanskyy, Dmytro; Voong, David; Vorobyev, Alexey; Vorobyev, Vitaly; Voß, Christian; de Vries, Jacco; Waldi, Roland; Wallace, Charlotte; Wallace, Ronan; Walsh, John; Wandernoth, Sebastian; Wang, Jianchun; Ward, David; Watson, Nigel; Websdale, David; Whitehead, Mark; Wicht, Jean; Wiedner, Dirk; Wilkinson, Guy; Williams, Matthew; Williams, Mike; Wilson, Fergus; Wimberley, Jack; Wishahi, Julian; Wislicki, Wojciech; Witek, Mariusz; Wormser, Guy; Wotton, Stephen; Wright, Simon; Wu, Suzhi; Wyllie, Kenneth; Xie, Yuehong; Xing, Zhou; Xu, Zhirui; Yang, Zhenwei; Yuan, Xuhao; Yushchenko, Oleg; Zangoli, Maria; Zavertyaev, Mikhail; Zhang, Liming; Zhang, Wen Chao; Zhang, Yanxi; Zhelezov, Alexey; Zhokhov, Anatoly; Zhong, Liang; Zvyagin, Alexander

    2014-01-01

    The production of $\\chi_b$ mesons in proton-proton collisions is studied using a data sample collected by the LHCb detector, at centre-of-mass energies of $\\sqrt{s}=7$ and $8$ TeV and corresponding to an integrated luminosity of 3.0 fb$^{-1}$. The $\\chi_b$ mesons are identified through their decays to $\\Upsilon(1S)\\gamma$ and $\\Upsilon(2S)\\gamma$ using photons that converted to $e^+e^-$ pairs in the detector. The $\\chi_b(3P)$ meson mass, and the relative prompt production rate of $\\chi_{b1}(1P)$ and $\\chi_{b2}(1P)$ mesons as a function of the $\\Upsilon(1S)$ transverse momentum in the $\\chi_b$ rapidity range 2.0< $y$<4.5, are measured. Assuming a mass splitting between the $\\chi_{b1}(3P)$ and the $\\chi_{b2}(3P)$ states of 10.5 MeV/$c^2$, the mass of the $\\chi_{b1}(3P)$ meson is \\begin{equation*} m(\\chi_{b1}(3P))= 10515.7^{+2.2}_{-3.9}(stat) ^{+1.5}_{-2.1}(syst) MeV/c^2. \\end{equation*}

  16. Sustainability: Teaching an Interdisciplinary Threshold Concept through Traditional Lecture and Active Learning

    Science.gov (United States)

    Levintova, Ekaterina M.; Mueller, Daniel W.

    2015-01-01

    One of the difficulties in teaching global sustainability in the introductory political science classes is the different emphases placed on this concept and the absence of the consensus on where the overall balance between environmental protection, economic development, and social justice should reside. Like many fuzzy concepts with which students…

  17. Creating an Innovative Interdisciplinary Graduate Certificate Program

    Science.gov (United States)

    McFadden, Kathleen L.; Chen, Shi-Jie; Munroe, Donna J.; Naftzger, Jay R.; Selinger, Evan M.

    2011-01-01

    In response to a growing movement within higher education to provide interdisciplinary educational programs, this study describes the creation of an interdisciplinary graduate certificate program in healthcare policy and management. Building on prior research, we surveyed healthcare executives to examine their perceptions about the need for such a…

  18. 7 CFR 610.5 - Interdisciplinary assistance.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 6 2010-01-01 2010-01-01 false Interdisciplinary assistance. 610.5 Section 610.5 Agriculture Regulations of the Department of Agriculture (Continued) NATURAL RESOURCES CONSERVATION SERVICE... Interdisciplinary assistance. Technical assistance is based on the principle that soil, water, plant, and...

  19. Toward an Interdisciplinary Science of Culture

    Science.gov (United States)

    Hayes, Linda J.; Fryling, Mitch J.

    2009-01-01

    Cultural events are of interest to scientists working in many scientific domains. Given this, an interdisciplinary science of culture may provide a more thorough understanding of cultural phenomena. However, interdisciplinary sciences depend upon the validity and vitality of the participating disciplines. This article reviews the nature of…

  20. Criminologyof the future: interdisciplinary scientific connections

    OpenAIRE

    Antonyan Yu.M.

    2014-01-01

    The results of interdisciplinary scientific connections of the modern criminology conditional on the open character of this science and the necessity of its further development are given. The narrow-purpose character of criminological researches is noted: trivial subject matter; the criminologists’ lack of psychological, psychiatric, economical, historical, biological, ethnological and other knowledge; insufficiency of complex interdisciplinary works and empirical studies. Different viewpoint...

  1. Engaging Undergraduates through Interdisciplinary Research in Nanotechnology

    Science.gov (United States)

    Goonewardene, Anura U.; Offutt, Christine; Whitling, Jacqueline; Woodhouse, Donald

    2012-01-01

    To recruit and retain more students in all science disciplines at our small (5,000 student) public university, we implemented an interdisciplinary strategy focusing on nanotechnology and enhanced undergraduate research. Inherently interdisciplinary, the novelty of nanotechnology and its growing career potential appeal to students. To engage…

  2. Interdisciplinary Best Practices for Adapted Physical Activity

    Science.gov (United States)

    Szostak, Rick

    2016-01-01

    This article provides an introduction to the literature on interdisciplinary research. It then draws lessons from that literature for the field of adapted physical activity. It is argued that adapted physical activity should be a self-consciously interdisciplinary field. It should insist that research be performed according to recognized…

  3. Authentic Interdisciplinary Instruction: Raising the Bar

    Science.gov (United States)

    Mohnsen, Bonnie

    2011-01-01

    This article addressed the need for authentic interdisciplinary instruction. Authentic interdisciplinary instruction is defined as a learning activity that simultaneously improves student performance related to grade-level standards in two or more disciplines (e.g., science and physical education). The process described for creating authentic…

  4. Interdisciplinary Doctoral Research Supervision: A Scoping Review

    Science.gov (United States)

    Vanstone, Meredith; Hibbert, Kathy; Kinsella, Elizabeth Anne; McKenzie, Pam; Pitman, Allan; Lingard, Lorelei

    2013-01-01

    This scoping literature review examines the topic of interdisciplinary doctoral research supervision. Interdisciplinary doctoral research programs are expanding in response to encouragement from funding agencies and enthusiasm from faculty and students. In an acknowledgement that the search for creative and innovative solutions to complex problems…

  5. Assessing Interdisciplinary Education in U.S. Dental Hygiene Programs.

    Science.gov (United States)

    Holt, Lorie; Bray, Kimberly; Mayberry, Bill; Overman, Pamela

    2000-01-01

    Survey responses from 136 of 216 dental hygiene programs indicated that 31% included interdisciplinary activities in the curriculum; only 15% included both clinical and instructional interdisciplinary coursework. However, 74% felt that students would benefit from interdisciplinary experiences. (SK)

  6. Fostering Interdisciplinary Communication between Pharmacy and Nursing Students

    OpenAIRE

    Chen, Aleda M. H.; Kiersma, Mary E.; Keib, Carrie N.; Cailor, Stephanie

    2015-01-01

    Objective. To evaluate pharmacy and nursing student self-perceptions of interdisciplinary communication skills, faculty member perceptions of interdisciplinary communication skills, and changes in those skills after increasing the interdisciplinary education content.

  7. Second-Order Science of Interdisciplinary Research

    DEFF Research Database (Denmark)

    Alrøe, Hugo Fjelsted; Noe, Egon

    2014-01-01

    are many different scientific knowledges on any complex problem. Method: We synthesize and elaborate a framework for second-order science in interdisciplinary research based on a number of earlier publications, experiences from large interdisciplinary research projects, and a perspectivist theory of...... require and challenge interdisciplinarity. Problem: The conventional methods of interdisciplinary research fall short in the case of wicked problems because they remain first-order science. Our aim is to present workable methods and research designs for doing second-order science in domains where there...... science. Results: The second-order polyocular framework for interdisciplinary research is characterized by five principles. Second-order science of interdisciplinary research must: 1. draw on the observations of first-order perspectives, 2. address a shared dynamical object, 3. establish a shared problem...

  8. "Social Imaginary" an Interdisciplinary Concept

    Directory of Open Access Journals (Sweden)

    F. Moharamkhani

    2014-04-01

    Full Text Available Brian Fey, divides concepts into three categories; first, concepts which we use in thinking, second, concepts which we think about, and third, concept by which we think,. According to this categories, "social imaginary" would be in third category. it means that there is fixed cultural element within each nation which confronting new developments, it affects them. "Social imaginary" is the main concept of Debry’s theory of mediology. this review tries to show that this concept is an interdisciplinary concept of Althusser’s Marxism structural theory and Jung’s unconscious theory, by using the metatheory. This methodology would help us to know more deeply about a theory. The consequence is that "social imaginary" is a synthesis of political and psychological theory developed in France.

  9. Interdisciplinary Symposium on Complex Systems

    CERN Document Server

    Rössler, Otto; Zelinka, Ivan

    2015-01-01

    The book you hold in your hands is the outcome of the “2014 Interdisciplinary Symposium on Complex Systems” held in the historical city of Florence. The book consists of 37 chapters from 4 areas of Physical Modeling of Complex Systems, Evolutionary Computations, Complex Biological Systems and Complex Networks. All 4 parts contain contributions that give interesting point of view on complexity in different areas in science and technology. The book starts with a comprehensive overview and classification of complexity problems entitled Physics in the world of ideas: Complexity as Energy”  , followed by chapters about complexity measures and physical principles, its observation, modeling and its applications, to solving various problems including real-life applications. Further chapters contain recent research about evolution, randomness and complexity, as well as complexity in biological systems and complex networks. All selected papers represent innovative ideas, philosophical overviews and state-of-the-...

  10. Escape angles in bulk chi((2)) soliton interactions

    OpenAIRE

    Johansen, Steffen Kjær; Bang, Ole; Sørensen, Mads Peter

    2002-01-01

    We develop a theory for nonplanar interaction between two identical type I spatial solitons propagating at opposite, but arbitrary transverse angles in quadratic nonlinear (or so-called chi((2))) bulk, media. We predict quantitatively the outwards escape angle, below which the solitons turn around and collide, and above which they continue to move-away from each other. For in-plane interaction, the theory allows prediction of the Outcome of a collision through the inwards escape angle, i.e., ...

  11. Feynman Rules of Higher-order Poles in CHY Construction

    CERN Document Server

    Huang, Rijun; Luo, Ming-xing; Zhu, Chuan-Jie

    2016-01-01

    In this paper, we generalize the integration rules for scattering equations to situations where higher-order poles are present. We describe the strategy to deduce the Feynman rules of higher-order poles from known analytic results of simple CHY-integrands, and propose the Feynman rules for single double pole and triple pole as well as duplex-double pole and triplex-double pole structures. We demonstrate the validation and strength of these rules by ample non-trivial examples.

  12. Consumer Behaviour. Case: iPhone Ho Chi Minh City

    OpenAIRE

    Tran, Thi Xuan Oanh

    2016-01-01

    The main aim of this thesis is to figure out the factors that have influenced consumer behaviour of young iPhone users in Ho Chi Minh City. In this study, the author draw a conclusion based on the data collected from the survey and proposed some feasible recommendations for Apple and other high-end smartphone companies to understand their consumers and enhance brand equity. For the secondary data, a variety of theories, including consumers’ characteristics, promotion and the decision mak...

  13. An Advanced Dictionary? Similarities and Differences between Duramazwi ReChiShona and Duramazwi Guru ReChiShona *

    Directory of Open Access Journals (Sweden)

    Emmanuel Chabata

    2011-10-01

    Full Text Available

    Abstract: In this article a comparative analysis of Duramazwi ReChiShona (DRC and Duramazwi Guru ReChiShona (DGC is made. Both DRC and DGC are monolingual Shona dictionaries compiled by a team of researchers under the African Languages Lexical (ALLEX Project, now the African Languages Research Institute (ALRI. During the compilation process, DRC was known as the General Shona Dictionary and DGC as the Advanced Shona Dictionary. A simple analysis of these titles shows that the dictionaries are similar in some ways and also different in others. The writer tries to show the ways in which DGC is regarded as a more advanced dictionary when compared to DRC. Although the argument of the article is mainly built on those differences which make DGC the more advanced, attention is also paid to the similarities between the dictionaries.

    Keywords: ALLEX PROJECT, ALRI, DURAMAZWI RECHISHONA, DURAMAZWI GURU RECHISHONA, DICTIONARY, SHONA, HEADWORD, SENSE, MONOLINGUAL DICTIONARY, CORPUS, IDIOM, PROVERB, PITHY SAYING

    Opsomming: 'n Gevorderde woordeboek? Ooreenkomste en verskille tussen Duramazwi ReChiShona en Duramazwi Guru ReChiShona. In hierdie artikel word 'n vergelykende ontleding van Duramazwi ReChiShona (DRC en Duramazwi Guru ReChiShona (DGC gemaak. Sowel die DRC en DGC is eentalige Sjonawoordeboeke, saamgestel deur ?n span navorsers by die African Languages Lexical (ALLEX Project, tans die African Languages Research Institute (ALRI. Gedurende die samestellingsproses was DRC bekend as die Algemene Sjonawoordeboek en DGC as die Gevorderde Sjonawoordeboek. 'n Eenvoudige ontleding van hierdie titels toon dat die woordeboeke op sommige maniere eenders en op ander ook verskillend is. Die skrywer probeer die maniere aantoon waarop DGC beskou word as 'n meer gevorderde woordeboek wanneer dit met DRC vergelyk word. Alhoewel die argument van die artikel hoofsaaklik gebou is op daardie verskille wat DGC die gevorderdste maak, word ook aandag gegee aan

  14. Lectures on branes in curved backgrounds

    International Nuclear Information System (INIS)

    These lectures provide an introduction to the microscopic description of branes in curved backgrounds. After a brief reminder of the flat space theory, the basic principles and techniques of (rational) boundary conformal field theory are presented in the second lecture. The general formalism is then illustrated through a detailed discussion of branes on compact group manifolds. In the final lecture, many more recent developments are reviewed, including some results for non-compact target spaces

  15. Oskar Klein memorial lectures 1988-1999

    CERN Document Server

    Ekspong, Gösta

    2014-01-01

    The Oskar Klein Memorial Lecture series has become a very successful tradition in Swedish physics since it started in 1988. Theoretical high-energy physics dominates the subjects of the lectures, mirroring one of Klein's own main interests. This single volume is a compilation of the unique lectures previously produced in three separate volumes. The lectures are by world renowned experts in physics who have all contributed to the excitement of the field over the years. They continue to be of value to students and teachers alike. Sample Chapter(s)Foreword (24 KB)Oskar Klein (47

  16. Lecture Notes on Multigrid Methods

    Energy Technology Data Exchange (ETDEWEB)

    Vassilevski, P S

    2010-06-28

    The Lecture Notes are primarily based on a sequence of lectures given by the author while been a Fulbright scholar at 'St. Kliment Ohridski' University of Sofia, Sofia, Bulgaria during the winter semester of 2009-2010 academic year. The notes are somewhat expanded version of the actual one semester class he taught there. The material covered is slightly modified and adapted version of similar topics covered in the author's monograph 'Multilevel Block-Factorization Preconditioners' published in 2008 by Springer. The author tried to keep the notes as self-contained as possible. That is why the lecture notes begin with some basic introductory matrix-vector linear algebra, numerical PDEs (finite element) facts emphasizing the relations between functions in finite dimensional spaces and their coefficient vectors and respective norms. Then, some additional facts on the implementation of finite elements based on relation tables using the popular compressed sparse row (CSR) format are given. Also, typical condition number estimates of stiffness and mass matrices, the global matrix assembly from local element matrices are given as well. Finally, some basic introductory facts about stationary iterative methods, such as Gauss-Seidel and its symmetrized version are presented. The introductory material ends up with the smoothing property of the classical iterative methods and the main definition of two-grid iterative methods. From here on, the second part of the notes begins which deals with the various aspects of the principal TG and the numerous versions of the MG cycles. At the end, in part III, we briefly introduce algebraic versions of MG referred to as AMG, focusing on classes of AMG specialized for finite element matrices.

  17. Improving Lecture Quality through Training in Public Speaking

    Science.gov (United States)

    Mowbray, Robert; Perry, Laura B.

    2015-01-01

    Lecturing is a common instructional format but poor lecturing skills can detract from students' learning experiences and outcomes. As lecturing is essentially a form of public communication, training in public speaking may improve lecture quality. Twelve university lecturers in Malaysia participated in a six-week public speaking skills…

  18. Special lecture on nuclear reactor

    International Nuclear Information System (INIS)

    This book gives a special lecture on nuclear reactor, which is divided into two parts. The first part has explanation on nuclear design of nuclear reactor and analysis of core with theories of integral transports, diffusion Nodal, transports Nodal and Monte Carlo skill parallel computer and nuclear calculation and speciality of transmutation reactor. The second part deals with speciality of nuclear reactor and control with nonlinear stabilization of nuclear reactor, nonlinear control of nuclear reactor, neural network and control of nuclear reactor, control theory of observer and analysis method of Adomian.

  19. Mechanics lectures on theoretical physics

    CERN Document Server

    Sommerfeld, Arnold Johannes Wilhelm

    1952-01-01

    Mechanics: Lectures on Theoretical Physics, Volume I covers a general course on theoretical physics. The book discusses the mechanics of a particle; the mechanics of systems; the principle of virtual work; and d'alembert's principle. The text also describes oscillation problems; the kinematics, statics, and dynamics of a rigid body; the theory of relative motion; and the integral variational principles of mechanics. Lagrange's equations for generalized coordinates and the theory of Hamilton are also considered. Physicists, mathematicians, and students taking Physics courses will find the book

  20. Lectures on the Strominger system

    CERN Document Server

    Garcia-Fernandez, Mario

    2016-01-01

    These notes give an introduction to the Strominger system of partial differential equations, and are based on lectures given in September 2015 at the GEOQUANT School, held at the Institute of Mathematical Sciences (ICMAT) in Madrid. We describe the links with the theory of balanced metrics in hermitian geometry, the Hermite-Yang-Mills equations, and its origins in physics, that we illustrate with many examples. We also cover some recent developments in the moduli problem and the interrelation of the Strominger system with generalized geometry, via the cohomological notion of string class.

  1. Amplitude analyses of the decays chi_c1 -> eta pi+ pi- and chi_c1 -> eta' pi+ pi-

    CERN Document Server

    Adams, G S; Ecklund, K M; Insler, J; Muramatsu, H; Park, C S; Pearson, L J; Thorndike, E H; Ricciardi, S; Thomas, C; Artuso, M; Blusk, S; Mountain, R; Skwarnicki, T; Stone, S; Zhang, L M; Bonvicini, G; Cinabro, D; Lincoln, A; Smith, M J; Zhou, P; Zhu, J; Naik, P; Rademacker, J; Asner, D M; Edwards, K W; Randrianarivony, K; Tatishvili, G; Briere, R A; Vogel, H; Onyisi, P U E; Rosner, J L; Alexander, J P; Cassel, D G; Das, S; Ehrlich, R; Gibbons, L; Gray, S W; Hartill, D L; Heltsley, B K; Kreinick, D L; Kuznetsov, V E; Patterson, J R; Peterson, D; Riley, D; Ryd, A; Sadoff, A J; Shi, X; Sun, W M; Yelton, J; Rubin, P; Lowrey, N; Mehrabyan, S; Selen, M; Wiss, J; Libby, J; Kornicer, M; Mitchell, R E; Shepherd, M R; Szczepaniak, A; Besson, D; Pedlar, T K; Cronin-Hennessy, D; Hietala, J; Dobbs, S; Metreveli, Z; Seth, K K; Tomaradze, A; Xiao, T; Martin, L; Powell, A; Wilkinson, G; Ge, J Y; Miller, D H; Shipsey, I P J; Xin, B

    2011-01-01

    Using a data sample of 2.59 x 10^7 psi(2S) decays obtained with the CLEO-c detector, we perform amplitude analyses of the complementary decay chains chi_c1 -> eta pi+ pi- and chi_c1 -> eta' pi+ pi-. We find evidence for a P-wave eta' pi scattering amplitude, which, if interpreted as a resonance, would have exotic J^PC = 1^-+ and parameters consistent with the pi_1(1600) state reported in other production mechanisms. We also make the first observation of the decay a_0(980) -> eta' pi and measure the ratio of branching fractions B(a_0(980) -> eta' pi)/B(a_0(980) -> eta pi) = 0.064 +- 0.014 +- 0.014. The pi pi spectrum produced with a recoiling eta is compared to that with eta' recoil.

  2. Lecture

    OpenAIRE

    2015-01-01

    Emploi Les professionnels et leurs formations : Entre développement des sujets et projets des institutions Wittorski Richard ; Maulini Olivier ; Sorel, Maryvonne (dir.)Berne : Peter Lang, 2015, 237 p., (Exploration ; n° 165). Comment étudier la professionnalisation du point de vue double du développement des personnes et de l'organisation sociale de leurs activités ? Il s'agit de s'intéresser à la fois à la manière dont un individu singulier devient professionnel au fil des apprentissages qu...

  3. Lectures

    OpenAIRE

    Ceccaldi, Sylviane; Lassus, Isabelle de; Leménager, Nathalie; Thévenot, Magali

    2009-01-01

    Emploi Serge Paugam, Le salarié de la précarité. Les nouvelles formes de l'intégration professionnelle Collection « Quadrige, essais débats », Collection « Le lien social, série Documents d'enquête », Paris, PUF, 2007, 2000, 437 p. Depuis les années 80, le nombre de salariés sous statut précaire a augmenté. Les formes de l'intégration professionnelle se sont modifiées avec des effets sur la structure sociale, les rapports sociaux dans les entreprises et sur les formes d'implication des salari...

  4. Lectures

    OpenAIRE

    2014-01-01

    Emploi Emploi, formation, compétences : les régulations de la relation salariale en questions Béthoux Elodie (dir.) ; Koster Jean-Vincent (dir.) ; Monchatre Sylvie (dir.) ; Rey Frédéric, (dir.) ; Tallard Michèle (dir.) ; Vincent CatherineToulouse : Octarès, 2013, 355 p., « Le travail en débats. Série Colloques & Congrès » La généralisation des risques de déstabilisation de l'emploi met en avant la question de la sécurisation des parcours professionnels. La formation et de la certification des...

  5. Why do students miss lectures? A study of lecture attendance amongst students of health science.

    Science.gov (United States)

    Bati, A Hilal; Mandiracioglu, Aliye; Orgun, Fatma; Govsa, Figen

    2013-06-01

    In the domain of health sciences, attendance by students at lectures is more critical. Lecture attendance is an issue which has been widely neglected. This study aims to determine those factors which affect the lecture attendance. The research data was collected by means of a questionnaire during the second semester of the academic year 2010-2011 from second-year students of the Faculties of Medicine, Pharmacy, Dentistry and Nursing. Together with demographic data, the questionnaire includes a Likert-type scale aiming to determine the factors influencing attendance at lectures. 663 participated in this study on a voluntary basis from Medical, Dentistry, Pharmacy and Nursing Faculties. Raising attainment levels, being able to take their own lecture notes, learning which aspects of the lecture content were being emphasized, and the opportunity to ask questions were amongst the chief reasons for attending lectures. It appears that the factors preventing students from attending lectures are mainly individual. Amongst the most frequently cited causes of non-attendance, sleeplessness, ill health and the inefficiency of lectures in overcrowded halls are emphasized. In the totals and sub-dimensions of the Lecture Attendance Scale, Medical Faculty students have average scores higher than those of students at other faculties. The vital nature of professional expertise and its applications, health sciences students' attendance at lectures carries greater importance. It is important to strengthen the mentoring system with regard to individual and external factors, which have been implicated as having a substantial influence on lecture attendance by students. PMID:22863210

  6. Lecture Is Not a Dirty Word: How to Use Active Lecture to Increase Student Engagement

    Science.gov (United States)

    Gregory, Jess L.

    2013-01-01

    Lecture is a much maligned classroom method of instruction. Like any other technique employed by educators, there are both effective and ineffective ways to deliver content through a lecture format. Respecting that the college learner has changed, active lecturing strategies maximize student learning of course content, engaging both modern…

  7. Teaching Interdisciplinary Engineering and Science Educations

    DEFF Research Database (Denmark)

    Kofoed, Lise B.; S. Stachowicz, Marian

    2014-01-01

    creating new knowledge. We will address the challenges by defining the term interdisciplinary in connection with education, and using the Problem Based Learning educational approach and experience from the engineering and science educational areas to find the obstacles. Two cases based on interdisciplinary...... curriculum are used to find the problems. The conclusion is that teachers have to develop understanding of how to integrate their expertise in a new interdisciplinary curriculum. Furthermore they have to be aware of their knowledge profile. Teachers also need to use resources to find a common goal and...

  8. Web Lectures - ATLAS Overview Week

    CERN Multimedia

    Tushar Bhatnagar; Jeremy Herr; Mitch McLachlan; Homer A. Neal

    2007-01-01

    ATLAS Web Archives Web Archives of the ATLAS Overview Week in Glasgow are now available from the University of Michigan portal here. Archives of ATLAS Plenary Sessions, Workshops, Meetings, and Tutorials recorded over the past two years are available via the University of Michigan Lecture Portal. Other recent additions include the ROOT Workshop held at CERN on March 26-27, the Physics Analysis Tools Workshop held in Bergen, Norway on April 23-27, and the CTEQ Workshop: "Physics at the LHC: Early Challenges" held at Michigan State University on May 14-15. Viewing requires a standard Web browser with RealPlayer plug-in (included in most browsers automatically) and works on any major platform. Lectures can be viewed directly over the Web or downloaded locally. In addition, you will find access to a variety of general tutorials and events via the portal. Feedback & Suggestions Welcome Suggestions for events or tutorials to record in 2007, as well as feedback on existing archives, is always welcome...

  9. Measurement of the Branching Fraction for B+- --> chi_c0 K+-

    CERN Document Server

    Aubert, B; Boutigny, D; Gaillard, J M; Hicheur, A; Karyotakis, Yu; Lees, J P; Robbe, P; Tisserand, V; Zghiche, A; Palano, A; Pompili, A; Chen, J C; Qi, N D; Rong, G; Wang, P; Zhu, Y S; Eigen, G; Ofte, I; Stugu, B; Abrams, G S; Borgland, A W; Breon, A B; Brown, D N; Button-Shafer, J; Cahn, R N; Charles, E; Day, C T; Gill, M S; Gritsan, A V; Groysman, Y; Jacobsen, R G; Kadel, R W; Kadyk, J; Kerth, L T; Kolomensky, Yu G; Kral, J F; Kukartsev, G; Le Clerc, C; Levi, M E; Lynch, G; Mir, L M; Oddone, P J; Orimoto, T J; Pripstein, M; Roe, N A; Romosan, A; Ronan, Michael T; Shelkov, V G; Telnov, A V; Wenzel, W A; Ford, K; Harrison, T J; Hawkes, C M; Knowles, D J; Morgan, S E; Penny, R C; Watson, A T; Watson, N K; Goetzen, K; Held, T; Koch, H; Lewandowski, B; Pelizaeus, M; Peters, K; Schmücker, H; Steinke, M; Barlow, N R; Boyd, J T; Chevalier, N; Cottingham, W N; Kelly, M P; Latham, T E; MacKay, C; Wilson, F F; Abe, K; Çuhadar-Dönszelmann, T; Hearty, C; Mattison, T S; McKenna, J A; Thiessen, D; Kyberd, P; McKemey, A K; Blinov, V E; Bukin, A D; Golubev, V B; Ivanchenko, V N; Kravchenko, E A; Onuchin, A P; Serednyakov, S I; Skovpen, Yu I; Solodov, E P; Yushkov, A N; Best, D; Bruinsma, M; Chao, M; Kirkby, D; Lankford, A J; Mandelkern, M A; Mommsen, R K; Röthel, W; Stoker, D P; Buchanan, C; Hartfiel, B L; Shen, B C; Del Re, D; Hadavand, H K; Hill, E J; MacFarlane, D B; Paar, H P; Rahatlou, S; Sharma, V; Berryhill, J W; Campagnari, C; Dahmes, B; Kuznetsova, N; Levy, S L; Long, O; Lu, A; Mazur, M A; Richman, J D; Verkerke, W; Beck, T W; Beringer, J; Eisner, A M; Heusch, C A; Lockman, W S; Schalk, T; Schmitz, R E; Schumm, B A; Seiden, A; Turri, M; Walkowiak, W; Williams, D C; Wilson, M G; Albert, J; Chen, E; Dubois-Felsmann, G P; Dvoretskii, A; Hitlin, D G; Narsky, I; Porter, F C; Ryd, A; Samuel, A; Yang, S; Jayatilleke, S M; Mancinelli, G; Meadows, B T; Sokoloff, M D; Abe, T; Blanc, F; Bloom, P; Chen, S; Clark, P J; Ford, W T; Nauenberg, U; Olivas, A; Rankin, P; Roy, J; Smith, J G; Van Hoek, W C; Zhang, L; Harton, J L; Hu, T; Soffer, A; Toki, W H; Wilson, R J; Zhang, J; Altenburg, D; Brandt, T; Brose, J; Colberg, T; Dickopp, M; Dubitzky, R S; Hauke, A; Lacker, H M; Maly, E; Müller-Pfefferkorn, R; Nogowski, R; Otto, S; Schubert, J; Schubert, Klaus R; Schwierz, R; Spaan, B; Wilden, L; Bernard, D; Bonneaud, G R; Brochard, F; Cohen-Tanugi, J; Grenier, P; Thiebaux, C; Vasileiadis, G; Verderi, M; Khan, A; Lavin, D; Muheim, F; Playfer, S; Swain, J E; Andreotti, M; Azzolini, V; Bettoni, D; Bozzi, C; Calabrese, R; Cibinetto, G; Luppi, E; Negrini, M; Piemontese, L; Sarti, A; Treadwell, E; Anulli, F; Baldini-Ferroli, R; Biasini, M; Calcaterra, A; De Sangro, R; Falciai, D; Finocchiaro, G; Patteri, P; Peruzzi, I M; Piccolo, M; Pioppi, M; Zallo, A; Buzzo, A; Capra, R; Contri, R; Crosetti, G; Lo Vetere, M; Macri, M; Monge, M R; Passaggio, S; Patrignani, C; Robutti, E; Santroni, A; Tosi, S; Bailey, S; Morii, M; Won, E; Bhimji, W; Bowerman, D A; Dauncey, P D; Egede, U; Eschrich, I; Gaillard, J R; Morton, G W; Nash, J A; Sanders, P; Taylor, G P; Grenier, G J; Lee, S J; Mallik, U; Cochran, J; Crawley, H B; Lamsa, J; Meyer, W T; Prell, S; Rosenberg, E I; Yi, J; Davier, M; Grosdidier, G; Höcker, A; Laplace, S; Le Diberder, F R; Lepeltier, V; Lutz, A M; Petersen, T C; Plaszczynski, S; Schune, M H; Tantot, L; Wormser, G; Brigljevic, V; Cheng, C H; Lange, D J; Wright, D M; Bevan, A J; Coleman, J P; Fry, J R; Gabathuler, Erwin; Gamet, R; Kay, M; Parry, R J; Payne, D J; Sloane, R J; Touramanis, C; Back, J J; Harrison, P F; Shorthouse, H W; Strother, P; Vidal, P B; Brown, C L; Cowan, G; Flack, R L; Flächer, H U; George, S; Green, M G; Kurup, A; Marker, C E; McMahon, T R; Ricciardi, S; Salvatore, F; Vaitsas, G; Winter, M A; Brown, D; Davis, C L; Allison, J; Barlow, R J; Forti, A C; Hart, P A; Hodgkinson, M C; Jackson, F; Lafferty, G D; Lyon, A J; Weatherall, J H; Williams, J C; Farbin, A; Jawahery, A; Kovalskyi, D; Lae, C K; Lillard, V; Roberts, D A; Blaylock, G; Dallapiccola, C; Flood, K T; Hertzbach, S S; Kofler, R; Koptchev, V B; Moore, T B; Saremi, S; Stängle, H; Willocq, S; Cowan, R; Sciolla, G; Taylor, F; Yamamoto, R K; Mangeol, D J J; Patel, P M; Lazzaro, A; Palombo, F; Bauer, J M; Cremaldi, L M; Eschenburg, V; Godang, R; Kroeger, R; Reidy, J; Sanders, D A; Summers, D J; Zhao, H W; Brunet, S; Cote-Ahern, D; Hast, C; Taras, P; Nicholson, H; Cartaro, C; Cavallo, N; De Nardo, Gallieno; Fabozzi, F; Gatto, C; Lista, L; Paolucci, P; Piccolo, D; Sciacca, C; Baak, M A; Raven, G; LoSecco, J M; Gabriel, T A; Brau, B; Gan, K K; Honscheid, K; Hufnagel, D; Kagan, H; Kass, R; Pulliam, T; Wong, Q K; Brau, J E; Frey, R; Potter, C T; Sinev, N B; Strom, D; Torrence, E; Colecchia, F; Dorigo, A; Galeazzi, F; Margoni, M; Morandin, M; Posocco, M; Rotondo, M; Simonetto, F; Stroili, R; Tiozzo, G; Voci, C; Benayoun, M; Briand, H; Chauveau, J; David, P; La Vaissière, C de; Del Buono, L; Hamon, O; John, M J J; Leruste, P; Ocariz, J; Pivk, M; Roos, L; Stark, J; T'Jampens, S; Therin, G; Manfredi, P F; Re, V; Behera, P K; Gladney, L; Guo, Q H; Panetta, J; Angelini, C; Batignani, G; Bettarini, S; Bondioli, M; Bucci, F; Calderini, G; Carpinelli, M; Del Gamba, V; Forti, F; Giorgi, M A; Lusiani, A; Marchiori, G; Martínez-Vidal, F; Morganti, M; Neri, N; Paoloni, E; Rama, M; Rizzo, G; Sandrelli, F; Walsh, J; Haire, M; Judd, D; Paick, K; Wagoner, D E; Danielson, N; Elmer, P; Lü, C; Miftakov, V; Olsen, J; Smith, A J S; Tanaka, H A; Varnes, E W; Bellini, F; Cavoto, G; Faccini, R; Ferrarotto, F; Ferroni, F; Gaspero, M; Mazzoni, M A; Morganti, S; Pierini, M; Piredda, G; Safai-Tehrani, F; Voena, C; Christ, S; Wagner, G; Waldi, R; Adye, T; De Groot, N; Franek, B J; Geddes, N I; Gopal, G P; Olaiya, E O; Xella, S M; Aleksan, Roy; Emery, S; Gaidot, A; Ganzhur, S F; Giraud, P F; Hamel de Monchenault, G; Kozanecki, Witold; Langer, M; Legendre, M; London, G W; Mayer, B; Schott, G; Vasseur, G; Yéche, C; Zito, M; Purohit, M V; Weidemann, A W; Yumiceva, F X; Aston, D; Bartoldus, R; Berger, N; Boyarski, A M; Buchmüller, O L; Convery, M R; Coupal, D P; Dong, D; Dorfan, J; Dujmic, D; Dunwoodie, W M; Field, R C; Glanzman, T; Gowdy, S J; Graugès-Pous, E; Hadig, T; Halyo, V; Hrynóva, T; Innes, W R; Jessop, C P; Kelsey, M H; Kim, P; Kocian, M L; Langenegger, U; Leith, D W G S; Luitz, S; Lüth, V; Lynch, H L; Marsiske, H; Messner, R; Müller, D R; O'Grady, C P; Ozcan, V E; Perazzo, A; Perl, M; Petrak, S; Ratcliff, B N; Robertson, S H; Roodman, A; Salnikov, A A; Schindler, R H; Schwiening, J; Simi, G; Snyder, A; Soha, A; Stelzer, J; Su, D; Sullivan, M K; Vavra, J; Wagner, S R; Weaver, M; Weinstein, A J R; Wisniewski, W J; Wright, D H; Young, C C; Burchat, Patricia R; Edwards, A J; Meyer, T I; Petersen, B A; Roat, C; Ahmed, S; Alam, M S; Ernst, J A; Saleem, M; Wappler, F R; Bugg, W; Krishnamurthy, M; Spanier, S M; Eckmann, R; Kim, H; Ritchie, J L; Schwitters, R F; Izen, J M; Kitayama, I; Lou, X C; Ye, S; Bianchi, F; Bóna, M; Gallo, F; Gamba, D; Borean, C; Bosisio, L; Della Ricca, G; Dittongo, S; Grancagnolo, S; Lanceri, L; Poropat, P; Vitale, L; Vuagnin, G; Panvini, R S; Banerjee, Sw; Brown, C M; Fortin, D; Jackson, P D; Kowalewski, R V; Roney, J M; Band, H R; Dasu, S; Datta, M; Eichenbaum, A M; Johnson, J R; Kutter, P E; Li, H; Liu, R; Di Lodovico, F; Mihályi, A; Mohapatra, A K; Pan, Y; Prepost, R; Sekula, S J; Von Wimmersperg-Töller, J H; Wu, J; Wu, S L; Yu, Z; Neal, H

    2004-01-01

    We present a measurement of the branching fraction of the decay B+- --> chi_c0 K+- from a sample of 89 million BB pairs collected by the BaBar detector at the PEP-II asymmetric-energy B Factory at SLAC. The chi_c0 meson is reconstructed through its two-body decays to pi+ pi- and K+ K-. We measure BR(B+- --> chi_c0 K+-)* BR(chi_c0 --> pi+ pi-) = (1.32^{+0.28}_{-0.27}(stat) +- 0.09(syst))*10^-6 and BR(B+- --> chi_c0 K+-) * BR(chi_c0 --> K+ K-) = (1.49^{+0.36}_{-0.34}(stat) +- 0.11(syst))* 10^-6. Using the known values for the chi_c0 decays branching fractions, we combine these results to obtain BR(B+- --> chi_c0 K+-) = (2.7+-0.7)* 10^-4.

  10. The best approximation of $P-$ metric space of $\\chi^{2}-$ defined by Musielak

    Directory of Open Access Journals (Sweden)

    NAGARAJAN SUBRAMANIAN

    2014-06-01

    Full Text Available In this paper, we introduce the idea of constructing sequence space $\\chi^{2}$ of best approximation in $p-$ metric defined by Musielak and also construct some general topological properties of approximation of $\\chi^{2}$

  11. Effect of tai chi exercise on proprioception of ankle and knee joints in old people

    OpenAIRE

    Xu, D.; Hong, Y; Li, J.; Chan, K.

    2004-01-01

    Objectives: To assess if tai chi, a traditional Chinese form of exercise, could improve proprioception in old people and if the effects of tai chi on proprioception are more evident than other exercise forms in the elderly.

  12. Studies in organic and physical photochemistry - an interdisciplinary approach.

    Science.gov (United States)

    Oelgemöller, Michael; Hoffmann, Norbert

    2016-08-21

    Traditionally, organic photochemistry when applied to synthesis strongly interacts with physical chemistry. The aim of this review is to illustrate this very fruitful interdisciplinary approach and cooperation. A profound understanding of the photochemical reactivity and reaction mechanisms is particularly helpful for optimization and application of these reactions. Some typical reactions and particular aspects are reported such as the Norrish-Type II reaction and the Yang cyclization and related transformations, the [2 + 2] photocycloadditions, particularly the Paternò-Büchi reaction, photochemical electron transfer induced transformations, different kinds of catalytic reactions such as photoredox catalysis for organic synthesis and photooxygenation are discussed. Particular aspects such as the structure and reactivity of aryl cations, photochemical reactions in the crystalline state, chiral memory, different mechanisms of hydrogen transfer in photochemical reactions or fundamental aspects of stereoselectivity are discussed. Photochemical reactions are also investigated in the context of chemical engineering. Particularly, continuous flow reactors are of interest. Novel reactor systems are developed and modeling of photochemical transformations and different reactors play a key role in such studies. This research domain builds a bridge between fundamental studies of organic photochemical reactions and their industrial application. PMID:27381273

  13. Search for Factorization-Suppressed $B \\to{ chi_c} K^(*)$ Decays

    CERN Document Server

    Aubert, B; Boutigny, D; Couderc, F; Karyotakis, Yu; Lees, J P; Poireau, V; Tisserand, V; Zghiche, A; Graugès-Pous, E; Palano, A; Pompili, A; Chen, J C; Qi, N D; Rong, G; Wang, P; Zhu, Y S; Eigen, G; Ofte, I; Stugu, B; Abrams, G S; Borgland, A W; Breon, A B; Brown, D N; Button-Shafer, J; Cahn, R N; Charles, E; Day, C T; Gill, M S; Gritsan, A V; Groysman, Y; Jacobsen, R G; Kadel, R W; Kadyk, J; Kerth, L T; Kolomensky, Yu G; Kukartsev, G; Lynch, G; Mir, L M; Oddone, P J; Orimoto, T J; Pripstein, M; Roe, N A; Ronan, Michael T; Wenzel, W A; Barrett, M; Ford, K E; Harrison, T J; Hart, A J; Hawkes, C M; Morgan, S E; Watson, A T; Fritsch, M; Goetzen, K; Held, T; Koch, H; Lewandowski, B; Pelizaeus, M; Schröder, T; Steinke, M; Boyd, J T; Chevalier, N; Cottingham, W N; Kelly, M P; Latham, T E; Wilson, F F; Çuhadar-Dönszelmann, T; Hearty, C; Knecht, N S; Mattison, T S; McKenna, J A; Thiessen, D; Khan, A; Kyberd, P; Teodorescu, L; Blinov, A E; Blinov, V E; Druzhinin, V P; Golubev, V B; Ivanchenko, V N; Kravchenko, E A; Onuchin, A P; Serednyakov, S I; Skovpen, Yu I; Solodov, E P; Yushkov, A N; Best, D; Bruinsma, M; Chao, M; Eschrich, I; Kirkby, D; Lankford, A J; Mandelkern, M A; Mommsen, R K; Röthel, W; Stoker, D P; Buchanan, C; Hartfiel, B L; Weinstein, A J R; Foulkes, S D; Gary, J W; Long, O; Shen, B C; Wang, K; Del Re, D; Hadavand, H K; Hill, E J; MacFarlane, D B; Paar, H P; Rahatlou, S; Sharma, V; Berryhill, J W; Campagnari, C; Cunha, A; Dahmes, B; Hong, T M; Lu, A; Mazur, M A; Richman, J D; Verkerke, W; Beck, T W; Eisner, A M; Heusch, C A; Kroseberg, J; Lockman, W S; Nesom, G; Schalk, T; Schumm, B A; Seiden, A; Spradlin, P; Williams, D C; Wilson, M G; Albert, J; Chen, E; Dubois-Felsmann, G P; Dvoretskii, A; Hitlin, D G; Narsky, I; Piatenko, T; Porter, F C; Ryd, A; Samuel, A; Yang, S; Jayatilleke, S M; Mancinelli, G; Meadows, B T; Sokoloff, M D; Blanc, F; Bloom, P; Chen, S; Ford, W T; Nauenberg, U; Olivas, A; Rankin, P; Ruddick, W O; Smith, J G; Ulmer, K A; Zhang, J; Zhang, L; Chen, A; Eckhart, E A; Harton, J L; Soffer, A; Toki, W H; Wilson, R J; Zeng, Q; Spaan, B; Altenburg, D; Brandt, T; Brose, J; Dickopp, M; Feltresi, E; Hauke, A; Lacker, H M; Nogowski, R; Otto, S; Petzold, A; Schubert, J; Schubert, Klaus R; Schwierz, R; Sundermann, J E; Bernard, D; Bonneaud, G R; Grenier, P; Schrenk, S; Thiebaux, C; Vasileiadis, G; Verderi, M; Bard, D J; Clark, P J; Muheim, F; Playfer, S; Xie, Y; Andreotti, M; Azzolini, V; Bettoni, D; Bozzi, C; Calabrese, R; Cibinetto, G; Luppi, E; Negrini, M; Piemontese, L; Sarti, A; Anulli, F; Baldini-Ferroli, R; Calcaterra, A; De Sangro, R; Finocchiaro, G; Patteri, P; Peruzzi, I M; Piccolo, M; Zallo, A; Buzzo, A; Capra, R; Contri, R; Crosetti, G; Lo Vetere, M; Macri, M; Monge, M R; Passaggio, S; Patrignani, C; Robutti, E; Santroni, A; Tosi, S; Bailey, S; Brandenburg, G; Chaisanguanthum, K S; Morii, M; Won, E; Dubitzky, R S; Langenegger, U; Marks, J; Uwer, U; Bhimji, W; Bowerman, D A; Dauncey, P D; Egede, U; Gaillard, J R; Morton, G W; Nash, J A; Nikolich, M B; Taylor, G P; Charles, M J; Grenier, G J; Mallik, U; Cochran, J; Crawley, H B; Lamsa, J; Meyer, W T; Prell, S; Rosenberg, E I; Rubin, A E; Yi, J; Arnaud, N; Davier, M; Giroux, X; Grosdidier, G; Höcker, A; Le Diberder, F R; Lepeltier, V; Lutz, A M; Petersen, T C; Plaszczynski, S; Schune, M H; Wormser, G; Cheng, C H; Lange, D J; Simani, M C; Wright, D M; Bevan, A J; Chavez, C A; Coleman, J P; Forster, I J; Fry, J R; Gabathuler, Erwin; Gamet, R; Hutchcroft, D E; Parry, R J; Payne, D J; Touramanis, C; Cormack, C M; Di Lodovico, F; Brown, C L; Cowan, G; Flack, R L; Flächer, H U; Green, M G; Jackson, P S; McMahon, T R; Ricciardi, S; Salvatore, F; Winter, M A; Brown, D; Davis, C L; Allison, J; Barlow, N R; Barlow, R J; Hodgkinson, M C; Lafferty, G D; Williams, J C; Chen, C; Farbin, A; Hulsbergen, W D; Jawahery, A; Kovalskyi, D; Lae, C K; Lillard, V; Roberts, D A; Blaylock, G; Dallapiccola, C; Hertzbach, S S; Kofler, R; Koptchev, V B; Moore, T B; Saremi, S; Stängle, H; Willocq, S; Cowan, R; Koeneke, K; Sciolla, G; Sekula, S J; Taylor, F; Yamamoto, R K; Patel, P M; Robertson, S H; Lazzaro, A; Lombardo, V; Palombo, F; Bauer, J M; Cremaldi, L M; Eschenburg, V; Godang, R; Kroeger, R; Reidy, J; Sanders, D A; Summers, D J; Zhao, H W; Brunet, S; Côté, D; Taras, P; Nicholson, H; Cavallo, N; Fabozzi, F; Gatto, C; Lista, L; Monorchio, D; Paolucci, P; Piccolo, D; Sciacca, C; Baak, M; Bulten, H; Raven, G; Snoek, H L; Wilden, L; Jessop, C P; LoSecco, J M; Allmendinger, T; Benelli, G; Gan, K K; Honscheid, K; Hufnagel, D; Kagan, H; Kass, R; Pulliam, T; Rahimi, A M; Ter-Antonian, R; Wong, Q K; Brau, J E; Frey, R; Igonkina, O; Lu, M; Potter, C T; Sinev, N B; Strom, D; Torrence, E; Colecchia, F; Dorigo, A; Galeazzi, F; Margoni, M; Morandin, M; Posocco, M; Rotondo, M; Simonetto, F; Stroili, R; Voci, C; Benayoun, M; Briand, H; Chauveau, J; David, P; La Vaissière, C de; Del Buono, L; Hamon, O; John, M J J; Leruste, P; Malcles, J; Ocariz, J; Roos, L; Therin, G; Behera, P K; Gladney, L; Guo, Q H; Panetta, J; Biasini, M; Covarelli, R; Pioppi, M; Angelini, C; Batignani, G; Bettarini, S; Bondioli, M; Bucci, F; Calderini, G; Carpinelli, M; Forti, F; Giorgi, M A; Lusiani, A; Marchiori, G; Morganti, M; Neri, N; Paoloni, E; Rama, M; Rizzo, G; Simi, G; Walsh, J; Haire, M; Judd, D; Paick, K; Wagoner, D E; Danielson, N; Elmer, P; Lau, Y P; Lü, C; Miftakov, V; Olsen, J; Smith, A J S; Telnov, A V; Bellini, F; Cavoto, G; D'Orazio, A; Di Marco, E; Faccini, R; Ferrarotto, F; Ferroni, F; Gaspero, M; Li Gioi, L; Mazzoni, M A; Morganti, S; Pierini, M; Piredda, G; Polci, F; Safai-Tehrani, F; Voena, C; Christ, S; Schröder, H; Wagner, G; Waldi, R; Adye, T; De Groot, N; Franek, B J; Gopal, G P; Olaiya, E O; Aleksan, Roy; Emery, S; Gaidot, A; Ganzhur, S F; Giraud, P F; Hamel de Monchenault, G; Kozanecki, Witold; Legendre, M; London, G W; Mayer, B; Schott, G; Vasseur, G; Yéche, C; Zito, M; Purohit, M V; Weidemann, A W; Wilson, J R; Yumiceva, F X; Abe, T; Allen, M; Aston, D; Bartoldus, R; Berger, N; Boyarski, A M; Buchmüller, O L; Claus, R; Convery, M R; Cristinziani, M; De Nardo, Gallieno; Dingfelder, J C; Dong, D; Dorfan, J; Dujmic, D; Dunwoodie, W M; Fan, S; Field, R C; Glanzman, T; Gowdy, S J; Hadig, T; Halyo, V; Hast, C; Hrynóva, T; Innes, W R; Kelsey, M H; Kim, P; Kocian, M L; Leith, D W G S; Libby, J; Luitz, S; Lüth, V; Lynch, H L; Marsiske, H; Messner, R; Müller, D R; O'Grady, C P; Ozcan, V E; Perazzo, A; Perl, M; Ratcliff, B N; Roodman, A; Salnikov, A A; Schindler, R H; Schwiening, J; Snyder, A; Soha, A; Stelzer, J; Strube, J; Su, D; Sullivan, M K; Thompson, J; Vavra, J; Wagner, S R; Weaver, M; Wisniewski, W J; Wittgen, M; Wright, D H; Yarritu, A K; Young, C C; Burchat, Patricia R; Edwards, A J; Majewski, S A; Petersen, B A; Roat, C; Ahmed, M; Ahmed, S; Alam, M S; Ernst, J A; Saeed, M A; Saleem, M; Wappler, F R; Bugg, W; Krishnamurthy, M; Spanier, S M; Eckmann, R; Kim, H; Ritchie, J L; Satpathy, A; Schwitters, R F; Izen, J M; Kitayama, I; Lou, X C; Ye, S; Bianchi, F; Bóna, M; Gallo, F; Gamba, D; Bosisio, L; Cartaro, C; Cossutti, F; Della Ricca, G; Dittongo, S; Grancagnolo, S; Lanceri, L; Poropat, P; Vitale, L; Vuagnin, G; Martínez-Vidal, F; Panvini, R S; Banerjee, S; Bhuyan, B; Brown, C M; Fortin, D; Jackson, P D; Kowalewski, R V; Roney, J M; Sobie, R J; Back, J J; Harrison, P F; Mohanty, G B; Band, H R; Chen, X; Cheng, B; Dasu, S; Datta, M; Eichenbaum, A M; Flood, K T; Graham, M; Hollar, J J; Johnson, J R; Kutter, P E; Li, H; Liu, R; Mihályi, A; Pan, Y; Prepost, R; Tan, P; Von Wimmersperg-Töller, J H; Wu, J; Wu, S L; Yu, Z; Greene, M G; Neal, H

    2005-01-01

    We search for the factorization-suppressed decays B -> chi_c0 K(*) and B -> chi_c2 K(*), with chi_c0 and chi_c2 decaying into J/psi gamma using a sample of 124 10^6 BBbar events collected with the BABAR detector at the PEP-II storage ring of the Stanford Linear Accelerator Center.

  14. An Interdisciplinary Concept of Activity

    Directory of Open Access Journals (Sweden)

    Andy Blunden

    2009-09-01

    Full Text Available It is suggested that if Cultural-Historical Activity Theory (CHAT is to fulfil its potential as an approach to cultural and historical science in general, then an interdisciplinary concept of activity is needed. Such a concept of activity would provide a common foundation for all the human sciences, underpinning concepts of, for example, state and social movement equally as, for example, learning and personality. For this is needed a clear conception of the ‘unit of analysis’ of activity, i.e., of what constitutes ‘an activity’, and a clear distinction between the unit of analysis and the substance, i.e., ultimate reality underlying all the human sciences: artifact-mediated joint activity. It is claimed that the concept of ‘project collaboration’ – the interaction between two or more persons in pursuit of a common objective – forms such a unit of activity, the single ‘molecule’ in terms of which both sociological and psychological phenomena can be theorised. It is suggested that such a clarification of the notion of activity allows us to see how individual actions and societal activities mutually constitute one another and are each construed in the light of the other.

  15. Interdisciplinary Symposium on Complex Systems

    CERN Document Server

    Zelinka, Ivan; Rössler, Otto

    2014-01-01

    The book you hold in your hands is the outcome of the "ISCS 2013: Interdisciplinary Symposium on Complex Systems" held at the historical capital of Bohemia as a continuation of our series of symposia in the science of complex systems. Prague, one of the most beautiful European cities, has its own beautiful genius loci. Here, a great number of important discoveries were made and many important scientists spent fruitful and creative years to leave unforgettable traces. The perhaps most significant period was the time of Rudolf II who was a great supporter of the art and the science and attracted a great number of prominent minds to Prague. This trend would continue. Tycho Brahe, Niels Henrik Abel, Johannes Kepler, Bernard Bolzano, August Cauchy Christian Doppler, Ernst Mach, Albert Einstein and many others followed developing fundamental mathematical and physical theories or expanding them. Thus in the beginning of the 17th century, Kepler formulated here the first two of his three laws of planetary motion on ...

  16. Corporate Knowledge Management: Interdisciplinary Approach

    Directory of Open Access Journals (Sweden)

    Andrei Kapterev

    2012-06-01

    Full Text Available Governing the professional and intellectual potential – interdisciplinary field of scientific research and a systematic process of creating, using and developing the innovation technologies of transforming the individual knowledge and specialists’ experience in such a way that would apply the knowledge and experience to the processes, services and products offered by an organization to reach its strategic goals. From the technological standpoint, governing the professional and intellectual potential represents modeling, forming, using and developing the corporate system of governing the professional and intellectual potential, including: (a corporate model of external environment and internal business processes; (b corporate information system; (c corporate knowledge management system (KMS; and (d corporate learning management system (LMS. Author considers structuring knowledge using this model rather valuable during the stage of forming the governance system of the professional and intellectual potential. Understanding, i.e., explicit definition of these factors, would allow for constant observation of the behavioral trends and for organizing the activity in a way conducive for influencing the favorable change of these factors. In addition, the presence of the critical management factor (CMF system enables one to check the significance of any activity (i.e., any processes within a company against these factors.

  17. Building Interdisciplinary Research Models: A Didactic Course to Prepare Interdisciplinary Scholars and Faculty

    OpenAIRE

    Larson, Elaine L.; Begg, Melissa D.

    2011-01-01

    Many academicians assume that anyone can engage in interdisciplinary research, but it is clear that successful interdisciplinary efforts require mastery of specific competencies which can be learned and improved. This article describes the development and implementation of a course designed for Master’s, pre- and post-doctoral students and research faculty on models of interdisciplinary research skills, based on a set of core competencies. Major challenges included working through institution...

  18. Lecture Notes in Statistics. 3rd Semester

    DEFF Research Database (Denmark)

    The lecture note is prepared to meet the requirements of the curriculum for the 3rd smester course in statistics at the Aarhus School of Business.......The lecture note is prepared to meet the requirements of the curriculum for the 3rd smester course in statistics at the Aarhus School of Business....

  19. Lectures on hydrodynamic fluctuations in relativistic theories

    International Nuclear Information System (INIS)

    These are pedagogical lecture notes on hydrodynamic fluctuations in normal relativistic fluids. The lectures discuss correlation functions of conserved densities in thermal equilibrium, interactions of the hydrodynamic modes, an effective action for viscous fluids and the breakdown of the derivative expansion in hydrodynamics. (topical review)

  20. Sir Nevill F. Mott Lecture Award

    NARCIS (Netherlands)

    Schropp, R.E.I.

    2010-01-01

    The Mott Lecture is awarded to scientists working in the tradition of Nobel laureate Sir Nevill F. Mott, with exceptional contributions to the fields important to the ICANS conference. The ICANS23 Mott Lecture was awarded to Prof. Dr. Sigurd Wagner of Princeton University. He is recognized for his g

  1. Short lecture series in sustainable product development

    DEFF Research Database (Denmark)

    McAloone, Tim C.

    2005-01-01

    Three lectures in sustainable product development models, methods and mindsets should give insight into the way of thinking about the environment when developing products. The first two lectures will guide you through: . Environmental problems in industry & life-cycle thinking . Professional...

  2. The Humanity of English. 1972 Distinguished Lectures.

    Science.gov (United States)

    National Council of Teachers of English, Urbana, IL.

    This is a collection of lectures by distinguished members of the English profession who were invited to lecture to schools located far from large urban and cultural centers. Included are papers by: John H. Fisher, "Truth Versus Beauty: An Inquiry into the Function of Language and Literature in an Articulate Society"; Walter Loban, "The Green…

  3. Teaching Bioethics from an Interdisciplinary Perspective.

    Science.gov (United States)

    Singleton, Rivers, Jr.; Brock, D. Heyward

    1982-01-01

    Outlines an interdisciplinary workshop in bioethics for secondary teachers taught by a team consisting of a scientist, a philosopher, and a literary critic. Discusses definitions, topics, reading selections, problems, and value. (DC)

  4. Ovarian cancer in an interdisciplinary context

    DEFF Research Database (Denmark)

    Seibæk, Lene

    quality of treatment.   Patients/ Methods We developed an interdisciplinary programme including patient data from the records of doctors, nurses, anaesthetists and observations. This programme was applied on a population of 65 women with ovarian malignancies. Subsequently analyses were performed...

  5. Interdisciplinary Collaborative Mathematics: Standards Correlation Guide

    Science.gov (United States)

    Chiatula, Victoria Oliaku

    2015-01-01

    This guide outlines teacher preparation, professional association, and Common Core State Standards aligned to an "interdisciplinary collaborative mathematics" approach using Junior Achievement educational programs within a Math Methods course to train pre-service elementary teachers to teach math.

  6. Orientations and Outcome of Interdisciplinary Research

    DEFF Research Database (Denmark)

    Valentin, Finn; Norn, Maria Theresa; Alkærsig, Lars

    2016-01-01

    interdisciplinary research spanning basic and applied research influences the output of academic research, and (3) how different disciplinary distance in interdisciplinary research contributes to reputational benefits of researchers. We find that for some types of collaboration, interdisciplinarity results in more......The importance of interdisciplinary research in accelerating the progress and commercialization of science is widely recognized, yet little is known about how academic research self-organizes towards interdisciplinarity. In this paper, we therefore explore the micro-level behavior of researchers as...... they venture into a promising space for interdisciplinary research, namely translational research—a bridge between basic and applied biomedical research. More specifically, we ask (1) whether the researchers who choose to engage in translational research have a strong scientific record, (2) how...

  7. Language for International Communication: Linking Interdisciplinary Perspectives

    OpenAIRE

    University of Latvia. Faculty of Humanities, Department of English Studies and Centre for Applied Linguistics

    2014-01-01

    This collection contains papers delivered at the 2nd international symposium "Language for International Communication: Linking Interdisciplinary Perspectives" held at the University of Latvia, Latvia, on 23-24 May 2013.

  8. Tai Chi and Qi Gong for Health and Well-Being

    Medline Plus

    Full Text Available ... Tai Chi and Qi Gong for Health and Well-Being Share: taichi_nccamIMG_2962.jpg © Mariann Seriff ... Tai Chi and Qi Gong for Health and Well-Being Video › Tai Chi and Qi Gong for ...

  9. Interdisciplinary communication in the intensive care unit

    OpenAIRE

    Reader, Tom W; Flin, R; Mearns, Kathryn; Cuthbertson, Brian H

    2007-01-01

    Background. Patient safety research has shown poor communication among intensive care unit (ICU) nurses and doctors to be a common causal factor underlying critical incidents in intensive care. This study examines whether ICU doctors and nurses have a shared perception of interdisciplinary communication in the UK ICU. Methods. Cross-sectional survey of ICU nurses and doctors in four UK hospitals using a previously established measure of ICU interdisciplinary collaboration. Results. A sample o...

  10. Trending Approaches in Innovation Using Interdisciplinary Methods

    OpenAIRE

    Robert Cherinka; Joseph Prezzama

    2013-01-01

    This presentation presents a study of approaches to foster open innovation, including the use of crowds and social media to leverage and utilize interdisciplinary sources. Crowds are inherently interdisciplinary, and they contain experts. Wisdom can be extracted from these sources. However, the peril of bias and "group think" could be detrimental if not carefully exposed. The process of innovation benefits from a diversity of skills and perspectives. There are technology and communication tre...

  11. Integrated interdisciplinary training in the radiological sciences

    OpenAIRE

    Brenner, D J; Vazquez, M.; M. Buonanno; Amundson, S A; Bigelow, A W; Garty, G.; Harken, A.D.; Hei, T K; Marino, S A; Ponnaiya, B; Randers-Pehrson, G.; Xu, Y

    2014-01-01

    The radiation sciences are increasingly interdisciplinary, both from the research and the clinical perspectives. Beyond clinical and research issues, there are very real issues of communication between scientists from different disciplines. It follows that there is an increasing need for interdisciplinary training courses in the radiological sciences. Training courses are common in biomedical academic and clinical environments, but are typically targeted to scientists in specific technical fi...

  12. Interdisciplinary approach for improved esthetic results

    Directory of Open Access Journals (Sweden)

    G Sriram

    2014-01-01

    Full Text Available This clinical report describes an interdisciplinary (orthodontic, prosthodontics and operative dentist approach for the coordinated treatment of an adult patient diagnosed with severely mutilated dentition secondary to caries lesion warranting restorative procedures that was facilitated with orthodontic treatment. The patient′s specific esthetic expectation for the anterior teeth and improved smile were successfully met through planned treatment, including orthodontic tooth movement, restoration and porcelain conversion crowns. Such coordinated interdisciplinary evaluations and treatment are necessary for improved esthetics.

  13. Dicty_cDB: CHI614 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 850F7 (Roswell Park Cancer Institute Human BAC Library) complete sequence. 38 0.53 5 CR382125 |CR382125.1 Kluyveromyces lact...AAACCTTATTATCCA ATATTTTATTATCAGGTTTTAGG Length of 3' end seq. 743 Connected seq. ID CHI614P Connected seq. >...IILVXIINXVYNXFSGHS SEHTKNXLKXASKTSKKX--- ---DNHTFLRENRDPVKKMKHLPQGIL*sksirerffigfgtwhwwcts...ENRDPVKKMKHLPQGIL*sksirerffigfgtwhwwctsfsqss*ti*lc isitllvatyss*yv*tlvlcrn*sfmrtqisiikhwsrsksystmskrw*nya*ysts...d in the head. 40 2.1 2 CR238085 |CR238085.1 Forward strand read from insert in 5'HPRT insertion

  14. Dicty_cDB: CHI740 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHI740 (Link to dictyBase) - - - Contig-U16419-1 - (Link to Original site) ... krftxchenctx** Frame B: ---xkttslvfkmxtks*m*i**prssmlc kgsp**mfikmshmamnvklitmvknvxsd pidhhhqkfvh*dahqnmnv ... slrcptwp*m*s*sqw*rmlxqi p*ttttrslfikmptkt*m*i**sw*kmlc kdsl**sl*frlw*rf*m*n*t*wfkmlc p frkttpttt*km**empxrp ... *m*s*stwkrmlrccp*txtkmlfkmstkt*m*sqpxw*r mlc *sspr*mfiemstrp*m*s*stwkrmxrccp*tttemlikmstkt*m*nqs ... lw*rml c *k*k*lfnl*rpktvkekvyxvp*klyxlik Homology vs CSM-cD ...

  15. Connecting art and science: An interdisciplinary strategy and its impact on the affective domain of community college human anatomy students

    Science.gov (United States)

    Petti, Kevin

    Educational objectives are often described within the framework of a three-domain taxonomy: cognitive, affective and psychomotor. While most of the research on educational objectives has focused on the cognitive domain, the research that has been conducted on the affective domain, which speaks to emotions, attitudes, and values, has identified a number of positive outcomes. One approach to enhancing the affective domain is that of interdisciplinary education. Science education research in the realm of interdisciplinary education and affective outcomes is limited; especially research conducted on community college students of human anatomy. This project investigated the relationship between an interdisciplinary teaching strategy and the affective domain in science education by utilizing an interdisciplinary lecture in a human anatomy class. Subjects were anatomy students in a California community college who listened to a one-hour lecture describing the cultural, historical and scientific significance of selected pieces of art depicting human dissection in European medieval and Renaissance universities. The focus was on how these renderings represent the state of anatomy education during their respective eras. After listening to the lecture, subjects were administered a 35-question survey that was composed of 14 demographic questions and 21 Likert-style statements that asked respondents to rate the extent to which the intervention influenced their affective domain. Descriptive statistics were then used to determine which component of the affective domain was most influenced, and multiple regression analysis was used to examine the extent to which individual differences along the affective continuum were explained by select demographic measures such as gender, race/ethnicity, education level, and previous exposure to science courses. Results indicate that the interdisciplinary intervention had a positive impact on every component of the affective domain hierarchy

  16. Interdisciplinary research has consistently lower funding success.

    Science.gov (United States)

    Bromham, Lindell; Dinnage, Russell; Hua, Xia

    2016-06-30

    Interdisciplinary research is widely considered a hothouse for innovation, and the only plausible approach to complex problems such as climate change. One barrier to interdisciplinary research is the widespread perception that interdisciplinary projects are less likely to be funded than those with a narrower focus. However, this commonly held belief has been difficult to evaluate objectively, partly because of lack of a comparable, quantitative measure of degree of interdisciplinarity that can be applied to funding application data. Here we compare the degree to which research proposals span disparate fields by using a biodiversity metric that captures the relative representation of different fields (balance) and their degree of difference (disparity). The Australian Research Council's Discovery Programme provides an ideal test case, because a single annual nationwide competitive grants scheme covers fundamental research in all disciplines, including arts, humanities and sciences. Using data on all 18,476 proposals submitted to the scheme over 5 consecutive years, including successful and unsuccessful applications, we show that the greater the degree of interdisciplinarity, the lower the probability of being funded. The negative impact of interdisciplinarity is significant even when number of collaborators, primary research field and type of institution are taken into account. This is the first broad-scale quantitative assessment of success rates of interdisciplinary research proposals. The interdisciplinary distance metric allows efficient evaluation of trends in research funding, and could be used to identify proposals that require assessment strategies appropriate to interdisciplinary research. PMID:27357795

  17. Two-Photon Widths of the chi_cJ States of Charmonium

    CERN Document Server

    Ecklund, K M; Savinov, V; López, A; Méndez, H; Ramírez, J; Ge, J Y; Miller, D H; Shipsey, I P J; Xin, B; Adams, G S; Anderson, M; Cummings, J P; Danko, I; Hu, D; Moziak, B; Napolitano, J; He, Q; Insler, J; Muramatsu, H; Park, C S; Thorndike, E H; Yang, F; Artuso, M; Blusk, S; Khalil, S; Li, J; Mountain, R; Nisar, S; Randrianarivony, K; Sultana, N; Skwarnicki, T; Stone, S; Wang, J C; Zhang, L M; Bonvicini, G; Cinabro, D; Dubrovin, M; Lincoln, A; Naik, P; Rademacker, J; Asner, D M; Edwards, K W; Reed, J; Briere, R A; Ferguson, T; Tatishvili, G; Vogel, H; Watkins, M E; Rosner, J L; Alexander, J P; Cassel, D G; Duboscq, J E; Ehrlich, R; Fields, L; Galik, R S; Gibbons, L; Gray, R; Gray, S W; Hartill, D L; Hertz, D; Hunt, J M; Kandaswamy, J; Kreinick, D L; Kuznetsov, V E; Ledoux, J; Mahlke-Krüger, H; Mohapatra, D; Onyisi, P U E; Patterson, J R; Peterson, D; Riley, D; Ryd, A; Sadoff, A J; Shi, X; Stroiney, S; Sun, W M; Wilksen, T; Athar, S B; Patel, R; Yelton, J; Rubin, P; Eisenstein, B I; Karliner, I; Mehrabyan, S; Lowrey, N; Selen, M; White, E J; Wiss, J; Mitchell, R E; Shepherd, M R; Besson, D; Pedlar, T K; Cronin-Hennessy, D; Gao, K Y; Hietala, J; Kubota, Y; Klein, T; Lang, B W; Poling, R; Scott, A W; Zweber, P; Dobbs, S; Metreveli, Z; Seth, K K; Tomaradze, A G; Libby, J; Powell, A; Wilkinson, G

    2008-01-01

    Using a data sample of 24.5 million psi(2S) the reactions psi(2S)->gamma chi_cJ, chi_cJ->gamma gamma have been studied for the first time to determine the two-photon widths of the chi_cJ states of charmonium in their decay into two photons. The measured quantities are B(psi(2S)->gamma chi_c0)xB(chi_c0->gamma gamma)=(2.22+-0.32+-0.10)x10^-5, and B(psi(2S)->gamma chi_c2)xB(chi_c2->gamma gamma)=(2.70+-0.28+-0.15)x10^-5. Using values for B(psi(2S)->gamma chi_c0,c2) and \\Gamma(chi_c0,c2) from the literature the two-photon widths are derived to be \\Gamma_{gamma gamma}(chi_c0)=(2.53+-0.37+-0.26) keV, \\Gamma_{gamma gamma}(chi_c2)=(0.60+-0.06+-0.06) keV, and R=\\Gamma_{gamma gamma}(chi_c2)/\\Gamma_{gamma gamma}(chi_c0)= 0.237+-0.043+-0.034. The importance of the measurement of R is emphasized. For the forbidden transition, chi_c1->gamma gamma, an upper limit of \\Gamma_{gamma gamma}(chi_c1)<0.03 keV is established.

  18. Lecture notes: Astrophysical fluid dynamics

    CERN Document Server

    Ogilvie, Gordon I

    2016-01-01

    These lecture notes and example problems are based on a course given at the University of Cambridge in Part III of the Mathematical Tripos. Fluid dynamics is involved in a very wide range of astrophysical phenomena, such as the formation and internal dynamics of stars and giant planets, the workings of jets and accretion discs around stars and black holes, and the dynamics of the expanding Universe. Effects that can be important in astrophysical fluids include compressibility, self-gravitation and the dynamical influence of the magnetic field that is 'frozen in' to a highly conducting plasma. The basic models introduced and applied in this course are Newtonian gas dynamics and magnetohydrodynamics (MHD) for an ideal compressible fluid. The mathematical structure of the governing equations and the associated conservation laws are explored in some detail because of their importance for both analytical and numerical methods of solution, as well as for physical interpretation. Linear and nonlinear waves, includin...

  19. Academic Training Lecture Regular Programme

    CERN Multimedia

    2012-01-01

    Ultra-High Energy Cosmic Rays (1/3), by Maria Teresa Dova (Universidad Nacional de La Plata & CONICET, Argentina).   Wednesday, April 25, 2012 from 11:00 to 12:00 (Europe/Zurich) at CERN (500-1-001 - Main Auditorium ) The origin of the highest energy cosmic rays (UHECR) with energies above 1000 TeV, is still unknown. The discovery of their sources will reveal the engines of the most energetic astrophysical accelerators in the universe. In these lectures we present the recent observational results from HiRes, Telescope Array and Pierre Auger Observatory as well as (some of) the possible astrophysical origins of UHECR. These experiments deal with particle interactions at energies orders of magnitude higher than achieved in terrestrial accelerators. Organised by Luis Alvarez-Gaume.

  20. Two lectures on track structure

    International Nuclear Information System (INIS)

    In a series of two lectures the principles of track structure theory, developed by Katz and collaborators, are reviewed. The text is intended to serve as an introduction to the theory. Applications of the model to c-hit physical detectors and to biological systems are reviewed. The model relates the signal of a detector after doses of X and gamma radiations to its signal after heavy charged particle irradiations, and is applicable to a variety of physical dosimeters: alanine, thermoluminescence and the Fricke dosimeters, to the inactivation of enzymes and viruses, and to biological systems: description of survival and neoplastic transformations in mammalian cells. Application of the model to heavy-ion cancer radiotherapy and to radiation protection is discussed as well as the controversies around the track structure approach. The model suggests new insights to fundamental research in detector theory and in radiobiology and in their applications in radiotherapy and radiation protection. 41 refs., 39 figs. (author)

  1. Lectures on density wave theory

    International Nuclear Information System (INIS)

    This is a simplified version of the spiral density wave theory intended as a first introduction into this important new field of galactic astronomy. I have chosen the gas-dynamical approach, since it is so much simpler than the usual one of collisionless stellar dynamics, and the results do hardly differ. This is especially true for all those problems connected with the dispersion equations. The qualitative behaviour of the equations as given here and Lin's dispersion equation is the same, the differences are only small - less than the uncertainty caused by the various approximations. The lectures cover only the linear theory. This should not be understood to imply the conviction that non-linear effects are of no importance but reflects only the transitory state the density wave theory still is in. While there can hardly be any doubts that most spiral arms are density-wave-like features, the precise details are still in dispute. (orig.)

  2. Collide@CERN - public lecture

    CERN Multimedia

    2012-01-01

    CERN, the Republic and Canton of Geneva and the City of Geneva are delighted to invite you to a public lecture by Gilles Jobin, first winner of the Collide@CERN Geneva Dance and Performance Artist-in-residence Prize, and his CERN inspiration partner, Joao Pequenao. They will present their work in dance and science at the Globe of Science and Innovation on Wednesday, 23 May 2012 at 7 p.m. (doors open at 6.30 p.m.).   
                                                  Programme 19:00 Opening address by - Professor Rolf-Dieter Heuer, CERN Director-General, - Ariane Koek...

  3. Lectures on Gravity and Entanglement

    CERN Document Server

    Van Raamsdonk, Mark

    2016-01-01

    The AdS/CFT correspondence provides quantum theories of gravity in which spacetime and gravitational physics emerge from ordinary non-gravitational quantum systems with many degrees of freedom. Recent work in this context has uncovered fascinating connections between quantum information theory and quantum gravity, suggesting that spacetime geometry is directly related to the entanglement structure of the underlying quantum mechanical degrees of freedom and that aspects of spacetime dynamics (gravitation) can be understood from basic quantum information theoretic constraints. In these notes, we provide an elementary introduction to these developments, suitable for readers with some background in general relativity and quantum field theory. The notes are based on lectures given at the CERN Spring School 2014, the Jerusalem Winter School 2014, the TASI Summer School 2015, and the Trieste Spring School 2015.

  4. Ultrasonic testing and sensors. Lectures

    International Nuclear Information System (INIS)

    Progress in ultrasonic testing is based for many applications on the now available electro-acoustic transducers and on their adaptation to the different requirements. Experience on the use of new and often unusual transducer concepts rarely spreads beyond the area of the directly interested users. The consideration of the test head for ultrasonic testing as an electro-acoustic sensor contains an intentional generalisation by which an exchange of knowledge and experience from very different fields is to be started. In 20 lectures, the seminar introduced sensor concepts and applications from different areas of application of ultrasonic pulse echo technique and sound emission, therefore gave a survey of new developments and provide the stimulus for solving special problems. (orig./HP)

  5. Lecture notes on diophantine analysis

    CERN Document Server

    Zannier, Umberto

    2014-01-01

    These lecture notes originate from a course delivered at the Scuola Normale in Pisa in 2006. Generally speaking, the prerequisites do not go beyond basic mathematical material and are accessible to many undergraduates. The contents mainly concern diophantine problems on affine curves, in practice describing the integer solutions of equations in two variables. This case historically suggested some major ideas for more general problems. Starting with linear and quadratic equations, the important connections with Diophantine Approximation are presented and Thue's celebrated results are proved in full detail. In later chapters more modern issues on heights of algebraic points are dealt with, and applied to a sharp quantitative treatment of the unit equation. The book also contains several Supplements, hinted exercises and an Appendix on recent work on heights.

  6. Lecture 3: Web Application Security

    CERN Document Server

    CERN. Geneva

    2013-01-01

    Computer security has been an increasing concern for IT professionals for a number of years, yet despite all the efforts, computer systems and networks remain highly vulnerable to attacks of different kinds. Design flaws and security bugs in the underlying software are among the main reasons for this. This lecture focuses on security aspects of Web application development. Various vulnerabilities typical to web applications (such as Cross-site scripting, SQL injection, cross-site request forgery etc.) are introduced and discussed. Sebastian Lopienski is CERN’s deputy Computer Security Officer. He works on security strategy and policies; offers internal consultancy and audit services; develops and maintains security tools for vulnerability assessment and intrusion detection; provides training and awareness raising; and does incident investigation and response. During his work at CERN since 2001, Sebastian has had various assignments, including designing and developing software to manage and support servic...

  7. Two-photon widths of the $\\chi_{c0, 2}$ states and helicity analysis for $\\chi_{c2}\\ar\\gamma\\gamma$}

    CERN Document Server

    Ablikim, M; Ambrose, D J; An, F F; An, Q; An, Z H; Bai, J Z; Ferroli, R B; Ban, Y; Becker, J; Berger, N; Bertani, M B; Bian, J M; Boger, E; Bondarenko, O; Boyko, I; Briere, R A; Bytev, V; Cai, X; Calcaterra, A C; Cao, G F; Chang, J F; Chelkov, G; Chen, G; Chen, H S; Chen, J C; Chen, M L; Chen, S J; Chen, Y; Chen, Y B; Cheng, H P; Chu, Y P; Cronin-Hennessy, D; Dai, H L; Dai, J P; Dedovich, D; Deng, Z Y; Denig, A; Denysenko, I; Destefanis, M; Ding, W M; Ding, Y; Dong, L Y; Dong, M Y; Du, S X; Fang, J; Fang, S S; Fava, L; Feldbauer, F; Feng, C Q; Fu, C D; Fu, J L; Gao, Y; Geng, C; Goetzen, K; Gong, W X; Gradl, W; Greco, M; Gu, M H; Gu, Y T; Guan, Y H; Guo, A Q; Guo, L B; Guo, Y P; Han, Y L; Hao, X Q; Harris, F A; He, K L; He, M; He, Z Y; Held, T; Heng, Y K; Hou, Z L; Hu, H M; Hu, J F; Hu, T; Huang, B; Huang, G M; Huang, J S; Huang, X T; Huang, Y P; Hussain, T; Ji, C S; Ji, Q; Ji, X B; Ji, X L; Jia, L K; Jiang, L L; Jiang, X S; Jiao, J B; Jiao, Z; Jin, D P; Jin, S; Jing, F F; Kalantar-Nayestanaki, N; Kavatsyuk, M; Kuehn, W; Lai, W; Lange, J S; Leung, J K C; Li, C H; Li, Cheng; Li, Cui; Li, D M; Li, F; Li, G; Li, H B; Li, J C; Li, K; Li, Lei; Li, N B; Li, Q J; Li, S L; Li, W D; Li, W G; Li, X L; Li, X N; Li, X Q; Li, X R; Li, Z B; Liang, H; Liang, Y F; Liang, Y T; Liao, G R; Liao, X T; Liu, B J; Liu, B J; Liu, C L; Liu, C X; Liu, C Y; Liu, F H; Liu, Fang; Liu, Feng; Liu, H; Liu, H B; Liu, H H; Liu, H M; Liu, H W; Liu, J P; Liu, Kun; Liu, Kai; Liu, K Y; Liu, P L; Liu, S B; Liu, X; Liu, X H; Liu, Y B; Liu, Y; Liu, Z A; Liu, Zhiqiang; Liu, Zhiqing; Loehner, H; Lu, G R; Lu, H J; Lu, J G; Lu, Q W; Lu, X R; Lu, Y P; Luo, C L; Luo, M X; Luo, T; Luo, X L; Lv, M; Ma, C L; Ma, F C; Ma, H L; Ma, Q M; Ma, S; Ma, T; Ma, X Y; Ma, Y; Maas, F E; Maggiora, M; Malik, Q A; Mao, H; Mao, Y J; Mao, Z P; Messchendorp, J G; Min, J; Min, T J; Mitchell, R E; Mo, X H; Morales, C Morales; Motzko, C; Muchnoi, N Yu; Nefedov, Y; Nicholson, C; Nikolaev, I B; Ning, Z; Olsen, S L; Ouyang, Q; Pacetti, S P; Park, J W; Pelizaeus, M; Peters, K; Ping, J L; Ping, R G; Poling, R; Prencipe, E; Pun, C S J; Qi, M; Qian, S; Qiao, C F; Qin, X S; Qin, Y; Qin, Z H; Qiu, J F; Rashid, K H; Rong, G; Ruan, X D; Sarantsev, A; Schulze, J; Shao, M; Shen, C P; Shen, X Y; Sheng, H Y; Shepherd, M R; Song, X Y; Spataro, S; Spruck, B; Sun, D H; Sun, G X; Sun, J F; Sun, S S; Sun, X D; Sun, Y J; Sun, Y Z; Sun, Z J; Sun, Z T; Tang, C J; Tang, X; Thorndike, E H; Tian, H L; Toth, D; Ulrich, M U; Varner, G S; Wang, B; Wang, B Q; Wang, K; Wang, L L; Wang, L S; Wang, M; Wang, P; Wang, P L; Wang, Q; Wang, Q J; Wang, S G; Wang, X F; Wang, X L; Wang, Y D; Wang, Y F; Wang, Y Q; Wang, Z; Wang, Z G; Wang, Z Y; Wei, D H; Weidenkaff, P; Wen, Q G; Wen, S P; Werner, M W; Wiedner, U; Wu, L H; Wu, N; Wu, S X; Wu, W; Wu, Z; Xia, L G; Xiao, Z J; Xie, Y G; Xiu, Q L; Xu, G F; Xu, G M; Xu, H; Xu, Q J; Xu, X P; Xu, Y; Xu, Z R; Xue, F; Xue, Z; Yan, L; Yan, W B; Yan, Y H; Yang, H X; Yang, T; Yang, Y; Yang, Y X; Ye, H; Ye, M; Ye, M H; Yu, B X; Yu, C X; Yu, J S; Yu, S P; Yuan, C Z; Yuan, W L; Yuan, Y; Zafar, A A; Zallo, A Z; Zeng, Y; Zhang, B X; Zhang, B Y; Zhang, C C; Zhang, D H; Zhang, H H; Zhang, H Y; Zhang, J; Zhang, J G; Zhang, J Q; Zhang, J W; Zhang, J Y; Zhang, J Z; Zhang, L; Zhang, S H; Zhang, T R; Zhang, X J; Zhang, X Y; Zhang, Y; Zhang, Y H; Zhang, Y S; Zhang, Z P; Zhang, Z Y; Zhao, G; Zhao, H S; Zhao, J W; Zhao, K X; Zhao, Lei; Zhao, Ling; Zhao, M G; Zhao, Q; Zhao, S J; Zhao, T C; Zhao, X H; Zhao, Y B; Zhao, Z G; Zhemchugov, A; Zheng, B; Zheng, J P; Zheng, Y H; Zheng, Z P; Zhong, B; Zhong, J; Zhou, L; Zhou, X K; Zhou, X R; Zhu, C; Zhu, K; Zhu, K J; Zhu, S H; Zhu, X L; Zhu, X W; Zhu, Y M; Zhu, Y S; Zhu, Z A; Zhuang, J; Zou, B S; Zou, J H; Zuo, J X

    2012-01-01

    Based on a data sample of 106 M $\\psi^{\\prime}$ events collected with the BESIII detector, the decays $\\psi^{\\prime}\\ar\\gamma\\chi_{c0, 2}$,$\\chi_{c0, 2}\\ar\\gamma\\gamma$ are studied to determine the two-photon widths of the $\\chi_{c0, 2}$ states. The two-photon decay branching fractions are determined to be ${\\cal B}(\\chi_{c0}\\ar\\gamma\\gamma) = (2.24\\pm 0.19\\pm 0.12\\pm 0.08)\\times 10^{-4}$ and ${\\cal B}(\\chi_{c2}\\ar\\gamma\\gamma) = (3.21\\pm 0.18\\pm 0.17\\pm 0.13)\\times 10^{-4}$. From these, the two-photon widths are determined to be $\\Gamma_{\\gamma \\gamma}(\\chi_{c0}) = (2.33\\pm0.20\\pm0.13\\pm0.17)$ keV, $\\Gamma_{\\gamma \\gamma}(\\chi_{c2}) = (0.63\\pm0.04\\pm0.04\\pm0.04)$ keV, and $\\cal R$ $=\\Gamma_{\\gamma \\gamma}(\\chi_{c2})/\\Gamma_{\\gamma \\gamma}(\\chi_{c0})=0.271\\pm 0.029\\pm 0.013\\pm 0.027$, where the uncertainties are statistical, systematic, and those from the PDG ${\\cal B}(\\psi^{\\prime}\\ar\\gamma\\chi_{c0,2})$ and $\\Gamma(\\chi_{c0,2})$ errors, respectively. The ratio of the two-photon widths for helicity $\\lambda=0...

  8. Chi-Chi (Taiwan) earthquake of September 21, 1999. Findings for the nuclear installations in Switzerland: short report

    International Nuclear Information System (INIS)

    The Swiss Federal Nuclear Safety Inspectorate (HSK) has a great interest to be rapidly informed and documented on relevant consequences of major earthquakes in industrialized countries in the world, in particular with respect to nuclear installations. The main goal is to recognize within a short time after such events, if measures should be taken at the Swiss nuclear installations. Therefore, Basler and Hofmann have prepared a report on the Chi-Chi (1999) earthquake for HSK within a few weeks after the event. The information was obtained primarily from the Internet and by directly contacting local authorities and other selected organisations in Taiwan. This short report is a summary representation of the HSK report of November 23, 1999. No updated or additional information on the earthquake is included herein. The summary concentrates on the findings for the Swiss nuclear installations. Compared with Taiwan, Switzerland is situated in a seismically much less active region. However, similarities exist with respect to the focal mechanism (thrust), the compressional stress regime and the low focal depth. Thus, the pattern of the iso-seismal lines and the maximum acceleration values would be similar in Switzerland in the case of an equally strong event. Such a strong event has been considered as unrealistic to occur in Switzerland so far. In the PSA studies for the Swiss nuclear power plants, a maximum magnitude up to 7.5 was considered, but only with a low weight. Under the assumption of a magnitude 7.6 event in the seismically most active region in Switzerland (Valais), the SSE accelerations at the closest site (Muehleberg NPP) could probably be exceeded. Most effects at components observed during the Chi-Chi earthquake (at non-nuclear sites) are already known to HSK and they have been considered systematically at the Swiss NPPs. A rather sensitive point is the possible loss of power from emergency diesel generators, as observed at non-nuclear sites in Taiwan. The

  9. Lecture notes for criticality safety

    International Nuclear Information System (INIS)

    These lecture notes for criticality safety are prepared for the training of Department of Energy supervisory, project management, and administrative staff. Technical training and basic mathematics are assumed. The notes are designed for a two-day course, taught by two lecturers. Video tapes may be used at the options of the instructors. The notes provide all the materials that are necessary but outside reading will assist in the fullest understanding. The course begins with a nuclear physics overview. The reader is led from the macroscopic world into the microscopic world of atoms and the elementary particles that constitute atoms. The particles, their masses and sizes and properties associated with radioactive decay and fission are introduced along with Einstein's mass-energy equivalence. Radioactive decay, nuclear reactions, radiation penetration, shielding and health-effects are discussed to understand protection in case of a criticality accident. Fission, the fission products, particles and energy released are presented to appreciate the dangers of criticality. Nuclear cross sections are introduced to understand the effectiveness of slow neutrons to produce fission. Chain reactors are presented as an economy; effective use of the neutrons from fission leads to more fission resulting in a power reactor or a criticality excursion. The six-factor formula is presented for managing the neutron budget. This leads to concepts of material and geometric buckling which are used in simple calculations to assure safety from criticality. Experimental measurements and computer code calculations of criticality are discussed. To emphasize the reality, historical criticality accidents are presented in a table with major ones discussed to provide lessons-learned. Finally, standards, NRC guides and regulations, and DOE orders relating to criticality protection are presented

  10. Exclusive Baryon-Antibaryon Decays of the chi_cJ Mesons

    CERN Document Server

    Naik, P; Asner, D M; Edwards, K W; Reed, J; Briere, R A; Ferguson, T; Tatishvili, G; Vogel, H; Watkins, M E; Rosner, J L; Alexander, J P; Cassel, D G; Duboscq, J E; Ehrlich, R; Fields, L; Gibbons, L; Gray, R; Gray, S W; Hartill, D L; Heltsley, B K; Hertz, D; Hunt, J M; Kandaswamy, J; Kreinick, D L; Kuznetsov, V E; Ledoux, J; Mahlke-Krüger, H; Mohapatra, D; Onyisi, P U E; Patterson, J R; Peterson, D; Riley, D; Ryd, A; Sadoff, A J; Shi, X; Stroiney, S; Sun, W M; Wilksen, T; Athar, S B; Patel, R; Yelton, J; Rubin, P; Eisenstein, B I; Karliner, I; Mehrabyan, S; Lowrey, N; Selen, M; White, E J; Wiss, J; Mitchell, R E; Shepherd, M R; Besson, D; Pedlar, T K; Cronin-Hennessy, D; Gao, K Y; Hietala, J; Kubota, Y; Klein, T; Lang, B W; Poling, R; Scott, A W; Zweber, P; Dobbs, S; Metreveli, Z; Seth, K K; Tomaradze, A G; Libby, J; Powell, A; Wilkinson, G; Ecklund, K M; Love, W; Savinov, V; Méndez, H; Ge, J Y; Miller, D H; Shipsey, I P J; Xin, B; Adams, G S; Anderson, M; Cummings, J P; Danko, I; Hu, D; Moziak, B; Napolitano, J; He, Q; Insler, J; Muramatsu, H; Park, C S; Thorndike, E H; Yang, F; Artuso, M; Blusk, S; Khalil, S; Li, J; Mountain, R; Nisar, S; Randrianarivony, K; Sultana, N; Skwarnicki, T; Stone, S; Wang, J C; Zhang, L M; Bonvicini, G; Cinabro, D; Dubrovin, M; Lincoln, A

    2008-01-01

    Using a sample of 2.59 \\times 10^7 psi(2S) decays collected by the CLEO--c detector, we present results of a study of chi_{cJ} (J=0,1,2) decays into baryon-antibaryon final states. We present the world's most precise measurements of the chi_cJ -> p-pbar and chi_cJ -> Lambda-Lambdabar branching fractions, and the first measurements of chi_c0 decays to other hyperons. These results illuminate the decay mechanism of the chi_c states.

  11. [THE DISCUSSION CONCERNING THE PLACE OF LECTURES AND COMPULSORY LECTURE ATTENDANCE IN MEDICAL EDUCATION].

    Science.gov (United States)

    Reis, Shmuel

    2016-04-01

    Luder shows that there is a lack of correlation between lecture attendance in medical school and examination performance, and thus draws attention to a discourse concerning the place of lectures and lecture attendance enforcement in 2015 and beyond. The paper addresses 4 questions: First, what is the current place of the traditional lecture in the education of medical students? Second, are there alternatives to this format of teaching? Third, what are the educational consequences of mandating lecture attendance; and fourth, should there be such enforcement? The author discusses these questions and concludes that lectures should be used sparingly, after a careful evaluation that they have an added value over learning away from the classroom. Furthermore, that there are clear guidelines on how to make the traditional lecture enhanced and educationally effective, as well as alternatives such as the "flipped classroom", e-learning and more to lectures. In addition, that lectures frequently drive learning negatively and enforcing attendance in Israel entails serious unintended consequences such as a need to monitor attendance, and a host of disciplinary adverse reactions. Finally, that besides lecture efficiency and economy (when having added value) one reason to consider compulsory attendance, may be when poor attendance negatively influences teachers morale. PMID:27323539

  12. Tai Chi as a form of exercise training in people with chronic obstructive pulmonary disease.

    Science.gov (United States)

    Leung, Regina W M; McKeough, Zoe J; Alison, Jennifer A

    2013-12-01

    Tai Chi is an ancient Chinese martial art which incorporates elements of strengthening, balance, postural alignment and concentration. The benefits of Tai Chi in the healthy population have been widely examined. In comparison, only three studies have evaluated the effects of Tai Chi in people with chronic obstructive pulmonary disease (COPD). Existing evidence suggests that the exercise intensity of Tai Chi reaches a moderate level in people with COPD. Furthermore, a short-term program of Tai Chi improves exercise capacity, health-related quality of life, balance and quadriceps strength in people with mild to moderate COPD. More studies are warranted to examine the effects of different styles of Tai Chi and the long-term benefits of Tai Chi as an exercise regimen for people with COPD. PMID:24224506

  13. Health care providers′ acceptance of unsedated colonoscopy before and after a state-of-the-art lecture on the feasibility of the option

    Directory of Open Access Journals (Sweden)

    Felix W Leung

    2012-01-01

    Full Text Available Background/Aim: The impact of education on acceptance of unsedated colonoscopy by health care providers is unknown. To test the hypothesis that knowledge imparted by a lecture on unsedated colonoscopy is associated with its enhanced acceptance. Settings and Design: At the State-of-the-Art Lecture on "Unsedated colonoscopy: Is it feasible?" presented at the 8 th Pan-Arab Conference on Gastroenterology, February, 2011, Riyadh, Saudi Arabia, a questionnaire survey of the audience was undertaken. Materials and Methods: An expectation questionnaire was administered before and after the lecture. Attendees responded anonymously. Statistical analysis used: The responses of a convenient sample of 49 attendees who provided completed responses to the questionnaire both before and after the lecture were analyzed. Data are expressed as frequency counts and means±SEM. Repeated measures analysis of variance (ANOVA, ANOVA with contrasts and Chi-square analysis (Statview II Program for Macintosh computers were used to assess the data. A P value of <0.05 is considered significant. Results and Conclusions: The mean±SEM credibility score (maximum possible score=50 was 25.8 ± 1.8 before and 33.3 ± 2.1 after the lecture, with a significant improvement in mean score of 7.5 ± 1.3 (P=0.001, paired t test. Nineteen (39% respondents were not willing to consider unsedated colonoscopy for themselves before the lecture. This number decreased to 13 (27% after the lecture. Before the lecture only 4 (8% respondents were willing to consider unsedated colonoscopy for themselves. After the lecture this number increased to 8 (16%. The data suggest education of healthcare professionals regarding the feasibility of unsedated colonoscopy appears to enhance its acceptance as a credible patient care option at a Pan-Arab Gastroenterology Conference.

  14. Definitions of Interdisciplinary Research: Toward Graduate-Level Interdisciplinary Learning Outcomes

    Science.gov (United States)

    Borrego, Maura; Newswander, Lynita K.

    2010-01-01

    Combining the interdisciplinary studies (primarily humanities) literature with the content analysis of 129 successful National Science Foundation proposals written predominantly by science and engineering faculty members, the authors identify five categories of learning outcomes for interdisciplinary graduate education: disciplinary grounding,…

  15. Constructing the Interdisciplinary Ivory Tower: The Planning of Interdisciplinary Spaces on University Campuses

    Science.gov (United States)

    Harris, Michael S.; Holley, Karri

    2008-01-01

    The demand for interdisciplinary teaching and research suggests the need to understand how universities are undertaking and fostering interdisciplinarity. Through an examination of strategic and master plans at 21 research universities, this article explores how institutions plan and foster interdisciplinary engagement through the use of space on…

  16. Definitions of Interdisciplinary Research: Toward Graduate-Level Interdisciplinary Learning Outcomes

    OpenAIRE

    Borrego, M.; Newswander, L. K.

    2010-01-01

    Combining the interdisciplinary studies (primarily humanities) literature with the content analysis of 129 successful National Science Foundation proposals written predominantly by science and engineering faculty members, the authors identify five categories of learning outcomes for interdisciplinary graduate education: disciplinary grounding, integration, teamwork, communication, and critical awareness. They identify important parallels between humanities-based descriptions of interdisciplin...

  17. mRNA Expression of EgCHI1, EgCHI2, and EgCHI3 in Oil Palm Leaves (Elaeis guineesis Jacq. after Treatment with Ganoderma boninense Pat. and Trichoderma harzianum Rifai

    Directory of Open Access Journals (Sweden)

    Laila Naher

    2012-01-01

    Full Text Available Background. Basal stem rot (BSR disease caused by the fungus Ganoderma boninense is the most serious disease affecting the oil palm; this is because the disease escapes the early disease detection. The biocontrol agent Trichoderma harzianum can protect the disease only at the early stage of the disease. In the present study, the expression levels of three oil palm (Elaeis guineensis Jacq. chitinases encoding EgCHI1, EgCHI2, and EgCHI3 at 2, 5, and 8 weeks inoculation were measured in oil palm leaves from plants treated with G. boninense or T. harzianum alone or both. Methods. The five-month-old oil palm seedlings were treated with Gano-wood blocks inoculum and trichomulch. Expression of EgCHI1, EgCHI2, and EgCHI3 in treated leaves tissue was determined by real-time PCR. Results. Oil palm chitinases were not strongly expressed in oil palm leaves of plants treated with G. boninense alone compared to other treatments. Throughout the 8-week experiment, expression of EgCHI1 increased more than 3-fold in leaves of plants treated with T. harzianum and G. boninense when compared to those of control and other treated plants. Conclusion. The data illustrated that chitinase cDNA expression varied depending on tissue and the type of treatment.

  18. Formative E-Assessment in Plenary Lectures

    Directory of Open Access Journals (Sweden)

    Rune Johan Krumsvik

    2012-03-01

    Full Text Available Little is known about how subjective and objective learning outcomes in plenary lectures are related in the Quality Framework of Higher Education and how they are influenced by formative e-assessment. Given the increasing focus on digitalisation and formative assessment in higher education and the increasing diversity among university students, questions relating to these topics should also be explored within plenary lectures. These lectures constitute the most formal, defined and “bounded” educational practice at universities and it is important to study the question of whether the relationship between student diversity, pedagogy and technology can re-define some of the pedagogical underpinnings that are historically associated with lecturer-centred pedagogy. This paper aims to identify: (1 factors that influence the relationship between intended and subjective learning outcomes in plenary lectures; and (2 how formative e-assessment may improve moments of contingency by increasing the consistency between intended and subjective learning outcomes. The results of this study show that audience response systems (ARS can enhance formative e-assessment in plenary lectures and reduce the discrepancy between the intended learning outcome and the subjective learning outcome in such lectures with several hundred students. The implications of the current paper are twofold: first, a better understanding of similarities and dissimilarities in students’ learning processes in plenary lectures and how these processes may be affected by formative e-assessment has implications for the planning and implementation of teaching and learning in higher education. Second, this has implications for how we can reduce the discrepancy between the intended, subjective and objective learning outcomes in plenary lectures.

  19. Lectures Abandoned: Active Learning by Active Seminars

    DEFF Research Database (Denmark)

    Christensen, Henrik Bærbak; Corry, Aino Vonge

    2012-01-01

    Traditional lecture-based courses are widely criticised for be- ing less eective in teaching. The question is of course what should replace the lectures and various active learning tech- niques have been suggested and studied. In this paper, we report on our experiences of redesigning a software ......- tive seminars as a replacement of traditional lectures, an activity template for the contents of active seminars, an ac- count on how storytelling supported the seminars, as well as reports on our and the students' experiences....

  20. Long-period ground motion characteristic of the 1999 Jiji (Chi-Chi), Taiwan, mainshock and aftershocks

    Institute of Scientific and Technical Information of China (English)

    LI Chun-feng; ZHANG Yang; ZHAO Jin-bao; TANG Hui

    2006-01-01

    This paper investigates long-period ground motion characteristic of the 1999 Jiji (Chi-Chi), Taiwan, mainshock and aftershocks on the basis of lots of high quality digital strong motion records. The study attaches the importance to the variation of strength of the long-period ground motion with the magnitude, distance, and site condition. In the meantime, the near-fault long-period ground motion characteristic is analyzed. The result shows that the shape of the long-period response spectrum is mainly controlled by site condition and magnitude (the spectrum of class D+E is wider than that of class B+C, and the spectrum of larger magnitude is wider than that of smaller magnitude), and the effect of fault distance on the shape is not evident. And near-fault long-period ground motion characteristic depends on fault activity apparently, that is to say, the long-term ground motion in the hanger is stronger than that in the footwall, and the long-term ground motion in the north is stronger than that in the south.

  1. mRNA Expression of EgCHI1, EgCHI2, and EgCHI3 in Oil Palm Leaves (Elaeis guineesis Jacq.) after Treatment with Ganoderma boninense Pat. and Trichoderma harzianum Rifai

    OpenAIRE

    Laila Naher; Soon Guan Tan; Chai Ling Ho; Umi Kalsom Yusuf; Siti Hazar Ahmad; Faridah Abdullah

    2012-01-01

    Background. Basal stem rot (BSR) disease caused by the fungus Ganoderma boninense is the most serious disease affecting the oil palm; this is because the disease escapes the early disease detection. The biocontrol agent Trichoderma harzianum can protect the disease only at the early stage of the disease. In the present study, the expression levels of three oil palm (Elaeis guineensis Jacq.) chitinases encoding EgCHI1, EgCHI2, and EgCHI3 at 2, 5, and 8 weeks inoculation were measured in oil pa...

  2. High-level expression and characterization of two chitinases, ChiCH and ChiCW, of Bacillus cereus 28-9 in Escherichia coli

    International Nuclear Information System (INIS)

    Many chitinase genes have been cloned and sequenced from prokaryotes and eukaryotes but overexpression of chitinases in Escherichia coli cells was less reported. ChiCH and ChiCW of Bacillus cereus 28-9 belong to two distinct groups based on their amino acid sequences of catalytic domains, and in addition, domain structures of two enzymes are different. In this study, we established an ideal method for high-level expression of chitinases in E. coli as glutathione-S-transferase fusion proteins using pGEX-6P-1 vector. Both ChiCH and ChiCW were successfully highly expressed in E. coli cells as soluble GST-chitinase fusion proteins, and recombinant native ChiCH and ChiCW could be purified after cleavage with PreScission protease to remove GST tag. Purified chitinases were used for biochemical characterization of kinetics, hydrolysis products, and binding activities. The results indicate that ChiCW is an endo-chitinase and effectively hydrolyzes chitin and chito-multimers to chito-oligomers and the end product chitobiose, and ChiCH is an exo-chitinase and degrades chito-oligomers to produce chitobiose. Furthermore, due to higher affinity of ChiCW toward colloidal chitin than Avicel, C-terminal domain of ChiCW should be classified as a chitin-binding domain not a cellulose-binding domain although that was revealed as a cellulose-binding domain by conserved domain analysis. Therefore, the method of high-level expression of chitinases is helpful to studies and applications of chitinases

  3. Towards Automated Lecture Capture, Navigation and Delivery System for Web-Lecture on Demand

    CERN Document Server

    Kannan, Rajkumar

    2010-01-01

    Institutions all over the world are continuously exploring ways to use ICT in improving teaching and learning effectiveness. The use of course web pages, discussion groups, bulletin boards, and e-mails have shown considerable impact on teaching and learning in significant ways, across all disciplines. ELearning has emerged as an alternative to traditional classroom-based education and training and web lectures can be a powerful addition to traditional lectures. They can even serve as a main content source for learning, provided users can quickly navigate and locate relevant pages in a web lecture. A web lecture consists of video and audio of the presenter and slides complemented with screen capturing. In this paper, an automated approach for recording live lectures and for browsing available web lectures for on-demand applications by end users is presented.

  4. The 2015 Garrod Lecture: Why is improvement difficult?

    Science.gov (United States)

    Davey, Peter

    2015-11-01

    The pressing need to measure and improve antibiotic use was recognized >40 years ago, so why have we failed to achieve sustained improvement at scale? In his 2014 Reith Lectures about the future of medicine, the US surgeon Atul Gawande said that failure in medicine is largely due to ineptitude (failure to use existing knowledge) rather than ignorance (lack of knowledge). Consequently, it is notable that most interventions to improve antimicrobial prescribing are either designed to educate individual practitioners or patients about policies or to restrict prescribing to make practitioners follow policies. Interventions that enable practitioners to apply existing knowledge through decision support, feedback and action planning are relatively uncommon. There is an urgent need to improve the design and reporting of interventions to change behaviour. However, achieving sustained improvement at scale will also require a more profound understanding of the role of context. What makes contexts receptive to change and which elements of context, under what circumstances, are important for human performance? Answering these questions will require interdisciplinary work with social scientists to integrate complementary approaches from human factors and ergonomics, improvement science and educational research. We need to rethink professional education to embrace complexity and enable teams to learn in practice. Workplace-based learning of improvement science will enable students and early-career professionals to become change agents and transform training from a burden on clinical teams into a driver for improvement. This will make better use of existing resources, which is the key to sustainability at scale. PMID:26269530

  5. The CHY representation of tree-level primitive QCD amplitudes

    CERN Document Server

    de la Cruz, Leonardo; Weinzierl, Stefan

    2015-01-01

    In this paper we construct a CHY representation for all tree-level primitive QCD amplitudes. The quarks may be massless or massive. We define a generalised cyclic factor $\\hat{C}(w,z)$ and a generalised permutation invariant function $\\hat{E}(z,p,\\varepsilon)$. The amplitude is then given as a contour integral encircling the solutions of the scattering equations with the product $\\hat{C} \\hat{E}$ as integrand. Equivalently, it is given as a sum over the inequivalent solutions of the scattering equations, where the summand consists of a Jacobian times the product $\\hat{C} \\hat{E}$. This representation separates information: The generalised cyclic factor does not depend on the helicities of the external particles, the generalised permutation invariant function does not depend on the ordering of the external particles.

  6. The CHY representation of tree-level primitive QCD amplitudes

    Science.gov (United States)

    de la Cruz, Leonardo; Kniss, Alexander; Weinzierl, Stefan

    2015-11-01

    In this paper we construct a CHY representation for all tree-level primitive QCD amplitudes. The quarks may be massless or massive. We define a generalised cyclic factor Ĉ( w, z) and a generalised permutation invariant function Ê( z, p, ɛ). The amplitude is then given as a contour integral encircling the solutions of the scattering equations with the product ĈÊ as integrand. Equivalently, it is given as a sum over the inequivalent solutions of the scattering equations, where the summand consists of a Jacobian times the product Ĉ Ê. This representation separates information: The generalised cyclic factor does not depend on the helicities of the external particles, the generalised permutation invariant function does not depend on the ordering of the external particles.

  7. Factors Shaping Mathematics Lecturers' Service Teaching in Different Departments

    Science.gov (United States)

    Bingolbali, E.; Ozmantar, M. F.

    2009-01-01

    In this article we focus on university lecturers' approaches to the service teaching and factors that influence their approaches. We present data obtained from the interviews with 19 mathematics and three physics lecturers along with the observations of two mathematics lecturers' calculus courses. The findings show that lecturers' approaches to…

  8. The Impact of Online Lecture Recordings on Student Performance

    Science.gov (United States)

    Williams, Andrew; Birch, Elisa; Hancock, Phil

    2012-01-01

    The use of online lecture recordings as a supplement to physical lectures is an increasingly popular tool at many universities. This paper combines survey data with student record data for students in a "Microeconomics Principles" class to examine the relative effects of lecture attendance and online lecture recordings. The main finding is that…

  9. Lectures on the basis of physics

    International Nuclear Information System (INIS)

    The paper contains the following three lectures given by Alan Cook at ICTP Trieste in August, 1990: ''Metrology and the Structure of Physics'', ''Why does Mathematical Physics Work?'' and ''Probability, Chaos and the Environment. 9 refs

  10. Recently Published Lectures and Tutorials for ATLAS

    CERN Multimedia

    Goldfarb, S.

    2006-01-01

    As reported in the September 2004 ATLAS eNews, the Web Lecture Archive Project, WLAP, a collaboration between the University of Michigan and CERN, has developed a synchronized system for recording and publishing educational multimedia presentations, using the Web as medium. The current system, including future developments for the project and the field in general, was recently presented at the CHEP 2006 conference in Mumbai, India. The relevant presentations and papers can be found here: The Web Lecture Archive Project. A Web Lecture Capture System with Robotic Speaker Tracking This year, the University of Michigan team has been asked to record and publish all ATLAS Plenary sessions, as well as a large number of Physics and Computing tutorials. A significant amount of this material has already been published and can be accessed via the links below. All lectures can be viewed on any major platform with any common internet browser, either via streaming or local download (for limited bandwidth). Please e...

  11. Nonrelativistic theory of collisions: lecture notes

    International Nuclear Information System (INIS)

    These are lecture notes on the nonrelativistic scattering theory with an emphasis on the analytical properties of scattering amplitudes, Jost fonctions, study of Regge poles and Regge trajectories for potentials which are a superposition of Yukawa potentials

  12. TASI Lectures on Effective Field Theories

    OpenAIRE

    Rothstein, Ira Z.

    2003-01-01

    These notes are a written version of a set of lectures given at TASI-02 on the topic of effective field theories. They are meant as an introduction to some of the latest techniques and applications in the field.

  13. Recently Published Lectures and Tutorials for ATLAS

    CERN Multimedia

    J. Herr

    2006-01-01

    As reported in the September 2004 ATLAS eNews, the Web Lecture Archive Project, a collaboration between the University of Michigan and CERN, has developed a synchronized system for recording and publishing educational multimedia presentations, using the Web as medium. The current system, including future developments for the project and the field in general, was recently presented at the CHEP 2006 conference in Mumbai, India. The relevant presentations and papers can be found here: The Web Lecture Archive Project A Web Lecture Capture System with Robotic Speaker Tracking This year, the University of Michigan team has been asked to record and publish all ATLAS Plenary sessions, as well as a large number of Physics and Computing tutorials. A significant amount of this material has already been published and can be accessed via the links below. All lectures can be viewed on any major platform with any common internet browser, either via streaming or local download (for limited bandwidth). Please enjoy the l...

  14. Teaching Principles of Economics Without Lectures

    Science.gov (United States)

    McConnell, Campbell R.; Lamphear, Charles

    1969-01-01

    Presents important evidence thatstudents taking principles of economics with lectures, and those taking the course on a lectureless basis performed equally well on an intensive battery of objective examinations." (Editor)

  15. Manufacturing and recycling of technology metals. Lectures

    International Nuclear Information System (INIS)

    This seminar volume contains 13 lectures concerning the geological availability, the trends of the technology, manufacturing and recycling process of technology metals such as Indium, Gallium, Selenium, Rhenium or the Rare Earths.

  16. Lectures on Physics Beyond the Standard Model

    OpenAIRE

    Gripaios, Ben

    2015-01-01

    These four lectures, given at the British Universities Summer School in Theoretical Elementary Particle Physics (BUSSTEPP), held in 2014 in Southampton, are a brief introduction to a selection of current topics in physics Beyond the Standard Model.

  17. Lecture about crowdsourcing and social media

    OpenAIRE

    Willems, Frank

    2012-01-01

    Hanze Honours Lecture, 19-12-12. Het lectoraat Regisseren van Ondernemende Netwerken richt zich op onderzoek naar het effect van regisserend leiderschap in een wereld waarin internet nieuwe verbindingen tussen mensen en organisaties creëert.

  18. Lectures on probability and statistics

    International Nuclear Information System (INIS)

    These notes are based on a set of statistics lectures delivered at Imperial College to the first-year postgraduate students in High Energy Physics. They are designed for the professional experimental scientist. We begin with the fundamentals of probability theory, in which one makes statements about the set of possible outcomes of an experiment, based upon a complete a priori understanding of the experiment. For example, in a roll of a set of (fair) dice, one understands a priori that any given side of each die is equally likely to turn up. From that, we can calculate the probability of any specified outcome. We finish with the inverse problem, statistics. Here, one begins with a set of actual data (e.g., the outcomes of a number of rolls of the dice), and attempts to make inferences about the state of nature which gave those data (e.g., the likelihood of seeing any given side of any given die turn up). This is a much more difficult problem, of course, and one's solutions often turn out to be unsatisfactory in one respect or another

  19. Lectures on probability and statistics

    Energy Technology Data Exchange (ETDEWEB)

    Yost, G.P.

    1984-09-01

    These notes are based on a set of statistics lectures delivered at Imperial College to the first-year postgraduate students in High Energy Physics. They are designed for the professional experimental scientist. We begin with the fundamentals of probability theory, in which one makes statements about the set of possible outcomes of an experiment, based upon a complete a priori understanding of the experiment. For example, in a roll of a set of (fair) dice, one understands a priori that any given side of each die is equally likely to turn up. From that, we can calculate the probability of any specified outcome. We finish with the inverse problem, statistics. Here, one begins with a set of actual data (e.g., the outcomes of a number of rolls of the dice), and attempts to make inferences about the state of nature which gave those data (e.g., the likelihood of seeing any given side of any given die turn up). This is a much more difficult problem, of course, and one's solutions often turn out to be unsatisfactory in one respect or another.

  20. Paul Dirac lectures at CERN

    CERN Multimedia

    CERN Bulletin

    2010-01-01

    When a group of physicists entered the Main Auditorium, during the evening of 29 June, they felt they had opened a time portal.   Paul Dirac in front of a blackboard showing his formula. ©Sandra Hoogeboom An attentive audience, dressed in early 1900 costumes, were watching a lecture by the elusive Paul Dirac, presenting for the first time his famous formula on the blackboard. Paul Adrien Maurice Dirac (1902-1984) was a British mathematical physicist at Cambridge, and one of the "fathers" of quantum mechanics. When he first wrote it, in 1928, Dirac was not sure what his formula really meant. As demonstrated by Andersson four year later, what Dirac had written on the blackboard was the first definition of a positron, hence he is credited with having anticipated the existence of antimatter. The actor John Kohl performs as Paul Dirac. ©Sandra Hoogeboom What the group of puzzled physicists were really observing when they entered the CERN Auditorium was the shoo...

  1. The mathematics of lecture hall partitions

    OpenAIRE

    Savage, Carla D.

    2016-01-01

    Over the past twenty years, lecture hall partitions have emerged as fundamental combinatorial structures, leading to new generalizations and interpretations of classical theorems and new results. In recent years, geometric approaches to lecture hall partitions have used polyhedral geometry to discover further properties of these rich combinatorial objects. In this paper we give an overview of some of the surprising connections that have surfaced in the process of trying to understand the lect...

  2. Lecture Notes in Statistics. 3rd Semester

    DEFF Research Database (Denmark)

    The lecture note is prepared to meet the requirements for the 3rd semester course in statistics at the Aarhus School of Business. It focuses on multiple regression models, analysis of variance, and log-linear models.......The lecture note is prepared to meet the requirements for the 3rd semester course in statistics at the Aarhus School of Business. It focuses on multiple regression models, analysis of variance, and log-linear models....

  3. Unsupervised Topic Adaptation for Lecture Speech Retrieval

    OpenAIRE

    Fujii, Atsushi; Itou, Katunobu; Akiba, Tomoyosi; Ishikawa, Tetsuya

    2004-01-01

    We are developing a cross-media information retrieval system, in which users can view specific segments of lecture videos by submitting text queries. To produce a text index, the audio track is extracted from a lecture video and a transcription is generated by automatic speech recognition. In this paper, to improve the quality of our retrieval system, we extensively investigate the effects of adapting acoustic and language models on speech recognition. We perform an MLLR-based method to adapt...

  4. ENGLISH LECTURERS' BELIEFS REGARDING INTERCULTURAL COMPETENCE

    OpenAIRE

    Kılıç, Serpil

    2013-01-01

    This present study aims to investigate the role of intercultural competence in Turkish tertiary EFL teaching. More specifically, the study was carried out in order to reveal English lecturers’ beliefs regarding intercultural competence. Data were collected from 368 English lecturers in İstanbul via a questionnaire and a scale. The findings have revealed that English lecturers do not believe that culture learning is among the primary objectives of English language teaching and believe more in ...

  5. Personal Professional Reflection as Interdisciplinary Problem

    Directory of Open Access Journals (Sweden)

    Rezvan Oksana

    2013-08-01

    Full Text Available Consideration of professional reflection as interdisciplinary problem is the necessary condition of quality analysis for personal professional becoming. Personal becoming in a profession is related to forming the necessary professional skills of a person, behaviour stereotypes which is the area of pedagogics. Reflection processes are inalienable part of self-knowledge of a person which result must lead to his self-perfection (including professional one and studying within the psychology increasingly. Thus the aim of the article is to ground the determination of professional reflection as an interdisciplinary problem in pedagogics and psychology.

  6. Towards mutual understanding within interdisciplinary palaeoenvironmental research

    DEFF Research Database (Denmark)

    Förster, F.; Großmann, R.; Hinz, M.;

    2013-01-01

    The term landscape is a crucial term for a diversity of scientific disciplines researching the Quaternary, each of which maintains different concepts and definitions. With increasing interdisciplinary research cooperation between disparate disciplines, a basis for communication has to be...... established. The aim of this paper is a) to survey an assortment of concepts and understandings of landscape within diverse disciplinary contexts and b) to explore the possibilities and usefulness of a common concept in an interdisciplinary palaeo-environmental research field, shared by scholars from the...

  7. ENTRA - or the chances of interdisciplinary work

    International Nuclear Information System (INIS)

    Since 2013 about 60 scientists work together in the research platform ENTRA (disposal options for radioactive residuals: interdisciplinary analyses and development of evaluation criteria). The scientists group includes physicists, mathematicians, engineers, jurists, experts from ethics, social and political sciences. The common question is the disposal of high-level radioactive waste. The contribution describes the concept of interdisciplinary work, using the example of the definition of terms like risk by different scientists, projects for specific disposal options, the problem of public distrust, the problem of limiting values and the optimization of final repository systems.

  8. Envisioning the Transformative Role of IT in Lectures

    Directory of Open Access Journals (Sweden)

    Telmo Zarraonandia

    2013-02-01

    Full Text Available One of the most widely used methods for teaching is the lecture. During the last few decades lecturers and students have taken advantage of the progressive introduction of new technology for supporting these lectures. As this trend is very likely to continue, in this paper we will try to anticipate some possible technology enriched future lecture scenarios. We also present ALFs, a system which aims to improve the communication between participants in a lecture making use of augmented reality techniques.

  9. A Randomized Trial Comparing Digital and Live Lecture Formats

    OpenAIRE

    Solomon PhD, David J.

    2004-01-01

    Problem Statement and Background – Medical education is increasingly being conducted in community-based teaching sites making it difficult to provide a consistent curriculum. We conducted a randomized trial to assess whether digital lectures could replace live lectures. Methods – Students were randomized to either attending a lecture series at our main campus or viewing digital versions of the same lectures at community sites. Both groups completed an examination based on the lectures and ...

  10. Two-dimensional Co-Seismic Surface Displacements Field of the Chi-Chi Earthquake Inferred from SAR Image Matching

    Directory of Open Access Journals (Sweden)

    Jian-Jun Zhu

    2008-10-01

    Full Text Available The Mw=7.6 Chi-Chi earthquake in Taiwan occurred in 1999 over the Chelungpu fault and caused a great surface rupture and severe damage. Differential Synthetic Aperture Radar Interferometry (DInSAR has been applied previously to study the co-seismic ground displacements. There have however been significant limitations in the studies. First, only one-dimensional displacements along the Line-of-Sight (LOS direction have been measured. The large horizontal displacements along the Chelungpu fault are largely missing from the measurements as the fault is nearly perpendicular to the LOS direction. Second, due to severe signal decorrelation on the hangling wall of the fault, the displacements in that area are un-measurable by differential InSAR method. We estimate the co-seismic displacements in both the azimuth and range directions with the method of SAR amplitude image matching. GPS observations at the 10 GPS stations are used to correct for the orbital ramp in the amplitude matching and to create the two-dimensional (2D co-seismic surface displacements field using the descending ERS-2 SAR image pair. The results show that the co-seismic displacements range from about -2.0 m to 0.7 m in the azimuth direction (with the positive direction pointing to the flight direction, with the footwall side of the fault moving mainly southwards and the hanging wall side northwards. The displacements in the LOS direction range from about -0.5 m to 1.0 m, with the largest displacement occuring in the northeastern part of the hanging wall (the positive direction points to the satellite from ground. Comparing the results from amplitude matching with those from DInSAR, we can see that while only a very small fraction of the LOS displacement has been recovered by the DInSAR mehtod, the azimuth displacements cannot be well detected with the DInSAR measurements as they are almost perpendicular to the LOS. Therefore, the amplitude matching method is obviously more

  11. Argonne lectures on particles accelerator magnets

    Energy Technology Data Exchange (ETDEWEB)

    Devred, A

    1999-09-01

    The quest for elementary particles has promoted the development of particle accelerators producing beams of increasingly higher energies. In a synchrotron, the particle energy is directly proportional to the product of the machine's radius times the bending magnets' field strength. Present proton experiments at the TeV scale require facilities with circumferences ranging from a few to tens of kilometers and relying on a large number (several hundred to several thousand) high field dipole magnets and high field gradient quadrupole magnets. These electro-magnets use high-current-density, low-critical-temperature superconducting cables and are cooled down at liquid helium temperature. They are among the most costly and the most challenging components of the machine. After explaining what are the various types of accelerator magnets and why they are needed (lecture 1), we briefly recall the origins of superconductivity and we review the parameters of existing superconducting particle accelerators (lecture 2). Then, we review the superconducting materials that are available at industrial scale (chiefly, NbTi and Nb{sub 3}Sn) and we explain in details the manufacturing of NbTi wires and cables (lecture 3). We also present the difficulties of processing and insulating Nb{sub 3}Sn conductors, which so far have limited the use of this material in spite of its superior performances. We continue by discussing the two dimensional current distributions which are the most appropriate for generating pure dipole and quadrupole fields and we explain how these ideal distributions can be approximated by so called cos{theta} and cos 2{theta} coil designs (lecture 4). We also present a few alternative designs which are being investigated and we describe the difficulties of realizing coil ends. Next, we present the mechanical design concepts that are used in existing accelerator magnets (lecture 5) and we describe how the magnets are assembled (lecture 6). Some of the toughest

  12. Argonne lectures on particles accelerator magnets

    International Nuclear Information System (INIS)

    The quest for elementary particles has promoted the development of particle accelerators producing beams of increasingly higher energies. In a synchrotron, the particle energy is directly proportional to the product of the machine's radius times the bending magnets' field strength. Present proton experiments at the TeV scale require facilities with circumferences ranging from a few to tens of kilometers and relying on a large number (several hundred to several thousand) high field dipole magnets and high field gradient quadrupole magnets. These electro-magnets use high-current-density, low-critical-temperature superconducting cables and are cooled down at liquid helium temperature. They are among the most costly and the most challenging components of the machine. After explaining what are the various types of accelerator magnets and why they are needed (lecture 1), we briefly recall the origins of superconductivity and we review the parameters of existing superconducting particle accelerators (lecture 2). Then, we review the superconducting materials that are available at industrial scale (chiefly, NbTi and Nb3Sn) and we explain in details the manufacturing of NbTi wires and cables (lecture 3). We also present the difficulties of processing and insulating Nb3Sn conductors, which so far have limited the use of this material in spite of its superior performances. We continue by discussing the two dimensional current distributions which are the most appropriate for generating pure dipole and quadrupole fields and we explain how these ideal distributions can be approximated by so called cosθ and cos 2θ coil designs (lecture 4). We also present a few alternative designs which are being investigated and we describe the difficulties of realizing coil ends. Next, we present the mechanical design concepts that are used in existing accelerator magnets (lecture 5) and we describe how the magnets are assembled (lecture 6). Some of the toughest requirements on the performance

  13. Observation of direct ion heating in double-pulsing CHI in helicity injected spherical torus plasmas

    International Nuclear Information System (INIS)

    Anomalous ion heating has been observed for the first time during flux/current amplification by double-pulsing coaxial helicity injection (CHI) in the helicity injected spherical torus (HIST) device. Doppler ion temperature increases significantly near the separatrix on the inboard side during the second CHI pulse, whereas electron temperature remains constant. The experimental results indicate that selective ion heating may be associated with viscous damping of poloidal flows driven by the CHI pulse. (author)

  14. Training in ChiRunning to reduce blood pressure: a randomized controlled pilot study

    OpenAIRE

    McDermott, Kelly; Kumar, Deepak; Goldman, Veronica; Feng, Haojun; Mehling, Wolf; Moskowitz, Judith T.; Souza, Richard B.; Frederick M Hecht

    2015-01-01

    Background People with prehypertension (120–130/80–90 mmHg) are at increased risk of progressing to hypertension. Recommendations for prehypertension include engaging in regular physical activity. We aimed to assess feasibility and acceptability and collect preliminary outcome data on ChiRunning for people with elevated blood pressure. ChiRunning is a commercially available running program based on the mindful movements of Tai Chi, which is aimed at decreasing injury by both increasing body a...

  15. Métropolisation, habitat précaire et relogement forcé: entre phénomènes d'exclusion et tactiques populaires d'intégration: le cas du canal Nhieu Loc-Thi Nghe à Ho Chi Minh-Ville, Vietnam

    OpenAIRE

    Wust, Sébastien

    2001-01-01

    This work was carried out within the interdisciplinary scientific program named "Sustainable Development, Metropolisation and Pollution of Natural Resources in Ho Chi Minh-City, Vietnam". This program, launched in 1994, is financed by the Swiss National Science Foundation (Priority Program Environment, Module 7 "Environment and development"). The main goal of this thesis is to grasp the social, economic and spatial dimensions at stake of involuntary ...

  16. Multidisciplinary, Interdisciplinary, and Transdisciplinary Collaboration: Implications for Vocational Psychology

    Science.gov (United States)

    Collin, Audrey

    2009-01-01

    The literature on interdisciplinarity identifies several forms of collaboration: multidisciplinary, transdisciplinary, and interdisciplinary (as bridge building or integration). To assist vocational psychology translate its interdisciplinary discourse into action, this paper uses that literature to identify the benefits, challenges and conditions…

  17. Aggregated Interdisciplinary Databases and the Needs of Undergraduate Researchers

    Science.gov (United States)

    Fister, Barbara; Gilbert, Julie; Fry, Amy Ray

    2008-01-01

    After seeing growing frustration among inexperienced undergraduate researchers searching a popular aggregated interdisciplinary database, the authors questioned whether the leading interdisciplinary databases are serving undergraduates' needs. As a preliminary exploration of this question, the authors queried vendors, analyzed their marketing…

  18. First Observation of Exclusive chi_cJ Decays to Two Charged and Two Neutral Hadrons

    OpenAIRE

    Q. He

    2008-01-01

    We study exclusive chi_c0, chi_c1 and chi_c2 decays to four-hadron final states involving two charged and two neutral mesons: pi^+pi^-pi^0pi^0, K^+K^-pi^0pi^0, pppi^0pi^0, K^+K^-etapi^0, and K^+-pi^-+K^0pi^0o. The chi_c states are produced in radiative decays of 3.08 million psi-prime resonance decays and observed in the CLEO detector. We also measure the largest substructure contributions to the modes pi^+pi^-pi^0pi^0 and K^+-pi^-+K^0pi^0.

  19. Study of {chi}{sub c} production using HERA-B data

    Energy Technology Data Exchange (ETDEWEB)

    Aleksandrov, Aleksandar

    2010-07-15

    In this thesis the production of the charmonium states {chi}{sub c1} and {chi}{sub c2} in protonnucleus collisions at a proton-nucleon center-of-mass energy {radical}(s)=41.6 GeV was studied. The data used for the analysis have been taken by the fixed-target experiment HERA-B that uses the HERA proton beam to scatter protons off the nuclei of different wire targets. About 122.10{sup 3} recorded muonic J/{psi} decays, J/{psi}{yields}{mu}{sup +}{mu}{sup -}, resulted in almost 10000 reconstructed {chi}{sub c}{yields}J/{psi}{gamma}. The ratio R{sub {chi}{sub c}}= sum {sub i=1,2}{sigma}({chi}{sub ci})Br({chi}{sub ci}{yields}J/{psi}{gamma})/{sigma}(J/{psi}), which is the ratio of J/{psi} from {chi}{sub c} decays to all produced J/{psi}, was measured in the kinematical range -0.35chi}{sub c}}=0.190{sub -0.029}{sup +0.030}. Despite the small separation of the masses of the two {chi}{sub c} states, comparable to the detector resolution, the ratio R{sub 12}=R{sub {chi}{sub c}{sub 1}}/R{sub {chi}{sub c}{sub 2}} was measured yielding R{sub 12}=1.30{sub -0.37}{sup +0.59} which corresponds to a production cross section ratio ({sigma}({chi}{sub c1}))/({sigma}({chi}{sub c2}))=0.74{sub -0.22}{sup +0.34}. By using the known J/{psi} production cross section, the {chi}{sub c1} and {chi}{sub c2} production cross sections are calculated to be {sigma}({chi}{sub c1})=(153{+-}27) nb/nucleon and {sigma}({chi}{sub c2})=(207{+-}39) nb/nucleon, respectively. All results were obtained under the assumption that both the J/{psi} and {chi}{sub c} states are produced without polarization. In addition a study of possible deviations of R{sub {chi}{sub c}} and R{sub 12} due to the polarization of J/{psi} and {chi}{sub c} was performed. By varying the polarization parameter, {lambda}{sub obs}, of all produced J/{psi} by 2{sigma} around the value measured by HERA-B, and assuming fully

  20. Interdisciplinary analysis of digital government work

    DEFF Research Database (Denmark)

    Scholl, Hans J.; Mai, Jens Erik; Fidel, Raya

    2006-01-01

    This bird-of-a-feather session attempts to break interdisciplinary ground in the context of work content, workflow, and work context analysis in Digital Government. The authors argue that using and connecting multiple theories and disciplines might yield more robust results and deeper understanding...... of the Digital Government evolution than strictly disciplinary research....

  1. Interdisciplinary Research: Practising the In-Between

    Science.gov (United States)

    Wall, Gina

    2012-01-01

    This article will demonstrate that practice-led photographic research offers an example of dialogical encounter. Through recourse to an outline of my own practice and the experience of completing a practice-led doctoral thesis, the article will account for photographic practice and interdisciplinary research in terms of dialogism. This will…

  2. Interdisciplinary Practices in iSchools

    DEFF Research Database (Denmark)

    Madsen, Dorte; Ho, Shuyan Mary

    2014-01-01

    Interdisciplinarity is in the DNA of the iSchools. This workshop invites you to discuss how inter-disciplinarity plays out in theory and practice. The workshop addresses the uniqueness of the iSchools, provides an interactive framework to discuss and reflect on interdisciplinary practice. It sugg...

  3. Improving Teaching Practice through Interdisciplinary Dialog

    Science.gov (United States)

    Cardetti, Fabiana A.; Orgnero, M. Carolina

    2013-01-01

    This study presents the results of a self-study of interdisciplinary work that has generated profound changes in our teaching practices. The research grew out of an interest in exploring the nature of our work and the practices that contribute to its success. Our self-study revealed that our work process consists of five stages and is the product…

  4. Whales and Whaling--An Interdisciplinary Course.

    Science.gov (United States)

    Kelly, Richard D.

    1978-01-01

    Outlines the content of this interdisciplinary course and includes a list of the texts being used. Parts one and two are concerned with the biology of the whale and other marine mammals, while part three covers the whaling industry and related topics. (MA)

  5. Modeling of Interdisciplinary Connections in Science Courses

    International Nuclear Information System (INIS)

    Graph model of interdisciplinary connections, and method of calculation quantitative parameters of model have described. The application of quantitative method to content of physics and mathematics has already done in this paper. The hierarchy of mathematical concepts used by the general physics course is established co according to two parameters – the bond strength (frequency of use) and the bond length (duration of use)

  6. Facilitating Interdisciplinary Learning: Lessons from Project Kaleidoscope

    Science.gov (United States)

    Kezar, Adrianna; Elrod, Susan

    2012-01-01

    Many major funding organizations, policymakers, government agencies, and other higher education stakeholders want higher education to encourage interdisciplinary learning so that students graduate with the requisite skills to take on complex jobs in science, policy, business, and industry. Calls for this kind of change have been most urgent within…

  7. Interdisciplinary Curriculum Reform in the Changing University

    Science.gov (United States)

    Millar, Victoria

    2016-01-01

    In response to the current demands and trends within education, the disciplines as one of the core long-standing organizing structures within knowledge production and transmission are questioning and shifting what and how they teach. Universities are increasingly offering interdisciplinary subjects and programmes as an alternative to or alongside…

  8. Exploring Interdisciplinary Themes in Introductory Psychology

    Science.gov (United States)

    Ritchey, Kristin A.; Bott, Jennifer P.

    2010-01-01

    We describe a method for helping introductory psychology students identify interdisciplinary connections among 5 social science disciplines. Pre- and posttest data assessed 359 undergraduates' understanding of psychology's relation to other fields. Results indicate the method is effective and provides one way for individual instructors to address…

  9. The Promise and Pragmatism of Interdisciplinary Education.

    Science.gov (United States)

    Stumpf, Steve H.; Clark, Judith Z.

    1999-01-01

    Barriers to interdisciplinary teamwork in allied health education include loss of revenue, schedule conflicts, differences in degree level, identity and status protection, and content control issues. Ways to foster teamwork include all-inclusive cross-enrollment, web-based curricula, and hiring of faculty across disciplinary lines. (SK)

  10. Institutional Challenges of Interdisciplinary Research Centers

    Science.gov (United States)

    Glied, Sherry; Bakken, Suzanne; Formicola, Allan; Gebbie, Kristine; Larson, Elaine L.

    2007-01-01

    Interdisciplinarity has become the model of scholarly inquiry generally espoused by many who seek federal research funding. Interdisciplinary research centers pose challenges to academic settings and to investigators. In a conference of directors of diverse research centers at a single research university we found that the challenges facing…

  11. Enriching Social Work through Interdisciplinary Disability Studies

    Science.gov (United States)

    Carter, Irene; Quaglia, Christine; Leslie, Donald

    2010-01-01

    This paper recommends that faculties of Social Work incorporate Disability Studies in their curriculum by embracing its interdisciplinary deconstructionist perspective. Disability Studies encourages Social Work to move beyond person-in--the-environment and anti-oppressive approaches to find more effective ways of removing barriers for persons with…

  12. The Challenges of Interdisciplinary Epistemology in Neuroaesthetics

    Science.gov (United States)

    Croft, James

    2011-01-01

    Neuroaesthetics is a burgeoning new interdisciplinary research space in which cognitive science, psychology, neuroscience, and philosophy intersect in order to better inform our understanding of aesthetic experience. The purpose of this study is to analyze high-profile work in neuroaesthetics in the light of recent research into interdisciplinary…

  13. Interdisciplinary Approach: A Lever to Business Innovation

    Science.gov (United States)

    Razmak, Jamil; Bélanger, Charles H.

    2016-01-01

    The advances in interdisciplinary studies are driving universities to utilize their available resources to efficiently enable development processes and provide increasing examples of research while gradually allocating the disciplines' resources. Ultimately, this trend asks universities to provide a platform of integrated disciplines, along with…

  14. 40 CFR 1502.6 - Interdisciplinary preparation.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 32 2010-07-01 2010-07-01 false Interdisciplinary preparation. 1502.6 Section 1502.6 Protection of Environment COUNCIL ON ENVIRONMENTAL QUALITY ENVIRONMENTAL IMPACT STATEMENT...-disciplinary approach which will insure the integrated use of the natural and social sciences and...

  15. Interdisciplinary Aspects of Learning: Physics and Psychology

    Science.gov (United States)

    Oleg, Yavoruk

    2015-01-01

    The article deals with interdisciplinary aspects of learning in the case of physics and psychology. It describes the lab-based academic course focused on: observation and experimentation; discovery of new scientific facts; measurement; identification of errors; the study of psychological characteristics of people (time perception, the reaction…

  16. Interdisciplinary research approach for cultural heritage

    Czech Academy of Sciences Publication Activity Database

    Drdácký, Miloš; Minster, Jiří

    Brusel : ECCREDI, 2003, s. 2-2 ISBN N. [FP6 Construction research in the enlarged European union. Warsaw (PL), 06.11.2003-07.11.2003] Institutional research plan: CEZ:AV0Z2071913 Keywords : cultural heritage * interdisciplinary approach * stone masonry Subject RIV: JM - Building Engineering

  17. Synergistic Knowledge Development in Interdisciplinary Teams

    Science.gov (United States)

    Broussard, Shorna R.; La Lopa, Joseph Mick; Ross-Davis, Amy

    2007-01-01

    Problem solving, interpersonal skills, information literacy, and critical and independent thinking are essential qualities that employers seek, yet many undergraduates lack. We structured an interdisciplinary classroom and experiential learning environment where students from three undergraduate courses (Hospitality and Tourism Management,…

  18. Preventing Dance Injuries: An Interdisciplinary Perspective.

    Science.gov (United States)

    Solomon, Ruth, Ed.; And Others

    This book on the interdisciplinary nature of dance medicine as an emerging field of inquiry contains the following chapters: (1) "A Comparison of Patterns of Injury in Ballet, Modern, and Aerobic Dance" (Marie Schafle, And Others); (2) "Pronation as a Predisposing Factor in Overuse Injuries" (Steven R. Kravitz); (3) "Some Common Foot and Ankle…

  19. Interdisciplinary and transdisciplinary relationships of accounting

    OpenAIRE

    Козлова, Марія Олегівна

    2015-01-01

    The circle of the inter- and transdisciplinary relationships of accounting has been presented in the article as well as the list of social and humanitarian disciplines without which it is impossible to form the modern accounting theory has been formed. The own extended variant of  interdisciplinary matrix of accounting theory forming has been disclosed

  20. Getting Involved: An Interdisciplinary Project on Homelessness.

    Science.gov (United States)

    Marcincin, Linda W.

    1992-01-01

    At a Pennsylvania middle school, an informal, cooperative effort to apply fractions to cookie recipes resulted in an interdisciplinary project on the homelessness. Embracing home economics, mathematics, art, English, social studies, and reading, the project incorporates the essentials of middle school philosophy: cooperative learning, team…

  1. Biomedical Interdisciplinary Curriculum Project: Practicum Manual.

    Science.gov (United States)

    Biomedical Interdisciplinary Curriculum Project, Berkeley, CA.

    This guide is designed to assist in the preparation of "hands-on" career experiences in the health care occupations for high school students. The experiences take place in at least three different work settings in addition to participation in small-group discussions, and lectures from practicing professionals. Students are encouraged, in the final…

  2. Electronic voting to encourage interactive lectures: a randomised trial

    Science.gov (United States)

    2007-01-01

    Background Electronic Voting Systems have been used for education in a variety of disciplines. Outcomes from these studies have been mixed. Because results from these studies have been mixed, we examined whether an EVS system could enhance a lecture's effect on educational outcomes. Methods A cohort of 127 Year 5 medical students at the University of Adelaide was stratified by gender, residency status and academic record then randomised into 2 groups of 64 and 63 students. Each group received consecutive 40-minute lectures on two clinical topics. One group received the EVS for both topics. The other group received traditional teaching only. Evaluation was undertaken with two, 15-question multiple-choice questionnaires (MCQ) assessing knowledge and problem solving and undertaken as a written paper immediately before and after the lectures and repeated online 8–12 weeks later. Standardised institutional student questionnaires were completed for each lecture and independent observers assessed student behaviour during the lectures. Lecturer's opinions were assessed by a questionnaire developed for this study. Results Two-thirds of students randomised to EVS and 59% of students randomised to traditional lectures attended. One-half of the students in the EVS group and 41% in the traditional group completed all questionnaires. There was no difference in MCQ scores between EVS and traditional lectures (p = 0.785). The cervical cancer lectures showed higher student ranking in favour of EVS in all parameters. The breast cancer lectures showed higher ranking in favour of traditional lectures in 5 of 7 parameters (p lecturer-students interactions were increased in the EVS lecture for one lecturer and reduced for the other. Both lecturers felt that the EVS lectures were difficult to prepare, that they were able to keep to time in the traditional lectures, that the educational value of both lecture styles was similar, and that they were neutral-to-slightly favourably disposed

  3. Starting to Uncover the Mystery of Interdisciplinary Research in Kinesiology

    Science.gov (United States)

    Schary, David P.; Cardinal, Bradley J.

    2016-01-01

    The multidisciplinary nature of kinesiology seems to be an ideal configuration for conducting interdisciplinary research. Proposed as a potential solution to overcome fragmentation, interdisciplinary research has a role within kinesiology that remains unknown. In this study, we explored kinesiologists' perceptions of interdisciplinary research,…

  4. Teaching and Learning in Interdisciplinary Higher Education: A Systematic Review

    Science.gov (United States)

    Spelt, Elisabeth J. H.; Biemans, Harm J. A.; Tobi, Hilde; Luning, Pieternel A.; Mulder, Martin

    2009-01-01

    Interdisciplinary higher education aims to develop boundary-crossing skills, such as interdisciplinary thinking. In the present review study, interdisciplinary thinking was defined as the capacity to integrate knowledge of two or more disciplines to produce a cognitive advancement in ways that would have been impossible or unlikely through single…

  5. From Surprise Parties to Mapmaking: Undergraduate Journeys toward Interdisciplinary Understanding

    Science.gov (United States)

    Haynes, Carolyn; Leonard, Jeannie Brown

    2010-01-01

    As educators in academic programs featuring interdisciplinary learning, the authors can attest that helping undergraduate students in an interdisciplinary studies major engage in interdisciplinary learning--that is, draw from two or more disciplines to advance understanding of a problem, question, or phenomenon--is no mean feat. Consequently, the…

  6. Learn with SAT to Minimize Büchi Automata

    Directory of Open Access Journals (Sweden)

    Stephan Barth

    2012-10-01

    Full Text Available We describe a minimization procedure for nondeterministic Büchi automata (NBA. For an automaton A another automaton A_min with the minimal number of states is learned with the help of a SAT-solver. This is done by successively computing automata A' that approximate A in the sense that they accept a given finite set of positive examples and reject a given finite set of negative examples. In the course of the procedure these example sets are successively increased. Thus, our method can be seen as an instance of a generic learning algorithm based on a "minimally adequate teacher'' in the sense of Angluin. We use a SAT solver to find an NBA for given sets of positive and negative examples. We use complementation via construction of deterministic parity automata to check candidates computed in this manner for equivalence with A. Failure of equivalence yields new positive or negative examples. Our method proved successful on complete samplings of small automata and of quite some examples of bigger automata. We successfully ran the minimization on over ten thousand automata with mostly up to ten states, including the complements of all possible automata with two states and alphabet size three and discuss results and runtimes; single examples had over 100 states.

  7. Electromagnetic Currents and Magnetic Moments in $\\chi$EFT

    Energy Technology Data Exchange (ETDEWEB)

    Saori Pastore, Luca Girlanda, Rocco Schiavilla, Michele Viviani, Robert Wiringa

    2009-09-01

    A two-nucleon potential and consistent electromagnetic currents are derived in chiral effective field theory ($\\chi$EFT) at, respectively, $Q^{\\, 2}$ (or N$^2$LO) and $e\\, Q$ (or N$^3$LO), where $Q$ generically denotes the low-momentum scale and $e$ is the electric charge. Dimensional regularization is used to renormalize the pion-loop corrections. A simple expression is derived for the magnetic dipole ($M1$) operator associated with pion loops, consisting of two terms, one of which is determined, uniquely, by the isospin-dependent part of the two-pion-exchange potential. This decomposition is also carried out for the $M1$ operator arising from contact currents, in which the unique term is determined by the contact potential. Finally, the low-energy constants (LEC's) entering the N$^2$LO potential are fixed by fits to the $np$ S- and P-wave phase shifts up to 100 MeV lab energies. Three additional LEC's are needed to completely specify the $M1$ operator at N$^3$L

  8. High chi polymer development for DSA applications using RAFT technology

    Science.gov (United States)

    Sheehan, Michael T.; Farnham, William B.; Tran, Hoang V.; Londono, J. David; Brun, Yefim

    2013-03-01

    Directed self-assembly (DSA) of block copolymers is proving to be an interesting and innovative method to make three-dimensional periodic, uniform patterns useful in a variety of microelectronics applications. Attributes critical to acceptable DSA performance of block copolymers include molecular weight uniformity, final purity, and reproducibility in all the steps involved in producing the polymers. Reversible Addition Fragmentation Chain Transfer (RAFT) polymerization technology enables the production of such materials provided that careful process monitoring and compositional homogeneity measurement systems are employed. It is uniquely suited to construction of multiblocks with components of widely divergent surface energies and functionality. We describe a high chi diblock system comprising partially fluorinated methacrylates and substituted styrenics. While special new polymer separation strategies involving controlled polymer particle assembly in liquid media are required for some monomer systems and molecular weight regimes, we have been able to demonstrate high yield and compositionally homogeneous diblocks of lamellar and cylindrical morphology with polydispersities < 1.1. During purification processes, these diblock materials undergo assembly processes in liquid media, and with appropriate controls, this allows for removal of soluble homopolymer contaminants. SAXS analyses of solid polymer samples provide estimates of lamellar d-spacing, and a good correlation with molecular weight is shown. This system will be described.

  9. The challenges of water governance in Ho Chi Minh City.

    Science.gov (United States)

    van Leeuwen, Cornelis J; Dan, Nguyen P; Dieperink, Carel

    2016-04-01

    Population growth, urbanization, pollution, and climate change pose urgent water challenges in cities. In this study, the sustainability of integrated water resources management in Ho Chi Minh City (HCMC) was evaluated using the City Blueprint approach. The City Blueprint is a set of 24 dedicated indicators divided over 8 categories (i.e., water security, water quality, drinking water, sanitation, infrastructure, climate robustness, biodiversity and attractiveness, and governance including public participation). The analysis showed that the rapid increase of water use for urban, industrial, and agricultural activities in HCMC has resulted in depletion of groundwater and severe pollution of both groundwater and surface water. Surface water quality, groundwater quality, biodiversity, and the sanitation of domestic and industrial wastewater are matters that need serious improvement. Current and future water supply in HCMC is at risk. HCMC can cope with it, but the 7 governance gaps as described by the Organisation for Economic Co-operation and Development (OECD) are major obstacles for HCMC. Rainwater harvesting, pollution reduction, as well as wastewater reuse are among the practical options. Wastewater reuse could lower the water stress index to 10%. The window to do this is narrow and rapidly closing as a result of the unprecedented urbanization and economic growth of this region. PMID:26009880

  10. Acute Cardiovascular Response to Sign Chi Do Exercise

    Directory of Open Access Journals (Sweden)

    Carol E. Rogers

    2015-08-01

    Full Text Available Safe and gentle exercise may be important for older adults overcoming a sedentary lifestyle. Sign Chi Do (SCD, a novel form of low impact exercise, has shown improved balance and endurance in healthy older adults, and there have been no SCD-related injuries reported. Sedentary older adults are known to have a greater cardiovascular (CV response to physical activity than those who regularly exercise. However their CV response to SCD is unknown. This study explored the acute CV response of older adults to SCD. Cross-sectional study of 34 sedentary and moderately active adults over age 55 with no previous experience practicing SCD. Participants completed a 10 min session of SCD. CV outcomes of heart rate, blood pressure, rate pressure product were recorded at 0, 5, 10 min of SCD performance, and after 10 min of rest. HR was recorded every minute. There was no difference in CV scores of sedentary and moderately active older adults after a session of SCD-related activity. All CV scores increased at 5 min, were maintained at 10 min, and returned to baseline within 10 min post SCD (p < 0.05. SCD may be a safe way to increase participation in regular exercise by sedentary older adults.

  11. Central Exclusive Production of $\\chi$ Mesons at LHCb

    CERN Document Server

    Bjornstad, Pal Marius

    The LHCb experiment is a forward spectrometer at the Large Hadron Collider, covering a range of pseudorapidity $1.9<\\eta<4.9$. It has a very precise vertex detector called the VELO, near the interaction point. The monitoring software for the VELO is discussed in this thesis. In proton-proton interactions, Central Exclusive Production (CEP) is a process where the protons remain intact after the interaction, and an additional simple central system is produced. CEP processes are selected experimentally by requiring that there is no activity in the detector apart from the central system. The installation of additional detectors to increase the sensitivity at small angles from the beam axis is discussed. A geometrical description of the region of the LHC up to $100$~m on each side of the LHCb interaction point is developed. Simulated forward shower counters are added to the model, and the efficiencies of the detectors are measured. The main part of this thesis describes an analysis of CEP of $\\chi_c$ mes...

  12. Vocal intensity in lecturers: Results of measurements conducted during lecture sessions

    Directory of Open Access Journals (Sweden)

    Witold Mikulski

    2013-12-01

    Full Text Available Background: Occupational voice users (inter alia: lecturers speak with different levels of vocal intensity. Speakers adjust this intensity knowingly (e.g. to underline the importance of fragments of the speech or unknowingly. The unknown adjustment of voice intensity occurs e.g. in the presence of high acoustic background noise (so-called Lombard effect, but it also results from many other factors: hearing loss, construction of the vocal tract, habits and others. The aim of the article is to confirm the thesis that in similar conditions of acoustic properties of the room different lecturers speak with different levels of vocal intensity. Materials and Methods: The study was conducted in a group of 10 lecturers in the same conference room. A-weighted sound pressure level determined at 1 m from the lecturer's mouth was adopted as a parameter defining the intensity of the lecturer's voice. The levels of all lecturers' voice intensity were compared and evaluated according to the criteria defined in EN ISO 9921. Results: Nine in ten lecturers were speaking with normal voice intensity (60-65 dB and only one full-time university lecturer was speaking with raised voice (66-71 dB. Conclusions: It was found that in the room of the same acoustic conditions the lecturers spoke with different intensities of voice. Some lecturers occasionally, and one all the time spoke with the voice intensity specified by PN-EN ISO 9921 as a raised voice. The results of the preliminary study warrant further studies in a larger group of teachers. Med Pr 2013;64(6:797–804

  13. Building interdisciplinary research models: a didactic course to prepare interdisciplinary scholars and faculty.

    Science.gov (United States)

    Larson, Elaine L; Landers, Timothy F; Begg, Melissa D

    2011-02-01

    Many academicians assume that anyone can engage in interdisciplinary research, but it is clear that successful interdisciplinary efforts require mastery of specific competencies that can be learned and improved. This paper describes the development and implementation of a course designed for Master's, pre- and postdoctoral students and research faculty on models of interdisciplinary research skills, based on a set of core competencies. Major challenges included working through institutional structures that made it difficult to offer cross-school courses, and interpersonal challenges among a diverse group of students from a number of disciplines. Although universities may be poised for interdisciplinary research, strategies for faculty preparation and support are lacking. Institutions embracing the concept of team and interdisciplinary science must focus not only on the structural barriers and facilitators, but also on direct support to faculty. The didactic course described in this paper is one approach to enhance interdisciplinary research skills of scholars-in-training and faculty, and we recommend that similar efforts be widely implemented. PMID:21348954

  14. Statistical analysis of earthquakes after the 1999 MW 7.7 Chi-Chi, Taiwan, earthquake based on a modified Reasenberg-Jones model

    Science.gov (United States)

    Chen, Yuh-Ing; Huang, Chi-Shen; Liu, Jann-Yenq

    2015-12-01

    We investigated the temporal-spatial hazard of the earthquakes after the 1999 September 21 MW = 7.7 Chi-Chi shock in a continental region of Taiwan. The Reasenberg-Jones (RJ) model (Reasenberg and Jones, 1989, 1994) that combines the frequency-magnitude distribution (Gutenberg and Richter, 1944) and time-decaying occurrence rate (Utsu et al., 1995) is conventionally employed for assessing the earthquake hazard after a large shock. However, it is found that the b values in the frequency-magnitude distribution of the earthquakes in the study region dramatically decreased from background values after the Chi-Chi shock, and then gradually increased up. The observation of a time-dependent frequency-magnitude distribution motivated us to propose a modified RJ model (MRJ) to assess the earthquake hazard. To see how the models perform on assessing short-term earthquake hazard, the RJ and MRJ models were separately used to sequentially forecast earthquakes in the study region. To depict the potential rupture area for future earthquakes, we further constructed relative hazard (RH) maps based on the two models. The Receiver Operating Characteristics (ROC) curves (Swets, 1988) finally demonstrated that the RH map based on the MRJ model was, in general, superior to the one based on the original RJ model for exploring the spatial hazard of earthquakes in a short time after the Chi-Chi shock.

  15. Interactive lectures: Clickers or personal devices?

    Science.gov (United States)

    Morrell, Lesley J; Joyce, Domino A

    2015-01-01

    Audience response systems ('clickers') are frequently used to promote participation in large lecture classes, and evidence suggests that they convey a number of benefits to students, including improved academic performance and student satisfaction. The limitations of these systems (such as limited access and cost) can be overcome using students' personal electronic devices, such as mobile phones, tablets and laptops together with text message, web- or app-based polling systems. Using questionnaires, we compare student perceptions of clicker and smartphone based polling systems. We find that students prefer interactive lectures generally, but those that used their own device preferred those lectures over lectures using clickers. However, device users were more likely to report using their devices for other purposes (checking email, social media etc.) when they were available to answer polling questions. These students did not feel that this distracted them from the lecture, instead, concerns over the use of smartphones centred around increased battery usage and inclusivity for students without access to suitable technology. Our results suggest that students generally preferred to use their own devices over clickers, and that this may be a sensible way to overcome some of the limitations associated with clickers, although issues surrounding levels of distraction and the implications for retention and recall of information need further investigation. PMID:26594327

  16. Three lectures on effective interaction in nuclei

    International Nuclear Information System (INIS)

    The first lecture discusses the origins of the density dependence of the effective interaction. The significance of effective interactions in nuclei is noted. The lowest-order treatment of the short-range repulsion in the nucleon-nucleon interaction (the separation method) and an improved treatment including some of the effect of the nuclear medium on the interaction (dispersion effect) are reviewed. Density dependence and effective three-body interactions and also isospin asymmetry effects are discussed as well. The second lecture examines surface peaking of the effective interaction and why the shell model works. Average interaction energy between valence nucleons and pairing are considered. In concluding this lecture the author explains why the nuclear shell model works and how it could break down if the interaction were not density dependent. The final lecture presents essential features of the effective interaction for nuclear structure calculations. The surface-delta interaction is discussed, brief remarks are made concerning the effective interaction at high energies, and a summary of the dozen most important points of the lectures is given. 1 figure

  17. An interdisciplinary perspective on social and physical determinants of seismic risk

    Science.gov (United States)

    Lin, K.-H.; Chang, Y.-C.; Liu, G.-Y.; Chan, C.-H.; Lin, T.-H.; Yeh, C.-H.

    2015-01-01

    While disaster studies researchers usually view risk as a function of hazard, exposure, and vulnerability, few studies have systematically examined the relationships among the various physical and socioeconomic determinants underlying disasters, and fewer have done so through seismic risk analysis. In the context of the 1999 Chi-Chi earthquake in Taiwan, this study constructs five hypothetical models to test different determinants that affect disaster fatality at the village level, namely seismic hazard intensity, population, building fragility, demographics and socioeconomics. The Poisson Regression Model is used to estimate the impact of natural hazards and social factors on fatality. Results indicate that although all of the determinants have an impact on the specific dimension of seismic fatality, some indicators of social inequality, such as gender ratio, dependency ratio, income and its SD, are the driving determinants deteriorating vulnerability to seismic risk. These findings have strong social implications for policy interventions to mitigate such disasters. This study presents an interdisciplinary investigation into social and physical determinants in seismic risk.

  18. ACADEMIC TRAINING LECTURES QUESTIONNAIRE: SUGGEST AND WIN!

    CERN Document Server

    Academic Training; Tel. 73127

    2001-01-01

    Time to plan for the 2001-02 lecture series. From today until April 9 you have the chance to give your contribution to improved planning for next year's Academic Training Lectures Series. At the web site: http://wwwinfo/support/survey/academic-training/ you will find questionnaires concerning the following different categories: high energy physics, applied physics, science and society and post-graduate students lectures. Answering the questionnaire will help ensure that the selected topics are as close as possible to your interests. In particular requests and comments from students will be much appreciated. To encourage your contribution, the AT Committee will reward one lucky winner with a small prize, a 50 CHF coupon for a book purchase at CERN bookshop.

  19. Lectures on formal and rigid geometry

    CERN Document Server

    Bosch, Siegfried

    2014-01-01

    A first version of this work appeared in 2005 as a Preprint of the Collaborative Research Center "Geometrical Structures in Mathematics" at the University of Münster. Its aim was to offer a concise and self-contained 'lecture-style' introduction to the theory of classical rigid geometry established by John Tate, together with the formal algebraic geometry approach launched by Michel Raynaud. These Lectures are now viewed commonly as an ideal means of learning advanced rigid geometry, regardless of the reader's level of background. Despite its parsimonious style, the presentation illustrates a number of key facts even more extensively than any other previous work. This Lecture Notes Volume is a revised and slightly expanded version of the original preprint and has been published at the suggestion of several experts in the field.

  20. Interdisciplinary research: putting the methods under the microscope

    Directory of Open Access Journals (Sweden)

    Martin Douglas K

    2003-10-01

    Full Text Available Abstract Background While the desirability of interdisciplinary inquiry has been widely acknowledged, indeed has become 'the mantra of science policy', the methods of interdisciplinary collaboration are opaque to outsiders and generally remain undescribed. Discussion Many have analysed interdisciplinarity, especially in relation to the creation of new disciplines and institutions. These analyses are briefly outlined. Still, there currently persists a silence about the methods of interdisciplinary collaboration itself, and the core of this paper proposes a template for such methods. Summary Breaking this silence – by making the methods of interdisciplinary projects transparent – could further invigorate interdisciplinary research.

  1. Observation of chi(cJ) decays to Lambda(Lambda)over-bar pi(+)pi(-)

    NARCIS (Netherlands)

    Ablikim, M.; Achasov, M. N.; Ambrose, D. J.; An, F. F.; An, Q.; An, Z. H.; Bai, J. Z.; Ban, Y.; Becker, J.; Bennett, J. V.; Bertani, M.; Bian, J. M.; Boger, E.; Bondarenko, O.; Boyko, I.; Briere, R. A.; Bytev, V.; Cai, X.; Cakir, O.; Calcaterra, A.; Cao, G. F.; Cetin, S. A.; Chang, J. F.; Chelkov, G.; Chen, G.; Chen, H. S.; Chen, J. C.; Chen, M. L.; Chen, S. J.; Chen, Y. B.; Cheng, H. P.; Chu, Y. P.; Cronin-Hennessy, D.; Dai, H. L.; Dai, J. P.; Dedovich, D.; Deng, Z. Y.; Denig, A.; Denysenko, I.; Destefanis, M.; Ding, W. M.; Ding, Y.; Dong, L. Y.; Dong, M. Y.; Du, S. X.; Fang, J.; Fang, S. S.; Fava, L.; Feldbauer, F.; Feng, C. Q.; Ferroli, R. B.; Fu, C. D.; Fu, J. L.; Gao, Y.; Geng, C.; Goetzen, K.; Gong, W. X.; Gradl, W.; Greco, M.; Gu, M. H.; Gu, Y. T.; Guan, Y. H.; Guo, A. Q.; Guo, L. B.; Guo, Y. P.; Han, Y. L.; Harris, F. A.; He, K. L.; He, M.; He, Z. Y.; Held, T.; Heng, Y. K.; Hou, Z. L.; Hu, H. M.; Hu, J. F.; Hu, T.; Huang, G. M.; Huang, J. S.; Huang, X. T.; Huang, Y. P.; Hussain, T.; Ji, C. S.; Ji, Q.; Ji, X. B.; Ji, X. L.; Jiang, L. L.; Jiang, X. S.; Jiao, J. B.; Jiao, Z.; Jin, D. P.; Jin, S.; Jing, F. F.; Kalantar-Nayestanaki, N.; Kavatsyuk, M.; Kuehn, W.; Lai, W.; Lange, J. S.; Li, C. H.; Li, Cheng; Li, Cui; Li, D. M.; Li, F.; Li, G.; Li, H. B.; Li, J. C.; Li, K.; Li, Lei; Li, Q. J.; Li, S. L.; Li, W. D.; Li, W. G.; Li, X. L.; Li, X. N.; Li, X. Q.; Li, X. R.; Li, Z. B.; Liang, H.; Liang, Y. F.; Liang, Y. T.; Liao, G. R.; Liao, X. T.; Liu, B. J.; Liu, C. L.; Liu, C. X.; Liu, C. Y.; Liu, F. H.; Liu, Fang; Liu, Feng; Liu, H.; Liu, H. B.; Liu, H. H.; Liu, H. M.; Liu, H. W.; Liu, J. P.; Liu, K. Y.; Liu, Kai; Liu, P. L.; Liu, Q.; Liu, S. B.; Liu, X.; Liu, X. H.; Liu, Y. B.; Liu, Z. A.; Liu, Zhiqiang; Liu, Zhiqing; Loehner, H.; Lu, G. R.; Lu, H. J.; Lu, J. G.; Lu, Q. W.; Lu, X. R.; Lu, Y. P.; Luo, C. L.; Luo, M. X.; Luo, T.; Luo, X. L.; Lv, M.; Ma, C. L.; Ma, F. C.; Ma, H. L.; Ma, Q. M.; Ma, S.; Ma, T.; Ma, X. Y.; Ma, Y.; Maas, F. E.; Maggiora, M.; Malik, Q. A.; Mao, Y. J.; Mao, Z. P.; Messchendorp, J. G.; Min, J.; Min, T. J.; Mitchell, R. E.; Mo, X. H.; Morales, C. Morales; Motzko, C.; Muchnoi, N. Yu.; Muramatsu, H.; Nefedov, Y.; Nicholson, C.; Nikolaev, I. B.; Ning, Z.; Olsen, S. L.; Ouyang, Q.; Pacetti, S.; Park, J. W.; Pelizaeus, M.; Peng, H. P.; Peters, K.; Ping, J. L.; Ping, R. G.; Poling, R.; Prencipe, E.; Qi, M.; Qian, S.; Qiao, C. F.; Qin, X. S.; Qin, Y.; Qin, Z. H.; Qiu, J. F.; Rashid, K. H.; Rong, G.; Ruan, X. D.; Sarantsev, A.; Schaefer, B. D.; Schulze, J.; Shao, M.; Shen, C. P.; Shen, X. Y.; Sheng, H. Y.; Shepherd, M. R.; Song, X. Y.; Spataro, S.; Spruck, B.; Sun, D. H.; Sun, G. X.; Sun, J. F.; Sun, S. S.; Sun, Y. J.; Sun, Y. Z.; Sun, Z. J.; Sun, Z. T.; Tang, C. J.; Tang, X.; Tapan, I.; Thorndike, E. H.; Toth, D.; Ullrich, M.; Varner, G. S.; Wang, B.; Wang, B. Q.; Wang, K.; Wang, L. L.; Wang, L. S.; Wang, M.; Wang, P.; Wang, P. L.; Wang, Q.; Wang, Q. J.; Wang, S. G.; Wang, X. L.; Wang, Y. D.; Wang, Y. F.; Wang, Y. Q.; Wang, Z.; Wang, Z. G.; Wang, Z. Y.; Wei, D. H.; Weidenkaff, P.; Wen, Q. G.; Wen, S. P.; Wiedner, U.; Wu, L. H.; Wu, N.; Wu, S. X.; Wu, W.; Wu, Z.; Xia, L. G.; Xiao, Z. J.; Xie, Y. G.; Xiu, Q. L.; Xu, G. F.; Xu, G. M.; Xu, H.; Xu, Q. J.; Xu, X. P.; Xu, Z. R.; Xue, F.; Xue, Z.; Yan, L.; Yan, W. B.; Yan, Y. H.; Yang, H. X.; Yang, Y.; Yang, Y. X.; Ye, H.; Ye, M.; Ye, M. H.; Yu, B. X.; Yu, C. X.; Yu, J. S.; Yu, S. P.; Yuan, C. Z.; Yuan, Y.; Zafar, A. A.; Zallo, A.; Zeng, Y.; Zhang, B. X.; Zhang, B. Y.; Zhang, C. C.; Zhang, D. H.; Zhang, H. H.; Zhang, H. Y.; Zhang, J. Q.; Zhang, J. W.; Zhang, J. Y.; Zhang, J. Z.; Zhang, S. H.; Zhang, X. J.; Zhang, X. Y.; Zhang, Y.; Zhang, Y. H.; Zhang, Y. S.; Zhang, Z. P.; Zhang, Z. Y.; Zhao, G.; Zhao, H. S.; Zhao, J. W.; Zhao, K. X.; Zhao, Lei; Zhao, Ling; Zhao, M. G.; Zhao, Q.; Zhao, S. J.; Zhao, T. C.; Zhao, X. H.; Zhao, Y. B.; Zhao, Z. G.; Zhemchugov, A.; Zheng, B.; Zheng, Y. H.; Zhong, B.; Zhong, J.; Zhou, L.; Zhou, X. K.; Zhou, X. R.; Zhu, C.; Zhu, K.; Zhu, K. J.; Zhu, S. H.; Zhu, X. L.; Zhu, X. W.; Zhu, Y. C.; Zhu, Y. M.; Zhu, Y. S.; Zhu, Z. A.; Zhuang, J.; Zou, B. S.; Zou, J. H.; Werner, M.J.; Zheng, J.P.

    2012-01-01

    Decays of the chi(cJ) states (J = 0, 1, 2) to Lambda(Lambda) over bar pi(+)pi(-), including processes with intermediate Sigma(1385), are studied through the E1 transition psi(1) -> gamma chi(cJ) using 106 x 10(6) psi(1) events collected with the BESIII detector at BEPCII. This is the first observati

  2. Higher-order multipole amplitude measurement in psi ' -> gamma chi(c2)

    NARCIS (Netherlands)

    Ablikim, M.; Achasov, M. N.; Alberto, D.; An, F. F.; An, Q.; An, Z. H.; Bai, J. Z.; Baldini, R.; Ban, Y.; Becker, J.; Berger, N.; Bertani, M.; Bian, J. M.; Boger, E.; Bondarenko, O.; Boyko, I.; Briere, R. A.; Bytev, V.; Cai, X.; Calcaterra, A. C.; Cao, G. F.; Chang, J. F.; Chelkov, G.; Chen, G.; Chen, H. S.; Chen, J. C.; Chen, M. L.; Chen, S. J.; Chen, Y.; Chen, Y. B.; Cheng, H. P.; Chu, Y. P.; Cronin-Hennessy, D.; Dai, H. L.; Dai, J. P.; Dedovich, D.; Deng, Z. Y.; Denysenko, I.; Destefanis, M.; Ding, Y.; Dong, L. Y.; Dong, M. Y.; Du, S. X.; Fang, J.; Fang, S. S.; Feng, C. Q.; Fu, C. D.; Fu, J. L.; Gao, Y.; Geng, C.; Goetzen, K.; Gong, W. X.; Greco, M.; Gu, M. H.; Gu, Y. T.; Guan, Y. H.; Guo, A. Q.; Guo, L. B.; Guo, Y. P.; Han, Y. L.; Hao, X. Q.; Harris, F. A.; He, K. L.; He, M.; He, Z. Y.; Heng, Y. K.; Hou, Z. L.; Hu, H. M.; Hu, J. F.; Hu, T.; Huang, B.; Huang, G. M.; Huang, J. S.; Huang, X. T.; Huang, Y. P.; Hussain, T.; Ji, C. S.; Ji, Q.; Ji, X. B.; Ji, X. L.; Jia, L. K.; Jiang, L. L.; Jiang, X. S.; Jiao, J. B.; Jiao, Z.; Jin, D. P.; Jin, S.; Jing, F. F.; Kalantar-Nayestanaki, N.; Kavatsyuk, M.; Kuehn, W.; Lai, W.; Lange, J. S.; Leung, J. K. C.; Li, C. H.; Li, Cheng; Li, Cui; Li, D. M.; Li, F.; Li, G.; Li, H. B.; Li, J. C.; Li, K.; Li, Lei; Li, N. B.; Li, Q. J.; Li, S. L.; Li, W. D.; Li, W. G.; Li, X. L.; Li, X. N.; Li, X. Q.; Li, X. R.; Li, Z. B.; Liang, H.; Liang, Y. F.; Liang, Y. T.; Liao, X. T.; Liu, B. J.; Liu, C. L.; Liu, C. X.; Liu, C. Y.; Liu, F. H.; Liu, Fang; Liu, Feng; Liu, H.; Liu, H. B.; Liu, H. H.; Liu, H. M.; Liu, H. W.; Liu, J. P.; Liu, K.; Liu, K.; Liu, K. Y.; Liu, Q.; Liu, S. B.; Liu, X.; Liu, X. H.; Liu, Y. B.; Liu, Y. W.; Liu, Yong; Liu, Z. A.; Liu, Zhiqiang; Liu, Zhiqing; Loehner, H.; Lu, G. R.; Lu, H. J.; Lu, J. G.; Lu, Q. W.; Lu, X. R.; Lu, Y. P.; Luo, C. L.; Luo, M. X.; Luo, T.; Luo, X. L.; Lv, M.; Ma, C. L.; Ma, F. C.; Ma, H. L.; Ma, Q. M.; Ma, S.; Ma, T.; Ma, X.; Ma, X. Y.; Maggiora, M.; Malik, Q. A.; Mao, H.; Mao, Y. J.; Mao, Z. P.; Messchendorp, J. G.; Min, J.; Min, T. J.; Mitchell, R. E.; Mo, X. H.; Muchnoi, N. Yu; Nefedov, Y.; Nikolaev, I. B.; Ning, Z.; Olsen, S. L.; Ouyang, Q.; Pacetti, S.; Park, J. W.; Pelizaeus, M.; Peters, K.; Ping, J. L.; Ping, R. G.; Poling, R.; Pun, C. S. J.; Qi, M.; Qian, S.; Qiao, C. F.; Qin, X. S.; Qiu, J. F.; Rashid, K. H.; Rong, G.; Ruan, X. D.; Sarantsev, A.; Schulze, J.; Shao, M.; Shen, C. P.; Shen, X. Y.; Sheng, H. Y.; Shepherd, M. R.; Song, X. Y.; Spataro, S.; Spruck, B.; Sun, D. H.; Sun, G. X.; Sun, J. F.; Sun, S. S.; Sun, X. D.; Sun, Y. J.; Sun, Y. Z.; Sun, Z. J.; Sun, Z. T.; Tang, C. J.; Tang, X.; Tian, H. L.; Toth, D.; Varner, G. S.; Wang, B.; Wang, B. Q.; Wang, K.; Wang, L. L.; Wang, L. S.; Wang, M.; Wang, P.; Wang, P. L.; Wang, Q.; Wang, Q. J.; Wang, S. G.; Wang, X. L.; Wang, Y. D.; Wang, Y. F.; Wang, Y. Q.; Wang, Z.; Wang, Z. G.; Wang, Z. Y.; Wei, D. H.; Wen, Q. G.; Wen, S. P.; Wiedner, U.; Wu, L. H.; Wu, N.; Wu, W.; Wu, Z.; Xiao, Z. J.; Xie, Y. G.; Xiu, Q. L.; Xu, G. F.; Xu, G. M.; Xu, H.; Xu, Q. J.; Xu, X. P.; Xu, Y.; Xu, Z. R.; Xu, Z. Z.; Xue, Z.; Yan, L.; Yan, W. B.; Yan, Y. H.; Yang, H. X.; Yang, T.; Yang, Y.; Yang, Y. X.; Ye, H.; Ye, M.; Ye, M. H.; Yu, B. X.; Yu, C. X.; Yu, S. P.; Yuan, C. Z.; Yuan, W. L.; Yuan, Y.; Zafar, A. A.; Zallo, A.; Zeng, Y.; Zhang, B. X.; Zhang, B. Y.; Zhang, C.; Zhang, C. C.; Zhang, D. H.; Zhang, H. H.; Zhang, H. Y.; Zhang, J.; Zhang, J. Q.; Zhang, J. W.; Zhang, J. Y.; Zhang, J. Z.; Zhang, L.; Zhang, S. H.; Zhang, T. R.; Zhang, X. J.; Zhang, X. Y.; Zhang, Y.; Zhang, Y. H.; Zhang, Y. S.; Zhang, Z. P.; Zhang, Z. Y.; Zhao, G.; Zhao, H. S.; Zhao, Jiawei; Zhao, Jingwei; Zhao, Lei; Zhao, Ling; Zhao, M. G.; Zhao, Q.; Zhao, S. J.; Zhao, T. C.; Zhao, X. H.; Zhao, Y. B.; Zhao, Z. G.; Zhao, Z. L.; Zhemchugov, A.; Zheng, B.; Zheng, J. P.; Zheng, Y. H.; Zheng, Z. P.; Zhong, B.; Zhong, J.; Zhong, L.; Zhou, L.; Zhou, X. K.; Zhou, X. R.; Zhu, C.; Zhu, K.; Zhu, K. J.; Zhu, S. H.; Zhu, X. L.; Zhu, X. W.; Zhu, Y. S.; Zhu, Z. A.; Zhuang, J.; Zou, B. S.; Zou, J. H.; Zuo, J. X.

    2011-01-01

    Using 106 x 10(6) psi' events collected with the BESIII detector at the BEPCII storage ring, the higher-order multipole amplitudes in the radiative transition psi' -> gamma chi(c2) -> gamma pi(+)pi(-)/gamma K+K- are measured. A fit to the chi(c2) production and decay angular distributions yields M2

  3. Quantum key distribution by swapping the entanglement of {chi}-type state

    Energy Technology Data Exchange (ETDEWEB)

    Gao Gan, E-mail: gaogan0556@163.co [Department of Electrical Engineering, Tongling University, Tongling 244000 (China)

    2010-06-01

    We propose a quantum key distribution protocol using entanglement swapping of {chi}-type state; in this protocol, Alice and Bob transmit a particle sequence to each other and perform {chi}-type state measurements. Alice's and Bob's roles are completely symmetric.

  4. Implementing e-Health through CHI: A Very Canadian Solution to a Very Canadian Problem

    Directory of Open Access Journals (Sweden)

    Tom Daniels

    2014-05-01

    Full Text Available Canada Health Infoway (CHI was established as an arms-length body by the federal government in 2001 to provide funding to provinces for the development of interoperable e-health systems. CHI was established in response to a number of reports calling on the government to act to make use of technological advances to improve health care quality and provide more rigorous data. In addition to these explicit goals, through establishing CHI the federal government also sought to avoid potential criticism if the implementation of e-health failed, increase its own popularity ahead of the 2000 election and subtly redistribute wealth between the provinces. The paper suggests that the major influence behind the policy to establish CHI came from Canadian institutions and the fact that the federal government was hamstrung by the Canadian Constitution and Canada Health Act. Evaluation of the reform shows that progress has been made by CHI in implementing e-health solutions, but that Canada still lags behind other comparable health systems in the use of technologies. SWOT analysis of the CHI implementation highlights the criticism that CHI could stifle provincial innovation but recognizes that it also offers the opportunity for best practice dissemination across Canada and ensures that ring-fenced funding is available for e-health implementation across the provinces. In conclusion, the paper suggests that, because of constitutional constraints, the federal government was limited in options to implement e-health and that CHI represents a fair compromise.

  5. On performing concepts during science lectures

    Science.gov (United States)

    Pozzer-Ardenghi, Lilian; Roth, Wolff-Michael

    2007-01-01

    When lecturing, teachers make use of both verbal and nonverbal communication. What is called teaching, therefore, involves not only the words and sentences a teacher utters and writes on the board during a lesson, but also all the hands/arms gestures, body movements, and facial expressions a teacher performs in the classroom. All of these communicative modalities constitute resources that are made available to students for making sense of and learning from lectures. Yet in the literature on teaching science, these other means of communication are little investigated and understood - and, correspondingly, they are undertheorized. The purpose of this position paper is to argue for a different view of concepts in lectures: they are performed simultaneously drawing on and producing multiple resources that are different expressions of the same holistic meaning unit. To support our point, we provide examples from a database of 26 lectures in a 12th-grade biology class, where the human body was the main topic of study. We analyze how different types of resources - including verbal and nonverbal discourse and various material artifacts - interact during lectures. We provide evidence for the unified production of these various sense-making resources during teaching to constitute a meaning unit, and we emphasize particularly the use of gestures and body orientations inside this meaning unit. We suggest that proper analyses of meaning units need to take into account not only language and diagrams but also a lecturer's pointing and depicting gestures, body positions, and the relationships between these different modalities. Scientific knowledge (conceptions) exists in the concurrent display of all sense-making resources, which we, following Vygotsky, understand as forming a unit (identity) of nonidentical entities.

  6. Introductory lecture on waveguides and cavities

    International Nuclear Information System (INIS)

    This lecture has two parts: waveguides and cavities. Basic topics are discussed which can serve as bases for the following lectures. Many of the results obtained in the first part concerning waveguides are applied in the second part in the discussion on cavity properties, since a cavity can be considered as a part of a waveguide, a cavity resonant mode being a superposition of two counter-travelling waves in the waveguide. In deriving most of the mathematical formulas, complex number representation - that is, phasor forms - are used. For the final results, however, real number representations are also provided as much as possible as an aid to a more intuitive understanding. (author)

  7. Lecture notes for Advanced Time Series Analysis

    DEFF Research Database (Denmark)

    Madsen, Henrik; Holst, Jan

    1997-01-01

    A first version of this notes was used at the lectures in Grenoble, and they are now extended and improved (together with Jan Holst), and used in Ph.D. courses on Advanced Time Series Analysis at IMM and at the Department of Mathematical Statistics, University of Lund, 1994, 1997, ......A first version of this notes was used at the lectures in Grenoble, and they are now extended and improved (together with Jan Holst), and used in Ph.D. courses on Advanced Time Series Analysis at IMM and at the Department of Mathematical Statistics, University of Lund, 1994, 1997, ...

  8. Three lectures on the physics of RHIC

    International Nuclear Information System (INIS)

    Relativistic Heavy Ion Collider at BNL has just begun its operation, colliding the nuclei of Gold at unprecedented energies, RHIC is a dedicated QCD machine, and in these lectures I discuss some topics in the physics of hot and dense QCD matter that can be addressed there. The following subjects are considered in the present three lectures: introduction to the physics of RHIC; heavy quarkonium as a probe of QCD dynamics; topological fluctuations near the deconfinement phase transition and the possibility of P and CP violation in hot QCD. (author)

  9. $\\chi_{c2}$ formation in two-photon collisions at LEP

    CERN Document Server

    Acciarri, M; Adriani, O; Aguilar-Benítez, M; Alcaraz, J; Alemanni, G; Allaby, James V; Aloisio, A; Alviggi, M G; Ambrosi, G; Anderhub, H; Andreev, V P; Angelescu, T; Anselmo, F; Arefev, A; Azemoon, T; Aziz, T; Bagnaia, P; Baksay, L; Balandras, A; Ball, R C; Banerjee, S; Banerjee, Sw; Banicz, K; Barczyk, A; Barillère, R; Barone, L; Bartalini, P; Basile, M; Battiston, R; Bay, A; Becattini, F; Becker, U; Behner, F; Berdugo, J; Berges, P; Bertucci, B; Betev, B L; Bhattacharya, S; Biasini, M; Biland, A; Blaising, J J; Blyth, S C; Bobbink, Gerjan J; Böck, R K; Böhm, A; Boldizsar, L; Borgia, B; Bourilkov, D; Bourquin, Maurice; Braccini, S; Branson, J G; Brigljevic, V; Brochu, F; Buffini, A; Buijs, A; Burger, J D; Burger, W J; Busenitz, J K; Button, A M; Cai, X D; Campanelli, M; Capell, M; Cara Romeo, G; Carlino, G; Cartacci, A M; Casaus, J; Castellini, G; Cavallari, F; Cavallo, N; Cecchi, C; Cerrada-Canales, M; Cesaroni, F; Chamizo-Llatas, M; Chang, Y H; Chaturvedi, U K; Chemarin, M; Chen, A; Chen, G; Chen, G M; Chen, H F; Chen, H S; Chéreau, X J; Chiefari, G; Cifarelli, Luisa; Cindolo, F; Civinini, C; Clare, I; Clare, R; Coignet, G; Colijn, A P; Colino, N; Costantini, S; Cotorobai, F; de la Cruz, B; Csilling, Akos; Dai, T S; van Dalen, J A; D'Alessandro, R; De Asmundis, R; Déglon, P L; Degré, A; Deiters, K; Della Volpe, D; Denes, P; De Notaristefani, F; De Salvo, A; Diemoz, M; Van Dierendonck, D N; Di Lodovico, F; Dionisi, C; Dittmar, Michael; Dominguez, A; Doria, A; Dova, M T; Duchesneau, D; Dufournaud, D; Duinker, P; Durán, I; El-Mamouni, H; Engler, A; Eppling, F J; Erné, F C; Extermann, Pierre; Fabre, M; Faccini, R; Falagán, M A; Falciano, S; Favara, A; Fay, J; Fedin, O; Felcini, Marta; Ferguson, T; Ferroni, F; Fesefeldt, H S; Fiandrini, E; Field, J H; Filthaut, Frank; Fisher, P H; Fisk, I; Forconi, G; Fredj, L; Freudenreich, Klaus; Furetta, C; Galaktionov, Yu; Ganguli, S N; García-Abia, P; Gataullin, M; Gau, S S; Gentile, S; Gheordanescu, N; Giagu, S; Goldfarb, S; Gong, Z F; Grünewald, M W; van Gulik, R; Gupta, V K; Gurtu, A; Gutay, L J; Haas, D; Hartmann, B; Hasan, A; Hatzifotiadou, D; Hebbeker, T; Hervé, A; Hidas, P; Hirschfelder, J; Hofer, H; Holzner, G; Hoorani, H; Hou, S R; Iashvili, I; Jin, B N; Jones, L W; de Jong, P; Josa-Mutuberria, I; Khan, R A; Kamrad, D; Kapustinsky, J S; Kaur, M; Kienzle-Focacci, M N; Kim, D; Kim, D H; Kim, J K; Kim, S C; Kinnison, W W; Kirkby, Jasper; Kiss, D; Kittel, E W; Klimentov, A; König, A C; Kopp, A; Korolko, I; Koutsenko, V F; Krämer, R W; Krenz, W; Kunin, A; Lacentre, P E; Ladrón de Guevara, P; Laktineh, I; Landi, G; Lapoint, C; Lassila-Perini, K M; Laurikainen, P; Lavorato, A; Lebeau, M; Lebedev, A; Lebrun, P; Lecomte, P; Lecoq, P; Le Coultre, P; Lee, H J; Le Goff, J M; Leiste, R; Leonardi, E; Levchenko, P M; Li Chuan; Lin, C H; Lin, W T; Linde, Frank L; Lista, L; Liu, Z A; Lohmann, W; Longo, E; Lü, Y S; Lübelsmeyer, K; Luci, C; Luckey, D; Luminari, L; Lustermann, W; Ma Wen Gan; Maity, M; Majumder, G; Malgeri, L; Malinin, A; Maña, C; Mangeol, D J J; Marchesini, P A; Marian, G; Martin, J P; Marzano, F; Massaro, G G G; Mazumdar, K; McNeil, R R; Mele, S; Merola, L; Meschini, M; Metzger, W J; Von der Mey, M; Migani, D; Mihul, A; Milcent, H; Mirabelli, G; Mnich, J; Molnár, P; Monteleoni, B; Moulik, T; Muanza, G S; Muheim, F; Muijs, A J M; Nahn, S; Napolitano, M; Nessi-Tedaldi, F; Newman, H; Niessen, T; Nippe, A; Nisati, A; Nowak, H; Oh, Yu D; Organtini, G; Ostonen, R; Palomares, C; Pandoulas, D; Paoletti, S; Paolucci, P; Park, H K; Park, I H; Pascale, G; Passaleva, G; Patricelli, S; Paul, T; Pauluzzi, M; Paus, C; Pauss, Felicitas; Peach, D; Pedace, M; Pei, Y J; Pensotti, S; Perret-Gallix, D; Petersen, B; Petrak, S; Piccolo, D; Pieri, M; Piroué, P A; Pistolesi, E; Plyaskin, V; Pohl, M; Pozhidaev, V; Postema, H; Pothier, J; Produit, N; Prokofev, D; Prokofiev, D O; Quartieri, J; Rahal-Callot, G; Raja, N; Rancoita, P G; Raven, G; Razis, P A; Ren, D; Rescigno, M; Reucroft, S; Van Rhee, T; Riemann, S; Riles, K; Robohm, A; Rodin, J; Roe, B P; Romero, L; Rosier-Lees, S; Roth, S; Rubio, Juan Antonio; Ruschmeier, D; Rykaczewski, H; Sakar, S; Salicio, J; Sánchez, E; Sanders, M P; Sarakinos, M E; Schäfer, C; Shchegelskii, V; Schmidt-Kärst, S; Schmitz, D; Scholz, N; Schopper, Herwig Franz; Schotanus, D J; Schwenke, J; Schwering, G; Sciacca, C; Sciarrino, D; Servoli, L; Shevchenko, S; Shivarov, N; Shoutko, V; Shukla, J; Shumilov, E; Shvorob, A V; Siedenburg, T; Son, D; Smith, B; Spillantini, P; Steuer, M; Stickland, D P; Stone, A; Stone, H; Stoyanov, B; Strässner, A; Sudhakar, K; Sultanov, G G; Sun, L Z; Suter, H; Swain, J D; Szillási, Z; Tang, X W; Tauscher, Ludwig; Taylor, L; Timmermans, C; Ting, Samuel C C; Ting, S M; Tonwar, S C; Tóth, J; Tully, C; Tung, K L; Uchida, Y; Ulbricht, J; Valente, E; Vesztergombi, G; Vetlitskii, I; Viertel, Gert M; Villa, S; Vivargent, M; Vlachos, S; Vogel, H; Vogt, H; Vorobev, I; Vorobyov, A A; Vorvolakos, A; Wadhwa, M; Wallraff, W; Wang, J C; Wang, X L; Wang, Z M; Weber, A; Wilkens, H; Wu, S X; Wynhoff, S; Xia, L; Xu, Z Z; Yang, B Z; Yang, C G; Yang, H J; Yang, M; Ye, J B; Yeh, S C; You, J M; Zalite, A; Zalite, Yu; Zemp, P; Zeng, Y; Zhang, Z P; Zhu, G Y; Zhu, R Y; Zichichi, Antonino; Ziegler, F; Zilizi, G

    1999-01-01

    Two-photon formation of the charmonium resonance $\\chi_{{\\rm c}2}$ has been studied with the L3 detector at LEP. The $\\chi_{{\\rm c}2}$ is identified through its decay $\\chi_{{\\rm c}2} \\rightarrow \\gamma {\\rm J}$, with a subsequent decay ${\\rm J} \\rightarrow {\\mathrm{e^+ e^-}}$ or ${\\rm J} \\rightarrow {\\mathrm{\\mu^+ \\mu^-}}$. With an integrated luminosity of 140 pb$^{-1}$ at $\\sqrt{s} \\simeq$ 91~\\textrm{Ge\\kern -0.1em V} and 52 pb$^{-1}$ at $\\sqrt{s} \\simeq$ {Ge\\kern -0.1em V}, we measure the two-photon width of the $\\chi_{{\\rm c}2}$ to be \\begin{center} $\\Gamma_{\\gamma\\gamma}(\\chi_{{\\rm c}2})=1.02 \\pm 0.40 \\mbox{$\\;$(stat.)} \\pm 0.15 \\mbox{$\\;$(sys.)} \\pm 0.09(\\rm{BR.}) {\\mathrm{\\ ke\\kern -0.1em V}}$.

  10. An Assessment of Tai Chi Exercise on Cognitive Ability in Older Adults

    Directory of Open Access Journals (Sweden)

    Hung Manh NGUYEN

    2015-09-01

    Full Text Available The purpose of this study was to evaluate the effects of Tai Chi exercise on cognitive performance of community - dwelling elderly in Vinh city, Vietnam. It is a controlled trial. One hundred subjected were recruited. Subjects were divided randomly into two groups. Tai Chi group was assigned 6 - months Tai Chi training. Control group was instructed to maintain their routine daily activities. Participants in Tai Chi group reported significant improvement cognitive ability, part A with F(1, 68 = 75.36, p < .001, and in part B with F(1, 68= 172.83, p < .001 in comparison with Control group. Tai Chi is beneficial to improve cognitive performance of the elderly.

  11. 4th international interdisciplinary chaos symposium

    CERN Document Server

    Banerjee, Santo; Caglar, Suleyman; Ozer, Mehmet; Chaos and complex systems

    2013-01-01

    Complexity Science and Chaos Theory are fascinating areas of scientific research with wide-ranging applications.  The interdisciplinary nature and ubiquity of complexity and chaos are features that provides scientists with a motivation to pursue general theoretical tools and frameworks. Complex systems give rise to emergent behaviors, which in turn produce novel and interesting phenomena in science, engineering, as well as in the socio-economic sciences. The aim of all Symposia on Chaos and Complex Systems (CCS) is to bring together scientists, engineers, economists and social scientists, and to discuss the latest insights and results obtained in the area of corresponding nonlinear-system complex (chaotic) behavior. Especially for the “4th International Interdisciplinary Chaos Symposium on Chaos and Complex Systems,” which took place April 29th to May 2nd, 2012 in Antalya, Turkey, the scope of the symposium had been further enlarged so as to encompass the presentation of work from circuits to econophysic...

  12. What is Interdisciplinary about Victorian History today?

    Directory of Open Access Journals (Sweden)

    Rohan McWilliam

    2005-10-01

    Full Text Available This article examines the way demands for interdisciplinarity have shaped the writing of Victorian history in recent years. It briefly explores the writing of Victorian history since the 1930s (arguing that the interdisciplinary impulse is nothing new so as to consider the peculiarities of the post-1980 historiography. A range of works by cultural historians (such as Judith Walkowitz and Peter Bailey who made a distinctive contribution to debates about the Victorians in the late twentieth century are assessed in order to understand the current state of the academic conversation. The article discusses both the strengths and weaknesses of recent approaches. It argues that interdisciplinary cultural history has so far resisted attempts to create a new synthesis and ponders ways in which such a synthesis might be achieved.

  13. Interdisciplinary education approach to the human science

    Science.gov (United States)

    Szu, Harold; Zheng, Yufeng; Zhang, Nian

    2012-06-01

    We introduced human sciences as components, and integrated them together as an interdisciplinary endeavor over decades. This year, we built a website to maintain systematically the educational research service. We captured the human sciences in various components in the SPIE proceedings over the last decades, which included: (i) ears & eyes like adaptive wavelets, (ii) brain-like unsupervised learning independent component analysis (ICA); (iii) compressive sampling spatiotemporal sparse information processing, (iv) nanoengineering approach to sensing components, (v) systems biology measurements, and (vi) biomedical wellness applications. In order to serve the interdisciplinary community better, our system approach is based on that the former recipients invited the next recipients to deliver their review talks and panel discussions. Since only the former recipients of each component can lead the nomination committees and make the final selections, we also create a leadership award which may be nominated by any conference attendance, to be approved by the conference organization committee.

  14. Design Research : Synergies from Interdisciplinary Perspectives

    OpenAIRE

    2010-01-01

    Design Research is a new interdisciplinary research area with a social science orientation at its heart, and this book explores how scientific knowledge can be put into practice in ways that are at once ethical, creative, helpful, and extraordinary in their results. In order to clarify the common aspects – in terms of features and approaches – that characterize all strands of research disciplines addressing design, Design Research undertakes an in depth exploration of the social processes inv...

  15. EDITORIAL: MUSLIM SCHOLARS TOWARDS WESTERN INTERDISCIPLINARY APPROACH

    OpenAIRE

    Editor Al-Jami'ah: Journal of Islamic Studies

    2006-01-01

    It could be spoken up that ‘ulama’ of classical and medieval ages carried out interdisciplinary approaches in dealing with difficulties they had encountered in understanding Islamic texts or teachings. This could be indicated from a number of the ‘ulama’ who possessed not only one expertise but more, such as an Arabic linguist who was also expert both in Islamic jurisprudence, quranic exegesis and Muhammadan tradition. Therefore, it was common sense that when they were interpreting quranic ve...

  16. [Interdisciplinary quality management in preventive medicine institutions].

    Science.gov (United States)

    Fischer, Robert

    2004-12-01

    Like all health care institutions, preventive medicine institutions, too, need a quality assurance structure. An integrated system consisting of "balanced score card", "finite-elements-model" and "interdisciplinary quality circles" is presented. This organisational structure allows the implementation of quality assurance in complex institutions as well, such as health care organisations. In addition, this concept guarantees broad acceptance by all team members, not least due to complexity reduction. PMID:15675427

  17. Diversity – An International and Interdisciplinary Journal

    OpenAIRE

    Shu-Kun Lin

    2009-01-01

    After many years of careful planning, we are pleased to launch Diversity (ISSN 1424-2818), a new international and interdisciplinary Open Access journal. Among diversity topics, biodiversity has always been a key topic. In 1996, when I was establishing Molecular Diversity Preservation International (MDPI), an organization dedicated to the collection and distribution of rare molecular samples, I read several books on biodiversity. To promote the MDPI project, in 1996 the journal Molecules was ...

  18. Interpreting the landscape: an interdisciplinary task

    OpenAIRE

    Fürstenau Togashi, Henrique

    2010-01-01

    The landscape concept has been used by several disciplines and has been given multiple connotations, hence there are few agreements on its meaning. This paper is a conceptual review of the landscape, made from an integration of elements taken from different geographic disciplines, like environmental history and landscape ecology. From this interdisciplinary approach, a historical assessment is performed to cover from the origin of the term to its most recent transformation. The main purpose i...

  19. Extracurricular Activities, an Alternative for Interdisciplinary Learning

    Directory of Open Access Journals (Sweden)

    Carmen Maria CHISIU

    2013-12-01

    Full Text Available Extracurricular activities include multiple measures of education and training. They are characterized by a greater variety and flexibility, providing better options for folding the particular skills and interests of students, satisfying the greater needs of children and young people, having at the same time a strong band. As extracurricular activities are not unequivocally associated to content, they may be an opportunity for interdisciplinary learning, which is much closer to learning to life than learning school subjects, which is strictly divided. Interdisciplinarity as a way of organizing learning content, with implications for the entire design strategies curriculum provides a consistent view of phenomena and processes proposed for study and facilitates contextualization and application of school knowledge in different life situations. Interdisciplinary approach to learning leads to the achievement of learning objectives of a high complexity. Children learn to make decisions, to think critically, to solve problems. Learning is achieved mainly through cooperation, teacher and students become partners in learning. The student is asked to solve various tasks and make an active contribution to his own development. The assessment focuses on the qualitative elements and targets the learning progress. In this paper we propose a way to achieve the design of an extracurricular activity – the trip in an interdisciplinary manner, in terms of Bloom’s taxonomy and of the theory of multiple intelligences – HowardGardner. The tasks approach the interdisciplinary learning, differentiated, based on the eight types of intelligences: linguistic, logical -mathematical, visual-spatial, musicalrhythmical, kinesthetical, interpersonal, intrapersonal, naturalistic, following step by step the six levels of Bloom’ s taxonomy: knowledge, comprehension, application, analysis, synthesis and evaluation. Classification-JEL: A23

  20. Biophysics software for interdisciplinary education and research

    OpenAIRE

    Deutsch, J. M.

    2013-01-01

    Biophysics is a subject that is spread over many disciplines and transcends the skills and knowledge of the individual student. This makes it challenging both to teach and to learn. Educational materials are described to aid in teaching undergraduates biophysics in an interdisciplinary manner. Projects have been devised on topics that range from x-ray diffraction to the Hodgkin Huxley equations. They are team-based and encourage collaboration. The projects make extensive use of software writt...

  1. Interdisciplinary Practices in iSchools

    OpenAIRE

    Madsen, Dorte; Ho, Shuyuan Mary

    2014-01-01

    Interdisciplinarity is in the DNA of the iSchools. This workshop invites you to discuss how inter-disciplinarity plays out in theory and practice. The workshop addresses the uniqueness of the iSchools, provides an interactive framework to discuss and reflect on interdisciplinary practice. It suggests some models and tools to describe relations between disciplines, while offering a venue to brainstorm and envision issues of interest with like-minded colleagues. The purpose of this workshop is ...

  2. Interdisciplinary glossary — particle accelerators and medicine

    Science.gov (United States)

    Dmitrieva, V. V.; Dyubkov, V. S.; Nikitaev, V. G.; Ulin, S. E.

    2016-02-01

    A general concept of a new interdisciplinary glossary, which includes particle accelerator terminology used in medicine, as well as relevant medical concepts, is presented. Its structure and usage rules are described. An example, illustrating the quickly searching technique of relevant information in this Glossary, is considered. A website address, where one can get an access to the Glossary, is specified. Glossary can be refined and supplemented.

  3. Interdisciplinary Collaboration in Hospice Team Meetings

    OpenAIRE

    Wittenberg-Lyles, Elaine; Oliver, Debra Parker; Demiris, George; Regehr, Kelly

    2010-01-01

    Hospice and palliative care teams provide interdisciplinary care to seriously-ill and terminally-ill patients and their families. Care teams are comprised of medical and non-medical disciplines and include volunteers and lay workers in healthcare. The authors explored the perception of collaboration among hospice team members and actual collaborative communication practices in team meetings. The data set consisted of videotaped team meetings, some of which included caregiver participation, an...

  4. Gender and family firms: an interdisciplinary approach

    OpenAIRE

    Paloma Fernandez Perez; Eleanor Hamilton

    2007-01-01

    This study contributes to developing our understanding of gender and family business, a topic so crucial to recent policies about competitive growth. It does so by providing an interdisciplinary synthesis of some major theoretical debates. It also contributes to this understanding by illuminating the role of women and their participation in the practices of the family and the business. Finally, it explores gender relations and the notion that leadership in family business may take complex for...

  5. Spirituality and business: An interdisciplinary overview

    OpenAIRE

    Zsolnai, László; Bouckaert, Luk

    2012-01-01

    The paper gives an interdisciplinary overview of the emerging field of spirituality and business. It uses insights from business ethics, theology, neuroscience, psychology, gender studies, and philosophy to economics, management, organizational science, and banking and refers to different religious convictions including Christianity, Judaism, Islam, Hinduism, Buddhism, Confucianism, the Baha'i faith, and the North-American aboriginal worldview. The authors argue that the materialistic managem...

  6. The Interdisciplinary Essence of Political Knowledge

    OpenAIRE

    H. Salimi

    2014-01-01

    In the article, it has been tried to answer a fundamental question on the political science; whether the science has been constituted through a combination of difference and diversity of sciences or that is a unique, totally independent discipline. The author endeavors to manifest that the nature of political science is interdisciplinary. The study of the history of political knowledge reveals that this kind of knowledge can be understandable just by comprehending the impact of other discipl...

  7. Teaching design engineering in an interdisciplinary programme

    OpenAIRE

    Wits, Wessel; Homminga, Jasper; Endedijk, Maaike; Visscher, Klaasjan; Krab-Hüsken, Leonie; Berg, van den, S.J.P.L.; Wilhelm, Pascal

    2014-01-01

    ATLAS, the Academy of Technology and Liberal Arts & Sciences, is an interdisciplinary three-year Bachelor of Science honours programme for talented students that opened its doors in September 2013. This international programme uses the concept of project-led education to teach students to integrate both technical and social perspectives into a new engineering approach. It aims to educate the so-called ‘new engineer’: a generalist who can combine technological and societal approaches with desi...

  8. Interdisciplinary perspectives on abstracts for information retrieval

    OpenAIRE

    Soon Keng Chan; Schubert Foo

    2004-01-01

    The paper examines the abstract genre from the perspectives of English for Specific Purposes (ESP) practitioners and information professionals. It aims to determine specific interdisciplinary interests in the abstract, and to explore areas of collaboration in terms of research and pedagogical practices. A focus group (FG) comprising information professionals from the Division of Information Studies, Nanyang Technological University, Singapore, convened for a discussion on the subject of abstr...

  9. The interdisciplinary approach in community interpreting research

    OpenAIRE

    Vargas Urpi, Mireia

    2011-01-01

    Community interpreting is a complex activity that has been studied from many different angles. Based on a review of the literature, this paper aims to highlight the importance of an interdisciplinary approach in community interpreting research, as well as the close relationship between the theoretical and methodological frameworks that have been used to date. As a prospective study and by describing theories applied from five different fields (i.e. anthropology, sociology, applied linguistics...

  10. Interdisciplinary Interpretation of the Bible Text

    OpenAIRE

    Ying Han

    2015-01-01

    Literature and critical and creative thinking complement each other. The Bible’s classics status has been demonstrated and approved by many Western and domestic scholars, accordingly literary criticism of the Bible examined extensively and from different angles. This paper makes an interdisciplinary interpretation of the Bible text from the perspective of literature, history, philosophy and so on. It suggests offering course of literary criticism of the Bible and cultivating critical and crea...

  11. Bangalore looks to new interdisciplinary science centre

    Science.gov (United States)

    Ramachandran, Ramaseshan

    2008-09-01

    A new centre to boost interdisciplinary research in India is being established in Bangalore - India's IT and software capital. The International Centre for Theoretical Sciences (ICTS) will be led by Spenta Wadia, a theoretical physicist from the Tata Institute of Fundamental Research (TIFR) in Mumbai, which is setting up the new centre. He expects construction of the ICTS, the first of its kind in India, to start by November 2009.

  12. Poverty and Vulnerability - An Interdisciplinary Approach

    OpenAIRE

    Makoka, Donald; Kaplan, Marcus

    2005-01-01

    This paper describes the concepts of poverty and vulnerability as well as the interconnections and differences between them using an interdisciplinary approach. While poverty is a static concept, vulnerability has a forward-looking dimension. We, therefore, review the methodologies that different disciplines use to measure poverty and vulnerability. In particular, the differences between vulnerability to natural disasters, vulnerability to climate change, as well as vulnerability to poverty a...

  13. Interdisciplinary preoperative patient education in cardiac surgery.

    OpenAIRE

    De Weert, J.; van Dulmen, S.; Bar, P.; Venus, E.

    2003-01-01

    Patient education in cardiac surgery is complicated by the fact that cardiac surgery patients meet a lot of different health care providers. Little is known about education processes in terms of interdisciplinary tuning. In this study, complete series of consecutive preoperative consultations of 51 cardiac surgery patients with different health care providers (physicians, nurses and health educators) were videotaped. The information exchange between patients and providers was analyzed directl...

  14. Goals and design of public physics lectures: perspectives of high-school students, physics teachers and lecturers

    Science.gov (United States)

    Kapon, S.; Ganiel, U.; Eylon, B.

    2009-09-01

    Many large scientific projects and scientific centres incorporate some kind of outreach programme. Almost all of these outreach programmes include public scientific lectures delivered by practising scientists. In this article, we examine such lectures from the perspectives of: (i) lecturers (7) who are practising scientists acknowledged to be good public lecturers and (ii) audiences composed of high-school students (169) and high-school physics teachers (80) who attended these lectures. We identify and discuss the main goals as expressed by the lecturers and the audiences, and the correspondence between these goals. We also discuss how the lecturers' goals impact on the design of their lectures and examine how the lecture affects audiences with different attitudes towards (and interests in) physics. Our findings suggest that the goals of the participating lecturers and the expectations of their audiences were highly congruent. Both believe that a good public scientific lecture must successfully communicate state-of-the-art scientific knowledge to the public, while inspiring interest in and appreciation of science. Our findings also suggest that exemplary public scientific lectures incorporate content, structure and explanatory means that explicitly adhere to the lecturers' goals. We identify and list several design principles.

  15. Pluralistic dialoguing: A theory of interdisciplinary teamworking

    Directory of Open Access Journals (Sweden)

    Antoinette McCallin, Ph.D., M.A. (hons, B.A., RGON

    2004-11-01

    Full Text Available The aim of this emerging grounded theory study was to discover the main concerns of health professionals working in interdisciplinary teams, and to explain the processes team members used to continually resolve practice problems. Data collected from forty-four participants from seven disciplines in two teaching hospitals in New Zealand, included eighty hours each of interviewing and participant observation. In this paper the theory of pluralistic dialoguing is presented. It is argued that interdisciplinary work is possible whenthe team replaces the discipline focus with a client-focused care and thinks differently about service delivery. Thinking cooperatively requires individual team members to dialogue with colleagues, thereby deconstructing traditional ways of thinking and reconstructing new approaches to interdisciplinary practice. Although dialoguing was an informal process occurring within clinical spaces, as the effects of health reform and restructuring intensify teams also need to establish formal dialogue groups to facilitate team practice development and support team learning in the continually changing fast-paced practice context.

  16. Teaching Scales in the Climate System: An example of interdisciplinary teaching and learning

    Science.gov (United States)

    Baehr, Johanna; Behrens, Jörn; Brüggemann, Michael; Frisius, Thomas; Glessmer, Mirjam S.; Hartmann, Jens; Hense, Inga; Kaleschke, Lars; Kutzbach, Lars; Rödder, Simone; Scheffran, Jürgen

    2016-04-01

    Climate change is commonly regarded as one of 21st century's grand challenges that needs to be addressed by conducting integrated research combining natural and social sciences. To meet this need, how to best train future climate researchers should be reconsidered. Here, we present our experience from a team-taught semester-long course with students of the international master program "Integrated Climate System Sciences" (ICSS) at the University of Hamburg, Germany. Ten lecturers with different backgrounds in physical, mathematical, biogeochemical and social sciences accompanied by a researcher trained in didactics prepared and regularly participated in a course which consisted of weekly classes. The foundation of the course was the use of the concept of 'scales' - climate varying on different temporal and spatial scales - by developing a joint definition of 'scales in the climate system' that is applicable in the natural sciences and in the social sciences. By applying this interdisciplinary definition of 'scales' to phenomena from all components of the climate system and the socio-economic dimensions, we aimed for an integrated description of the climate system. Following the concept of research-driven teaching and learning and using a variety of teaching techniques, the students designed their own scale diagram to illustrate climate-related phenomena in different disciplines. The highlight of the course was the presentation of individually developed scale diagrams by every student with all lecturers present. Based on the already conducted course, we currently re-design the course concept to be teachable by a similarly large group of lecturers but with alternating presence in class. With further refinement and also a currently ongoing documentation of the teaching material, we will continue to use the concept of 'scales' as a vehicle for teaching an integrated view of the climate system.

  17. Lecturer and student perceptions on CLIL at a spanish university

    OpenAIRE

    Aguilar Pérez, Marta; Rodríguez Montañés, Rosa

    2011-01-01

    This study reports on a pilot implementation of Content and Language Integrated Learning (CLIL) at a Spanish university. In order to find out how both lecturers and students perceived their experience, several interviews and meetings took place with lecturers, and an open-ended questionnaire was passed to students. The meetings and interviews with lecturers yielded important information about their satisfaction. It was found out that lecturers were mostly interested in pract...

  18. Lecturing Style Teaching and Student Performance

    Science.gov (United States)

    Van Klaveren, Chris

    2011-01-01

    Teachers in the Netherlands tend to spend less time in front of the class, and often adopt a more personal approach. This allows them to better adjust their lecturing style to the needs of the individual student with the aim of increasing student performance. However, a more personal approach is also more time consuming and potentially reduces the…

  19. Creativity and the Curriculum. Inaugural Professorial Lecture

    Science.gov (United States)

    Wyse, Dominic

    2014-01-01

    Creativity is regarded by many as a vital aspect of the human world, and creative endeavours are seen as a central element of society. Hence student creativity is regarded as a desirable outcome of education. This inaugural professorial lecture examines the place of creativity in education and in national curricula. Beginning with examples of…

  20. Foundations of computer science : lecture notes

    OpenAIRE

    Escardó, Martín

    2005-01-01

    Lecture given at Foundations of Computer Science, 2nd term In this part of the module are studied data structures and algorithms. The firts module have been treated some data structures (e.g. arrays, lists, stacks, queues) and some algorithms (e.g. linear search and binary search).

  1. Introductory lectures on quantum field theory

    International Nuclear Information System (INIS)

    In these lectures we present a few topics in quantum field theory in detail. Some of them are conceptual and some more practical. They have been selected because they appear frequently in current applications to particle physics and string theory. (author)

  2. Knowledge, Power, and Freud's Clark Conference Lectures.

    Science.gov (United States)

    Cooper, Martha; Makay, John J.

    1988-01-01

    Examines Freud's Clark Conference Lectures in which he offers a case in point of the intersection among knowledge, power, and discourse. Argues that Freud's rhetorical action constituted the "new" knowledge of psychoanalysis, while simultaneously forging relationships between the scientific and medical communities that endowed the psychoanalyst…

  3. Lectures on extended affine Lie algebras

    CERN Document Server

    Neher, Erhard

    2010-01-01

    We give an introduction to the structure theory of extended affine Lie algebras, which provide a common framework for finite-dimensional semisimple, affine and toroidal Lie algebras. The notes are based on a lecture series given during the Fields Institute summer school at the University of Ottawa in June 2009.

  4. Five Lectures on Supersymmetry: Elementary Introduction

    CERN Document Server

    Ivanov, Evgeny

    2014-01-01

    These five lectures collect elementary facts about 4D supersymmetric theories with emphasis on N=1 supersymmetry, as well as the basic notions of supersymmetric quantum mechanics. Contents: I. From symmetries to supersymmetry; II. Basic features of supersymmetry; III. Representations of supersymmetry; IV. Superspace and superfields; V. Supersymmetric quantum mechanics.

  5. Lectures on general relativity and cosmology

    International Nuclear Information System (INIS)

    The lectures are entitled: theories of gravitation; vectors and tensors; tensor calculus; space-time curvature; space-time symmetries; energy momentum tensors; Einstein equations of gravitation; Schwarzschild solution; experimental tests of general relativity; strong gravitational fields (relativistic astrophysics, black holes); cosmology; Friedmann models; steady state theory; observational tests in cosmology; Mach's principle; glimpses of advanced topics. (U.K.)

  6. Lectures on particle physics and cosmology

    International Nuclear Information System (INIS)

    This paper compiles the lectures given in the 1985 ICTP High Energy Physics and Cosmology Workshop. The three topics discussed are: I) Generation of a Cosmological Baryon Asymmetry, II) Extra Dimensions and Cosmology, and III) The Sage of Cygnus X-3

  7. Academic Training: Summer Student Lecture Programme

    CERN Multimedia

    2004-01-01

    Main Auditorium, bldg. 500 DATE TIME LECTURER TITLE Monday 19 July 09:15 - 10:00 A. PICH (IFIC) The Standard Model (1/8) 10:15 - 11:00 O. ULLALAND (CERN) Detectors (2/5) 11:15 - 12:00 O. ULLALAND (CERN) Detectors (3/5) DATE TIME LECTURER TITLE Tuesday 20 July 09:15 - 10:00 A. PICH (IFIC) The Standard Model (2/8) 10:15 - 11:00 O. ULLALAND (CERN) Detectors (4/5) 11:15 - 12:00 O. ULLALAND (CERN) A. PICH (IFIC) Discussion Session DATE TIME LECTURER TITLE Wednesday 21 July 09:15 - 10:00 A. PICH (IFIC) The Standard Model (3/8) 10:15 - 11:00 A. PICH (IFIC) The Standard Model (4/8) 11:15 - 12:00 O. ULLALAND (CERN) Detectors (5/5) 14:00 - 15:00 R. BRUN (CERN) ROOT: Introduction and Demonstration DATE TIME LECTURER TITLE Thursday 22 July 09:15 - 10:00 A. PICH (IFIC) The Standard Model (5/8) 10:15 - 11:00 C. De La Taille (Laboratoire de l'Accélérateur Linéaire) Introduction to Electronics (1/3) 11:15 - 12:00 A. PICH (IFIC) C. De La Taille (Laboratoi...

  8. Academic Training: Summer Student Lecture Programme

    CERN Multimedia

    2004-01-01

    Main Auditorium, bldg. 500 DATE TIME LECTURER TITLE Monday 26 July 09:15 - 10:00 A. Pich (IFIC) The Standard Model (7/8) 10:15 - 11:00 R. Rattazzi (CERN) Beyond the Standard Model (1/3) 11:15 - 12:00 K. Jacobs (Universität Freiburg) Physics in Hadronic Colliders (1/4) DATE TIME LECTURER TITLE Tuesday 27 July 09:15 - 10:00 A. Pich (IFIC) The Standard Model (8/8) 10:15 - 11:00 R. Rattazzi (CERN) Beyond the Standard Model (2/3) 11:15 - 12:00 R. Rattazzi (CERN) A. Pich (IFIC) Discussion Session DATE TIME LECTURER TITLE Wednesday 28 July 09:15 - 10:00 K. Jacobs (Universität Freiburg) Physics in Hadronic Colliders (2/4) 10:15 - 11:00 K. Jacobs (Universität Freiburg) Physics in Hadronic Colliders (3/4) 11:15 - 12:00 R. Rattazzi (CERN) Beyond the Standard Model (3/3) 14:00 - 15:00 R. Assmann (CERN) The CLIC project DATE TIME LECTURER TITLE Thursday 29 July 09:15 - 10:00 K. Jacobs (Universität Freiburg) Physics in Hadronic ...

  9. Movement and Character. Lecture, London, 1946

    Science.gov (United States)

    Montesorri, Maria

    2013-01-01

    Dr. Montessori's words from the 1946 London Lectures describe principles of intelligence and character, the work of the hand, and movement with a purpose as being integral to self-construction. The perfection of movement is spiritual, says Dr. Montessori. Repetition of practical life exercises are exercises in movement with the dignity of human…

  10. Lectures on the foundations of QCD

    OpenAIRE

    Smilga, A. V.

    1999-01-01

    The paper is withdrawn by the author. This was an embryon of the book which has now been published with World Scientific under the title "Lectures on Quantum Chromodynamics". See http://www.wspc.com.sg/books/physics/4443.html, where the beginning of the book will soon be available in the pdf format.

  11. Music during Lectures: Will Students Learn Better?

    Science.gov (United States)

    Dosseville, Fabrice; Laborde, Sylvain; Scelles, Nicolas

    2012-01-01

    We investigated the influence of music during learning on the academic performance of undergraduate students, and more particularly the influence of affects induced by music. Altogether 249 students were involved in the study, divided into a control group and an experimental group. Both groups attended the same videotaped lecture, with the…

  12. Lecturing style teaching and student performance

    NARCIS (Netherlands)

    C. van Klaveren

    2011-01-01

    Teachers in the Netherlands tend to spend less time in front of the class, and often adopt a more personal approach. This allows them to better adjust their lecturing style to the needs of the individual student with the aim of increasing student performance. However, a more personal approach is als

  13. CAS paleoichthyologist gives Artedi Lecture in Sweden

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    @@ Prof. ZHANG Miman (CHANG Mee-mann), a CAS Member from the CAS Institute of Vertebrate Paleontology and Paleoanthropology, was invited to give a talk at the Artedi Lectures at the Royal Swedish Academy of Sciences in Stockholm, Sweden, on 5 December, 2008.

  14. Introductory lecture on triple-axis spectrometer

    International Nuclear Information System (INIS)

    Triple-axis spectrometer is a multi-purpose instrument for powder neutron diffraction, single crystal neutron diffraction, powder inelastic neutron scattering, single crystal inelastic neutron scattering, and neutron polarization analysis. In this lecture how to use the triple-axis spectrometer is explained for the beginners. (author)

  15. Lecture on Female Masturbation Harassed Him, Male Student Says.

    Science.gov (United States)

    Wilson, Robin

    1995-01-01

    A male student in a California State University-Sacramento psychology lecture on female masturbation has filed a sexual harassment complaint, claiming the lecture violated institutional policy by creating an intimidating, hostile, and offensive learning environment. He felt the lecture was inappropriately graphic and political in intent. (MSE)

  16. Student Use of Mobile Devices in University Lectures

    Science.gov (United States)

    Roberts, Neil; Rees, Michael

    2014-01-01

    Mobile devices are increasingly used by students in university lectures. This has resulted in controversy and the banning of mobile devices in some lectures. Although there has been some research into how students use laptop computers in lectures, there has been little investigation into the wider use of mobile devices. This study was designed to…

  17. Taxonomy of Lecture Note-Taking Skills and Subskills

    Science.gov (United States)

    Al-Musalli, Alaa M.

    2015-01-01

    Note taking (NT) in lectures is as active a skill as listening, which stimulates it, and as challenging as writing, which is the end product. Literature on lecture NT misses an integration of the processes involved in listening with those in NT. In this article, a taxonomy is proposed of lecture NT skills and subskills based on a similar list…

  18. Lecturers' Experience of Using Social Media in Higher Education Courses

    Science.gov (United States)

    Seechaliao, Thapanee

    2015-01-01

    This research paper presents lecturers' experience of using social media in higher education courses. The research methodology used a survey approach. The research instrument was a questionnaire about lecturers' experience of using social media in higher education courses. Thirty-one lecturers completed the questionnaire. The data were scored by…

  19. 45 CFR 73.735-706 - Teaching, lecturing, and speechmaking.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 1 2010-10-01 2010-10-01 false Teaching, lecturing, and speechmaking. 73.735-706... OF CONDUCT Outside Activities § 73.735-706 Teaching, lecturing, and speechmaking. (a) Employees are encouraged to engage in teaching and lecturing activities which are not part of their official duties...

  20. Engagement of Students with Lectures in Biochemistry and Pharmacology

    Science.gov (United States)

    Davis, Elizabeth Ann; Hodgson, Yvonne; Macaulay, Janet Olwyn

    2012-01-01

    Academic staff at universities have become concerned about the decrease in student attendance at lectures and the implication of this on student achievement and learning. Few studies have measured actual lecture attendance in a coherent or comprehensive way. The aim of this study was to measure actual lecture attendance of students over two year…