WorldWideScience

Sample records for chi b2-9915 mesons

  1. Probing scalar meson structures in $\\chi_{c1}$ decays into pseudoscalar and scalar

    CERN Document Server

    Wang, Qian; Zhao, Qiang

    2012-01-01

    We evaluate the decay branching ratios of $\\chi_{c1}\\to PS$, in a quark model parametrization scheme, where $P$ and $S$ stand for pseudoscalar and scalar meson, respectively. An interesting feature of this decay process is that the $c\\bar{c}$ annihilate via the pQCD hair-pin diagram is supposed to be dominant. Hence, this decay process should be sensitive to the quark components of the final-state light mesons, and would provide a great opportunity for testing the mixing relations among the scalar mesons, i.e. $f_0(1370)$, $f_0(1500)$ and $f_0(1710)$, by tagging the final state pseudoscalar mesons.

  2. Central Exclusive Production of $\\chi$ Mesons at LHCb

    CERN Document Server

    Bjornstad, Pal Marius

    The LHCb experiment is a forward spectrometer at the Large Hadron Collider, covering a range of pseudorapidity $1.9<\\eta<4.9$. It has a very precise vertex detector called the VELO, near the interaction point. The monitoring software for the VELO is discussed in this thesis. In proton-proton interactions, Central Exclusive Production (CEP) is a process where the protons remain intact after the interaction, and an additional simple central system is produced. CEP processes are selected experimentally by requiring that there is no activity in the detector apart from the central system. The installation of additional detectors to increase the sensitivity at small angles from the beam axis is discussed. A geometrical description of the region of the LHC up to $100$~m on each side of the LHCb interaction point is developed. Simulated forward shower counters are added to the model, and the efficiencies of the detectors are measured. The main part of this thesis describes an analysis of CEP of $\\chi_c$ mes...

  3. Production of chi mesons in 225 GeV/c π-Be interactions

    International Nuclear Information System (INIS)

    Gamma rays associated with psi mesons have been studied in 225 GeV/c π-Be interactions. The psi-γ mass spectrum shows an excess of 47 +- 11 events above background centered at 3.531 GeV/c2 with an rms width of 22.4 MeV. Attributing this excess of events to the decay chi → psi γ implies that 38 +- 9 % of all psi mesons are produced by this mechanism. The experimental setup and results are detailed

  4. Nonperturbative and spin effects in the central exclusive production of tensor \\chi_c(2^+) meson

    CERN Document Server

    Pasechnik, R S; Teryaev, O V

    2009-01-01

    We discuss central exclusive production (CEP) of the tensor $\\chi_c(2^{+})$ meson in proton-(anti)proton collisions at Tevatron, RHIC and LHC energies. The amplitude for the process is derived within the $k_t$-factorisation approach. Differential and total cross sections are calculated for several unintegrated gluon distributions (UGDFs). We compare exclusive production of all charmonium states $\\chi_c(0^+), \\chi_c(1^+)$ and $\\chi_c(2^+)$. Good description of the recent Tevatron data is achieved both with Martin-Ryskin phenomenological UGDF and UGDF based on unified BFKL-DGLAP approach. Unlike for Higgs production, the main contribution to the diffractive amplitude of heavy quarkonia comes from nonperturbative region of gluon transverse momenta $Q_{\\perp}<1 \\GeV$. At $y \\approx$ 0, we predict the contribution of $\\chi_c(1^+,2^+)$ to the $J/\\Psi + \\gamma$ channel to be larger than that of the $\\chi_c(0^+)$ one. This is partially due to a significant contribution from lower polarization states $\\lambda=0$ fo...

  5. Observation of chi(c1) Decays into Vector Meson Pairs phi phi, omega omega, and omega phi

    NARCIS (Netherlands)

    Ablikim, M.; Achasov, M. N.; An, L.; An, Q.; An, Z. H.; Bai, J. Z.; Baldini, R.; Ban, Y.; Becker, J.; Berger, N.; Bertani, M.; Bian, J. M.; Bondarenko, O.; Boyko, I.; Briere, R. A.; Bytev, V.; Cai, X.; Cao, G. F.; Cao, X. X.; Chang, J. F.; Chelkov, G.; Chen, G.; Chen, H. S.; Chen, J. C.; Chen, M. L.; Chen, S. J.; Chen, Y.; Chen, Y. B.; Cheng, H. P.; Chu, Y. P.; Cronin-Hennessy, D.; Dai, H. L.; Dai, J. P.; Dedovich, D.; Deng, Z. Y.; Denysenko, I.; Destefanis, M.; Ding, Y.; Dong, L. Y.; Dong, M. Y.; Du, S. X.; Duan, M. Y.; Fan, R. R.; Fang, J.; Fang, S. S.; Feng, C. Q.; Fu, C. D.; Fu, J. L.; Gao, Y.; Geng, C.; Goetzen, K.; Gong, W. X.; Greco, M.; Grishin, S.; Gu, M. H.; Gu, Y. T.; Guan, Y. H.; Guo, A. Q.; Guo, L. B.; Guo, Y. P.; Hao, X. Q.; Harris, F. A.; He, K. L.; He, M.; He, Z. Y.; Heng, Y. K.; Hou, Z. L.; Hu, H. M.; Hu, J. F.; Hu, T.; Huang, B.; Huang, G. M.; Huang, J. S.; Huang, X. T.; Huang, Y. P.; Hussain, T.; Ji, C. S.; Ji, Q.; Ji, X. B.; Ji, X. L.; Jia, L. K.; Jiang, L. L.; Jiang, X. S.; Jiao, J. B.; Jiao, Z.; Jin, D. P.; Jin, S.; Jing, F. F.; Kavatsyuk, M.; Komamiya, S.; Kuehn, W.; Lange, J. S.; Leung, J. K. C.; Li, Cheng; Li, Cui; Li, D. M.; Li, F.; Li, G.; Li, H. B.; Li, J. C.; Li, Lei; Li, N. B.; Li, Q. J.; Li, W. D.; Li, W. G.; Li, X. L.; Li, X. N.; Li, X. Q.; Li, X. R.; Li, Z. B.; Liang, H.; Liang, Y. F.; Liang, Y. T.; Liao, G. R.; Liao, X. T.; Liu, B. J.; Liu, B. J.; Liu, C. L.; Liu, C. X.; Liu, C. Y.; Liu, F. H.; Liu, Fang; Liu, Feng; Liu, G. C.; Liu, H.; Liu, H. B.; Liu, H. M.; Liu, H. W.; Liu, J. P.; Liu, K.; Liu, K. Y.; Liu, Q.; Liu, S. B.; Liu, X.; Liu, X. H.; Liu, Y. B.; Liu, Y. W.; Liu, Yong; Liu, Z. A.; Liu, Z. Q.; Loehner, H.; Lu, G. R.; Lu, H. J.; Lu, J. G.; Lu, Q. W.; Lu, X. R.; Lu, Y. P.; Luo, C. L.; Luo, M. X.; Luo, T.; Luo, X. L.; Ma, C. L.; Ma, F. C.; Ma, H. L.; Ma, Q. M.; Ma, T.; Ma, X.; Ma, X. Y.; Maggiora, M.; Malik, Q. A.; Mao, H.; Mao, Y. J.; Mao, Z. P.; Messchendorp, J. G.; Min, J.; Mitchell, R. E.; Mo, X. H.; Muchnoi, N. Yu.; Nefedov, Y.; Ning, Z.; Olsen, S. L.; Ouyang, Q.; Pacetti, S.; Pelizaeus, M.; Peters, K.; Ping, J. L.; Ping, R. G.; Poling, R.; Pun, C. S. J.; Qi, M.; Qian, S.; Qiao, C. F.; Qin, X. S.; Qiu, J. F.; Rashid, K. H.; Rong, G.; Ruan, X. D.; Sarantsev, A.; Schulze, J.; Shao, M.; Shen, C. P.; Shen, X. Y.; Sheng, H. Y.; Shepherd, M. R.; Song, X. Y.; Sonoda, S.; Spataro, S.; Spruck, B.; Sun, D. H.; Sun, G. X.; Sun, J. F.; Sun, S. S.; Sun, X. D.; Sun, Y. J.; Sun, Y. Z.; Sun, Z. J.; Sun, Z. T.; Tang, C. J.; Tang, X.; Tang, X. F.; Tian, H. L.; Toth, D.; Varner, G. S.; Wan, X.; Wang, B. Q.; Wang, K.; Wang, L. L.; Wang, L. S.; Wang, M.; Wang, P.; Wang, P. L.; Wang, Q.; Wang, S. G.; Wang, X. L.; Wang, Y. D.; Wang, Y. F.; Wang, Y. Q.; Wang, Z.; Wang, Z. G.; Wang, Z. Y.; Wei, D. H.; Wen, Q. G.; Wen, S. P.; Wiedner, U.; Wu, L. H.; Wu, N.; Wu, W.; Wu, Z.; Xiao, Z. J.; Xie, Y. G.; Xu, G. F.; Xu, G. M.; Xu, H.; Xu, Y.; Xu, Z. R.; Xu, Z. Z.; Xue, Z.; Yan, L.; Yan, W. B.; Yan, Y. H.; Yang, H. X.; Yang, M.; Yang, T.; Yang, Y.; Yang, Y. X.; Ye, M.; Ye, M. H.; Yu, B. X.; Yu, C. X.; Yu, L.; Yuan, C. Z.; Yuan, W. L.; Yuan, Y.; Zafar, A. A.; Zallo, A.; Zeng, Y.; Zhang, B. X.; Zhang, B. Y.; Zhang, C. C.; Zhang, D. H.; Zhang, H. H.; Zhang, H. Y.; Zhang, J.; Zhang, J. W.; Zhang, J. Y.; Zhang, J. Z.; Zhang, L.; Zhang, S. H.; Zhang, T. R.; Zhang, X. J.; Zhang, X. Y.; Zhang, Y.; Zhang, Y. H.; Zhang, Z. P.; Zhang, Z. Y.; Zhao, G.; Zhao, H. S.; Zhao, Jiawei; Zhao, Jingwei; Zhao, Lei; Zhao, Ling; Zhao, M. G.; Zhao, Q.; Zhao, S. J.; Zhao, T. C.; Zhao, X. H.; Zhao, Y. B.; Zhao, Z. G.; Zhao, Z. L.; Zhemchugov, A.; Zheng, B.; Zheng, J. P.; Zheng, Y. H.; Zheng, Z. P.; Zhong, B.; Zhong, J.; Zhong, L.; Zhou, L.; Zhou, X. K.; Zhou, X. R.; Zhu, C.; Zhu, K.; Zhu, K. J.; Zhu, S. H.; Zhu, X. L.; Zhu, X. W.; Zhu, Y. S.; Zhu, Z. A.; Zhuang, J.; Zou, B. S.; Zou, J. H.; Zuo, J. X.; Zweber, P.

    2011-01-01

    Using (106 +/- 4) x 10(6) psi(3686) events accumulated with the BESIII detector at the BEPCII e(+) e(-) collider, we present the first measurement of decays of chi(c1) to vector meson pairs phi phi, omega omega, and omega phi. The branching fractions are measured to be (4.4 +/- 0.3 +/- 0.5) x 10(-4)

  6. Exclusive Baryon-Antibaryon Decays of the chi_cJ Mesons

    CERN Document Server

    Naik, P; Asner, D M; Edwards, K W; Reed, J; Briere, R A; Ferguson, T; Tatishvili, G; Vogel, H; Watkins, M E; Rosner, J L; Alexander, J P; Cassel, D G; Duboscq, J E; Ehrlich, R; Fields, L; Gibbons, L; Gray, R; Gray, S W; Hartill, D L; Heltsley, B K; Hertz, D; Hunt, J M; Kandaswamy, J; Kreinick, D L; Kuznetsov, V E; Ledoux, J; Mahlke-Krüger, H; Mohapatra, D; Onyisi, P U E; Patterson, J R; Peterson, D; Riley, D; Ryd, A; Sadoff, A J; Shi, X; Stroiney, S; Sun, W M; Wilksen, T; Athar, S B; Patel, R; Yelton, J; Rubin, P; Eisenstein, B I; Karliner, I; Mehrabyan, S; Lowrey, N; Selen, M; White, E J; Wiss, J; Mitchell, R E; Shepherd, M R; Besson, D; Pedlar, T K; Cronin-Hennessy, D; Gao, K Y; Hietala, J; Kubota, Y; Klein, T; Lang, B W; Poling, R; Scott, A W; Zweber, P; Dobbs, S; Metreveli, Z; Seth, K K; Tomaradze, A G; Libby, J; Powell, A; Wilkinson, G; Ecklund, K M; Love, W; Savinov, V; Méndez, H; Ge, J Y; Miller, D H; Shipsey, I P J; Xin, B; Adams, G S; Anderson, M; Cummings, J P; Danko, I; Hu, D; Moziak, B; Napolitano, J; He, Q; Insler, J; Muramatsu, H; Park, C S; Thorndike, E H; Yang, F; Artuso, M; Blusk, S; Khalil, S; Li, J; Mountain, R; Nisar, S; Randrianarivony, K; Sultana, N; Skwarnicki, T; Stone, S; Wang, J C; Zhang, L M; Bonvicini, G; Cinabro, D; Dubrovin, M; Lincoln, A

    2008-01-01

    Using a sample of 2.59 \\times 10^7 psi(2S) decays collected by the CLEO--c detector, we present results of a study of chi_{cJ} (J=0,1,2) decays into baryon-antibaryon final states. We present the world's most precise measurements of the chi_cJ -> p-pbar and chi_cJ -> Lambda-Lambdabar branching fractions, and the first measurements of chi_c0 decays to other hyperons. These results illuminate the decay mechanism of the chi_c states.

  7. Prompt charmonia production and polarization at LHC in the NRQCD with kt-factorization. Part II: $\\chi_c$ mesons

    CERN Document Server

    Baranov, S P; Zotov, N P

    2015-01-01

    In the framework of kt-factorization approach,the production of prompt $\\chi_c$ mesons in pp collisions at the LHC energies is studied. Our consideration is based on the off-shell amplitudes for hard partonic subprocesses $g^*g^*\\to\\chi_{cJ}$ and non-relativistic QCD formalism for bound states. The transverse momentum dependent (unintegrated) gluon densities in a proton were derived from Ciafaloni-Catani-Fiorani-Marchesini evolution equation or, alternatively, were chosen in accordance with Kimber-Martin-Ryskin prescription. Taking into account both color singlet and color octet contributions, we deduce the corresponding non-perturbative long-distance matrix elements from the fits to the latest ATLAS data on $\\chi_{c1}$ and $\\chi_{c2}$ transverse momentum distributions at $\\sqrt s = 7$ TeV. We find that these distributions at small and moderate pt are formed mainly by the color singlet components. We successfully described the data on the differential cross sections and relative production rates $\\sigma(\\chi_...

  8. Production of $\\Upsilon(1S)$ Mesons from $_{\\chi}_{b}$ Decays in $p\\overline{p}$ Collisions at $sqrt{s}$ = 1.8 TeV

    CERN Document Server

    Affolder, T; Akopian, A M; Albrow, Michael G; Amaral, P; Amendolia, S R; Amidei, D; Antos, J; Apollinari, G; Arisawa, T; Asakawa, T; Ashmanskas, W J; Atac, Muzaffer; Azfar, F; Azzi-Bacchetta, P; Bacchetta, N; Bailey, M W; Bailey, S; De Barbaro, P; Barbaro-Galtieri, A; Barnes, Virgil E; Barnett, B A; Barone, M; Bauer, G; Bedeschi, F; Belforte, S; Bellettini, Giorgio; Bellinger, J; Benjamin, D; Bensinger, J; Beretvas, A; Bergé, J P; Berryhill, J W; Bertolucci, Sergio; Bevensee, B; Bhatti, A A; Bigongiari, C; Binkley, M; Bisello, D; Blair, R E; Blocker, C A; Bloom, K; Blumenfeld, B; Blusk, B S; Bocci, A; Bodek, Arie; Bokhari, W; Bölla, G; Bonushkin, Yu; Bortoletto, Daniela; Boudreau, J; Brandl, A; van den Brink, S C; Bromberg, C; Bruner, N L; Buckley-Geer, E; Budagov, Yu A; Budd, H S; Burkett, K; Busetto, G; Byon-Wagner, A; Byrum, K L; Campbell, M; Caner, A; Carithers, W C; Carlson, J; Carlsmith, D; Cassada, J A; Castro, A; Cauz, D; Cerri, A; Chan, A W; Chang, P S; Chang, P T; Chapman, J; Chen, C; Chen, Y C; Cheng, M T; Chertok, M; Chiarelli, G; Chirikov-Zorin, I E; Chlachidze, G; Chlebana, F S; Christofek, L S; Chu, M L; Cihangir, S; Ciobanu, C I; Clark, A G; Cobal, M; Cocca, E; Connolly, A; Conway, J; Cooper, J; Cordelli, M; Costanzo, D; Cranshaw, J; Cronin-Hennessy, D; Cropp, R; Culbertson, R J; Dagenhart, D; De Jongh, F; Dell'Agnello, S; Dell'Orso, Mauro; Demina, R; Demortier, L; Deninno, M M; Derwent, P F; Devlin, T; Dittmann, J R; Donati, S; Done, J; Dorigo, T; Eddy, N; Einsweiler, Kevin F; Elias, J E; Engels, E; Erdmann, W; Errede, D; Errede, S; Fan, Q; Feild, R G; Ferretti, C; Fiori, I; Flaugher, B L; Foster, G W; Franklin, M; Freeman, J; Friedman, J; Fukui, Y; Gadomski, S; Galeotti, S; Gallinaro, M; Gao, T; García-Sciveres, M; Garfinkel, A F; Gatti, P; Gay, C; Geer, S; Gerdes, D W; Giannetti, P; Giromini, P; Glagolev, V; Gold, M; Goldstein, J; Gordon, A; Goshaw, A T; Gotra, Yu; Goulianos, K; Grassmann, H; Green, C; Groer, L S; Grosso-Pilcher, C; Günther, M; Guillian, G; Guimarães da Costa, J; Guo, R S; Haber, C; Hafen, E S; Hahn, S R; Hall, C; Handa, T; Handler, R; Hao, W; Happacher, F; Hara, K; Hardman, A D; Harris, R M; Hartmann, F; Hatakeyama, K; Hauser, J; Heinrich, J; Heiss, A; Hinrichsen, B; Hoffman, K D; Holck, C; Hollebeek, R J; Holloway, L E; Hughes, R; Huston, J; Huth, J E; Ikeda, H; Incagli, M; Incandela, J R; Introzzi, G; Iwai, J; Iwata, Y; James, E; Jensen, H; Jones, M; Joshi, U; Kambara, H; Kamon, T; Kaneko, T; Karr, K M; Kasha, H; Kato, Y; Keaffaber, T A; Kelley, K F; Kelly, M; Kennedy, R D; Kephart, R D; Khazins, D M; Kikuchi, T; Kirk, M; Kim, B J; Kim, H S; Kim, S H; Kim, Y K; Kirsch, L; Klimenko, S; Knoblauch, D; Koehn, P; Köngeter, A; Kondo, K; Konigsberg, J; Kordas, K; Korytov, A V; Kovács, E; Kroll, J; Kruse, M; Kuhlmann, S E; Kurino, K; Kuwabara, T; Laasanen, A T; Lai, N; Lami, S; Lammel, S; Lamoureux, J I; Lancaster, M; Latino, G; LeCompte, T J; Lee, A M; Leone, S; Lewis, J D; Lindgren, M; Liss, T M; Liu, J B; Liu, Y C; Lockyer, N; Loken, J G; Loreti, M; Lucchesi, D; Lukens, P; Lusin, S; Lyons, L; Lys, J; Madrak, R; Maeshima, K; Maksimovic, P; Malferrari, L; Mangano, Michelangelo L; Mariotti, M; Martignon, G; Martin, A; Matthews, J A J; Mazzanti, P; McFarland, K S; McIntyre, P; McKigney, E A; Menguzzato, M; Menzione, A; Meschi, E; Mesropian, C; Miao, C; Miao, T; Miller, R; Miller, J S; Minato, H; Miscetti, S; Mishina, M; Moggi, N; Moore, E; Moore, R; Morita, Y; Mukherjee, A; Müller, T; Munar, A; Murat, P; Murgia, S; Musy, M; Nachtman, J; Nahn, S; Nakada, H; Nakaya, T; Nakano, I; Nelson, C; Neuberger, D; Newman-Holmes, C; Ngan, C Y P; Nicolaidi, P; Niu, H; Nodulman, L; Nomerotski, A; Oh, S H; Ohmoto, T; Ohsugi, T; Oishi, R; Okusawa, T; Olsen, J; Pagliarone, C; Palmonari, F; Paoletti, R; Papadimitriou, V; Pappas, S P; Parri, A; Partos, D S; Patrick, J; Pauletta, G; Paulini, M; Perazzo, A; Pescara, L; Phillips, T J; Piacentino, G; Pitts, K T; Plunkett, R K; Pompos, A; Pondrom, L; Pope, G; Prokoshin, F; Proudfoot, J; Ptohos, F; Punzi, G; Ragan, K; Reher, D; Reichold, A; Riegler, W; Ribon, A; Rimondi, F; Ristori, L; Robertson, W J; Robinson, A; Rodrigo, T; Rolli, S; Rosenson, L; Roser, R M; Rossin, R; Sakumoto, W K; Saltzberg, D; Sansoni, A; Santi, L; Sato, H; Savard, P; Schlabach, P; Schmidt, E E; Schmidt, M P; Schmitt, M; Scodellaro, L; Scott, A; Scribano, A; Segler, S L; Seidel, S; Seiya, Y; Semenov, A A; Semeria, F; Shah, T; Shapiro, M D; Shepard, P F; Shibayama, T; Shimojima, M; Shochet, M J; Siegrist, J L; Signorelli, G; Sill, A F; Sinervo, P K; Singh, P; Slaughter, A J; Sliwa, K; Smith, C; Snider, F D; Solodsky, A; Spalding, J; Speer, T; Sphicas, Paris; Spinella, F; Spiropulu, M; Spiegel, L; Stanco, L; Steele, J; Stefanini, A; Strologas, J; Strumia, F; Stuart, D; Sumorok, K; Suzuki, T; Takashima, R; Takikawa, K; Tanaka, M; Takano, T; Tannenbaum, B; Taylor, W; Tecchio, M; Teng, P K; Terashi, K; Tether, S; Theriot, D; Thurman-Keup, R M; Tipton, P; Tkaczyk, S M; Tollefson, K; Tollestrup, Alvin V; Toyoda, H; Trischuk, W; De Trocóniz, J F; Truitt, S; Tseng, J; Turini, N; Ukegawa, F; Valls, J; Vejcik, S; Velev, G V; Vidal, R; Vilar, R; Volobuev, I P; Vucinic, D; Wagner, R G; Wagner, R L; Wahl, J; Wallace, N B; Walsh, A M; Wang, C; Wang, C H; Wang, M J; Watanabe, T; Waters, D; Watts, T; Webb, R; Wenzel, H; Wester, W C; Wicklund, A B; Wicklund, E; Williams, H H; Wilson, P; Winer, B L; Winn, D; Wolbers, S; Wolinski, D; Wolinski, J; Worm, S D; Wu, X; Wyss, J; Yagil, A; Yao, W; Yeh, G P; Yeh, P; Yoh, J K; Yosef, C; Yoshida, T; Yu, I; Yu, S; Zanetti, A; Zetti, F; Zucchelli, S

    2000-01-01

    We have reconstructed the radiative decays $\\chi_{b}(1P) \\to \\Upsilon(1S) at $\\sqrt{s} = 1.8$ TeV, and measured the fraction of $\\Upsilon(1S)$ mesons that originate from these decays. For $\\Upsilon(1S)$ mesons with $p^{\\Upsilon}_{T}>8.0$ GeV/$c$, the fractions that come from $\\chi_{b}(1P)$ and $(10.5\\pm4.4(stat)\\pm1.4(s ys))%$, respectively. We have derived the fraction of directly produced $\\Upsilon(1S)$ mesons to be $(50.9\\pm8.2(stat)\\pm9.0(sys)) %$.

  9. Isospin violating decays of positive parity $B_s$ mesons in HM$\\chi$PT

    CERN Document Server

    Brdnik, Anita Prapotnik

    2016-01-01

    Recent lattice QCD results suggest that the masses of the first two positive parity $B_s$ mesons lie below the BK threshold, similar to the case of $D^*_{s0}(2317)^+$ and $D_{s1}(2460)^+$ mesons. The mass spectrum of $B_s$ mesons seems to follow pattern of $D_s$ mass spectrum. As in the case of charmed mesons, the structure of positive parity $B_s$ mesons is very intriguing. To shed more light on this issue, we investigate strong isospin violating decays $B_s(0^+) \\to B_s^0 \\pi^0$, $B_s(1^+) \\to B_s^{*0} \\pi^0$ and $B_s(1^+) \\to B_s^0 \\pi \\pi$ within heavy meson chiral perturbation theory. The two body decay amplitude arises at the tree level and we show that the loop corrections give significant contributions. On the other hand, in the case of three body decay $B_s(1^+) \\to B_s^0 \\pi \\pi$ amplitude occurs only at the loop level. We find that the decay widths for these decays are: $\\Gamma (B_s(1^+) \\to B_s^0 \\pi \\pi)\\sim 10^{-3}\\,$keV and $\\Gamma (B_s(0^+) \\to B_s^0 \\pi^0) \\leq 55\\,$keV, $\\Gamma (B_s(1^+) \\to...

  10. chi_{c1} and chi_{c2} decay angular distributions at the Fermilab Tevatron

    CERN Document Server

    Kniehl, Bernd A; Palisoc, C P

    2003-01-01

    We consider the hadroproduction of chi_{c1} and chi_{c2} mesons and their subsequent radiative decays to J/psi mesons and photons in the factorization formalism of nonrelativistic quantum chromodynamics, and study the decay angular distributions, by means of helicity density matrices, in view of their sensitivity to color-octet processes. We present numerical results appropriate for the Fermilab Tevatron.

  11. Measurement of the $\\chi_b(3P)$ mass and of the relative rate of $\\chi_{b1}(1P)$ and $\\chi_{b2}(1P)$ production

    CERN Document Server

    Aaij, Roel; Adinolfi, Marco; Affolder, Anthony; Ajaltouni, Ziad; Akar, Simon; Albrecht, Johannes; Alessio, Federico; Alexander, Michael; Ali, Suvayu; Alkhazov, Georgy; Alvarez Cartelle, Paula; Alves Jr, Antonio Augusto; Amato, Sandra; Amerio, Silvia; Amhis, Yasmine; An, Liupan; Anderlini, Lucio; Anderson, Jonathan; Andreassen, Rolf; Andreotti, Mirco; Andrews, Jason; Appleby, Robert; Aquines Gutierrez, Osvaldo; Archilli, Flavio; Artamonov, Alexander; Artuso, Marina; Aslanides, Elie; Auriemma, Giulio; Baalouch, Marouen; Bachmann, Sebastian; Back, John; Badalov, Alexey; Baesso, Clarissa; Baldini, Wander; Barlow, Roger; Barschel, Colin; Barsuk, Sergey; Barter, William; Batozskaya, Varvara; Battista, Vincenzo; Bay, Aurelio; Beaucourt, Leo; Beddow, John; Bedeschi, Franco; Bediaga, Ignacio; Belogurov, Sergey; Belous, Konstantin; Belyaev, Ivan; Ben-Haim, Eli; Bencivenni, Giovanni; Benson, Sean; Benton, Jack; Berezhnoy, Alexander; Bernet, Roland; Bettler, Marc-Olivier; van Beuzekom, Martinus; Bien, Alexander; Bifani, Simone; Bird, Thomas; Bizzeti, Andrea; Bjørnstad, Pål Marius; Blake, Thomas; Blanc, Frédéric; Blouw, Johan; Blusk, Steven; Bocci, Valerio; Bondar, Alexander; Bondar, Nikolay; Bonivento, Walter; Borghi, Silvia; Borgia, Alessandra; Borsato, Martino; Bowcock, Themistocles; Bowen, Espen Eie; Bozzi, Concezio; Brambach, Tobias; van den Brand, Johannes; Bressieux, Joël; Brett, David; Britsch, Markward; Britton, Thomas; Brodzicka, Jolanta; Brook, Nicholas; Brown, Henry; Bursche, Albert; Busetto, Giovanni; Buytaert, Jan; Cadeddu, Sandro; Calabrese, Roberto; Calvi, Marta; Calvo Gomez, Miriam; Campana, Pierluigi; Campora Perez, Daniel; Carbone, Angelo; Carboni, Giovanni; Cardinale, Roberta; Cardini, Alessandro; Carson, Laurence; Carvalho Akiba, Kazuyoshi; Casse, Gianluigi; Cassina, Lorenzo; Castillo Garcia, Lucia; Cattaneo, Marco; Cauet, Christophe; Cenci, Riccardo; Charles, Matthew; Charpentier, Philippe; Chefdeville, Maximilien; Chen, Shanzhen; Cheung, Shu-Faye; Chiapolini, Nicola; Chrzaszcz, Marcin; Ciba, Krzystof; Cid Vidal, Xabier; Ciezarek, Gregory; Clarke, Peter; Clemencic, Marco; Cliff, Harry; Closier, Joel; Coco, Victor; Cogan, Julien; Cogneras, Eric; Cojocariu, Lucian; Collins, Paula; Comerma-Montells, Albert; Contu, Andrea; Cook, Andrew; Coombes, Matthew; Coquereau, Samuel; Corti, Gloria; Corvo, Marco; Counts, Ian; Couturier, Benjamin; Cowan, Greig; Craik, Daniel Charles; Cruz Torres, Melissa Maria; Cunliffe, Samuel; Currie, Robert; D'Ambrosio, Carmelo; Dalseno, Jeremy; David, Pascal; David, Pieter; Davis, Adam; De Bruyn, Kristof; De Capua, Stefano; De Cian, Michel; De Miranda, Jussara; De Paula, Leandro; De Silva, Weeraddana; De Simone, Patrizia; Decamp, Daniel; Deckenhoff, Mirko; Del Buono, Luigi; Déléage, Nicolas; Derkach, Denis; Deschamps, Olivier; Dettori, Francesco; Di Canto, Angelo; Dijkstra, Hans; Donleavy, Stephanie; Dordei, Francesca; Dorigo, Mirco; Dosil Suárez, Alvaro; Dossett, David; Dovbnya, Anatoliy; Dreimanis, Karlis; Dujany, Giulio; Dupertuis, Frederic; Durante, Paolo; Dzhelyadin, Rustem; Dziurda, Agnieszka; Dzyuba, Alexey; Easo, Sajan; Egede, Ulrik; Egorychev, Victor; Eidelman, Semen; Eisenhardt, Stephan; Eitschberger, Ulrich; Ekelhof, Robert; Eklund, Lars; El Rifai, Ibrahim; Elsasser, Christian; Ely, Scott; Esen, Sevda; Evans, Hannah Mary; Evans, Timothy; Falabella, Antonio; Färber, Christian; Farinelli, Chiara; Farley, Nathanael; Farry, Stephen; Fay, Robert; Ferguson, Dianne; Fernandez Albor, Victor; Ferreira Rodrigues, Fernando; Ferro-Luzzi, Massimiliano; Filippov, Sergey; Fiore, Marco; Fiorini, Massimiliano; Firlej, Miroslaw; Fitzpatrick, Conor; Fiutowski, Tomasz; Fontana, Marianna; Fontanelli, Flavio; Forty, Roger; Francisco, Oscar; Frank, Markus; Frei, Christoph; Frosini, Maddalena; Fu, Jinlin; Furfaro, Emiliano; Gallas Torreira, Abraham; Galli, Domenico; Gallorini, Stefano; Gambetta, Silvia; Gandelman, Miriam; Gandini, Paolo; Gao, Yuanning; García Pardiñas, Julián; Garofoli, Justin; Garra Tico, Jordi; Garrido, Lluis; Gaspar, Clara; Gauld, Rhorry; Gavardi, Laura; Gavrilov, Gennadii; Geraci, Angelo; Gersabeck, Evelina; Gersabeck, Marco; Gershon, Timothy; Ghez, Philippe; Gianelle, Alessio; Gianì, Sebastiana; Gibson, Valerie; Giubega, Lavinia-Helena; Gligorov, Vladimir; Göbel, Carla; Golubkov, Dmitry; Golutvin, Andrey; Gomes, Alvaro; Gotti, Claudio; Grabalosa Gándara, Marc; Graciani Diaz, Ricardo; Granado Cardoso, Luis Alberto; Graugés, Eugeni; Graziani, Giacomo; Grecu, Alexandru; Greening, Edward; Gregson, Sam; Griffith, Peter; Grillo, Lucia; Grünberg, Oliver; Gui, Bin; Gushchin, Evgeny; Guz, Yury; Gys, Thierry; Hadjivasiliou, Christos; Haefeli, Guido; Haen, Christophe; Haines, Susan; Hall, Samuel; Hamilton, Brian; Hampson, Thomas; Han, Xiaoxue; Hansmann-Menzemer, Stephanie; Harnew, Neville; Harnew, Samuel; Harrison, Jonathan; He, Jibo; Head, Timothy; Heijne, Veerle; Hennessy, Karol; Henrard, Pierre; Henry, Louis; Hernando Morata, Jose Angel; van Herwijnen, Eric; Heß, Miriam; Hicheur, Adlène; Hill, Donal; Hoballah, Mostafa; Hombach, Christoph; Hulsbergen, Wouter; Hunt, Philip; Hussain, Nazim; Hutchcroft, David; Hynds, Daniel; Idzik, Marek; Ilten, Philip; Jacobsson, Richard; Jaeger, Andreas; Jalocha, Pawel; Jans, Eddy; Jaton, Pierre; Jawahery, Abolhassan; Jing, Fanfan; John, Malcolm; Johnson, Daniel; Jones, Christopher; Joram, Christian; Jost, Beat; Jurik, Nathan; Kandybei, Sergii; Kanso, Walaa; Karacson, Matthias; Karbach, Moritz; Karodia, Sarah; Kelsey, Matthew; Kenyon, Ian; Ketel, Tjeerd; Khanji, Basem; Khurewathanakul, Chitsanu; Klaver, Suzanne; Klimaszewski, Konrad; Kochebina, Olga; Kolpin, Michael; Komarov, Ilya; Koopman, Rose; Koppenburg, Patrick; Korolev, Mikhail; Kozlinskiy, Alexandr; Kravchuk, Leonid; Kreplin, Katharina; Kreps, Michal; Krocker, Georg; Krokovny, Pavel; Kruse, Florian; Kucewicz, Wojciech; Kucharczyk, Marcin; Kudryavtsev, Vasily; Kurek, Krzysztof; Kvaratskheliya, Tengiz; La Thi, Viet Nga; Lacarrere, Daniel; Lafferty, George; Lai, Adriano; Lambert, Dean; Lambert, Robert W; Lanfranchi, Gaia; Langenbruch, Christoph; Langhans, Benedikt; Latham, Thomas; Lazzeroni, Cristina; Le Gac, Renaud; van Leerdam, Jeroen; Lees, Jean-Pierre; Lefèvre, Regis; Leflat, Alexander; Lefrançois, Jacques; Leo, Sabato; Leroy, Olivier; Lesiak, Tadeusz; Lespinasse, Mickael; Leverington, Blake; Li, Yiming; Likhomanenko, Tatiana; Liles, Myfanwy; Lindner, Rolf; Linn, Christian; Lionetto, Federica; Liu, Bo; Lohn, Stefan; Longstaff, Iain; Lopes, Jose; Lopez-March, Neus; Lowdon, Peter; Lu, Haiting; Lucchesi, Donatella; Luo, Haofei; Lupato, Anna; Luppi, Eleonora; Lupton, Oliver; Machefert, Frederic; Machikhiliyan, Irina V; Maciuc, Florin; Maev, Oleg; Malde, Sneha; Malinin, Alexander; Manca, Giulia; Mancinelli, Giampiero; Mapelli, Alessandro; Maratas, Jan; Marchand, Jean François; Marconi, Umberto; Marin Benito, Carla; Marino, Pietro; Märki, Raphael; Marks, Jörg; Martellotti, Giuseppe; Martens, Aurelien; Martín Sánchez, Alexandra; Martinelli, Maurizio; Martinez Santos, Diego; Martinez Vidal, Fernando; Martins Tostes, Danielle; Massafferri, André; Matev, Rosen; Mathe, Zoltan; Matteuzzi, Clara; Mazurov, Alexander; McCann, Michael; McCarthy, James; McNab, Andrew; McNulty, Ronan; McSkelly, Ben; Meadows, Brian; Meier, Frank; Meissner, Marco; Merk, Marcel; Milanes, Diego Alejandro; Minard, Marie-Noelle; Moggi, Niccolò; Molina Rodriguez, Josue; Monteil, Stephane; Morandin, Mauro; Morawski, Piotr; Mordà, Alessandro; Morello, Michael Joseph; Moron, Jakub; Morris, Adam Benjamin; Mountain, Raymond; Muheim, Franz; Müller, Katharina; Mussini, Manuel; Muster, Bastien; Naik, Paras; Nakada, Tatsuya; Nandakumar, Raja; Nasteva, Irina; Needham, Matthew; Neri, Nicola; Neubert, Sebastian; Neufeld, Niko; Neuner, Max; Nguyen, Anh Duc; Nguyen, Thi-Dung; Nguyen-Mau, Chung; Nicol, Michelle; Niess, Valentin; Niet, Ramon; Nikitin, Nikolay; Nikodem, Thomas; Novoselov, Alexey; O'Hanlon, Daniel Patrick; Oblakowska-Mucha, Agnieszka; Obraztsov, Vladimir; Oggero, Serena; Ogilvy, Stephen; Okhrimenko, Oleksandr; Oldeman, Rudolf; Onderwater, Gerco; Orlandea, Marius; Otalora Goicochea, Juan Martin; Owen, Patrick; Oyanguren, Maria Arantza; Pal, Bilas Kanti; Palano, Antimo; Palombo, Fernando; Palutan, Matteo; Panman, Jacob; Papanestis, Antonios; Pappagallo, Marco; Pappalardo, Luciano; Parkes, Christopher; Parkinson, Christopher John; Passaleva, Giovanni; Patel, Girish; Patel, Mitesh; Patrignani, Claudia; Pearce, Alex; Pellegrino, Antonio; Pepe Altarelli, Monica; Perazzini, Stefano; Perret, Pascal; Perrin-Terrin, Mathieu; Pescatore, Luca; Pesen, Erhan; Petridis, Konstantin; Petrolini, Alessandro; Picatoste Olloqui, Eduardo; Pietrzyk, Boleslaw; Pilař, Tomas; Pinci, Davide; Pistone, Alessandro; Playfer, Stephen; Plo Casasus, Maximo; Polci, Francesco; Poluektov, Anton; Polycarpo, Erica; Popov, Alexander; Popov, Dmitry; Popovici, Bogdan; Potterat, Cédric; Price, Eugenia; Prisciandaro, Jessica; Pritchard, Adrian; Prouve, Claire; Pugatch, Valery; Puig Navarro, Albert; Punzi, Giovanni; Qian, Wenbin; Rachwal, Bartolomiej; Rademacker, Jonas; Rakotomiaramanana, Barinjaka; Rama, Matteo; Rangel, Murilo; Raniuk, Iurii; Rauschmayr, Nathalie; Raven, Gerhard; Reichert, Stefanie; Reid, Matthew; dos Reis, Alberto; Ricciardi, Stefania; Richards, Sophie; Rihl, Mariana; Rinnert, Kurt; Rives Molina, Vincente; Roa Romero, Diego; Robbe, Patrick; Rodrigues, Ana Barbara; Rodrigues, Eduardo; Rodriguez Perez, Pablo; Roiser, Stefan; Romanovsky, Vladimir; Romero Vidal, Antonio; Rotondo, Marcello; Rouvinet, Julien; Ruf, Thomas; Ruiz, Hugo; Ruiz Valls, Pablo; Saborido Silva, Juan Jose; Sagidova, Naylya; Sail, Paul; Saitta, Biagio; Salustino Guimaraes, Valdir; Sanchez Mayordomo, Carlos; Sanmartin Sedes, Brais; Santacesaria, Roberta; Santamarina Rios, Cibran; Santovetti, Emanuele; Sarti, Alessio; Satriano, Celestina; Satta, Alessia; Saunders, Daniel Martin; Savrina, Darya; Schiller, Manuel; Schindler, Heinrich; Schlupp, Maximilian; Schmelling, Michael; Schmidt, Burkhard; Schneider, Olivier; Schopper, Andreas; Schune, Marie Helene; Schwemmer, Rainer; Sciascia, Barbara; Sciubba, Adalberto; Semennikov, Alexander; Sepp, Indrek; Serra, Nicola; Serrano, Justine; Sestini, Lorenzo; Seyfert, Paul; Shapkin, Mikhail; Shapoval, Illya; Shcheglov, Yury; Shears, Tara; Shekhtman, Lev; Shevchenko, Vladimir; Shires, Alexander; Silva Coutinho, Rafael; Simi, Gabriele; Sirendi, Marek; Skidmore, Nicola; Skwarnicki, Tomasz; Smith, Anthony; Smith, Edmund; Smith, Eluned; Smith, Jackson; Smith, Mark; Snoek, Hella; Sokoloff, Michael; Soler, Paul; Soomro, Fatima; Souza, Daniel; Souza De Paula, Bruno; Spaan, Bernhard; Sparkes, Ailsa; Spradlin, Patrick; Sridharan, Srikanth; Stagni, Federico; Stahl, Marian; Stahl, Sascha; Steinkamp, Olaf; Stenyakin, Oleg; Stevenson, Scott; Stoica, Sabin; Stone, Sheldon; Storaci, Barbara; Stracka, Simone; Straticiuc, Mihai; Straumann, Ulrich; Stroili, Roberto; Subbiah, Vijay Kartik; Sun, Liang; Sutcliffe, William; Swientek, Krzysztof; Swientek, Stefan; Syropoulos, Vasileios; Szczekowski, Marek; Szczypka, Paul; Szumlak, Tomasz; T'Jampens, Stephane; Teklishyn, Maksym; Tellarini, Giulia; Teubert, Frederic; Thomas, Christopher; Thomas, Eric; van Tilburg, Jeroen; Tisserand, Vincent; Tobin, Mark; Tolk, Siim; Tomassetti, Luca; Tonelli, Diego; Topp-Joergensen, Stig; Torr, Nicholas; Tournefier, Edwige; Tourneur, Stephane; Tran, Minh Tâm; Tresch, Marco; Trisovic, Ana; Tsaregorodtsev, Andrei; Tsopelas, Panagiotis; Tuning, Niels; Ubeda Garcia, Mario; Ukleja, Artur; Ustyuzhanin, Andrey; Uwer, Ulrich; Vagnoni, Vincenzo; Valenti, Giovanni; Vallier, Alexis; Vazquez Gomez, Ricardo; Vazquez Regueiro, Pablo; Vázquez Sierra, Carlos; Vecchi, Stefania; Velthuis, Jaap; Veltri, Michele; Veneziano, Giovanni; Vesterinen, Mika; Viaud, Benoit; Vieira, Daniel; Vieites Diaz, Maria; Vilasis-Cardona, Xavier; Vollhardt, Achim; Volyanskyy, Dmytro; Voong, David; Vorobyev, Alexey; Vorobyev, Vitaly; Voß, Christian; de Vries, Jacco; Waldi, Roland; Wallace, Charlotte; Wallace, Ronan; Walsh, John; Wandernoth, Sebastian; Wang, Jianchun; Ward, David; Watson, Nigel; Websdale, David; Whitehead, Mark; Wicht, Jean; Wiedner, Dirk; Wilkinson, Guy; Williams, Matthew; Williams, Mike; Wilson, Fergus; Wimberley, Jack; Wishahi, Julian; Wislicki, Wojciech; Witek, Mariusz; Wormser, Guy; Wotton, Stephen; Wright, Simon; Wu, Suzhi; Wyllie, Kenneth; Xie, Yuehong; Xing, Zhou; Xu, Zhirui; Yang, Zhenwei; Yuan, Xuhao; Yushchenko, Oleg; Zangoli, Maria; Zavertyaev, Mikhail; Zhang, Liming; Zhang, Wen Chao; Zhang, Yanxi; Zhelezov, Alexey; Zhokhov, Anatoly; Zhong, Liang; Zvyagin, Alexander

    2014-01-01

    The production of $\\chi_b$ mesons in proton-proton collisions is studied using a data sample collected by the LHCb detector, at centre-of-mass energies of $\\sqrt{s}=7$ and $8$ TeV and corresponding to an integrated luminosity of 3.0 fb$^{-1}$. The $\\chi_b$ mesons are identified through their decays to $\\Upsilon(1S)\\gamma$ and $\\Upsilon(2S)\\gamma$ using photons that converted to $e^+e^-$ pairs in the detector. The $\\chi_b(3P)$ meson mass, and the relative prompt production rate of $\\chi_{b1}(1P)$ and $\\chi_{b2}(1P)$ mesons as a function of the $\\Upsilon(1S)$ transverse momentum in the $\\chi_b$ rapidity range 2.0< $y$<4.5, are measured. Assuming a mass splitting between the $\\chi_{b1}(3P)$ and the $\\chi_{b2}(3P)$ states of 10.5 MeV/$c^2$, the mass of the $\\chi_{b1}(3P)$ meson is \\begin{equation*} m(\\chi_{b1}(3P))= 10515.7^{+2.2}_{-3.9}(stat) ^{+1.5}_{-2.1}(syst) MeV/c^2. \\end{equation*}

  12. Measurement of the Branching Fraction for B+- --> chi_c0 K+-

    CERN Document Server

    Aubert, B; Boutigny, D; Gaillard, J M; Hicheur, A; Karyotakis, Yu; Lees, J P; Robbe, P; Tisserand, V; Zghiche, A; Palano, A; Pompili, A; Chen, J C; Qi, N D; Rong, G; Wang, P; Zhu, Y S; Eigen, G; Ofte, I; Stugu, B; Abrams, G S; Borgland, A W; Breon, A B; Brown, D N; Button-Shafer, J; Cahn, R N; Charles, E; Day, C T; Gill, M S; Gritsan, A V; Groysman, Y; Jacobsen, R G; Kadel, R W; Kadyk, J; Kerth, L T; Kolomensky, Yu G; Kral, J F; Kukartsev, G; Le Clerc, C; Levi, M E; Lynch, G; Mir, L M; Oddone, P J; Orimoto, T J; Pripstein, M; Roe, N A; Romosan, A; Ronan, Michael T; Shelkov, V G; Telnov, A V; Wenzel, W A; Ford, K; Harrison, T J; Hawkes, C M; Knowles, D J; Morgan, S E; Penny, R C; Watson, A T; Watson, N K; Goetzen, K; Held, T; Koch, H; Lewandowski, B; Pelizaeus, M; Peters, K; Schmücker, H; Steinke, M; Barlow, N R; Boyd, J T; Chevalier, N; Cottingham, W N; Kelly, M P; Latham, T E; MacKay, C; Wilson, F F; Abe, K; Çuhadar-Dönszelmann, T; Hearty, C; Mattison, T S; McKenna, J A; Thiessen, D; Kyberd, P; McKemey, A K; Blinov, V E; Bukin, A D; Golubev, V B; Ivanchenko, V N; Kravchenko, E A; Onuchin, A P; Serednyakov, S I; Skovpen, Yu I; Solodov, E P; Yushkov, A N; Best, D; Bruinsma, M; Chao, M; Kirkby, D; Lankford, A J; Mandelkern, M A; Mommsen, R K; Röthel, W; Stoker, D P; Buchanan, C; Hartfiel, B L; Shen, B C; Del Re, D; Hadavand, H K; Hill, E J; MacFarlane, D B; Paar, H P; Rahatlou, S; Sharma, V; Berryhill, J W; Campagnari, C; Dahmes, B; Kuznetsova, N; Levy, S L; Long, O; Lu, A; Mazur, M A; Richman, J D; Verkerke, W; Beck, T W; Beringer, J; Eisner, A M; Heusch, C A; Lockman, W S; Schalk, T; Schmitz, R E; Schumm, B A; Seiden, A; Turri, M; Walkowiak, W; Williams, D C; Wilson, M G; Albert, J; Chen, E; Dubois-Felsmann, G P; Dvoretskii, A; Hitlin, D G; Narsky, I; Porter, F C; Ryd, A; Samuel, A; Yang, S; Jayatilleke, S M; Mancinelli, G; Meadows, B T; Sokoloff, M D; Abe, T; Blanc, F; Bloom, P; Chen, S; Clark, P J; Ford, W T; Nauenberg, U; Olivas, A; Rankin, P; Roy, J; Smith, J G; Van Hoek, W C; Zhang, L; Harton, J L; Hu, T; Soffer, A; Toki, W H; Wilson, R J; Zhang, J; Altenburg, D; Brandt, T; Brose, J; Colberg, T; Dickopp, M; Dubitzky, R S; Hauke, A; Lacker, H M; Maly, E; Müller-Pfefferkorn, R; Nogowski, R; Otto, S; Schubert, J; Schubert, Klaus R; Schwierz, R; Spaan, B; Wilden, L; Bernard, D; Bonneaud, G R; Brochard, F; Cohen-Tanugi, J; Grenier, P; Thiebaux, C; Vasileiadis, G; Verderi, M; Khan, A; Lavin, D; Muheim, F; Playfer, S; Swain, J E; Andreotti, M; Azzolini, V; Bettoni, D; Bozzi, C; Calabrese, R; Cibinetto, G; Luppi, E; Negrini, M; Piemontese, L; Sarti, A; Treadwell, E; Anulli, F; Baldini-Ferroli, R; Biasini, M; Calcaterra, A; De Sangro, R; Falciai, D; Finocchiaro, G; Patteri, P; Peruzzi, I M; Piccolo, M; Pioppi, M; Zallo, A; Buzzo, A; Capra, R; Contri, R; Crosetti, G; Lo Vetere, M; Macri, M; Monge, M R; Passaggio, S; Patrignani, C; Robutti, E; Santroni, A; Tosi, S; Bailey, S; Morii, M; Won, E; Bhimji, W; Bowerman, D A; Dauncey, P D; Egede, U; Eschrich, I; Gaillard, J R; Morton, G W; Nash, J A; Sanders, P; Taylor, G P; Grenier, G J; Lee, S J; Mallik, U; Cochran, J; Crawley, H B; Lamsa, J; Meyer, W T; Prell, S; Rosenberg, E I; Yi, J; Davier, M; Grosdidier, G; Höcker, A; Laplace, S; Le Diberder, F R; Lepeltier, V; Lutz, A M; Petersen, T C; Plaszczynski, S; Schune, M H; Tantot, L; Wormser, G; Brigljevic, V; Cheng, C H; Lange, D J; Wright, D M; Bevan, A J; Coleman, J P; Fry, J R; Gabathuler, Erwin; Gamet, R; Kay, M; Parry, R J; Payne, D J; Sloane, R J; Touramanis, C; Back, J J; Harrison, P F; Shorthouse, H W; Strother, P; Vidal, P B; Brown, C L; Cowan, G; Flack, R L; Flächer, H U; George, S; Green, M G; Kurup, A; Marker, C E; McMahon, T R; Ricciardi, S; Salvatore, F; Vaitsas, G; Winter, M A; Brown, D; Davis, C L; Allison, J; Barlow, R J; Forti, A C; Hart, P A; Hodgkinson, M C; Jackson, F; Lafferty, G D; Lyon, A J; Weatherall, J H; Williams, J C; Farbin, A; Jawahery, A; Kovalskyi, D; Lae, C K; Lillard, V; Roberts, D A; Blaylock, G; Dallapiccola, C; Flood, K T; Hertzbach, S S; Kofler, R; Koptchev, V B; Moore, T B; Saremi, S; Stängle, H; Willocq, S; Cowan, R; Sciolla, G; Taylor, F; Yamamoto, R K; Mangeol, D J J; Patel, P M; Lazzaro, A; Palombo, F; Bauer, J M; Cremaldi, L M; Eschenburg, V; Godang, R; Kroeger, R; Reidy, J; Sanders, D A; Summers, D J; Zhao, H W; Brunet, S; Cote-Ahern, D; Hast, C; Taras, P; Nicholson, H; Cartaro, C; Cavallo, N; De Nardo, Gallieno; Fabozzi, F; Gatto, C; Lista, L; Paolucci, P; Piccolo, D; Sciacca, C; Baak, M A; Raven, G; LoSecco, J M; Gabriel, T A; Brau, B; Gan, K K; Honscheid, K; Hufnagel, D; Kagan, H; Kass, R; Pulliam, T; Wong, Q K; Brau, J E; Frey, R; Potter, C T; Sinev, N B; Strom, D; Torrence, E; Colecchia, F; Dorigo, A; Galeazzi, F; Margoni, M; Morandin, M; Posocco, M; Rotondo, M; Simonetto, F; Stroili, R; Tiozzo, G; Voci, C; Benayoun, M; Briand, H; Chauveau, J; David, P; La Vaissière, C de; Del Buono, L; Hamon, O; John, M J J; Leruste, P; Ocariz, J; Pivk, M; Roos, L; Stark, J; T'Jampens, S; Therin, G; Manfredi, P F; Re, V; Behera, P K; Gladney, L; Guo, Q H; Panetta, J; Angelini, C; Batignani, G; Bettarini, S; Bondioli, M; Bucci, F; Calderini, G; Carpinelli, M; Del Gamba, V; Forti, F; Giorgi, M A; Lusiani, A; Marchiori, G; Martínez-Vidal, F; Morganti, M; Neri, N; Paoloni, E; Rama, M; Rizzo, G; Sandrelli, F; Walsh, J; Haire, M; Judd, D; Paick, K; Wagoner, D E; Danielson, N; Elmer, P; Lü, C; Miftakov, V; Olsen, J; Smith, A J S; Tanaka, H A; Varnes, E W; Bellini, F; Cavoto, G; Faccini, R; Ferrarotto, F; Ferroni, F; Gaspero, M; Mazzoni, M A; Morganti, S; Pierini, M; Piredda, G; Safai-Tehrani, F; Voena, C; Christ, S; Wagner, G; Waldi, R; Adye, T; De Groot, N; Franek, B J; Geddes, N I; Gopal, G P; Olaiya, E O; Xella, S M; Aleksan, Roy; Emery, S; Gaidot, A; Ganzhur, S F; Giraud, P F; Hamel de Monchenault, G; Kozanecki, Witold; Langer, M; Legendre, M; London, G W; Mayer, B; Schott, G; Vasseur, G; Yéche, C; Zito, M; Purohit, M V; Weidemann, A W; Yumiceva, F X; Aston, D; Bartoldus, R; Berger, N; Boyarski, A M; Buchmüller, O L; Convery, M R; Coupal, D P; Dong, D; Dorfan, J; Dujmic, D; Dunwoodie, W M; Field, R C; Glanzman, T; Gowdy, S J; Graugès-Pous, E; Hadig, T; Halyo, V; Hrynóva, T; Innes, W R; Jessop, C P; Kelsey, M H; Kim, P; Kocian, M L; Langenegger, U; Leith, D W G S; Luitz, S; Lüth, V; Lynch, H L; Marsiske, H; Messner, R; Müller, D R; O'Grady, C P; Ozcan, V E; Perazzo, A; Perl, M; Petrak, S; Ratcliff, B N; Robertson, S H; Roodman, A; Salnikov, A A; Schindler, R H; Schwiening, J; Simi, G; Snyder, A; Soha, A; Stelzer, J; Su, D; Sullivan, M K; Vavra, J; Wagner, S R; Weaver, M; Weinstein, A J R; Wisniewski, W J; Wright, D H; Young, C C; Burchat, Patricia R; Edwards, A J; Meyer, T I; Petersen, B A; Roat, C; Ahmed, S; Alam, M S; Ernst, J A; Saleem, M; Wappler, F R; Bugg, W; Krishnamurthy, M; Spanier, S M; Eckmann, R; Kim, H; Ritchie, J L; Schwitters, R F; Izen, J M; Kitayama, I; Lou, X C; Ye, S; Bianchi, F; Bóna, M; Gallo, F; Gamba, D; Borean, C; Bosisio, L; Della Ricca, G; Dittongo, S; Grancagnolo, S; Lanceri, L; Poropat, P; Vitale, L; Vuagnin, G; Panvini, R S; Banerjee, Sw; Brown, C M; Fortin, D; Jackson, P D; Kowalewski, R V; Roney, J M; Band, H R; Dasu, S; Datta, M; Eichenbaum, A M; Johnson, J R; Kutter, P E; Li, H; Liu, R; Di Lodovico, F; Mihályi, A; Mohapatra, A K; Pan, Y; Prepost, R; Sekula, S J; Von Wimmersperg-Töller, J H; Wu, J; Wu, S L; Yu, Z; Neal, H

    2004-01-01

    We present a measurement of the branching fraction of the decay B+- --> chi_c0 K+- from a sample of 89 million BB pairs collected by the BaBar detector at the PEP-II asymmetric-energy B Factory at SLAC. The chi_c0 meson is reconstructed through its two-body decays to pi+ pi- and K+ K-. We measure BR(B+- --> chi_c0 K+-)* BR(chi_c0 --> pi+ pi-) = (1.32^{+0.28}_{-0.27}(stat) +- 0.09(syst))*10^-6 and BR(B+- --> chi_c0 K+-) * BR(chi_c0 --> K+ K-) = (1.49^{+0.36}_{-0.34}(stat) +- 0.11(syst))* 10^-6. Using the known values for the chi_c0 decays branching fractions, we combine these results to obtain BR(B+- --> chi_c0 K+-) = (2.7+-0.7)* 10^-4.

  13. First Observation of Exclusive chi_cJ Decays to Two Charged and Two Neutral Hadrons

    OpenAIRE

    Q. He

    2008-01-01

    We study exclusive chi_c0, chi_c1 and chi_c2 decays to four-hadron final states involving two charged and two neutral mesons: pi^+pi^-pi^0pi^0, K^+K^-pi^0pi^0, pppi^0pi^0, K^+K^-etapi^0, and K^+-pi^-+K^0pi^0o. The chi_c states are produced in radiative decays of 3.08 million psi-prime resonance decays and observed in the CLEO detector. We also measure the largest substructure contributions to the modes pi^+pi^-pi^0pi^0 and K^+-pi^-+K^0pi^0.

  14. Observation of chicJ radiative decays to light vector mesons.

    Science.gov (United States)

    Bennett, J V; Mitchell, R E; Shepherd, M R; Besson, D; Pedlar, T K; Cronin-Hennessy, D; Gao, K Y; Hietala, J; Kubota, Y; Klein, T; Lang, B W; Poling, R; Scott, A W; Zweber, P; Dobbs, S; Metreveli, Z; Seth, K K; Tan, B J Y; Tomaradze, A; Libby, J; Martin, L; Powell, A; Wilkinson, G; Ecklund, K M; Love, W; Savinov, V; Mendez, H; Ge, J Y; Miller, D H; Shipsey, I P J; Xin, B; Adams, G S; Hu, D; Moziak, B; Napolitano, J; He, Q; Insler, J; Muramatsu, H; Park, C S; Thorndike, E H; Yang, F; Artuso, M; Blusk, S; Khalil, S; Li, J; Mountain, R; Nisar, S; Randrianarivony, K; Sultana, N; Skwarnicki, T; Stone, S; Wang, J C; Zhang, L M; Bonvicini, G; Cinabro, D; Dubrovin, M; Lincoln, A; Naik, P; Rademacker, J; Asner, D M; Edwards, K W; Reed, J; Briere, R A; Tatishvili, G; Vogel, H; Rosner, J L; Alexander, J P; Cassel, D G; Duboscq, J E; Ehrlich, R; Fields, L; Galik, R S; Gibbons, L; Gray, R; Gray, S W; Hartill, D L; Heltsley, B K; Hertz, D; Hunt, J M; Kandaswamy, J; Kreinick, D L; Kuznetsov, V E; Ledoux, J; Mahlke-Krüger, H; Mohapatra, D; Onyisi, P U E; Patterson, J R; Peterson, D; Riley, D; Ryd, A; Sadoff, A J; Shi, X; Stroiney, S; Sun, W M; Wilksen, T; Athar, S B; Patel, R; Yelton, J; Rubin, P; Eisenstein, B I; Karliner, I; Mehrabyan, S; Lowrey, N; Selen, M; White, E J; Wiss, J

    2008-10-10

    Using a total of 2.74 x 10(7) decays of the psi(2S) collected with the CLEO-c detector, we present a study of chi(cJ)-->gammaV, where V=rho(0), omega, phi. The transitions chi(c1)-->gammarho(0 and chi(c1)-->gammaomega are observed with B(chi(c1)-->gammarho(0))=(2.43+/-0.19+/-0.22) x 10(-4) and B(chi(c1)-->gammaomega)=(8.3+/-1.5+/-1.2) x 10(-5). In the chi(c1)-->gammarho(0) transition, the final state meson is dominantly longitudinally polarized. Upper limits on the branching fractions of other chi(cJ) states to light vector mesons are presented. PMID:18999588

  15. From the Deuteron to Deusons, an Analysis of Deuteronlike Meson-Meson Bound States

    CERN Document Server

    Törnqvist, N A

    1994-01-01

    A systematic study of possible deuteronlike two-meson bound states, {\\it deusons}, is presented. Previous arguments that many such bound states may exist are elaborated with detailed arguments and numerical calculations including, in particular, the tensor potential. In the heavy meson sector one-pion exchange alone is strong enough to form at least deuteron-like $B\\bar B^*$ and $B^*\\bar B^*$ composites bound by approximately 50 MeV. Composites of $D\\bar D^*$ and $D^*\\bar D^*$ states bound by pion exchange alone are expected near the thresholds, while in the light meson sector one generally needs some additional short range attraction to form bound states. The quantum numbers of these states are I=0, In $B\\bar B^*$ one predictss the states: $\\eta_b(\\approx 10545),\\ \\chi_{b1}(\\approx 10562)$, and in $B^*\\bar B^*$ one finds the states: $\\eta_b(\\approx 10590),\\ \\chi_{b0}(\\approx 10582),\\ h_b(\\approx 10608),\\ \\chi_{b2}(\\approx 10602)$. Near the $D\\bar D^*$ threshold the states: $\\eta_c(\\approx 3870),\\ \\chi_{c0}(\\...

  16. Observation of B0 -> chi_c0 K*0 and Evidence of B+ -> chi_c0 K*+

    Energy Technology Data Exchange (ETDEWEB)

    Aubert, : B.

    2008-08-13

    The authors present the observation of the decay B{sup 0} {yields} {chi}{sub c0}K*{sup 0} as well as evidence of B{sup +} {yields} {chi}{sub c0}K*{sup +}, with an 8.9 and a 3.6 standard deviation significance, respectively, using a data sample of 454 million {Upsilon}(4S) {yields} B{bar B} decays collected with the BABAR detector at the PEP-II B meson factory located at the Standard Linear Accelerator Center (SLAC). The measured branching fractions are: {Beta}(B{sup 0} {yields} {chi}{sub c0}K*{sup 0}) = (1.7 {+-} 0.3 {+-} 0.2) x 10{sup -4} and {Beta}(B{sup +} {yields} {chi}{sub c0}K*{sup +}) = (1.4 {+-} 0.5 {+-} 0.2) x 10{sup -4}, where the first quoted errors are statistical and the second are systematic. They obtain a branching fraction upper limit of {Beta}(B{sup +} {yields} {chi}{sub c0}K*{sup +}) < 2.1 x 10{sup -4} at the 90% confidence level.

  17. Measurements of psi ' -> (p)over-barK(+)Sigma(0) and chi(cJ) -> (p)over-barK(+) Lambda

    NARCIS (Netherlands)

    Ablikim, M.; Achasov, M. N.; Albayrak, O.; Ambrose, D. J.; An, F. F.; An, Q.; Bai, J. Z.; Ban, Y.; Becker, J.; Bennett, J. V.; Bertani, M.; Bian, J. M.; Boger, E.; Bondarenko, O.; Boyko, I.; Briere, R. A.; Bytev, V.; Cai, X.; Cakir, O.; Calcaterra, A.; Cao, G. F.; Cetin, S. A.; Chang, J. F.; Chelkov, G.; Chen, G.; Chen, H. S.; Chen, J.C.; Chen, M.L.; Chen, S. J.; Chen, X.; Chen, Y.B.; Cheng, H. P.; Chu, Y. P.; Cronin-Hennessy, D.; Dai, H. L.; Dai, J.P.; Dedovich, D.; Deng, Z. Y.; Denig, A.; Denysenko, I.; Destefanis, M.; Ding, W. M.; Ding, Y.; Dong, L. Y.; Dong, M. Y.; Du, S. X.; Fang, J.; Fang, S. S.; Fava, L.; Feng, C. Q.; Ferroli, R. B.; Friedel, P.; Fu, C. D.; Gao, Y.; Geng, C.; Goetzen, K.; Gong, W. X.; Gradl, W.; Greco, M.; Gu, M. H.; Gu, Y. T.; Guan, Y. H.; Guo, Q.; Guo, L. B.; Guo, T.; Guo, Y. P.; Han, Y. L.; Harris, F. A.; He, K. L.; He, M.; He, Z. Y.; Held, T.; Heng, Y. K.; Hou, Z. L.; Hu, C.; Hu, H. M.; Hu, J. F.; Hu, T.; Huang, G. M.; Huang, G. S.; Huang, J.S.; Huang, L.; Huang, X.T.; Huang, Y.; Huang, Y.P.; Hussain, T.; Ji, C. S.; Ji, Q.; Ji, Q. P.; Ji, X. B.; Ji, X. L.; Jiang, L.L.; Jiang, X. S.; Jiao, J. B.; Jiao, Z.; Jin, D. P.; Jin, S.; Jing, F. F.; Kalantar-Nayestanaki, N.; Kavatsyuk, M.; Kopf, B.; Kornicer, M.; Kuehn, W.; Lai, W.; Lange, J.S.; Leyhe, M.; Li, C. H.; Li, Cheng; Li, Cui; Li, D. M.; Li, F.; Li, G.; Li, H.B.; Li, J. C.; Li, K.; Li, Lei; Li, Q. J.; Li, S.L.; Li, W. D.; Li, W. G.; Li, X. L.; Li, X. N.; Li, X. Q.; Li, X. R.; Li, Z. B.; Liang, H.; Liang, Y. F.; Liang, Y.T.; Liao, G.R.; Liao, X. T.; Lin, D.; Liu, B. J.; Liu, Cheng; Liu, C.X.; Liu, F.H.; Liu, Fang; Liu, Feng; Liu, H.; Liu, H. B.; Liu, H. H.; Liu, H. M.; Liu, H. W.; Liu, J. P.; Liu, K.; Liu, K.Y.; Liu, Kai; Liu, P. L.; Liu, Q.; Liu, S. B.; Liu, X.; Liu, Y. B.; Liu, Z. A.; Liu, Zhiqiang; Liu, Zhiqing; Loehner, H.; Lu, G. R.; Lu, H. J.; Lu, J.G.; Lu, Q. W.; Lu, X. R.; Lu, Y. P.; Luo, C. L.; Luo, M. X.; Luo, T.; Luo, X.L.; Lv, M.; Ma, C.L.; Ma, F. C.; Ma, H. L.; Ma, Q. M.; Ma, S.; Ma, T.; Ma, X. Y.; Maas, F.E.; Maggiora, M.; Malik, Q. A.; Mao, Y. J.; Mao, Z. P.; Messchendorp, J. G.; Min, J.; Min, T. J.; Mitchell, R. E.; Mo, X. H.; Morales, C. Morales; Moriya, K.; Muchnoi, N. Yu.; Muramatsu, H.; Nefedov, Y.; Nicholson, C.; Nikolaev, I. B.; Ning, Z.; Olsen, S. L.; Ouyang, Q.; Pacetti, S.; Park, J.W.; Pelizaeus, M.; Peng, H. P.; Peters, K.; Ping, J. L.; Ping, R. G.; Poling, R.; Prencipe, E.; Qi, M.; Qian, S.; Qiao, C. F.; Qin, L. Q.; Qin, X. S.; Qin, Y.; Qin, Z. H.; Qiu, J. F.; Rashid, K. H.; Rong, G.; Ruan, X. D.; Sarantsev, A.; Schaefer, B. D.; Shao, M.; Shen, C. P.; Shen, X. Y.; Sheng, H. Y.; Shepherd, M. R.; Song, X. Y.; Spataro, S.; Spruck, B.; Sun, D. H.; Sun, G. X.; Sun, J.F.; Sun, S. S.; Sun, Y.J.; Sun, Y.Z.; Sun, Z.J.; Sun, Z.T.; Tang, C.J.; Tang, X.; Tapan, I.; Thorndike, E. H.; Toth, D.; Ullrich, M.; Varner, G. S.; Wang, B.Q.; Wang, D.; Wang, D.Y.; Wang, K.; Wang, L. L.; Wang, L. S.; Wang, M.; Wang, P.; Wang, P. L.; Wang, Q. J.; Wang, S. G.; Wang, X. F.; Wang, X. L.; Wang, Y. F.; Wang, Z.; Wang, Z. G.; Wang, Z.Y.; Wei, D. H.; Wei, J.B.; Weidenkaff, P.; Wen, Q. G.; Wen, S. P.; Wiedner, U.; Wu, L.H.; Wu, N.; Wu, S.X.; Wu, W.; Wu, Z.; Xia, L. G.; Xia, Y. X.; Xiao, Z. J.; Xie, Y. G.; Xiu, Q. L.; Xu, G. F.; Xu, G. M.; Xu, Q.J.; Xu, Q.N.; Xu, X. P.; Xu, Z. R.; Xue, F.; Xue, Z.; Yan, L.; Yan, W. B.; Yan, Y. H.; Yang, H. X.; Yang, Y.; Yang, Y. X.; Ye, H.; Ye, M.; Ye, M. H.; Yu, B. X.; Yu, C. X.; Yu, H. W.; Yu, J. S.; Yu, S. P.; Yuan, C. Z.; Yuan, Y.; Zafar, A. A.; Zallo, A.; Zeng, Y.; Zhang, B. X.; Zhang, B. Y.; Zhang, C.; Zhang, C. C.; Zhang, D. H.; Zhang, H. H.; Zhang, H. Y.; Zhang, J. Q.; Zhang, J. W.; Zhang, J. Y.; Zhang, J. Z.; Zhang, LiLi; Zhang, R.; Zhang, S. H.; Zhang, X. J.; Zhang, X. Y.; Zhang, Y.; Zhang, Y. H.; Zhang, Z. P.; Zhang, Z. Y.; Zhang, Zhenghao; Zhao, G.; Zhao, H. S.; Zhao, J.W.; Zhao, K. X.; Zhao, Lei; Zhao, Ling; Zhao, M. G.; Zhao, Q.; Zhao, Q. Z.; Zhao, S.J.; Zhao, T.C.; Zhao, Y. B.; Zhao, Z. G.; Zhemchugov, A.; Zheng, B.; Zheng, Y. H.; Zhong, B.; Zhong, Z.; Zhou, L.; Zhou, X. K.; Zhou, X.R.; Zhu, C.; Zhu, K.; Zhu, K. J.; Zhu, S.H.; Zhu, Stuart; Zhu, Y.C.; Zhu, Y.M.; Zhu, Y.S.; Zhu, Z. A.; Zhuang, J.; Zou, B. S.; Zou, J. H.; Werner, M.J.; Zheng, J.P.

    2013-01-01

    Using a sample of 1.06 x 10(8) psi' mesons collectedwith the BESIII detector at the BEPCII e(+)e(-) collider and chi(cJ) mesons produced via radiative transitions from the psi', we report the first observation for psi' -> (p) over barK(+)Sigma(0) + c.c. (charge conjugate), as well as improved measur

  18. Model prediction for temperature dependence of meson pole masses from lattice QCD results on meson screening masses

    CERN Document Server

    Ishii, Masahiro; Yahiro, Masanobu

    2016-01-01

    We propose a practical effective model by introducing temperature ($T$) dependence to the coupling strengths of four-quark and six-quark Kobayashi-Maskawa-'t Hooft interactions in the 2+1 flavor Polyakov-loop extended Nambu-Jona-Lasinio model. The $T$ dependence is determined from LQCD data on the renormalized chiral condensate around the pseudocritical temperature $T_c^{\\chi}$ of chiral crossover and the screening-mass difference between $\\pi$ and $a_0$ mesons in $T > 1.1T_c^\\chi$ where only the $U(1)_{\\rm A}$-symmetry breaking survives. The model well reproduces LQCD data on screening masses $M_{\\xi}^{\\rm scr}(T)$ for both scalar and pseudoscalar mesons, particularly in $T \\ge T_c^{\\chi}$. Using this effective model, we predict meson pole masses $M_{\\xi}^{\\rm pole}(T)$ for scalar and pseudoscalar mesons. For $\\eta'$ meson, the prediction is consistent with the experimental value at finite $T$ measured in heavy-ion collisions. We point out that the relation $M_{\\xi}^{\\rm scr}(T)-M_{\\xi}^{\\rm pole}(T) \\approx...

  19. Measurement of branching fractions and charge asymmetries for two-body B meson decays with charmonium

    CERN Document Server

    Aubert, B; Boutigny, D; Couderc, F; Karyotakis, Yu; Lees, J P; Poireau, V; Tisserand, V; Zghiche, A; Graugès-Pous, E; Palano, A; Pompili, A; Chen, J C; Qi, N D; Rong, G; Wang, P; Zhu, Y S; Eigen, G; Ofte, I; Stugu, B; Abrams, G S; Borgland, A W; Breon, A B; Brown, D N; Button-Shafer, J; Cahn, R N; Charles, E; Day, C T; Gill, M S; Gritsan, A V; Groysman, Y; Jacobsen, R G; Kadel, R W; Kadyk, J; Kerth, L T; Kolomensky, Yu G; Kukartsev, G; Lynch, G; Mir, L M; Oddone, P J; Orimoto, T J; Pripstein, M; Roe, N A; Ronan, Michael T; Wenzel, W A; Barrett, M; Ford, K E; Harrison, T J; Hart, A J; Hawkes, C M; Morgan, S E; Watson, A T; Fritsch, M; Goetzen, K; Held, T; Koch, H; Lewandowski, B; Pelizaeus, M; Schröder, T; Steinke, M; Boyd, J T; Chevalier, N; Cottingham, W N; Kelly, M P; Latham, T E; Wilson, F F; Çuhadar-Dönszelmann, T; Hearty, C; Knecht, N S; Mattison, T S; McKenna, J A; Thiessen, D; Khan, A; Kyberd, P; Teodorescu, L; Blinov, A E; Blinov, V E; Druzhinin, V P; Golubev, V B; Ivanchenko, V N; Kravchenko, E A; Onuchin, A P; Serednyakov, S I; Skovpen, Yu I; Solodov, E P; Yushkov, A N; Best, D; Bruinsma, M; Chao, M; Eschrich, I; Kirkby, D; Lankford, A J; Mandelkern, M A; Mommsen, R K; Röthel, W; Stoker, D P; Buchanan, C; Hartfiel, B L; Weinstein, A J R; Foulkes, S D; Gary, J W; Long, O; Shen, B C; Wang, K; Del Re, D; Hadavand, H K; Hill, E J; MacFarlane, D B; Paar, H P; Rahatlou, S; Sharma, V; Berryhill, J W; Campagnari, C; Cunha, A; Dahmes, B; Hong, T M; Lu, A; Mazur, M A; Richman, J D; Verkerke, W; Beck, T W; Eisner, A M; Heusch, C A; Kroseberg, J; Lockman, W S; Nesom, G; Schalk, T; Schumm, B A; Seiden, A; Spradlin, P; Williams, D C; Wilson, M G; Albert, J; Chen, E; Dubois-Felsmann, G P; Dvoretskii, A; Hitlin, D G; Narsky, I; Piatenko, T; Porter, F C; Ryd, A; Samuel, A; Yang, S; Jayatilleke, S M; Mancinelli, G; Meadows, B T; Sokoloff, M D; Blanc, F; Bloom, P; Chen, S; Ford, W T; Nauenberg, U; Olivas, A; Rankin, P; Ruddick, W O; Smith, J G; Ulmer, K A; Zhang, J; Zhang, L; Chen, A; Eckhart, E A; Harton, J L; Soffer, A; Toki, W H; Wilson, R J; Zeng, Q; Spaan, B; Altenburg, D; Brandt, T; Brose, J; Dickopp, M; Feltresi, E; Hauke, A; Lacker, H M; Nogowski, R; Otto, S; Petzold, A; Schubert, J; Schubert, Klaus R; Schwierz, R; Sundermann, J E; Bernard, D; Bonneaud, G R; Grenier, P; Schrenk, S; Thiebaux, C; Vasileiadis, G; Verderi, M; Bard, D J; Clark, P J; Muheim, F; Playfer, S; Xie, Y; Andreotti, M; Azzolini, V; Bettoni, D; Bozzi, C; Calabrese, R; Cibinetto, G; Luppi, E; Negrini, M; Piemontese, L; Sarti, A; Anulli, F; Baldini-Ferroli, R; Calcaterra, A; De Sangro, R; Finocchiaro, G; Patteri, P; Peruzzi, I M; Piccolo, M; Zallo, A; Buzzo, A; Capra, R; Contri, R; Crosetti, G; Lo Vetere, M; Macri, M; Monge, M R; Passaggio, S; Patrignani, C; Robutti, E; Santroni, A; Tosi, S; Bailey, S; Brandenburg, G; Chaisanguanthum, K S; Morii, M; Won, E; Dubitzky, R S; Langenegger, U; Marks, J; Uwer, U; Bhimji, W; Bowerman, D A; Dauncey, P D; Egede, U; Gaillard, J R; Morton, G W; Nash, J A; Nikolich, M B; Taylor, G P; Charles, M J; Grenier, G J; Mallik, U; Cochran, J; Crawley, H B; Lamsa, J; Meyer, W T; Prell, S; Rosenberg, E I; Rubin, A E; Yi, J; Arnaud, N; Davier, M; Giroux, X; Grosdidier, G; Höcker, A; Le Diberder, F R; Lepeltier, V; Lutz, A M; Petersen, T C; Plaszczynski, S; Schune, M H; Wormser, G; Cheng, C H; Lange, D J; Simani, M C; Wright, D M; Bevan, A J; Chavez, C A; Coleman, J P; Forster, I J; Fry, J R; Gabathuler, Erwin; Gamet, R; Hutchcroft, D E; Parry, R J; Payne, D J; Touramanis, C; Cormack, C M; Di Lodovico, F; Brown, C L; Cowan, G; Flack, R L; Flächer, H U; Green, M G; Jackson, P S; McMahon, T R; Ricciardi, S; Salvatore, F; Winter, M A; Brown, D; Davis, C L; Allison, J; Barlow, N R; Barlow, R J; Hodgkinson, M C; Lafferty, G D; Williams, J C; Chen, C; Farbin, A; Hulsbergen, W D; Jawahery, A; Kovalskyi, D; Lae, C K; Lillard, V; Roberts, D A; Blaylock, G; Dallapiccola, C; Hertzbach, S S; Kofler, R; Koptchev, V B; Moore, T B; Saremi, S; Stängle, H; Willocq, S; Cowan, R; Koeneke, K; Sciolla, G; Sekula, S J; Taylor, F; Yamamoto, R K; Patel, P M; Robertson, S H; Lazzaro, A; Lombardo, V; Palombo, F; Bauer, J M; Cremaldi, L M; Eschenburg, V; Godang, R; Kroeger, R; Reidy, J; Sanders, D A; Summers, D J; Zhao, H W; Brunet, S; Côté, D; Nicholson, H; Cavallo, N; Lista, L; Monorchio, D; Paolucci, P; Piccolo, D; Sciacca, C; Baak, M; Bulten, H; Raven, G; Snoek, H L; Wilden, L; Jessop, C P; LoSecco, J M; Allmendinger, T; Benelli, G; Gan, K K; Honscheid, K; Hufnagel, D; Kagan, H; Kass, R; Pulliam, T; Rahimi, A M; Ter-Antonian, R; Wong, Q K; Brau, J E; Frey, R; Igonkina, O; Lu, M; Potter, C T; Sinev, N B; Strom, D; Torrence, E; Colecchia, F; Dorigo, A; Galeazzi, F; Margoni, M; Morandin, M; Posocco, M; Rotondo, M; Simonetto, F; Stroili, R; Voci, C; Benayoun, M; Briand, H; Chauveau, J; David, P; La Vaissière, C de; Del Buono, L; Hamon, O; John, M J J; Leruste, P; Malcles, J; Ocariz, J; Roos, L; Therin, G; Behera, P K; Gladney, L; Guo, Q H; Panetta, J; Biasini, M; Covarelli, R; Pioppi, M; Angelini, C; Batignani, G; Bettarini, S; Bondioli, M; Bucci, F; Calderini, G; Carpinelli, M; Forti, F; Giorgi, M A; Lusiani, A; Marchiori, G; Morganti, M; Neri, N; Paoloni, E; Rama, M; Rizzo, G; Simi, G; Walsh, J; Haire, M; Judd, D; Paick, K; Wagoner, D E; Danielson, N; Elmer, P; Lau, Y P; Lü, C; Miftakov, V; Olsen, J; Smith, A J S; Telnov, A V; Bellini, F; Cavoto, G; D'Orazio, A; Di Marco, E; Faccini, R; Ferrarotto, F; Ferroni, F; Gaspero, M; Li Gioi, L; Mazzoni, M A; Morganti, S; Pierini, M; Piredda, G; Polci, F; Safai-Tehrani, F; Voena, C; Christ, S; Schröder, H; Wagner, G; Waldi, R; Adye, T; De Groot, N; Franek, B J; Gopal, G P; Olaiya, E O; Aleksan, Roy; Emery, S; Gaidot, A; Ganzhur, S F; Giraud, P F; Hamel de Monchenault, G; Kozanecki, Witold; Legendre, M; London, G W; Mayer, B; Schott, G; Vasseur, G; Yéche, C; Zito, M; Purohit, M V; Weidemann, A W; Wilson, J R; Yumiceva, F X; Abe, T; Allen, M; Aston, D; Bartoldus, R; Berger, N; Boyarski, A M; Buchmüller, O L; Claus, R; Convery, M R; Cristinziani, M; De Nardo, Gallieno; Dingfelder, J C; Dong, D; Dorfan, J; Dujmic, D; Dunwoodie, W M; Fan, S; Field, R C; Glanzman, T; Gowdy, S J; Hadig, T; Halyo, V; Hast, C; Hrynóva, T; Innes, W R; Kelsey, M H; Kim, P; Kocian, M L; Leith, D W G S; Libby, J; Luitz, S; Lüth, V; Lynch, H L; Marsiske, H; Messner, R; Müller, D R; O'Grady, C P; Ozcan, V E; Perazzo, A; Perl, M; Ratcliff, B N; Roodman, A; Salnikov, A A; Schindler, R H; Schwiening, J; Snyder, A; Soha, A; Stelzer, J; Strube, J; Su, D; Sullivan, M K; Thompson, J; Vavra, J; Wagner, S R; Weaver, M; Wisniewski, W J; Wittgen, M; Wright, D H; Yarritu, A K; Young, C C; Burchat, Patricia R; Edwards, A J; Majewski, S A; Petersen, B A; Roat, C; Ahmed, M; Ahmed, S; Alam, M S; Ernst, J A; Saeed, M A; Saleem, M; Wappler, F R; Bugg, W; Krishnamurthy, M; Spanier, S M; Eckmann, R; Kim, H; Ritchie, J L; Satpathy, A; Schwitters, R F; Izen, J M; Kitayama, I; Lou, X C; Ye, S; Bianchi, F; Bóna, M; Gallo, F; Gamba, D; Bosisio, L; Cartaro, C; Cossutti, F; Della Ricca, G; Dittongo, S; Grancagnolo, S; Lanceri, L; Poropat, P; Vuagnin, G; Martínez-Vidal, F; Panvini, R S; Banerjee, Sw; Bhuyan, B; Brown, C M; Fortin, D; Jackson, P D; Kowalewski, R V; Roney, J M; Sobie, R J; Back, J J; Harrison, P F; Mohanty, G B; Band, H R; Chen, X; Cheng, B; Dasu, S; Datta, M; Eichenbaum, A M; Flood, K T; Graham, M; Hollar, J J; Johnson, J R; Kutter, P E; Li, H; Liu, R; Mihályi, A; Pan, Y; Prepost, R; Tan, P; Von Wimmersperg-Töller, J H; Wu, J; Wu, S L; Yu, Z; Greene, M G; Neal, H

    2003-01-01

    We report measurements of branching fractions and charge asymmetries of exclusive decays of neutral and charged B mesons into two-body final states containing a charmonium state and a light strange meson. The charmonium mesons considered are J/Psi, Psi(2S) and Chi_c1, and the light meson is either K or K*. We use a sample of about 124 million BBbar events collected with the BABAR detector at the PEP-II storage ring at the Stanford Linear Accelerator Center.

  20. Quarkonium Contribution to Meson Molecules

    CERN Document Server

    Cincioglu, E; Ozpineci, A; Yilmazer, A U

    2016-01-01

    Starting from a molecular picture for the X(3872) resonance, this state and its J^{PC}=2++ HQSS partner [X2(4012)] are analyzed within a model which incorporates possible mixings with 2P charmonium states. Since it is reasonable to expect the bare chi_{c1}(2P) to be located above the D\\bar D* threshold, but relatively close to it, the presence of the charmonium state provides an effective attraction that will contribute to bind the X(3872), but it will not appear in the 2++ sector. Indeed in this latter sector, the chi_{c2}(2P) should provide an effective small repulsion, because it is placed well below the D*\\bar D* threshold. We show how the 1++ and 2++ bare charmonium poles are modified due to the D(*)\\bar D(*) loop effects, and the first one is moved to the complex plane. The meson loops produce, besides some shifts in the masses of the charmonia, a finite width for the 1++ dressed charmonium state. On the other hand, the X(3872) and X2(4012) start developing some charmonium content, which is estimated by...

  1. Meson-meson processes in strong interactions

    International Nuclear Information System (INIS)

    Based on the meson-exchange framework the present work investigates the role played by meson-meson processes in strong interaction dynamics. We concentrate on two particular topics, one representing the more fundamental aspects of meson-meson systems the other being an example for the many possible applications. Using realistic meson-exchange models for ππ- and πη-scattering the first part of this work investigates the structure of the scalar meson f0(980) and a0(980) both being of outstanding importance for our understanding of the scalar meson sector. Our model produces good agreement with the available data. Furthermore, an analysis of the pole structure of the underlying ππ- and πη-scattering amplitudes leads to an understanding of the nature and parameters of f0(980) and a0(980). It is shown that besides the observed relationship between f0(980) and a0(980) their underlying structure is quite different. The second part of our investigation deals with the role played by correlated πρ exchange in the NN interaction. Starting point are open questions concerning the structure of the πNN vertex function. In the Bonn potential of the NN interaction a rather ''hard'' πNN formfactor is required in order to be able to reproduce experimental data, in particular the deuteron properties. However, this result is in disagreement with predictions from several theoretical models requiring a much softer πNN formfactor. We are able to show that this discrepancy is removed if correlated πρ exchange is added to the Bonn potential. (orig.)

  2. CHY formula and MHV amplitudes

    CERN Document Server

    Du, Yi-jian; Wu, Yong-shi

    2016-01-01

    In this paper, we study the relation between the Cachazo-He-Yuan (CHY) formula and the maximal-helicity-violating (MHV) amplitudes of Yang-Mills and gravity in four dimensions. We prove that only one special rational solution of the scattering equations found by Weinzierl support the MHV amplitudes. Namely, localized at this solution, the integrated CHY formula reproduces the Parke-Taylor formula for Yang-Mills amplitudes as well as the Hodges formula for gravitational amplitudes. This is achieved by developing techniques, in a manifestly M\\"obius covariant formalism, to explicitly compute relevant reduced Pfaffians/determinants. We observe and prove two interesting properties (or identities), which facilitate the computations. We also check that all the other $(n-3)!-1$ solutions to the scattering equations do not support the MHV amplitudes, and prove analytically that this is indeed true for the other special rational solution proposed by Weinzierl, that actually supports the anti-MHV amplitudes.

  3. The CHI 2013 interactive schedule

    DEFF Research Database (Denmark)

    Satyanarayan, Arvind; Strazzulla, Daniel; Klokmose, Clemens Nylandsted;

    2013-01-01

    available. The CHI'13 Interactive Schedule helps attendees navigate this wealth of video content in order to identify events they would like to attend. It consists of a number of large display screens throughout the conference venue which cycle through a video playlist of events. Attendees can interact with...... these displays using their mobile devices by either constructing custom video playlists or adding on-screen content to their personal schedule....

  4. CHY formula and MHV amplitudes

    Science.gov (United States)

    Du, Yi-Jian; Teng, Fei; Wu, Yong-Shi

    2016-05-01

    In this paper, we study the relation between the Cachazo-He-Yuan (CHY) formula and the maximal-helicity-violating (MHV) amplitudes of Yang-Mills and gravity in four dimensions. We prove that only one special rational solution of the scattering equations found by Weinzierl supports the MHV amplitudes. Namely, localized at this solution, the integrated CHY formula produces the Parke-Taylor formula for MHV Yang-Mills amplitudes as well as the Hodges formula for MHV gravitational amplitudes, with an arbitrary number of external gluons/gravitons. This is achieved by developing techniques, in a manifestly Möbius covariant formalism, to explicitly compute relevant reduced Pfaffians/determinants. We observe and prove two interesting properties (or identities), which facilitate the computations. We also check that all the other ( n - 3)! - 1 solutions to the scattering equations do not support the MHV amplitudes, and prove analytically that this is indeed true for the other special rational solution proposed by Weinzierl, that actually supports the anti-MHV amplitudes. Our results reveal a mysterious feature of the CHY formalism that in Yang-Mills and gravity theory, solutions of scattering equations, involving only external momenta, somehow know about the configuration of external polarizations of the scattering amplitudes.

  5. Spectroscopy of exotic mesons

    International Nuclear Information System (INIS)

    The authors discuss why QCD leads to the search for exotic hadrons. They summarize some expectations from theory and models concerning the masses, decay pattern and characteristic features of glueballs (gg), hybrid (q bar qg) and diquonia (qq bar q bar q) mesons. They discuss the best known or more interesting candidates for exotic mesons

  6. Tai Chi: Rx for Arthritic Knees

    Science.gov (United States)

    ... that tai chi can be effective in helping sleep, while reducing stress, anxiety and depression. "The mind component [of tai chi] promotes psychological well-being, life satisfaction, and improved perceptions of health," said Wang. Dr. Matthew Hepinstall, an ...

  7. Biomedical wellness by tai chi and sports

    Science.gov (United States)

    Chin, Daniel C.; Chin, Amita G.

    2011-06-01

    Tai-chi chuan is popular worldwide especially in China. People practice tai-chi chuan daily with faith believing that they will be rewarded with health and varieties of other rewords. The Tai Chi Chuan Theory by Master Chang and the Tai Chi Chuan Theory by Master Wang are translated to be the baseline of the tai-chi chuan. The theory described in these two papers clearly shows that the tai-chi power source is the combination of the two antigravity forces distinction by each foot. The ying, yang and hollowed, solid discussed in the papers are the properties and body relationship of the two antigravity forces. The antigravity forces presented inside of body are as air to the balloon termed chi. However chi could be generated by any muscle pressing; only the antigravity forces from feet are called nature chi that has the maximum strength of the person. When a person is soft, as an infant the nature chi will fulfill entire body with no time and effort. The sequence forms were designed for deploying the nature chi in speed and power. The combination of chi and tai-chi form make tai chi chuan supreme than other kinds of martial art. In the training process chi massages whole body many time for a sequence form practice that stimulate all organs and could lead to cure body diseases, lose weight, postpone aging process, and remove the aging symptoms. For the people practicing in the park daily with proper guidance they will fulfill their wishes. Tai chi exercise could also apply to other sports as in dancing and golfing they are discussed at the end of the paper.

  8. Vector-meson dominance revisited

    Directory of Open Access Journals (Sweden)

    Terschlüsen Carla

    2012-12-01

    Full Text Available The interaction of mesons with electromagnetism is often well described by the concept of vector-meson dominance (VMD. However, there are also examples where VMD fails. A simple chiral Lagrangian for pions, rho and omega mesons is presented which can account for the respective agreement and disagreement between VMD and phenomenology in the sector of light mesons.

  9. Mesonic effects in nuclear physics

    International Nuclear Information System (INIS)

    The relation between mesons and nucleons and the properties of nuclear matter, as presently understood, is considered in these lectures. Feynman diagrams, meson theoretical nucleon-nucleon interactions, mesonic components in nuclear wave functions, direct observation of mesonic components in NN scattering above the pion production threshold, nuclear matter theory, and pion condensation are treated. 120 references

  10. Properties of c meson

    Indian Academy of Sciences (India)

    Ajay Kumar Rai; P C Vinodkumar

    2006-05-01

    The mass spectrum of $c\\bar{b}$ meson is investigated with an effective quark-antiquark potential of the form $\\dfrac{-_{c}}{r} + Ar^{}$ with varying from 0.5 to 2.0. The and -wave masses, pseudoscalar decay constant, weak decay partial widths in spectator model and the lifetime of c meson are computed. The properties calculated here are found to be in good agreement with other theoretical and experimental values at potential index, = 1.

  11. Transversity and Meson Photoproduction

    CERN Document Server

    Goldstein, G R; Goldstein, Gary R.; Gamberg, Leonard

    2002-01-01

    Both meson photoproduction and semi-inclusive deep inelastic scattering can potentially probe transversity in the nucleon. We explore how that potential can be realized dynamically. The role of rescattering in both exclusive and inclusive meson production as a source for transverse polarization asymmetry is examined. We use a dynamical model to calculate the asymmetry and relate that to the transversity distribution of the nucleon.

  12. ρ meson decays of heavy hybrid mesons

    Science.gov (United States)

    Zhang, Liang; Huang, Peng-Zhi

    2016-07-01

    We calculate the ρ meson couplings between the heavy hybrid doublets Hh/Sh/Mh/Th and the ordinary qQ̅ doublets in the framework of the light-cone QCD sum rule. The sum rules obtained rely mildly on the Borel parameters in their working regions. The resulting coupling constants are rather small in most cases. Supported by National Natural Science Foundation of China (11105007)

  13. Chi activity during transduction-associated recombination.

    OpenAIRE

    Dower, N. A.; Stahl, F. W.

    1981-01-01

    Chi is a genetic element that stimulates phage lambda recombination by the Escherichia coli recBC pathway during lytic infection [Stahl, F. W. (1979) Annu. Rev. Genet. 13, 7--24]. Herein we show that chi in lambda prophage influences exchange distribution in P1 phage-mediated transduction and in conjugation. This demonstration encourages the view that chi may influence genetic exchange in E. coli in the total absence of lambda.

  14. Tai Chi philosophy and nursing epistemology.

    Science.gov (United States)

    Alperson, Sunny Yim

    2008-01-01

    This article analyzes the philosophy underpinning Tai Chi practice in light of nursing epistemology. The first half of the article reviews the general characteristics of major Chinese philosophical traditions that have been merged in Tai Chi: Confucianism, Daoism, and Buddhism. In the second half, themes of integration and praxis in Tai Chi are linked with Carper's fundamental patterns of knowing in nursing. Tai Chi is a practical fusion of humanistic philosophy with an experiential dimension of movement in a nondualistic foundation. The author argues that TC philosophy can be applied to integrated knowledge development and nursing praxis. PMID:20531257

  15. Holographic meson melting

    International Nuclear Information System (INIS)

    The plasma phase at high temperatures of a strongly coupled gauge theory can be holographically modelled by an AdS black hole. Matter in the fundamental representation and in the quenched approximation is introduced through embedding D7-branes in the AdS-Schwarzschild background. Low spin mesons correspond to the fluctuations of the D7-brane world volume. As is well known by now, there are two different kinds of embeddings, either reaching down to the black hole horizon or staying outside of it. In the latter case the fluctuations of the D7-brane world volume represent stable low spin mesons. In the plasma phase we do not expect mesons to be stable but to melt at sufficiently high temperature. We model the late stages of this meson melting by the quasinormal modes of D7-brane fluctuations for the embeddings that do reach down to the horizon. The inverse of the imaginary part of the quasinormal frequency gives the typical relaxation time back to equilibrium of the meson perturbation in the hot plasma. We briefly comment on the possible application of our model to quarkonium suppression

  16. Healing of subsurface damage after the 1999 Chi-Chi earthquake

    Science.gov (United States)

    Chen, K. H.; Rau, R.; Dreger, D. S.

    2009-12-01

    Observation of six M 4.6 repeating earthquakes in eastern Taiwan from 1991 to 2007 reveals a unique temporal and spatial variation in seismic wave character associated with the 1999 Mw 7.6 Chi-Chi earthquakes that occurred ~90 km away. Post-Chi-Chi events have reduced waveform similarity, suggesting a sudden change of seismic wave propagation properties after the Chi-Chi event. The changes in seismic character are widely distributed over Taiwan and remain significant in 5 years after Chi-Chi. Since 2004, the waveform similarity gradually recovered to the pre-Chi-Chi level. The most recent repeating event occurred on 15 November 2007 reveals only a subtle variation in seismic character compared to the pre-Chi-Chi event. This indicates that the damaged rock has been regaining the strength with time. The healing of subsurface damage zone, however, is not fully complete even 8 yr after the Chi-Chi earthquake. Using cross correlation function derived time-lag between the pre- and post- Chi-Chi events, we also identify a ~1 sec delay for the 2001 repeating event at a number of stations. Such a large delay shown in different parts of seismograms for different stations may indicate a broad range of fluid-filled scatterers along the travel path. For the station with the longest distance from the M 4.6 event (~200 km), PNG station on Penghu island off the western coast of Taiwan, the 1sec delay appears on early P wave coda. This suggests that the scatterers are likely located down to a depth of at least 20 km.

  17. CHI: A General Agent Communication Framework

    Energy Technology Data Exchange (ETDEWEB)

    Goldsmith, S.Y.; Phillips, L.R.; Spires, S.V.

    1998-12-17

    We have completed and exercised a communication framework called CHI (CLOS to HTML Interface) by which agents can communicate with humans. CHI follows HTTP (HyperText Transfer Protocol) and produces HTML (HyperText Markup Language) for use by WWW (World-Wide Web) browsers. CHI enables the rapid and dynamic construction of interface mechanisms. The essence of CHI is automatic registration of dynamically generated interface elements to named objects in the agent's internal environment. The agent can access information in these objects at will. State is preserved, so an agent can pursue branching interaction sequences, activate failure recovery behaviors, and otherwise act opportunistically to maintain a conversation. The CHI mechanism remains transparent in multi-agent, multi-user environments because of automatically generated unique identifiers built into the CHI mechanism. In this paper we discuss design, language, implementation, and extension issues, and, by way of illustration, examine the use of the general CHI/HCHI mechanism in a specific international electronic commerce system. We conclude that the CHI mechanism is an effective, efficient, and extensible means of the agent/human communication.

  18. Static-light meson-meson potentials

    CERN Document Server

    Bali, Gunnar

    2010-01-01

    We investigate potentials between pairs of static-light mesons in Nf=2 Lattice QCD, in different spin channels. The question of attraction and repulsion is particularly interesting with respect to the X(3872) charmonium state and charged candidates such as the Z+(4430). We employ the nonperturbatively improved Sheikholeslami-Wohlert fermion and the Wilson gauge actions at a lattice spacing a approx. 0.084 fm and a pseudoscalar mass mPS approx. 760 MeV. We use stochastic all-to-all propagator techniques, improved by a hopping parameter expansion. The analysis is based on the variational method, utilizing various source and sink interpolators.

  19. Search for scalar mesons

    International Nuclear Information System (INIS)

    The search for I = 0 0++ mesons is described. The crucial role played by the states in the 1 GeV region is highlighted. An analysis program that with unimpeachable data would produce definitive results on these is outlined and shown with present data to provide prima facie evidence for dynamics beyond that of the quark model. The authors briefly speculate on the current status of the lowest mass scalar mesons and discuss how experiment can resolve the unanswered issues. 30 references, 6 figures, 1 table

  20. Techniques in meson spectroscopy

    International Nuclear Information System (INIS)

    This report contains lectures on the following topics: the quark model and beyond using quantum chromodynamics; analysis of formation reactions; energy dependence of the partial wave amplitudes; where the data for the t-matrix analysis comes from; and coupled channel analysis of isoscalar mesons

  1. Glueball-meson mixing

    Energy Technology Data Exchange (ETDEWEB)

    Vento, Vicente [Consejo Superior de Investigaciones Cientificas, Departamento de Fisica Teorica y Instituto de Fisica Corpuscular, Universidad de Valencia, Burjassot (Spain)

    2016-01-15

    Calculations in unquenched QCD for the scalar glueball spectrum have confirmed previous results of Gluodynamics finding a glueball at ∝1750 MeV. I analyze the implications of this discovery from the point of view of glueball-meson mixing in light of the experimental scalar spectrum. (orig.)

  2. Chi-Nu Level 2 Review

    Energy Technology Data Exchange (ETDEWEB)

    Haight, Robert Cameron [Los Alamos National Laboratory; Lee, Hye Young [Los Alamos National Laboratory; Mosby, Shea Morgan [Los Alamos National Laboratory; O' Donnell, John M. [Los Alamos National Laboratory; Solomon, Clell Jeffrey Jr. [Los Alamos National Laboratory; Taddeucci, Terry Nicholas [Los Alamos National Laboratory; Fotiadis, Nikolaos [Los Alamos National Laboratory; Devlin, Matthew James [Los Alamos National Laboratory; Ullmann, John Leonard [Los Alamos National Laboratory; Bredeweg, Todd Allen [Los Alamos National Laboratory; Jandel, Marian [Los Alamos National Laboratory; Nelson, Ronald Owen [Los Alamos National Laboratory; Wender, Stephen Arthur [Los Alamos National Laboratory; Neudecker, Denise [Los Alamos National Laboratory; Rising, Michael Evan [Los Alamos National Laboratory; White, Morgan Curtis [Los Alamos National Laboratory; Wu, Ching-Yen [Los Alamos National Laboratory; Bucher, Brian Michael [Los Alamos National Laboratory; Buckner, Matthew Quinn [Los Alamos National Laboratory; Henderson, Roger Alan [Los Alamos National Laboratory

    2015-09-18

    This series of slides presents information on Chi-Nu measurements and analysis of prompt fission neutron spectra (PFNS) for neutron energy below 1 MeV for 235U. A key focus of the Chi-Nu measurement is to address the energy dependence of the low-energy emissions. The 235U PFNS evaluation is in progress. Chi-Nu delivered preliminary experimental data and input for part of the old experimental data base. The 239Pu PFNS evaluation is finalized and submitted for testing. Data from 252Cf spontaneous fission will also be obtained.

  3. Study of \\chi_{bJ}(1P) Properties in the Radiative \\Upsilon(2S) Decays

    CERN Document Server

    Abdesselam, A; Adamczyk, K; Aihara, H; Said, S Al; Arinstein, K; Arita, Y; Asner, D M; Aso, T; Atmacan, H; Aulchenko, V; Aushev, T; Ayad, R; Aziz, T; Babu, V; Badhrees, I; Bahinipati, S; Bakich, A M; Bala, A; Ban, Y; Bansal, V; Barberio, E; Barrett, M; Bartel, W; Bay, A; Bedny, I; Behera, P; Belhorn, M; Belous, K; Berger, M; Besson, D; Bhardwaj, V; Bhuyan, B; Biswal, J; Bloomfield, T; Blyth, S; Bobrov, A; Bondar, A; Bonvicini, G; Bookwalter, C; Boulahouache, C; Bozek, A; Bračko, M; Breibeck, F; Brodzicka, J; Browder, T E; Waheed, E; Červenkov, D; Chang, M -C; Chang, P; Chao, Y; Chekelian, V; Chen, A; Chen, K -F; Chen, P; Cheon, B G; Chilikin, K; Chistov, R; Cho, K; Chobanova, V; Choi, S -K; Choi, Y; Cinabro, D; Crnkovic, J; Dalseno, J; Danilov, M; Dash, N; Di Carlo, S; Dingfelder, J; Doležal, Z; Dossett, D; Drásal, Z; Drutskoy, A; Dubey, S; Dutta, D; Dutta, K; Eidelman, S; Epifanov, D; Esen, S; Farhat, H; Fast, J E; Feindt, M; Ferber, T; Frey, A; Frost, O; Fulsom, B G; Gaur, V; Gabyshev, N; Ganguly, S; Garmash, A; Getzkow, D; Gillard, R; Giordano, F; Glattauer, R; Goh, Y M; Goldenzweig, P; Golob, B; Greenwald, D; Perdekamp, M Grosse; Grygier, J; Grzymkowska, O; Guo, H; Haba, J; Hamer, P; Han, Y L; Hara, K; Hara, T; Hasegawa, Y; Hasenbusch, J; Hayasaka, K; Hayashii, H; He, X H; Heck, M; Hedges, M T; Heffernan, D; Heider, M; Heller, A; Higuchi, T; Himori, S; Hirose, S; Horiguchi, T; Hoshi, Y; Hoshina, K; Hou, W -S; Hsiung, Y B; Hsu, C -L; Huschle, M; Hyun, H J; Igarashi, Y; Iijima, T; Imamura, M; Inami, K; Inguglia, G; Ishikawa, A; Itagaki, K; Itoh, R; Iwabuchi, M; Iwasaki, M; Iwasaki, Y; Iwata, S; Jacobs, W W; Jaegle, I; Jeon, H B; Joffe, D; Jones, M; Joo, K K; Julius, T; Kakuno, H; Kang, J H; Kang, K H; Kapusta, P; Kataoka, S U; Kato, E; Kato, Y; Katrenko, P; Kawai, H; Kawasaki, T; Keck, T; Kichimi, H; Kiesling, C; Kim, B H; Kim, D Y; Kim, H J; Kim, H -J; Kim, J B; Kim, J H; Kim, K T; Kim, M J; Kim, S H; Kim, S K; Kim, Y J; Kinoshita, K; Kleinwort, C; Klucar, J; Ko, B R; Kobayashi, N; Koblitz, S; Kodyš, P; Koga, Y; Korpar, S; Kotchetkov, D; Kouzes, R T; Križan, P; Krokovny, P; Kronenbitter, B; Kuhr, T; Kulasiri, L; Kumar, R; Kumita, T; Kurihara, E; Kuroki, Y; Kuzmin, A; Kvasnička, P; Kwon, Y -J; Lai, Y -T; Lange, J S; Lee, D H; Lee, I S; Lee, S -H; Leitgab, M; Leitner, R; Levit, D; Lewis, P; Li, C H; Li, H; Li, J; Li, L; Li, X; Li, Y; Gioi, L Li; Libby, J; Limosani, A; Liu, C; Liu, Y; Liu, Z Q; Liventsev, D; Loos, A; Louvot, R; Lubej, M; Lukin, P; Luo, T; MacNaughton, J; Masuda, M; Matsuda, T; Matvienko, D; Matyja, A; McOnie, S; Mikami, Y; Miyabayashi, K; Miyachi, Y; Miyake, H; Miyata, H; Miyazaki, Y; Mizuk, R; Mohanty, G B; Mohanty, S; Mohapatra, D; Moll, A; Moon, H K; Mori, T; Morii, T; Moser, H -G; Müller, T; Muramatsu, N; Mussa, R; Nagamine, T; Nagasaka, Y; Nakahama, Y; Nakamura, I; Nakamura, K R; Nakano, E; Nakano, H; Nakano, T; Nakao, M; Nakayama, H; Nakazawa, H; Nanut, T; Nath, K J; Natkaniec, Z; Nayak, M; Nedelkovska, E; Negishi, K; Neichi, K; Ng, C; Niebuhr, C; Niiyama, M; Nisar, N K; Nishida, S; Nishimura, K; Nitoh, O; Nozaki, T; Ogawa, A; Ogawa, S; Ohshima, T; Okuno, S; Olsen, S L; Ono, Y; Onuki, Y; Ostrowicz, W; Oswald, C; Ozaki, H; Pakhlov, P; Pakhlova, G; Pal, B; Palka, H; Panzenböck, E; Park, C -S; Park, C W; Park, H; Park, K S; Paul, S; Peak, L S; Pedlar, T K; Peng, T; Pesántez, L; Pestotnik, R; Peters, M; Petrič, M; Piilonen, L E; Poluektov, A; Prasanth, K; Prim, M; Prothmann, K; Pulvermacher, C; Purohit, M V; Rauch, J; Reisert, B; Ribežl, E; Ritter, M; Röhrken, M; Rorie, J; Rostomyan, A; Rozanska, M; Rummel, S; Ryu, S; Sahoo, H; Saito, T; Sakai, K; Sakai, Y; Sandilya, S; Santel, D; Santelj, L; Sanuki, T; Sasao, N; Sato, Y; Savinov, V; Schlüter, T; Schneider, O; Schnell, G; Schönmeier, P; Schram, M; Schwanda, C; Schwartz, A J; Schwenker, B; Seidl, R; Seino, Y; Semmler, D; Senyo, K; Seon, O; Seong, I S; Sevior, M E; Shang, L; Shapkin, M; Shebalin, V; Shen, C P; Shibata, T -A; Shibuya, H; Shinomiya, S; Shiu, J -G; Shwartz, B; Sibidanov, A; Simon, F; Singh, J B; Sinha, R; Smerkol, P; Sohn, Y -S; Sokolov, A; Soloviev, Y; Solovieva, E; Stanič, S; Starič, M; Steder, M; Strube, J F; Stypula, J; Sugihara, S; Sugiyama, A; Sumihama, M; Sumisawa, K; Sumiyoshi, T; Suzuki, K; Suzuki, K; Suzuki, S; Suzuki, S Y; Suzuki, Z; Takeichi, H; Takizawa, M; Tamponi, U; Tanaka, M; Tanaka, S; Tanida, K; Taniguchi, N; Taylor, G N; Tenchini, F; Teramoto, Y; Tikhomirov, I; Trabelsi, K; Trusov, V; Tse, Y F; Tsuboyama, T; Uchida, M; Uchida, T; Uehara, S; Ueno, K; Uglov, T; Unno, Y; Uno, S; Uozumi, S; Urquijo, P; Ushiroda, Y; Usov, Y; Vahsen, S E; Van Hulse, C; Vanhoefer, P; Varner, G; Varvell, K E; Vervink, K; Vinokurova, A; Vorobyev, V; Vossen, A; Wagner, M N; Waheed, E; Wang, C H; Wang, J; Wang, M -Z; Wang, P; Wang, X L; Watanabe, M; Watanabe, Y; Wedd, R; Wehle, S; White, E; Widmann, E; Wiechczynski, J; Williams, K M; Won, E; Yabsley, B D; Yamada, S; Yamamoto, H; Yamaoka, J; Yamashita, Y; Yamauchi, M; Yashchenko, S; Ye, H; Yelton, J; Yook, Y; Yuan, C Z; Yusa, Y; Zhang, C C; Zhang, L M; Zhang, Z P; Zhao, L; Zhilich, V; Zhukova, V; Zhulanov, V; Ziegler, M; Zivko, T; Zupanc, A; Zwahlen, N; Zyukova, O

    2016-01-01

    We report a study of radiative decays of \\chi_{bJ}(1P)(J=0,1,2) mesons into 74 hadronic final states comprising charged and neutral pions, kaons, protons; out of these, 41 modes are observed with at least 5 standard deviation significance. Our measurements not only improve the previous measurements by the CLEO Collaboration but also lead to first observations in many new modes. The large sample allows us to probe the total decay width of the \\chi_{b0}(1P). In the absence of a statistically significant result, a 90% confidence-level upper limit is set on the width at \\Gamma_{total}< 2.4 MeV. Our results are based on 24.7 fb^{-1} of e+e- collision data recorded by the Belle detector at the \\Upsilon(2S) resonance, corresponding to (157.8\\pm3.6)\\times10^6 \\Upsilon(2S) decays.

  4. Effective Field Theory and $\\chi$pt

    OpenAIRE

    Holstein, Barry R.

    2000-01-01

    A brief introduction to the subject of chiral perturbation theory ($\\chi$pt) is given, including a discussion of effective field theory and application to the upcoming Bates virtual Compton scattering measurement.

  5. Bottomonium Mesons and Strategies for Their Observation

    CERN Document Server

    Godfrey, Stephen

    2015-01-01

    The B-factories and Large Hadron Collider experiments have demonstrated the ability to observe and measure the properties of bottomonium mesons. In order to discover missing states it is useful to know their properties to develop a successful search strategy. To this end we calculate the masses and decay properties of excited bottomonium states. We use the relativized quark model to calculate the masses and wavefunctions which are used to calculate the decay properties. The open bottom decay widths are calculated using the $^3P_0$ model. We also summarize results for radiative transitions, annihilation decays, hadronic transitions and production cross sections which are used to develop strategies to find these states. We find that the $b\\bar{b}$ system has a rich spectroscopy that we expect to be substantially extended by the LHC and $e^+e^-$ experiments in the near future. Some of the most promising possibilities at the LHC are observing the $\\chi_{b(1,2)}(3P)$, $\\chi_{b(1,2)}(4P)$ and $\\eta_b(3S)$ states in...

  6. Exclusive and inclusive decays of B mesons into Ds mesons

    International Nuclear Information System (INIS)

    We have studied the production of Ds mesons in the decays of B mesons at the Υ(4S) resonance. We report on the first observation of exclusive B-meson decays B→Ds-D*+, B→Ds-D+, and B→Ds-D0. We also present a new measurement of the branching ratio and the momentum spectrum for the inclusive decay B→DsX

  7. Search for the Z_1(4050)^+ and Z_2(4250)^+ States in bar B^0 to chi_{c1} K^- pi^+ and B^+ to chi_{c1} K^0_S pi^+

    Energy Technology Data Exchange (ETDEWEB)

    Lees, J.P.; Poireau, V.; Tisserand, V.; /Annecy, LAPP; Garra Tico, J.; Grauges, E.; /Barcelona U., ECM; Martinelli, M.; /INFN, Bari /Bari U.; Milanes, D.A.; /INFN, Bari; Palano, A.; Pappagallo, M.; /INFN, Bari /Bari U.; Eigen, G.; Stugu, B.; /Bergen U.; Brown, D.N.; Kerth, L.T.; Kolomensky, Yu.G.; Lynch, G.; /UC, Berkeley; Koch, H.; Schroeder, T.; /Ruhr U., Bochum; Asgeirsson, D.J.; Hearty, C.; Mattison, T.S.; McKenna, J.A.; /British Columbia U. /Brunel U. /Novosibirsk, IYF /UC, Irvine /UC, Riverside /UC, Santa Barbara /UC, Santa Cruz /Caltech /Cincinnati U. /Colorado U. /Colorado State U. /Dortmund U. /Dresden, Tech. U. /Ecole Polytechnique /Edinburgh U. /INFN, Ferrara /Ferrara U. /INFN, Ferrara /Ferrara U. /INFN, Ferrara /Frascati /INFN, Genoa /Genoa U. /INFN, Genoa /INFN, Genoa /Genoa U. /INFN, Genoa /Indian Inst. Tech., Guwahati /Harvard U. /Harvey Mudd Coll. /Heidelberg U. /Humboldt U., Berlin /Imperial Coll., London /Iowa State U. /Iowa State U. /Johns Hopkins U. /Paris U., VI-VII /LLNL, Livermore /Liverpool U. /Queen Mary, U. of London /Royal Holloway, U. of London /Royal Holloway, U. of London /Louisville U. /Mainz U., Inst. Kernphys. /Manchester U. /Maryland U. /Massachusetts U., Amherst /MIT /McGill U. /INFN, Milan /Milan U. /Mississippi U. /Montreal U. /INFN, Naples /Naples U. /NIKHEF, Amsterdam /NIKHEF, Amsterdam /Notre Dame U. /Ohio State U. /Oregon U. /INFN, Padua /Padua U. /INFN, Padua /INFN, Padua /Padua U. /Paris U., VI-VII /INFN, Perugia /Perugia U. /INFN, Pisa /Pisa U. /INFN, Pisa /Pisa, Scuola Normale Superiore /INFN, Pisa /Pisa U. /INFN, Pisa /INFN, Pisa /Pisa U. /INFN, Pisa /Princeton U. /INFN, Rome /INFN, Rome /Rome U. /INFN, Rome /INFN, Rome /Rome U. /INFN, Rome /Rostock U. /Rutherford /DAPNIA, Saclay /SLAC /South Carolina U. /Southern Methodist U. /Stanford U., Phys. Dept. /SUNY, Albany /Tel Aviv U. /Tennessee U. /Texas Nuclear Corp., Austin /Texas U., Dallas /INFN, Turin /Turin U. /INFN, Trieste /Trieste U. /Valencia U. /Victoria U. /Warwick U. /Wisconsin U., Madison

    2012-04-10

    We search for the Z{sub 1}(4050){sup +} and Z{sub 2}(4250){sup +} states, reported by the Belle Collaboration, decaying to {chi}{sub c1}{pi}{sup +} in the decays {bar B}{sup 0} {yields} {chi}{sub c1}K{sup -}{pi}{sup +} and B{sup +} {yields} {chi}{sub c1}K{sub S}{sup 0}{pi}{sup +} where {chi}{sub c1} {yields} J/{psi}{gamma}. The data were collected with the BABAR detector at the SLAC PEP-II asymmetric-energy e{sup +}e{sup -} collider operating at center-of-mass energy 10.58 GeV, and correspond to an integrated luminosity of 429 fb{sup -1}. In this analysis, we model the background-subtracted, efficiency-corrected {chi}{sub c1}{pi}{sup +} mass distribution using the K{pi} mass distribution and the corresponding normalized K{pi} Legendre polynomial moments, and then test the need for the inclusion of resonant structures in the description of the {chi}{sub c1}{pi}{sup +} mass distribution. No evidence is found for the Z{sub 1}(4050){sup +} and Z{sub 2}(4250){sup +} resonances, and 90% confidence level upper limits on the branching fractions are reported for the corresponding B-meson decay modes.

  8. $f_0(500)$, $f_0(980)$ and $a_0(980)$ production in the $\\chi_{c1} \\to \\eta \\pi^+\\pi^-$ reaction

    CERN Document Server

    Liang, Wei-Hong; Oset, E

    2016-01-01

    We study the $\\chi_{c1} \\to \\eta \\pi^+ \\pi^-$ decay, paying attention to the production of $f_0(500)$, $f_0(980)$ and $a_0(980)$ from the final state interaction of pairs of mesons that can lead to these three mesons in the final state, which is implemented using the chiral unitary approach. Very clean and strong signals are obtained for the $a_0(980)$ excitation in the $\\eta \\pi$ invariant mass distribution and for the $f_0(500)$ in the $\\pi^+ \\pi^-$ mass distribution. A smaller, but also clear signal for the $f_0(980)$ excitation is obtained. The results are contrasted with experimental data and the agreement found is good, providing yet one more test in support of the picture where these resonances are dynamically generated from the meson-meson interaction.

  9. Light Meson Distribution Amplitudes

    CERN Document Server

    Arthur, R; Brommel, D; Donnellan, M A; Flynn, J M; Juttner, A; de Lima, H Pedroso; Rae, T D; Sachrajda, C T; Samways, B

    2010-01-01

    We calculated the first two moments of the light-cone distribution amplitudes for the pseudoscalar mesons ($\\pi$ and $K$) and the longitudinally polarised vector mesons ($\\rho$, $K^*$ and $\\phi$) as part of the UKQCD and RBC collaborations' $N_f=2+1$ domain-wall fermion phenomenology programme. These quantities were obtained with a good precision and, in particular, the expected effects of $SU(3)$-flavour symmetry breaking were observed. Operators were renormalised non-perturbatively and extrapolations to the physical point were made, guided by leading order chiral perturbation theory. The main results presented are for two volumes, $16^3\\times 32$ and $24^3\\times 64$, with a common lattice spacing. Preliminary results for a lattice with a finer lattice spacing, $32^3\\times64$, are discussed and a first look is taken at the use of twisted boundary conditions to extract distribution amplitudes.

  10. Decays of B mesons

    International Nuclear Information System (INIS)

    According to the Standard Model of six quarks and six leptons, the charged-current decays of quarks can couple any of the up quarks, u, c, or t, to any of the down quarks, d, s, or b. Several of these couplings can be measured only in B-meson decays. It is important to measure them accurately in order to expand our knowledge of the model, to test its validity, and more importantly, to take us to a formulation of what is beyond. In the paper, the authors review the measurements that have been made on the weak decays of B mesons and discuss their implications for the matrix of quark couplings

  11. Meson Spectroscopy without Tetraquarks

    CERN Document Server

    Bugg, D V

    2011-01-01

    Data on e+e- -> piplus-piminus-Upsilon(1S,2S,3S) show a large increase in branching fractions near Upsilon(10860). A suggestion of Ali et al. is to interpret this as evidence for a tetraquark, Yb(10890) = b-bbar. However, it may also be interpreted in terms of Upsilon(10860) -> B-B*, B*B* and BsB*s above the open-b threshold, followed by de-excitation processes such as $BB* -> Upsilon (1S,2S,3S). In the charm sector, a hypothesis open to experimental test is that X,Y and Z peaks in the mass range 3872 to 3945 MeV may all be due to regular 3P1 and 3P2 c-cbar states (and perhaps 3P0) mixed with meson-meson.

  12. Note on scalar mesons

    OpenAIRE

    Törnqvist, N. A.; Spanier, S.(University of Tennessee, Knoxville, USA); Amsler, C

    2008-01-01

    This biennial Review summarizes much of particle physics. Using data from previous editions, plus 2778 new measurements from 645 papers, we list, evaluate, and average measured properties of gauge bosons, leptons, quarks, mesons, and baryons. We also summarize searches for hypothetical particles such as Higgs bosons, heavy neutrinos, and supersymmetric particles. All the particle properties and search limits are listed in Summary Tables. We also give numerous tables, figures, formulae, and re...

  13. The scalar meson enigma

    International Nuclear Information System (INIS)

    The nature of the scalar mesons in the 1 GeV region is studied. Analysis of all high statistics data in the neighbourhood of Kanti K threshold, in particular the fine-binned spectra on ψ → φ(ππ), φ(Kanti K) from DM2 and Mark III, indicate in an almost model-independent way that the f0(S*) is not a Kanti K molecule. (orig.)

  14. Exotic meson challenges rules

    International Nuclear Information System (INIS)

    A heavy particle with an unusual decay pattern discovered by the Belle experiment at KEK in Japan is the latest addition to the meson family tree. If we had to name a modern-day Mendeleev, his name would surely be Murray Gell-Mann. In the 1960s, faced with a bewildering array of particles called hadrons that had been turning up in high-energy experiments around the world, Gell-Mann proposed that the particles were combinations of a few fundamental entities called quarks. This idea brought order into the hadronic chaos, a feat for which Gell-Man was awarded the 1969 Nobel Prize for Physics. Ever since the quark model was introduced, physicists have wanted to find out how the six different types of quarks - up (u), down (d), strange (s), charm (c), bottom (b) and top (t) - combine to form the hadrons we observe. The simple hadronic structures that we see are easy to define: mesons such as pions and kaons consist of a quark and an antiquark pair, while baryons such as protons and neutrons are made up of three quarks or three antiquarks. But the theory that describes quarks, quantum chromodynamics (QCD), also permits particles containing four or more quarks. Indeed, a meson can be more generally defined as a hadron that has an integer value of intrinsic angular momentum in quantum units, while baryons have half-integer multiples of spin. Discovering such exotic hadrons, particularly mesons with more than the minimal quark-antiquark structure, would therefore provide crucial information for our understanding of the strong force. In fact, physicists thought they had glimpsed a five-quark state called a 'pentaquark' in 2003. Sadly this excitement looks as if it was misplaced, since the latest results from dedicated experimental searches suggest that pentaquarks are a purely statistical phenomenon (see Physics World May p7: print edition only). (U.K.)

  15. Vector meson production and nuclear effects in FNAL E866

    Energy Technology Data Exchange (ETDEWEB)

    Leitch, M.J.; E866/NUSEA Collaboration

    1998-12-31

    Fermilab E866/NUSEA is a fixed-target experiment which has made a number of measurements of the production of vector mesons by 800 GeV protons. The nuclear dependence results include measurements for J/{psi}, {psi}{prime} and {phi} production over very broad ranges in {chi}{sub F} and p{sub T}, and the J/{psi} decay angular distribution at very large {chi}{sub F}. Preliminary results from measurements on Be, Fe and W targets are presented and discussed in the context of nuclear effects such as energy loss and multiple scattering of the partons, absorption of the produced c{bar c} pairs, and shadowing. Production mechanisms involving color-singlet or color-octet states for the c{bar c} pair which eventually forms a J/{psi} or {psi}{prime}, have implications on the strength of absorption in the nucleus and on the angular distribution of the decay muons. Their preliminary results on the angular distributions versus {chi}{sub F} and p{sub T} indicate some transverse polarization of the J/{psi} as predicted by models of production through the color octet state. The measurements of dimuons in the 1 to 3 GeV region explore the nuclear dependence of the {phi} meson and also the composition of the continuum between the {phi} and the J/{psi}. These studies of vector meson production and it`s nuclear dependence are critical in furthering the understanding of these processes towards future measurements at RHIC and new results from NA50 at CERN, where J/{psi} suppression is predicted to be an important signature of the creation of quark-gluon plasma in heavy-ion collisions.

  16. Heavy meson production at HERA

    Directory of Open Access Journals (Sweden)

    Figiel Jan

    2014-01-01

    Full Text Available The copious production of charm mesons at HERA has allowed QCD to be probed in open charm and charm vector meson production. Elastic and proton-dissociatve photoproduction of J/ψ mesons have been measured at HERA. The data are compared to other measurements and the W and t dependences are parametrised using phenomenological fits. The ψ (2S state has also been measured exclusively and the ratio of its production rate to J/ψ mesons presented as a function of the kinematic variables. Inelastic production of J/ψ and ψ(2S mesons gives insight into non-relativistic QCD and final results are presented here. Open charm production has been measured in order to better understand the fragmentation process of charm mesons as well as giving insight into the structure of the proton.

  17. Future prospects for exotic mesons

    International Nuclear Information System (INIS)

    A brief description is given of the current status of exotic mesons produced in π-p interactions at 18 GeV/c-carried out with the BNL multiparticle spectrometer. The next logical step in our endeavor to understand the gluonic degrees of freedom in mesons is to extend the search for exotic mesons with hidden strangeness in K-p interactions at beam momenta in the range 15 to 25 GeV/c. (orig.)

  18. Heavy meson in nuclear medium

    CERN Document Server

    Tolos, L; Garcia-Recio, C; Molina, R; Nieves, J; Oset, E; Ramos, A

    2010-01-01

    The properties of charmed mesons in dense matter are studied using a unitary coupled-channel approach in the nuclear medium which takes into account Pauli-blocking effects and meson self-energies in a self-consistent manner. We obtain the open-charm meson spectral functions in this dense nuclear environment, and discuss their implications on hidden charm and charm scalar resonances and on the formation of $D$-mesic nuclei at FAIR.

  19. MIXING AND CP VIOLATION IN D MESONS

    OpenAIRE

    Yaouanc, A. Le; Oliver, L.; Pène, O; Raynal, J. -C.

    1995-01-01

    We review mixing and CP violation in $D$ mesons, emphasizing the differences with the other pseudoscalar mesons in the Standard Model, and show that $D$ mesons can be useful to look for physics beyond the Standard Model.

  20. Charmed mesons in nuclear matter

    CERN Document Server

    Tolos, L; Garcia-Recio, C; Oset, E; Molina, R; Nieves, J; Ramos, A

    2010-01-01

    We obtain the properties of charmed mesons in dense matter using a coupled-channel approach which accounts for Pauli blocking effects and meson self-energies in a self-consistent manner. We study the behaviour of dynamically-generated baryonic resonances together with the open-charm meson spectral functions in this dense nuclear environment. We discuss the implications of the in-medium properties of open-charm mesons on the $D_{s0}(2317)$ and the predicted X(3700) scalar resonances, and on the formation of $D$-mesic nuclei.

  1. Rare B Meson Decays With Omega Mesons

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Lei; /Colorado U.

    2006-04-24

    Rare charmless hadronic B decays are particularly interesting because of their importance in understanding the CP violation, which is essential to explain the matter-antimatter asymmetry in our universe, and of their roles in testing the ''effective'' theory of B physics. The study has been done with the BABAR experiment, which is mainly designed for the study of CP violation in the decays of neutral B mesons, and secondarily for rare processes that become accessible with the high luminosity of the PEP-II B Factory. In a sample of 89 million produced B{bar B} pairs on the BABAR experiment, we observed the decays B{sup 0} {yields} {omega}K{sup 0} and B{sup +} {yields} {omega}{rho}{sup +} for the first time, made more precise measurements for B{sup +} {yields} {omega}h{sup +} and reported tighter upper limits for B {yields} {omega}K* and B{sup 0} {yields} {omega}{rho}{sup 0}.

  2. $\\chi_{c1}$ and $\\chi_{c2}$ production at $e^+e^-$ colliders

    CERN Document Server

    Czyz, Henryk; Tracz, Szymon

    2016-01-01

    Direct, resonant production of the charmonium states $\\chi_{c1}$ and $\\chi_{c2}$ in electron-positron annihilation is investigated. Depending on details of the model, a sizeable variation of the prediction for the production cross section is anticipated. It is demonstrated that resonant production could be observed under favorable circumstances.

  3. Exotic mesons: status and future

    OpenAIRE

    Klempt, Eberhard

    2007-01-01

    The evidence for the existence of mesons with exotic quantum numbers and of hybrid candidates with non-exotic quantum numbers is critically reviewed, including candidates with hidden charm. Aims and methods of future searches for hybrid mesons are briefly discussed.

  4. Mesonic theory of effective forces

    International Nuclear Information System (INIS)

    The construction of nucleon-nucleon effective interaction on base of meson theory of nuclear forces is considered. The dependence of effective force parameters from coupling constants and masses of the exchange mesons is investigated. The results of nuclear matter calculations are presented. 36 refs.; 9 figs.; 2 tabs

  5. Exotic meson spectroscopy with CLAS

    Energy Technology Data Exchange (ETDEWEB)

    Adams, G.; Napolitano, J. [Rensselaer Polytechnic Inst., Troy, NY (United States)

    1994-04-01

    The identification and study of mesons with explicit gluonic degrees of freedom will provide major constraints on nonperturbative QCD and models thereof. CLAS will provide a unique opportunity for studying these resonances by measuring photoproduction of multi-meson final states.

  6. B decays into light mesons

    International Nuclear Information System (INIS)

    The author calculates the form factors describing semileptonic and penguin induced decays of B mesons into light pseudoscalar and vector mesons. The form factors are calculated from QCD sum rules on the light-cone including contributions up to twist 4, radiative corrections to the leading twist contribution and SU(3) breaking effects. The theoretical uncertainty is estimated to be tilde (15--20)%

  7. The light meson spectroscopy program

    Directory of Open Access Journals (Sweden)

    Smith Elton S.

    2014-06-01

    Full Text Available Recent discoveries of a number of unexpected new charmomium-like meson states at the BaBar and Belle B-factories have demonstrated how little is still known about meson spectroscopy. In this talk we will review recent highlights of the light quark spectroscopy from collider and fixed target experiments.

  8. Meson Resonances from Lattice QCD

    Energy Technology Data Exchange (ETDEWEB)

    Edwards, Robert G. [Thomas Jefferson National Accelerator Facility (TJNAF), Newport News, VA (United States)

    2016-06-01

    There has been recent, significant, advances in the determination of the meson spectrum of QCD. Current efforts have focused on the development and application of finite-volume formalisms that allow for the determination of scattering amplitudes as well as resonance behavior in coupled channel systems. I will review some of these recent developments, and demonstrate the viability of the method in meson systems.

  9. Meson resonances on the lattice

    Energy Technology Data Exchange (ETDEWEB)

    Edwards, Robert G. [Thomas Jefferson National Accelerator Facility (TJNAF), Newport News, VA (United States)

    2016-06-01

    There has been recent, significant, advances in the determination of the meson spectrum of QCD. Current efforts have focused on the development and application of finite-volume formalisms that allow for the determination of scattering amplitudes as well as resonance behavior in coupled channel systems. I will review some of these recent developments, and demonstrate the viability of the method in meson systems

  10. K^* Mesons and Nucleon Strangeness

    OpenAIRE

    Barz, L. L.; Forkel, H.; Hammer, H. -W.; Navarra, F. S.; Nielsen, M; Ramsey-Musolf, M. J.

    1998-01-01

    We study contributions to the nucleon strange quark vector current form factors from intermediate states containing K^* mesons. We show how these contributions may be comparable in magnitude to those made by K mesons, using methods complementary to those employed in quark model studies. We also analyze the degree of theoretical uncertainty associated with K^* contributions.

  11. The light meson spectroscopy program

    Energy Technology Data Exchange (ETDEWEB)

    Smith, Elton S. [JLAB

    2014-06-01

    Recent discoveries of a number of unexpected new charmomium-like meson states at the BaBar and Belle B-factories have demonstrated how little is still known about meson spectroscopy. In this talk we will review recent highlights of the light quark spectroscopy from collider and fixed target experiments.

  12. Heavy meson fragmentation at LHC

    Directory of Open Access Journals (Sweden)

    M. A. Gomshi Nobary

    2003-06-01

    Full Text Available   Large Hadron Collider (LHC at CERN will provide excellent opportunity to study the production and decay of heavy mesons and baryons with high statistics. We aim at the heavy mesons in this work and calculate their fragmentation functions consistent with this machine and present their total fragmentation probabilities and average fragmentation parameters.

  13. Lifetimes of charmed mesons

    International Nuclear Information System (INIS)

    Using the ARGUS detector at the e+e- storage ring DORIS II at DESY, we have measured the lifetimes of the D0, D+ and Ds+ mesons. We find τsub(D0) = (4.8±0.4±0.3)x10-13 s, τsub(D+) = (10.5±0.8±0.7)x10-13 s and τsub(Ds+) = (5.6-1.2+1.3±0.8)x10.13s. (orig.)

  14. Photoproduction of Hybrid Mesons

    OpenAIRE

    Barnes, T.

    1999-01-01

    In this contribution I discuss prospects for photoproducing hybrid mesons at CEBAF, based on recent model results and experimental indications of possible hybrids. One excellent opportunity appears to be a search for the I=1, JPC=2+-, neutral "(b2)o" hybrid in (a2 pi)o through diffractive photoproduction. Other notable possibilities accessible through pi+ or pio exchange photoproduction are I=1, JPC=1-+, charged "pi1+" in f1 pi+, (b1 pi)+ and (rho pi)+; piJ(1770)+ in f2 pi+ and (b1 pi)+; pi(1...

  15. Physics opportunities with meson beams

    Energy Technology Data Exchange (ETDEWEB)

    Briscoe, William J.; Doering, Michael; Haberzettl, Helmut; Strakovsky, Igor I. [The George Washington University, Washington, DC (United States); Manley, D.M. [Kent State University, Kent, OH (United States); Naruki, Megumi [Kyoto University, Kyoto (Japan); Swanson, Eric S. [University of Pittsburgh, Pittsburgh, PA (United States)

    2015-10-15

    Over the past two decades, meson photo- and electroproduction data of unprecedented quality and quantity have been measured at electromagnetic facilities worldwide. By contrast, the meson-beam data for the same hadronic final states are mostly outdated and largely of poor quality, or even non-existent, and thus provide inadequate input to help interpret, analyze, and exploit the full potential of the new electromagnetic data. To reap the full benefit of the high-precision electromagnetic data, new high-statistics data from measurements with meson beams, with good angle and energy coverage for a wide range of reactions, are critically needed to advance our knowledge in baryon and meson spectroscopy and other related areas of hadron physics. To address this situation, a state-of-the-art meson-beam facility needs to be constructed. The present paper summarizes unresolved issues in hadron physics and outlines the vast opportunities and advances that only become possible with such a facility. (orig.)

  16. Physics Opportunities with Meson Beams

    CERN Document Server

    Briscoe, William J; Haberzettl, Helmut; Manley, D Mark; Naruki, Megumi; Strakovsky, Igor I; Swanson, Eric S

    2015-01-01

    Over the past two decades, meson photo- and electro-production data of unprecedented quality and quantity have been measured at electromagnetic facilities worldwide. By contrast, the meson-beam data for the same hadronic final states are mostly outdated and largely of poor quality, or even nonexistent, and thus provide inadequate input to help interpret, analyze, and exploit the full potential of the new electromagnetic data. To reap the full benefit of the high-precision electromagnetic data, new high-statistics data from measurements with meson beams, with good angle and energy coverage for a wide range of reactions, are critically needed to advance our knowledge in baryon and meson spectroscopy and other related areas of hadron physics. To address this situation, a state of-the-art meson-beam facility needs to be constructed. The present paper summarizes unresolved issues in hadron physics and outlines the vast opportunities and advances that only become possible with such a facility.

  17. Gain Shift Corrections at Chi-Nu

    Energy Technology Data Exchange (ETDEWEB)

    Brown, Tristan Brooks [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Univ. of Massachusetts, Lowell, MA (United States). Dept. of Physics and Applied Physics; Devlin, Matthew James [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2016-08-30

    Ambient conditions have the potential to cause changes in liquid scintillator detector gain that vary with time and temperature. These gain shifts can lead to poor resolution in both energy as well as pulse shape discrimination. In order to correct for these shifts in the Chi-Nu high energy array, a laser system has been developed for calibration of the pulse height signals.

  18. Tai Chi, Qi Gong and Reiki.

    Science.gov (United States)

    Chu, Dennis A

    2004-11-01

    Tai Chi, Qi Gong, and Reiki are complementary therapies that are gaining popularity with patients. Although these therapies seem simple and attractive in their philosophy and are easy to apply,more objective, well-designed research is needed to prove their efficacy and to gain acceptance from the medical community. PMID:15458751

  19. Tai Chi Chuan in Medicine and Health Promotion

    OpenAIRE

    Ching Lan; Ssu-Yuan Chen; Jin-Shin Lai; Alice May-Kuen Wong

    2013-01-01

    Tai Chi Chuan (Tai Chi) is a Chinese traditional mind-body exercise and recently, it becomes popular worldwide. During the practice of Tai Chi, deep diaphragmatic breathing is integrated into body motions to achieve a harmonious balance between body and mind and to facilitate the flow of internal energy (Qi). Participants can choose to perform a complete set of Tai Chi or selected movements according to their needs. Previous research substantiates that Tai Chi has significant benefits to heal...

  20. Meson Spectroscopy at COMPASS

    CERN Document Server

    Grube, Boris

    2015-01-01

    The COmmon Muon and Proton Apparatus for Structure and Spectroscopy (COMPASS) is a multi-purpose fixed-target experiment at the CERN Super Proton Synchrotron (SPS) aimed at studying the structure and spectrum of hadrons. The two-stage spectrometer has a good acceptance for charged as well as neutral particles over a wide kinematic range and thus allows to access a wide range of reactions. Light mesons are studied with negative (mostly $\\pi^-$) and positive ($p$, $\\pi^+$) hadron beams with a momentum of 190 GeV/$c$. The spectrum of light mesons is investigated in various final states produced in diffractive dissociation reactions at squared four-momentum transfers to the target between 0.1 and 1.0 $(\\text{GeV}/c)^2$. The flagship channel is the $\\pi^-\\pi^+\\pi^-$ final state, for which COMPASS has recorded the currently largest data sample. These data not only allow to measure the properties of known resonances with high precision, but also to search for new states. Among these is a new resonance-like signal, t...

  1. Meson radiobiology and therapy

    International Nuclear Information System (INIS)

    High-linear energy transfer radiation (neutrons, heavy ions, and pions) have a greater relative biological effectiveness than low-linear energy transfer radiation by depositing a high density of ionization in irradiated cells. This overcomes the protective effect of oxygen; decreases the variation in sensitivity among the several stages of the cell cycles; and, inhibits the repair of sublethal damage as compared to x-rays, gamma rays, electrons and protons. Negative pi mesons (pions), appear particularly suited for radiation therapy as their penetration and depth-dose profiles lend themselves to shaping the high dose area to the tumor size and location. Preliminary biological experiments with pions produced at the Los Alamos Meson Physics Facility studied cell survival at various radiation depths and cell cycle sensitivity. Histologic study of data from the first human experiments indicated severe tumor cell destruction by pions as compared to x-rays in treating malignant melanoma skin nodules, without increased effects on dermal elements. (U.S.)

  2. Meson Spectroscopy at COMPASS

    CERN Document Server

    ,

    2016-01-01

    The goal of the COMPASS experiment at CERN is to study the structure and dynamics of hadrons. The two-stage spectrometer used by the experiment has large acceptance and covers a wide kinematic range for charged as well as neutral particles and can therefore measure a wide range of reactions. The spectroscopy of light mesons is performed with negative (mostly $\\pi^-$) and positive ($p$, $\\pi^+$) hadron beams with a momentum of 190 GeV/$c$. The light-meson spectrum is measured in different final states produced in diffractive dissociation reactions with squared four-momentum transfer $t$ to the target between 0.1 and 1.0 $(\\text{GeV}/c)^2$. The flagship channel is the $\\pi^-\\pi^-\\pi^+$ final state, for which COMPASS has recorded the currently world's largest data sample. These data not only allow to measure the properties of known resonances with high precision, but also to observe new states. Among these is a new axial-vector signal, the $a_1(1420)$, with unusual properties. Novel analysis techniques have been...

  3. Photon-meson transition form factors of light pseudoscalar mesons

    OpenAIRE

    Xiao, Bo-Wen; Ma, Bo-Qiang

    2005-01-01

    The photon-meson transition form factors of light pseudoscalar mesons $\\pi ^{0}$, $\\eta$, and $\\eta ^{\\prime}$ are systematically calculated in a light-cone framework, which is applicable as a light-cone quark model at low $Q^{2}$ and is also physically in accordance with the light-cone pQCD approach at large $Q^{2}$. The calculated results agree with the available experimental data at high energy scale. We also predict the low $Q^{2}$ behaviors of the photon-meson transition form factors of ...

  4. Eta'-meson as pseudoscalar gluonium

    International Nuclear Information System (INIS)

    It is proved the sum rules of quantum chromodynamics for a current constructed of the gluon field operators are saturated by the eta'-meson. The meson mass is estimated and its residue in the gluon current. There is a considerable difference between the eta'-meson as gluon and the classical quark states such as the delta-meson. (orig.)

  5. Effect of near-fault earthquake on bridges: lessons learned from Chi-Chi earthquake

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    The objective of this paper is to describe the lessons learned and actions that have been taken related to the seismicdesign of bridge structures after the Chi-Chi, Taiwan earthquake. Much variable near-fault ground motion data was collected fromthe rupture of Chelungpu fault during the Chi-Chi earthquake, allowing the seismic response of bridge structures subjected to thesenear-fault ground motions to be carefully examined. To study the near-fault ground motion effect on bridge seismic design codes, atwo-level seismic design of bridge structures was developed and implemented. This design code reflects the near-fault factors in theseismic design forces. Finally, a risk assessment methodology, based on bridge vulnerability, is also developed to assist in decisionsfor reducing seismic risk due to failure of bridges.

  6. A precursory ULF signature for the Chi-Chi earthquake in Taiwan

    Directory of Open Access Journals (Sweden)

    Y. Akinaga

    2001-01-01

    Full Text Available ULF emission data at Lunping (epicentral distance, 120 km have been analysed for the Chi-Chi earthquake (with magnitude 7.6 and depth of 11 km in Taiwan which occurred on 21 September 1999. Simple intensity analyses have not yielded any significant results but we have found, based on the analysis of polarization (the ratio of vertical magnetic field component Z to the horizontal component G, that the polarization (Z/G showed a significant enhancement for two months before the earthquake. This kind of temporal evolution of polarization seems to be very similar to previous results, so that it is highly likely that this phenomenon may be associated with the Chi-Chi earthquake. Also, the comparison of the results of polarization analyses, by changing the signal threshold, has given us an approximate intensity of the seismogenic emission of the order of the monthly mean value.

  7. Rotating strings confronting PDG mesons

    OpenAIRE

    Jacob Sonnenschein; Dorin Weissman

    2014-01-01

    We revisit the model of mesons as rotating strings with massive endpoints and confront it with meson spectra. We look at Regge trajectories both in the ( J, M 2 ) and ( n, M 2 ) planes, where J and n are the angular momentum and radial excitation number respectively. We start from states comprised of u and d quarks alone, move on to trajectories involving s and c quarks, and finally analyze the trajectories of the heaviest observed b b ¯ $$ b\\overline{b} $$ mesons. The endpoint masses provide...

  8. Existence of the critical endpoint in the vector meson extended linear sigma model

    CERN Document Server

    Kovács, Peter; Wolf, György

    2016-01-01

    The chiral phase transition of the strongly interacting matter is investigated at nonzero temperature and baryon chemical potential mu_B within an extended (2+1) flavor Polyakov constituent quark-meson model which incorporates the effect of the vector and axial vector mesons. The effect of the fermionic vacuum and thermal fluctuations computed from the grand potential of the model is taken into account in the curvature masses of the scalar and pseudoscalar mesons. The parameters of the model are determined by comparing masses and tree-level decay widths with experimental values in a chi^2-minimization procedure which selects between various possible assignments of scalar nonet states to physical particles. We examine the restoration of the chiral symmetry by monitoring the temperature evolution of condensates and the chiral partners' masses and of the mixing angles for the pseudoscalar eta-eta' and the corresponding scalar complex. We calculate the pressure and various thermodynamical observables derived from...

  9. Heavy meson spectroscopy

    International Nuclear Information System (INIS)

    In this article we give a review of certain aspects of the present understanding of spectroscopy of heavy mesons and constituent quark masses in the light of non-relativistic potential model approach motivated by quantum chromodynamics. We find that the one gluon exchange at short distance and colour-confining interaction at large distance which is pure scalar (or scalar-vector admixture with dominant scalar interaction) under the Lorentz transformation, can explain only partially the present data on 1P states of cc-bar and bb-bar states. The S-wave data, that are available at present, however can be understood with both scalar confinement or scalar-vector admixture with scalar-dominant interaction. (author). 44 refs, 13 tabs

  10. Vector mesons in matter

    Indian Academy of Sciences (India)

    Gy Wolf

    2006-04-01

    One consequence of the chiral restoration is the mixing of parity partners. We look for a possible signature of the mixing of vector and axial vector mesons in heavy-ion collisions. We suggest an experimental method for its observation. The dynamical evolution of the heavy-ion collision is described by a transport equation of QMD-type evolving nucleons, * and resonances, ’s and $\\sum$ baryons, and furthermore, ’s, ’s ’s ’s ’s and kaons with their isospin degrees of freedom. The input cross-sections and resonance parameters of the model are fitted to the available nucleon–nucleon and pion–nucleon cross-sections.

  11. A Meson Emission Model of Psi to N Nbar m Charmonium Strong Decays

    CERN Document Server

    Barnes, T; Roberts, W

    2010-01-01

    In this paper we consider a sequential "meson emission" mechanism for charmonium decays of the type Psi -> N Nbar m, where Psi is a generic charmonium state, N is a nucleon and m is a light meson. This decay mechanism, which may not be dominant in general, assumes that an NNbar pair is created during charmonium annihilation, and the light meson m is emitted from the outgoing nucleon or antinucleon line. A straightforward generalization of this model can incorporate intermediate N* resonances. We derive Dalitz plot event densities for the cases Psi = eta_c, J/psi, chi_c0, chi_c1} and psi' and m = pi0, f0 and omega (and implicitly, any 0^{-+}, 0^{++} or 1^{--} final light meson). It may be possible to separate the contribution of this decay mechanism to the full decay amplitude through characteristic event densities. For the decay subset Psi -> p pbar pi0 the two model parameters are known, so we are able to predict absolute numerical partial widths for Gamma(Psi -> p pbar pi0). In the specific case J/psi -> p ...

  12. Barbed congruence of the asymmetric chi calculus

    Institute of Scientific and Technical Information of China (English)

    DONG Xiao-ju; FU Yu-xi

    2006-01-01

    The chi calculus is a model of mobile processes. It has evolved from the pi-calculus with motivations from simplification and communication-as-cut-elimination. This paper studies the chi calculus in the framework incorporating asymmetric communication. The major feature of the calculus is the identification of two actions:x/x and τ. The investigation on the barbed bisimilarity shows how the property affects the observational theory.Based on the definition of the barbed bisimilarity, the simulation properties of the barbed bisimilarity are studied. It shows that the algebraic properties of the barbed bisimilarity have changed greatly compared with the chi calculus. Although the definition of the barbed bisimilarity is very simple, the property of closeness under contexts makes it difficult to understand the barbed bisimilarity directly. Therefore an open style definition of the barbed bisimilarity is given, which is a context free description of barbed bisimilarity. Its definition is complex,but it is a well-behaved relation for it coincides with the barbed bisimilarity. It also helps to build an axiomatization system for the barbed congruence. Besides the axioms for the strong barbed bisimilarity, the paper proposes a new tau law and four new update laws for the barbed congruence. Both the operational and algebraic properties of the enriched calculus improve the understanding of the bisimulation behaviors of the model.

  13. Meson spectroscopy with unitary coupled-channels model for heavy-meson decay into three mesons

    OpenAIRE

    Nakamura, Satoshi X.

    2012-01-01

    We develop a model for describing excited mesons decay into three mesons. The properties of the excited mesons can be extracted with this model. The model maintains the three-body unitarity that has been missed in previous data analyses based on the conventional isobar models. We study an importance of the three-body unitarity in extracting hadron properties from data. For this purpose, we use the unitary and isobar models to analyze the same pseudo data of gamma p -> pi+pi+pi-n, and extract ...

  14. An introduction to heavy mesons

    CERN Document Server

    Grinstein, B

    1995-01-01

    Introductory lectures (delivered at the VI Mexican School of Particles and Fields) on heavy quarks and heavy quark effective field theory. Applications to inclusive semileptonic decays and to interactions with light mesons are covered in detail.

  15. Dicty_cDB: CHI518 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHI518 (Link to dictyBase) - - - Contig-U11768-1 CHI518P (Link to Original ... CVRY YFKALVYSGKINKANLGMTKLPPPTKKMTKAAREALGSE--- ---skw *rnh*yqtnr*ckr*yfngscsfeccne*rskt*hcls*swscfgssnd*s ...

  16. Dicty_cDB: CHI394 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHI394 (Link to dictyBase) - - - Contig-U16405-1 CHI394P (Link to Original ... sntvedctfdasglvyypkvynlkyskktkniw*ryshywlif kiiwws*fpy *fh*ck*tfcc--- ---TTFIGVRSGPSTTLTYIKPMISEIPTIENKIEK ...

  17. Structure of exotic nuclei and superheavy elements in meson field theory

    International Nuclear Information System (INIS)

    In this work the nuclear structure of exotic nuclei and superheavy nuclei is studied in a relativistic framework. In the relativistic mean-field (RMF) approximation, the nucleons interact with each other through the exchange of various effective mesons (scalar, vector, isovector-vector). Ground state properties of exotic nuclei and superheavy nuclei are studied in the RMF theory with the three different parameter sets (ChiM,NL3,NL-Z2). Axial deformation of nuclei within two drip lines are performed with the parameter set (ChiM). The position of drip lines are investigated with three different parameter sets (ChiM,NL3,NL-Z2) and compared with the experimental drip line nuclei. In addition, the structure of hypernuclei are studied and for a certain isotope, hyperon halo nucleus is predicted. (orig.)

  18. Measurement of inclusive production of charmonium states in B meson decays

    OpenAIRE

    The BABAR Collaboration; Aubert, B.

    2000-01-01

    We reconstruct the charmonium mesons J/psi, psi(2S) and chi_C1 using a sample of 8.46 x 10^6 B-anti-B events collected by the BABAR detector operating at e^+e^- center of mass energies near the Y(4S) resonance. By measuring rates relative to the branching fraction of the J/psi, we obtain preliminary inclusive B branching fractions of (0.25+/-0.02+/-0.02)% to the psi(2S) and (0.39+/-0.04+/-0.04)% to the chi_C1, and set a 90% confidence level limit of 0.24% on decays through the chi_C2.

  19. Structure of exotic nuclei and superheavy elements in meson field theory

    Energy Technology Data Exchange (ETDEWEB)

    Linn, Khin Nyan

    2008-07-15

    In this work the nuclear structure of exotic nuclei and superheavy nuclei is studied in a relativistic framework. In the relativistic mean-field (RMF) approximation, the nucleons interact with each other through the exchange of various effective mesons (scalar, vector, isovector-vector). Ground state properties of exotic nuclei and superheavy nuclei are studied in the RMF theory with the three different parameter sets (ChiM,NL3,NL-Z2). Axial deformation of nuclei within two drip lines are performed with the parameter set (ChiM). The position of drip lines are investigated with three different parameter sets (ChiM,NL3,NL-Z2) and compared with the experimental drip line nuclei. In addition, the structure of hypernuclei are studied and for a certain isotope, hyperon halo nucleus is predicted. (orig.)

  20. D meson decay channels that involve light scalar mesons

    Science.gov (United States)

    Fariborz, Amir

    2013-04-01

    A generalized linear sigma model of low-energy QCD is used to study several decay channels of D mesons that involve light scalar meson as a decay product. Such studies require reliable models for scalar mesons that take into account underlying mixing among quark-antiquarks, tetra quarks and glueballs. In this talk, the generalized linear sigma model of low-energy QCD for understanding the properties of scalar mosons will be briefly presented, and he application of this model to studies of heavier meson decays [such as the semileptonic decay Ds(1968)->f0(980) e^+ ν] will be presented, and a few directions for further extensions of the model will be outlined. Refs. A.H. Fariborz, R. Jora, J. Schechter and M.N. Shahid, ``Semi-leptonic Ds^+(1968) Decays as a Scalar Meson Probe,'' Physical Review D 84, 094024 (2011). A.H. Fariborz, R. Jora, J. Schechter and M.N. Shahid, ``Chiral Nonet Mixing in pi-pi Scattering,'' Physical Review D 84, 113004 (2011).

  1. A Constituent Quark-Meson Model for Heavy Meson Decays

    CERN Document Server

    Deandrea, Aldo

    1998-01-01

    I describe a model for heavy meson decays based on an effective quark-meson lagrangian. I consider the heavy mesons S with spin and parity J^P=(1+,0+), H with J^P=(1-,0-) and T^mu with J^P=(2+,1+), i.e. S and P wave heavy-light mesons. The model is constrained by the known symmetries of QCD in the mQ -> infinity limit for the heavy quarks, and chiral symmetry in the light quark sector. Using a very limited number of free parameters it is possible to compute several phenomenological quantities, e.g. the leptonic B and B** decay constants; the three universal Isgur-Wise form factors: xi, tau(3/2), tau(1/2), describing the semi-leptonic decays B -> D(*) l nu, B -> D** l nu; the strong and radiative D* decays; the weak semi-leptonic decays of B and D into light mesons: pi, rho, a1. An overall agreement with data, when available, is achieved.

  2. Cross sections for meson-meson nonresonant reactions

    CERN Document Server

    Li, Yu-Qi

    2007-01-01

    Meson-meson nonresonant reactions governed by the quark-interchange mechanism are studied in a potential that is derived from QCD. S-wave elastic phase shifts for I=2 \\pi\\pi and I=3/2 K \\pi scattering are obtained with wave functions determined by the central spin-independent term of the potential. The reactions include inelastic scatterings of two mesons in the ground-state pseudoscalar octet and the ground-state vector nonet. Cross sections for reactions involving pion, rho, K and K^* indicate that mesonic interactions in matter consisting of only K and K^* can be stronger than mesonic interactions in matter consisting of only pions and rhos and the reaction of I=3/2 \\pi K^* \\to \\rho K is most important among the endothermic nonresonant reactions. By the quark-interchange mechanism we can offer \\sqrt s-dependences of phi absorption cross sections in collisions with pion and rho and relevant average cross sections what are very small for the reaction of I=1 \\pi \\phi \\to K^* K^* and remarkably large for the r...

  3. Measurement of chi(3510) and chi(3555) production in 190 GeV/c piminus-beryllium interactions

    International Nuclear Information System (INIS)

    Charmonium production in 190 GeV/c π--Be interactions has been observed. The states chi(3510) and chi(3555) are seen through their radiative decay into J/Psi, and are found to correspond to 0.29 +- 0.09 of total J/Psi production for J/Psi's with x/sub f/ > 0.2. The rate of production for the two chi states appears as Bsigma(chi(3555))/Bsigma(chi(3510) = 0.60 +- 0.35. The fraction of J/Psi's produced through chi decay appears to rise with higher x/sub f/. For J/Psi's with x/sub f/ > 0.42, chi decay is responsible for 0.345 +- 0.09 of the total J/Psi sample, with the two states produced at the rate Bsigma(chi(3555))/Bsigma(3510) = 0.82 +- 0.45

  4. Photon-meson transition form factors of light pseudoscalar mesons

    CERN Document Server

    Xiao, B W; Xiao, Bo-Wen; Ma, Bo-Qiang

    2005-01-01

    The photon-meson transition form factors of light pseudoscalar mesons $\\pi ^{0}$, $\\eta $, and $\\eta ^{\\prime}$ are systematically calculated in a light-cone framework, which is applicable as a light-cone quark model at low $Q^{2}$ and is also physically in accordance with the light-cone pQCD approach at large $Q^{2}$. The calculated results agree with the available experimental data at high energy scale. We also predict the low $Q^{2}$ behaviors of the photon-meson transition form factors of $\\pi ^{0}$, $\\eta $ and $\\eta ^{\\prime }$, which are measurable in $e+A({Nucleus})\\to e+A+M$ process via Primakoff effect at JLab and DESY.

  5. CHY-Graphs on a Torus

    CERN Document Server

    Cardona, Carlos

    2016-01-01

    Recently, we proposed a new approach using a punctured Elliptic curve in the CHY framework in order to compute one-loop scattering amplitudes. In this note, we further develop this approach by introducing a set of connectors, which become the main ingredient to build integrands on $\\mathfrak{M}_{1,n}$, the moduli space of n-punctured Elliptic curves. As a particular application, we study the $\\Phi^3$ bi-adjoint scalar theory. We propose a set of rules to construct integrands on $\\mathfrak{M}_{1,n}$ from $\\Phi^ 3$ integrands on $\\mathfrak{M}_{0,n}$, the moduli space of n-punctured spheres. We illustrate these rules by computing a variety of $\\Phi^3$ one-loop Feynman diagrams. Conversely, we also provide another set of rules to compute the corresponding CHY-integrand on $\\mathfrak{M}_{1,n}$ by starting instead from a given $\\Phi^ 3$ one-loop Feynman diagram. In addition, our results can easily be extended to higher loops.

  6. Meson Strings and Flavor Branes

    CERN Document Server

    Bando, M; Terunuma, S; Bando, Masako; Sugamoto, Akio; Terunuma, Sachiko

    2006-01-01

    In a QCD-like string model based on D6 flavor branes in the presence of D4 color branes wrapping one of the compactified dimension on an $S^1$, the shape of meson strings in the five dimensional curved space as well as the potential between quark and anti-quark are investigated. The flavor branes on which both ends of a meson string live are assumed to be separated in this five dimensional space, depending on the values of the constituent quark masses. It is shown in this picture that the meson string with different flavors on both ends changes its shape at a critical distance. There is, however, no critical distance for the meson with the same flavors. At this critical distance the potential between quark and anti-quark with different flavors gives a point of reflection and changes its shape around this point. Accordingly, the attractive force between quark and anti-quark seems to become stronger when the distance of flavor branes connecting meson strings becomes larger. This indicates quark systems with dif...

  7. Beauty Meson Decays To Charmonium

    CERN Document Server

    Ershov, A V

    2001-01-01

    We study decays of beauty (B) mesons into the final states containing charmonium mesons. The data were collected by the CLEO experiment at the Cornell Electron Storage Ring from 1990 to 1999. First, we describe a technique that significantly improves the reconstruction efficiency for decays of J/ y and y (2S) mesons into a pair of leptons. This reconstruction method is used in all the analyses presented in this dissertation. Then we present a study of B decays to the χc 1 and χc2 charmonium states and compare our results with the predictions of different theoretical models of charmonium production. After that we report the first observation of the decay B → J/ y &phis;K, which is the first B meson decay requiring a creation of an additional ss¯ quark pair. Then we measure the B0 and B+ meson masses from B0 → y (′) K0S and B+ → y (′) K+ decays. The method employed eliminates the dominant systematic uncertainty associated w...

  8. Search for rare B meson decays into Ds+ mesons

    International Nuclear Information System (INIS)

    A search has been performed for rare B meson decays into Ds+ mesons arising from b→u transitions, W exchange modes, B+ annihilation processes, and decays where the Ds+ is not produced via a W→c anti s quark pair coupling, using the ARGUS detector operating on the Y(4S) resonance at the e+e- storage ring DORIS II. Upper limits for individual decay modes are obtained. In addition, from a study of Ds+l- correlations an upper limit of BR(B→Ds+l-X)<1.2%(90% CL) is determined. (orig.)

  9. Vector meson-vector meson interaction and dynamically generated resonances

    International Nuclear Information System (INIS)

    We report upon 11 composite meson states, dynamically generated from the vector meson–vector meson interaction using the local hidden gauge formalism within a unitary approach. Six of these states are associated to the f0(1370), f0(1710), f2(1270), f'2(1525), a2(1320) and K*2(1430) resonances. At the same time we predict five other states with the quantum numbers of h1, a0, b1, K*0, and K1 which could be tested by future experiments.

  10. Neutral B meson flavor tagging

    CERN Document Server

    Wilson, R J

    2001-01-01

    We present an investigation of the use of net charge and kaon identification to tag the flavor of neutral B mesons. The net charge of the neutral B meson decay products is zero if all charged particles are used and slightly non-zero if only undiscriminated hadronic final states are used. The net charge of the kaons alone correctly tags the identity of the neutral meson in at least a third of all decays. We have parametrized the particle identification capability of several techniques, such as dE/dx in time projection chambers, LEP/SLC ring-imaging chambers and an enhanced BaBar DIRC. Using these parametrisations we compare the relative tagging power of each technique to that of an ideal detector. (8 refs).

  11. Strange axial-vector mesons

    International Nuclear Information System (INIS)

    The strange axial-vector mesons K1 (1270) and K1 (1400) are reanalyzed in the light of the updated experimental information and compared with the recent result on the Kππ production in τ decay. The mixing angle between the strange mesons of 3P1 and 1P1 is determined by the partial decay rates, and, independently, by the masses. They lead to θK∼33 degree or 57 degree. The observed K1 (1400) production dominance in the τ decay favors θK∼33 degree. Flavor-SU(3) breaking of 20% or so in the production amplitudes can explain quantitatively the observed production ratio

  12. Beauty meson decays to charmonium

    Science.gov (United States)

    Ershov, Alexey Valerievich

    2001-10-01

    We study decays of beauty (B) mesons into the final states containing charmonium mesons. The data were collected by the CLEO experiment at the Cornell Electron Storage Ring from 1990 to 1999. First, we describe a technique that significantly improves the reconstruction efficiency for decays of J/ y and y (2S) mesons into a pair of leptons. This reconstruction method is used in all the analyses presented in this dissertation. Then we present a study of B decays to the χc 1 and χc2 charmonium states and compare our results with the predictions of different theoretical models of charmonium production. After that we report the first observation of the decay B --> J/ y φK, which is the first B meson decay requiring a creation of an additional ss¯ quark pair. Then we measure the B0 and B+ meson masses from B0 --> y (') K0S and B+ --> y (') K+ decays. The method employed eliminates the dominant systematic uncertainty associated with the previous B meson mass measurements at the e+e- colliders and results in a significant improvement in precision. After that we present a study of three B0 decay modes useful for time-dependent CP asymmetry measurements. In this study we reconstruct B0 --> J/ y K0S , B0 --> χc 1 K0S , and B0 --> J/ y π0 decays. The latter two decay modes are observed for the first time. We describe a K0S --> π0π0 detection technique and its application to the reconstruction of the decay B 0 --> J/ y K0S . Then we present a sensitivity study for the measurement of the mixing-induced CP violation in the neutral B meson system (parameter sin 2β) at CLEO using the method that requires a measurement of the decay time of only one meson in a B0overline B0 pair. Finally, we search for direct CP violation in decays B+/- --> J/ y K+/- and B +/- --> y (2S) K+/- . The results of this search are consistent with the Standard Model expectations and provide the first experimental test of the assumption that direct CP violation is negligible in B --> y (') K decays.

  13. Status of light scalar mesons as non-ordinary mesons

    International Nuclear Information System (INIS)

    In this talk I briefly review the status of the f0(500) and f0(980) together with the other light scalar resonances, as well as the emerging picture of a non-ordinary light meson multiplet, paying particular attention to unitarized Chiral Perturbation Theory, large Nc, semilocal duality and Regge theory arguments

  14. Unraveling the pattern of the $XYZ$ mesons

    CERN Document Server

    Vijande, J

    2015-01-01

    We present a plausible mechanism for the origin of the $XYZ$ mesons in the heavy meson spectra within a standard quark-model picture. We discuss the conditions required for the existence of four--quark bound states or resonances contributing to the heavy meson spectra, being either compact or molecular. We concentrate on charmonium and bottomonium spectra, where several new states, difficult to understand as simple quark-antiquark pairs, have been reported by different experimental collaborations. The pivotal role played by entangled meson-meson thresholds is emphasized.

  15. A Study on Near-Fault Mortality from the 1999 Chi-Chi, Taiwan Earthquake

    Science.gov (United States)

    Pai, C.; Tien, Y.; Teng, T.

    2004-12-01

    A new approach for estimating the relations between mortality and strong shaking from the 1999 Chi-Chi, Taiwan earthquake is introduced. We have finished the database giving the attributes of victims through a compilation of various after-earthquake survey documents. This survey was a comprehensive filed visit confirming exact locations of victims and their possible cause of death. Among the total 2492 victims of the Chi-Chi earthquake, 2039 victims (81.8% of the total) were located by using GPS. Through the attributive database of victims, digital maps and Geographic Information Systems, we can easily map the spatial distribution and the cause of death data of victims with accuracy of the smallest administrative districts in Taiwan. Moreover, a regression analysis gives correlated equations for the mortality as functions of the distance to the Chelungpu fault. We find that the percentage of the mortality M can be expressed as:\\[M=\\frac{(1.626+0.0007\\timesd)} {(1+0.0125\\timesd)}\\] Here d is the closest distance to the fault in meter. As expected, the shorter distance to the Chelungpu fault causes the higher mortality. We device three disastrous levels and then suggest the orders and scopes of the earthquake disaster rescue according to the regression curve of the mortality and the closest distance to the fault. The difference in mortality between hanging-wall and footwall areas is also discussed and different regression curves of hanging-wall and footwall areas are suggested. In near-fault regions, the mortality for the residents lived in hanging-wall block (1348) is significantly higher than that in the footwall block (557). The death ratio of hanging-wall vs. footwall block is approximately 2.4:1. Finally, we gathered the data of the peak ground acceleration (PGA) data for the mainshock of Chi-Chi earthquake at the 63 seismic stations on both sides of the causal fault. The regression curve of the PGA and mortality as functions of the closest distance to the

  16. Study of charmonia in four-meson final states produced in two-photon collisions

    CERN Document Server

    Uehara, S; Aihara, H; Aulchenko, V; Aushev, T; Bakich, A M; Balagura, V; Barberio, E; Bay, A; Belous, K S; Bitenc, U; Bondar, A; Bozek, A; Bracko, M; Brodzicka, J; Browder, T E; Chang, P; Chao, Y; Chen, A; Chen, K F; Chen, W T; Cheon, B G; Cho, I S; Choi, Y; Choi, Y K; Dalseno, J; Dash, M; Drutskoy, A; Eidelman, S; Epifanov, D; Fratina, S; Gabyshev, N; Gokhroo, G; Golob, B; Ha, H; Haba, J; Hayasaka, K; Hayashii, H; Hazumi, M; Heffernan, D; Hokuue, T; Hoshi, Y; Hou, W S; Hyun, H J; Iijima, T; Ikado, K; Inami, K; Ishikawa, A; Itoh, R; Iwasaki, M; Iwasaki, Y; Kah, D H; Kaji, H; Kang, J H; Kawai, H; Kawasaki, T; Kichimi, H; Kim, H O; Kim, S K; Kim, Y J; Korpar, S; Krizan, P; Krokovny, P; Kumar, R; Kuo, C C; Kuzmin, A; Kwon, Y J; Lee, J S; Lee, M J; Lee, S E; Lesiak, T; Li, J; Limosani, A; Lin, S W; Liu, Y; Liventsev, D; Mandl, F; Matsumoto, T; Matyja, A; McOnie, S; Medvedeva, T; Miyake, H; Miyata, H; Miyazaki, Y; Mizuk, R; Nagasaka, Y; Nakano, E; Nakao, M; Nakazawa, H; Natkaniec, Z; Nishida, S; Nitoh, O; Ogawa, S; Ohshima, T; Okuno, S; Olsen, S L; Onuki, Y; Ozaki, H; Pakhlov, P; Pakhlova, G; Palka, H; Park, C W; Park, H; Peak, L S; Pestotnik, R; Piilonen, L E; Sahoo, H; Sakai, Y; Schneider, O; Seidl, R; Senyo, K; Sevior, M E; Shapkin, M; Shibuya, H; Shiu, J G; Shwartz, B; Singh, J B; Sokolov, A; Somov, A; Soni, N; Stanic, S; Staric, M; Stöck, H; Sumiyoshi, T; Takasaki, F; Tamai, K; Tanaka, M; Taylor, G N; Teramoto, Y; Tian, X C; Tikhomirov, I; Tsuboyama, T; Unno, Y; Uno, S; Urquijo, P; Usov, Yu; Varner, G; Vervink, K; Villa, S; Vinokurova, A; Wang, C H; Wang, P; Watanabe, Y; Won, E; Yabsley, B D; Yamaguchi, A; Yamashita, Y; Yuan, C Z; Zhang, C C; Zhang, Z P; Zhilich, V; Zupanc, A

    2008-01-01

    We report measurements of charmonia produced in two-photon collisions and decaying to four-meson final states, where the meson is either a charged pion or a charged kaon. The analysis is based on a 395fb^{-1} data sample accumulated with the Belle detector at the KEKB electron-positron collider. We observe signals for the three C-even charmonia eta_c(1S), chi_{c0}(1P) and chi_{c2}(1P) in the pi^+pi^-pi^+pi^-, K^+K^-pi^+pi^- and K^+K^-K^+K^- decay modes. No clear signals for eta_c(2S) production are found in these decay modes. We have also studied resonant structures in charmonium decays to two-body intermediate meson resonances. We report the products of the two-photon decay width and the branching fractions, Gamma_{gamma gamma}B, for each of the charmonium decay modes.

  17. Theoretical overview: The New mesons

    Energy Technology Data Exchange (ETDEWEB)

    Quigg, Chris; /Fermilab

    2004-11-01

    After commenting on the state of contemporary hadronic physics and spectroscopy, I highlight four areas where the action is: searching for the relevant degrees of freedom, mesons with beauty and charm, chiral symmetry and the D{sub sJ} levels, and X(3872) and the lost tribes of charmonium.

  18. Holographic mesons in various dimensions

    CERN Document Server

    Myers, R C; Myers, Robert C.; Thomson, Rowan M.

    2006-01-01

    We calculate the spectrum of fluctuations of a probe Dk-brane in the background of N Dp-branes, for k=p,p+2,p+4 and p< 5. The result corresponds to the mesonic spectrum of a (p+1)-dimensional super-Yang-Mills (SYM) theory coupled to `dynamical quarks', i.e., fields in the fundamental representation -- the latter are confined to a defect for k=p and p+2. We find a universal behaviour where the spectrum is discrete and the mesons are deeply bound. The mass gap and spectrum are set by the scale M ~ m_q/g_{eff}(m_q), where m_q is the mass of the fundamental fields and g_{eff}(m_q) is the effective coupling evaluated at the quark mass, i.e. g_{eff}^2(m_q)=\\gym^2N m_q^{p-3}. We consider the evolution of the meson spectra into the far infrared of three-dimensional SYM, where the gravity dual lifts to M-theory. We also argue that the mass scale appearing in the meson spectra is dictated by holography.

  19. Local optical potentials for mesons

    International Nuclear Information System (INIS)

    Full text: Local optical models are very useful to describe many nuclear reactions, with the parameters often determined from fits to data. Elastic meson-nucleus scattering can be described by such potentials, but there is a strong ambiguity in the parameters [1], making the model hard to apply. Consideration of meson-nucleus inelastic scattering to collective states can be described in the local DWBA, built on local optical models. If the parameters of the optical potential are varied so as to find simultaneous agreement with both elastic and inelastic scattering, the ambiguity is removed, and a unique local optical potential can be defined for mesons [2,3]. The methods used to determine these parameters, examples of the fits and the meaning of the results will be explained. The result is a widely usable set of parameters in a simple local optical potential for pion and kaon interactions with nuclei, found to describe these reactions over a wide range of beam energies and nuclear masses. This accomplishment should allow a wider range of nuclear reaction models to include mesons in a simple way

  20. Mesons in the nuclear Medium

    OpenAIRE

    Kotulla, Martin

    2006-01-01

    We discuss recent experimental results on the modification of hadron properties in a nuclear medium. Particular emphasis is placed on an $\\omega$ production experiment performed by the CBELSA/TAPS collaboration at the ELSA accelerator. The data shows a smaller $\\omega$ meson mass together with a significant increase of its width in the nuclear medium.

  1. Pseudoscalar meson form factors and decays

    CERN Document Server

    Dorokhov, A E

    2011-01-01

    In this communication we discuss few topics related with modern experimental data on the physics of light pseudoscalar mesons. It includes the contribution of the pseudoscalar mesons to the muon anomalous magnetic moment (AMM), $g-2$, the rare decays of light pseudoscalar mesons to lepton pair, the transition form factors of pseudoscalar mesons at large momentum transfer, the pion transversity form factor. Measuring the muon anomalous magnetic moment $g-2$ and the rare decays of light pseudoscalar mesons into lepton pair $P\\rightarrow l^{+}l^{-} $ serve as important test of the standard model. To reduce the theoretical uncertainty in the standard model predictions the data on the transition form factors of light pseudoscalar mesons play significant role. Recently new data on behavior of these form factors at large momentum transfer was supplied by the BABAR collaboration. Within the nonlocal chiral quark model it shown how to describe these data and how the meson distribution amplitude evolves as a function o...

  2. Bi-normalized response spectral characteristics of the 1999 Chi-Chi earthquake

    Institute of Scientific and Technical Information of China (English)

    徐龙军; 谢礼立

    2004-01-01

    To develop uniform and seismic environment-dependent design spectrum, common acceleration response spectral characteristics need to be identified. In this paper, a bi-normalized response spectrum (BNRS) is proposed, which is defined as a spectrum of peak response acceleration normalized with respect to peak acceleration of the excitation plotted vs. the natural period of the system normalized with respect to the spectrum predominant period, Tp. Based on a statistical analysis of records from the 1999 Chi-Chi earthquake, the conventionally normalized response spectrum(NRS) and the BNRS are examined to account for the effects of soil conditions, epicentral distance, hanging wall and damping. It is found that compared to the NRS, the BNRS is much less dependent on these factors. Finally, some simple relationships between the BNRS tor a specified damping ratio and that for a damping ratio of 5%, and between the spectra predominant period and epicentral distance for different soil types are provided.

  3. A $\\chi^2$ veto for continuous wave searches

    CERN Document Server

    de la Jordana, Llucia Sancho

    2008-01-01

    $\\chi^2$ vetoes are commonly used in searching for gravitational waves, in particular for broad-band signals, but they can also be applied to narrow-band continuous wave signals, such as those expected from rapidly rotating neutron stars. In this paper we present a $\\chi^2$ veto adapted to the Hough transform searches for continuous gravitational wave signals; we characterize the $\\chi^2$-significance plane for different frequency bands; and discuss the expected performance of this veto in LIGO analysis.

  4. O Tai Chi Chuan na percussão

    OpenAIRE

    Teixeira, Mário Jorge Peixoto

    2013-01-01

    A good motricity and a strong psyche that allow for excellence in performance are essential in musical execution. Since Tai Chi Chuan is an activity that implies a considerable psychomotor and psychological development, it is the aim of this thesis to assess whether the practice of Tai Chi Chuan can be an optimising factor in a percussionist’s performance. Based on the outstanding physical and psychological effects that result from the practice of Tai Chi Chuan and the ce...

  5. Vector meson electroproduction in QCD

    International Nuclear Information System (INIS)

    Based on the generalized QCD vector meson dominance model, we study the electroproduction of a vector meson off a proton in the QCD inspired eikonalized model. Numerical calculations for the total cross section σtot and differential cross section dσ/dt are performed for ρ, ω and φ meson electroproduction in this paper. Since gluons interact among themselves (self-interaction), two gluons can form a glueball with quantum numbers IG, JPC = 0+, 2++, decay width Γt ≈ 100 MeV, and mass of mG=2.23 GeV. The three gluons can form a three-gluon colorless bound state with charge conjugation quantum number C = -1, called the Odderon. The mediators of interactions between projectiles (the quark and antiquark pair fluctuated from the virtual photon) and the proton target (a three-quark system) are the tensor glueball and the Odderon. Our calculated results in the tensor glueball and Odderon exchange model fit to the existing data successfully, which evidently shows that our present QCD mechanism is a good description of meson electroproduction off a proton. It should be emphasized that our mechanism is different from the theoretical framework of Block et al. We also believe that the present study and its success are important for the investigation of other vector meson electro- and photoproduction at high energies, as well as for searching for new particles such as tensor glueballs and Odderons, which have been predicted by QCD and the color glass condensate model (CGC). Therefore, in return, it can test the validity of QCD and the CGC model. (authors)

  6. Vector meson electroproduction in QCD

    Institute of Scientific and Technical Information of China (English)

    LU Juan; CAI Xian-Hao; ZHOU Li-Juan

    2012-01-01

    Based on the generalized QCD vector meson dominance model,we study the electroproduction of a vector meson off a proton in the QCD inspired eikonalized model.Numerical calculations for the total cross section σtot and differential cross section dσ/dt are performed for p,ω and φ meson electroproduction in this paper.Since gluons interact among themselves (self-interaction),two gluons can form a glueball with quantum numbers IG,JPC =0+,2++,decay width Γt ≈ 100 MeV,and mass of mG=2.23 GeV.The three gluons can form a three-gluon colorless bound state with charge conjugation quantum number C =-1,called the Odderon.The mediators of interactions between projectiles (the quark and antiquark pair fluctuated from the virtual photon) and the proton target (a three-quark system) are the tensor glueball and the Odderon.Our calculated results in the tensor glueball and Odderon exchange model fit to the existing data successfully,which evidently shows that our present QCD mechanism is a good description of meson electroproduction off a proton.It should be emphasized that our mechanism is different from the theoretical framework of Block et al.We also believe that the present study and its success are important for the investigation of other vector meson electro- and photoproduction at high energies,as well as for searching for new particles such as tensor glueballs and Odderons,which have been predicted by QCD and the color glass condensate model (CGC).Therefore,in return,it can test the validity of QCD and the CGC model.

  7. On the Role of Charmed Meson Loops in Charmonium Decays

    CERN Document Server

    Mehen, Thomas

    2011-01-01

    We investigate the effect of intermediate charmed meson loops on the M1 radiative decays $J/\\psi \\to \\eta_c \\gamma$ and $\\psi'\\rightarrow\\eta^{(\\prime)}_c\\gamma$ as well as the isospin violating hadronic decays $\\psi'\\rightarrow J/\\psi \\,\\pi^0(\\eta)$ using heavy hadron chiral perturbation theory (HH$\\chi$PT). The calculations include tree level as well as one loop diagrams and are compared to the latest data from CLEO and BES-III. Our fit constrains the couplings of 1S and 2S charmonium multiplets to charmed mesons, denoted $g_2$ and $g_2^\\prime$, respectively. We find that there are two sets of solutions for $g_2$ and $g_2^\\prime$. One set, which agrees with previous values of the product $g_2 g_2^\\prime$ extracted from analyses that consider only loop contributions to $\\psi'\\rightarrow J/\\psi \\,\\pi^0(\\eta)$, can only fit data on radiative decays with fine-tuned cancellations between tree level diagrams and loops in that process. The other solution for $g_2$ and $g_2^\\prime$ leads to couplings that are small...

  8. Tai Chi Chuan in Medicine and Health Promotion

    Directory of Open Access Journals (Sweden)

    Ching Lan

    2013-01-01

    Full Text Available Tai Chi Chuan (Tai Chi is a Chinese traditional mind-body exercise and recently, it becomes popular worldwide. During the practice of Tai Chi, deep diaphragmatic breathing is integrated into body motions to achieve a harmonious balance between body and mind and to facilitate the flow of internal energy (Qi. Participants can choose to perform a complete set of Tai Chi or selected movements according to their needs. Previous research substantiates that Tai Chi has significant benefits to health promotion, and regularly practicing Tai Chi improves aerobic capacity, muscular strength, balance, health-related quality of life, and psychological well-being. Recent studies also prove that Tai Chi is safe and effective for patients with neurological diseases (e.g., stroke, Parkinson's disease, traumatic brain injury, multiple sclerosis, cognitive dysfunction, rheumatological disease (e.g., rheumatoid arthritis, ankylosing spondylitis, and fibromyalgia, orthopedic diseases (e.g., osteoarthritis, osteoporosis, low-back pain, and musculoskeletal disorder, cardiovascular diseases (e.g., acute myocardial infarction, coronary artery bypass grafting surgery, and heart failure, chronic obstructive pulmonary diseases, and breast cancers. Tai Chi is an aerobic exercise with mild-to-moderate intensity and is appropriate for implementation in the community. This paper reviews the existing literature on Tai Chi and introduces its health-promotion effect and the potential clinical applications.

  9. Dicty_cDB: CHI194 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 58.1 V112D8 mTn-3xHA/lacZ Insertion Library, strain Y2278 Saccharomyces cerevisiae genomic 5', genomic survey se...) Frame A: ksnfi*ii*knk*ynikndiisnylmy*gn*ndlktstrsi*kkyknsnkeiisinwfsd nwyifsictsmvfvtnwmdiygysmlwiilcwvcmw...uolar 4.0 %: nuclear 4.0 %: vesicles of secretory system >> prediction for CHI194 is end 5' end seq. ID CHI194F 5' end se...CTTT TAATGGTTTAGTTTATAATCATTCATTTGCTGCTAGAAATTATTTGGATCTTTATAGAGT TGCTTTATTATCAAANNAATAAAATTAAATCATT Length of 3' end se...q. 754 Connected seq. ID CHI194P Connected seq. >CHI194P.Seq AAATCAAA

  10. Graphs with $\\chi=\\Delta$ have big cliques

    OpenAIRE

    Cranston, Daniel W.; Rabern, Landon

    2013-01-01

    Brooks' Theorem states that if a graph has $\\Delta\\ge 3$ and $\\omega \\le \\Delta$, then $\\chi \\le \\Delta$. Borodin and Kostochka conjectured that if $\\Delta\\ge 9$ and $\\omega\\le \\Delta-1$, then $\\chi\\le \\Delta-1$. We show that if $\\Delta\\ge 13$ and $\\omega \\le \\Delta-4$, then $\\chi\\le \\Delta-1$. For a graph $G$, let $\\mathcal{H}$ denote the subgraph of $G$ induced by vertices of degree $\\Delta$. We also show that if $\\omega\\le \\Delta-1$ and $\\omega(\\mathcal{H})\\le \\Delta-6$, then $\\chi\\le \\Del...

  11. Search for B --> chi_c K(*) decays

    CERN Document Server

    Aubert, B; Abrams, G S; Adye, T; Ahmed, S; Alam, M S; Albert, J; Aleksan, Roy; Allison, J; Allmendinger, T; Altenburg, D; Andreotti, M; Angelini, C; Anulli, F; Aston, D; Azzolini, V; Baak, M; Back, J J; Bailey, S; Baldini-Ferroli, R; Band, H R; Banerjee, Sw; Barate, R; Bard, D J; Barlow, N R; Barlow, R J; Barrett, M; Bartoldus, R; Batignani, G; Bauer, J M; Beck, T W; Bellini, F; Benayoun, M; Berger, N; Bernard, D; Berryhill, J W; Best, D; Bettarini, S; Bettoni, D; Bevan, A J; Bhimji, W; Bianchi, F; Biasini, M; Blanc, F; Blaylock, G; Blinov, A E; Blinov, V E; Bloom, P; Bóna, M; Bondioli, M; Bonneaud, G R; Borgland, A W; Bosisio, L; Boutigny, D; Bowerman, D A; Boyarski, A M; Boyd, J T; Bozzi, C; Brandenburg, G; Brandt, T; Brau, J E; Breon, A B; Briand, H; Brochard, F; Brose, J; Brown, C L; Brown, C M; Brown, D; Brown, D N; Bruinsma, M; Brunet, S; Bucci, F; Buchanan, C; Buchmüller, O L; Bulten, H; Burchat, Patricia R; Button-Shafer, J; Buzzo, A; Côté, D; Cahn, R N; Calabrese, R; Calcaterra, A; Calderini, G; Campagnari, C; Capra, R; Carpinelli, M; Cartaro, C; Cavallo, N; Cavoto, G; Chaisanguanthum, K S; Chao, M; Charles, E; Charles, M J; Chauveau, J; Chavez, C A; Chen, A; Chen, E; Chen, J C; Chen, S; Cheng, B; Cheng, C H; Chevalier, N; Christ, S; Cibinetto, G; Clark, P J; Claus, R; Cochran, J; Colecchia, F; Coleman, J P; Contri, R; Convery, M R; Cormack, C M; Cossutti, F; Cottingham, W N; Couderc, F; Covarelli, R; Cowan, G; Crawley, H B; Cremaldi, L M; Cristinziani, M; Crosetti, G; Çuhadar-Dönszelmann, T; Dahmes, B; Dallapiccola, C; Danielson, N; Dasu, S; Datta, M; Dauncey, P D; David, P; Davier, M; Davis, C L; Day, C T; De Groot, N; De Nardo, Gallieno; Del Buono, L; Della Ricca, G; Di Lodovico, F; Dickopp, M; Dittongo, S; Dong, D; Dorfan, J; Dorigo, A; Druzhinin, V P; Dubois-Felsmann, G P; Dujmic, D; Dunwoodie, W M; Dvoretskii, A; Eckmann, R; Edwards, A J; Egede, U; Eichenbaum, A M; Eigen, G; Eisner, A M; Elmer, P; Elsen, E E; Emery, S; Ernst, J A; Eschenburg, V; Eschrich, I; Fabozzi, F; Faccini, R; Fan, S; Farbin, A; Feltresi, E; Ferrarotto, F; Ferroni, F; Field, R C; Finocchiaro, G; Flack, R L; Flächer, H U; Flood, K T; Ford, K E; Ford, W T; Forster, I J; Forti, F; Fortin, D; Foulkes, S D; Franek, B J; Frey, R; Fritsch, M; Fry, J R; Gabathuler, Erwin; Gaidot, A; Gaillard, J M; Gaillard, J R; Galeazzi, F; Gallo, F; Gamba, D; Gamet, R; Gan, K K; Ganzhur, S F; Gary, J W; Gaspero, M; Gatto, C; Geddes, N I; Gill, M S; Giorgi, M A; Giraud, P F; Giroux, X; Gladney, L; Glanzman, T; Godang, R; Goetzen, K; Golubev, V B; Gopal, G P; Gowdy, S J; Graham, M; Grancagnolo, S; Green, M G; Greene, M G; Grenier, G J; Grenier, P; Gritsan, A V; Grosdidier, G; Groysman, Y; Guo, Q H; Hadavand, H K; Hadig, T; Haire, M; Halyo, V; Hamel de Monchenault, G; Hamon, O; Harrison, P F; Harrison, T J; Hart, A J; Hart, P A; Hartfiel, B L; Harton, J L; Hast, C; Hauke, A; Hawkes, C M; Hearty, C; Held, T; Hertzbach, S S; Heusch, C A; Hicheur, A; Hill, E J; Hitlin, D G; Höcker, A; Hodgkinson, M C; Hollar, J J; Honscheid, K; Hrynóva, T; Hufnagel, D; Hulsbergen, W D; Hutchcroft, D E; Igonkina, O; Innes, W R; Ivanchenko, V N; Izen, J M; Jackson, P D; Jackson, P S; Jacobsen, R G; Jawahery, A; Jayatilleke, S M; Jessop, C P; John, M J J; Johnson, J R; Judd, D; Kadel, R W; Kadyk, J; Kagan, H; Karyotakis, Yu; Kass, R; Kelly, M P; Kelsey, M H; Kerth, L T; Khan, A; Kim, H; Kim, P; Kirkby, D; Kitayama, I; Knecht, N S; Koch, H; Kocian, M L; Kofler, R; Kolomensky, Yu G; Koptchev, V B; Kovalskyi, D; Kowalewski, R V; Kozanecki, Witold; Kravchenko, E A; Krishnamurthy, M; Kroeger, R; Kroseberg, J; Kukartsev, G; Kutter, P E; Kyberd, P; Lacker, H M; Lae, C K; Lafferty, G D; Lamsa, J; Lanceri, L; Lange, D J; Langenegger, U; Lankford, A J; Laplace, S; Latham, T E; Lau, Y P; Lavin, D; Lazzaro, A; Le Diberder, F R; Lees, J P; Legendre, M; Leith, D W G S; Lepeltier, V; Leruste, P; Lewandowski, B; Li Gioi, L; Li, H; Libby, J; Lillard, V; Lista, L; Liu, R; LoSecco, J M; Lo Vetere, M; Lockman, W S; Lombardo, V; London, G W; Long, O; Lou, X C; Lu, A; Lü, C; Luitz, S; Luppi, E; Lusiani, A; Lüth, V; Lutz, A M; Lynch, G; Lynch, H L; Lyon, A J; MacFarlane, D B; Macri, M; Malcles, J; Mallik, U; Mancinelli, G; Mandelkern, M A; Manfredi, P F; Mangeol, D J J; Marchiori, G; Margoni, M; Marsiske, H; Martínez-Vidal, F; Mattison, T S; Mayer, B; Mazur, M A; Mazzoni, M A; McKenna, J A; McMahon, T R; Meadows, B T; Messner, R; Meyer, T I; Meyer, W T; Miftakov, V; Mihályi, A; Mir, L M; Mohanty, G B; Mohapatra, A K; Mommsen, R K; Monge, M R; Monorchio, D; Moore, T B; Morandin, M; Morgan, S E; Morganti, M; Morganti, S; Morii, M; Morton, G W; Muheim, F; Müller, D R; Müller-Pfefferkorn, R; Narsky, I; Nash, J A; Nauenberg, U; Neal, H; Negrini, M; Neri, N; Nesom, G; Nicholson, H; Nikolich, M B; Nogowski, R; O'Grady, C P; Ocariz, J; Oddone, P J; Ofte, I; Olaiya, E O; Olivas, A; Olsen, J; Onuchin, A P; Orimoto, T J; Otto, S; Ozcan, V E; Paar, H P; Paick, K; Palano, A; Palombo, F; Pan, Y; Panetta, J; Panvini, R S; Paoloni, E; Paolucci, P; Parry, R J; Passaggio, S; Patel, P M; Patrignani, C; Patteri, P; Payne, D J; Pelizaeus, M; Perazzo, A; Perl, M; Peruzzi, I M; Petersen, B A; Petersen, T C; Petrak, S; Petzold, A; Piatenko, T; Piccolo, D; Piccolo, M; Piemontese, L; Pierini, M; Pioppi, M; Piredda, G; Pivk, M; Plaszczynski, S; Playfer, S; Pompili, A; Poropat, P; Porter, F C; Posocco, M; Potter, C T; Prell, S; Prepost, R; Pripstein, M; Pulliam, T; Purohit, M V; Qi, N D; Rahatlou, S; Rahimi, A M; Rama, M; Rankin, P; Ratcliff, B N; Raven, G; Re, V; Reidy, J; Ricciardi, S; Richman, J D; Ritchie, J L; Rizzo, G; Roat, C; Roberts, D A; Robertson, S H; Robutti, E; Roe, N A; Röthel, W; Ronan, Michael T; Roney, J M; Rong, G; Roodman, A; Roos, L; Rosenberg, E I; Rotondo, M; Rubin, A E; Ryd, A; Saeed, M A; Safai-Tehrani, F; Saleem, M; Salnikov, A A; Salvatore, F; Samuel, A; Sanders, D A; Sandrelli, F; Santroni, A; Saremi, S; Sarti, A; Satpathy, A; Schalk, T; Schindler, R H; Schott, G; Schrenk, S; Schubert, J; Schubert, Klaus R; Schumm, B A; Schune, M H; Schwiening, J; Schwierz, R; Schwitters, R F; Sciacca, C; Sciolla, G; Seiden, A; Sekula, S J; Serednyakov, S I; Sharma, V; Shelkov, V G; Shen, B C; Simani, M C; Simi, G; Simonetto, F; Sinev, N B; Skovpen, Yu I; Sloane, R J; Smith, A J S; Smith, J G; Snoek, H L; Snyder, A; Sobie, R J; Soffer, A; Soha, A; Sokoloff, M D; Solodov, E P; Spaan, B; Spanier, S M; Spradlin, P; Stängle, H; Steinke, M; Stelzer, J; Stoker, D P; Stroili, R; Strom, D; Stugu, B; Su, D; Sullivan, M K; Summers, D J; Sundermann, J E; T'Jampens, S; Tan, P; Tantot, L; Taras, P; Taylor, F; Taylor, G P; Telnov, A V; Teodorescu, L; Ter-Antonian, R; Therin, G; Thiebaux, C; Thiessen, D; Tiozzo, G; Tisserand, V; Toki, W H; Torrence, E; Tosi, S; Touramanis, C; Treadwell, E; Vasileiadis, G; Vasseur, G; Vavra, J; Verderi, M; Verkerke, W; Vitale, L; Voci, C; Voena, C; Vuagnin, G; Wagner, G; Wagner, S R; Wagoner, D E; Waldi, R; Walsh, J; Wang, K; Wang, P; Wappler, F R; Watson, A T; Weaver, M; Weidemann, A W; Weinstein, A J R; Wenzel, W A; Wilden, L; Williams, D C; Williams, J C; Willocq, S; Wilson, F F; Wilson, J R; Wilson, M G; Wilson, R J; Winter, M A; Wisniewski, W J; Wittgen, M; Won, E; Wong, Q K; Wormser, G; Wright, D H; Wright, D M; Wu, J; Wu, S L; Xie, Y; Yamamoto, R K; Yang, S; Yarritu, A K; Ye, S; Yéche, C; Yi, J; Young, C C; Yu, Z; Yumiceva, F X; Yushkov, A N; Zallo, A; Zeng, Q; Zghiche, A; Zhang, J; Zhang, L; Zhao, H W; Zhu, Y S; Zito, M; De Sangro, R; La Vaissière, C de

    2004-01-01

    We report on the search for the factorization suppressed decays B -> chi_c0 K(*) and B -> chi_c2 K(*), with chi_c0 and chi_c2 decaying into J/psi gamma. We use a sample of 124 million BBbar events collected with the BABAR detector at the PEP-II storage ring at the Stanford Linear Accelerator Center. No significant signal is found and upper bounds for the branching fractions are obtained. All results are preliminary.

  12. Contributions of loops with dynamical vector mesons to masses and decay constants of pseudoscalar mesons and their quark mass dependence

    CERN Document Server

    Terschlüsen, Carla

    2016-01-01

    The contributions of one-loop diagrams with dynamical vector mesons to masses and decay constants of pseudoscalar mesons are determined. Hereby, a relativistic Lagrangian for both the pseudoscalar-meson octet and the vector-meson nonet is used. The vector mesons are given in the antisymmetric tensor representation. Both the differences between static and dynamical vector mesons and the differences between calculations with and without vector mesons are studied as functions of the light quark mass.

  13. chi_c0 and chi_c2 Decays into eta eta, eta eta', and eta' eta' Final States

    CERN Document Server

    Adams, G S; Cummings, J P; Danko, I; Napolitano, J; He, Q; Insler, J; Muramatsu, H; Park, C S; Thorndike, E H; Yang, F; Coan, T E; Gao, Y S; Artuso, M; Blusk, S; Butt, J; Li, J; Menaa, N; Mountain, R; Nisar, S; Randrianarivony, K; Sia, R; Skwarnicki, T; Stone, S; Wang, J C; Zhang, K; Csorna, S E; Bonvicini, G; Cinabro, D; Dubrovin, M; Lincoln, A; Asner, D M; Edwards, K W; Briere, R A; Chen, J; Ferguson, T; Tatishvili, G T; Vogel, H; Watkins, M E; Rosner, J L; Adam, N E; Alexander, J P; Berkelman, K; Cassel, D G; Duboscq, J E; Ecklund, K M; Ehrlich, R; Fields, L; Galik, R S; Gibbons, L; Gray, R; Gray, S W; Hartill, D L; Heltsley, B K; Hertz, D; Jones, C D; Kandaswamy, J; Kreinick, D L; Kuznetsov, V E; Mahlke-Krüger, H; Onyisi, P U E; Patterson, J R; Peterson, D; Pivarski, J; Riley, D; Ryd, A; Sadoff, A J; Schwarthoff, H; Shi, X; Stroiney, S; Sun, W M; Wilksen, T; Weinberger, M; Athar, S B; Patel, R; Potlia, V; Yelton, J; Rubin, P; Cawlfield, C; Eisenstein, B I; Karliner, I; Kim, D; Lowrey, N; Naik, P; Sedlack, C; Selen, M; White, E J; Wiss, J; Mitchell, R E; Shepherd, M R; Besson, D; Pedlar, T K; Cronin-Hennessy, D; Gao, K Y; Hietala, J; Kubota, Y; Klein, T; Lang, B W; Poling, R; Scott, A W; Smith, A; Zweber, P; Dobbs, S; Metreveli, Z V; Seth, K K; Tomaradze, A G; Ernst, J; Severini, H; Dytman, S A; Love, W; Savinov, V; Aquines, O; Li, Z; López, A; Mehrabyan, S S; Méndez, H; Ramírez, J; Huang, G S; Miller, D H; Pavlunin, V; Sanghi, B; Shipsey, I P J; Xin, B; al, et

    2006-01-01

    Using a sample of 3 x 10^6 psi(2S) decays collected by the CLEO III and CLEO_c detector configurations, we present results of a study of \\chi_{c0} and \\chi_{c2} decays into eta-eta, eta-etaprime, and etaprime-etaprime final states. We find B(chi_{c0} -> eta-eta)= (0.31+-0.05+-0.04+-0.02)%, B(chi_{c0} -> eta-etaprime) etaprime-etaprime) = (0.17 +- 0.04 +-0.02 +-0.01)%. We also present upper limits for the decays of \\chi_{c2} into these final states. These results give information on the decay mechanism of \\chi_c states into pseudoscalars.

  14. On Deusons or Deuteronlike Meson-Meson Bound States

    CERN Document Server

    Törnqvist, N A

    1994-01-01

    The systematics of deuteronlike two-meson bound states, {\\it deusons}, is discussed. Previous arguments that many of the present non-$q\\bar q$ states are such states are elaborated including, in particular, the tensor potential. For pseudoscalar states the important observation is made that the centrifugal barrier from the P-wave can be overcome by the $1/r^2$ and $1/r^3$ terms of the tensor potential. In the heavy meson sector one-pion exchange alone is strong enough to form at least deuteron-like $B\\bar B^*$ and $B^*\\bar B^*$ composites bound by approximately 50 MeV, while $D\\bar D^*$ and $D^*\\bar D^*$ states are expected near the threshold.

  15. Nontopological Soliton in the Polyakov Quark Meson Model

    CERN Document Server

    Jin, Jinshuang

    2016-01-01

    In mean field approximation, we study a nontopological soliton of Polyakov Quark Meson Model in the presence of fermionic vacuum term with two flavors at finite temperature and density. The behavior of the effective potential evolving with temperature supports the existence of the stable soliton solution as long as $T\\leq T_{\\chi}^c$ for both crossover and first-order phase transition, and these solutions are calculated with some appropriate boundary conditions. However, it is found that only if $T\\leq T^c_d$, the energy of the soliton $M_N$ is less than the energy of three free constituent quarks $3M_q$. As $T> T^c_d$, there is a instant delocalization phase transition from hadron matter to quark matter. The phase diagram together with the location of critical end point (CEP) has been obtained in $T$ and $\\mu$ plane. We notice that two critical temperatures always satisfy $T^c_d\\leq T_{\\chi}^c$. In the end, we present and compare the result for temperature variation of thermodynamic pressure at zero chemical...

  16. Community Recovery and Sustainable Development in the Region of Seismic Center in Taiwan after the 1999 CHI-CHI Earthquake

    OpenAIRE

    Hsiu-Jen Jennifer, Yeh

    2006-01-01

    International audience The major purpose of this study is to evaluate the progress of community recovery and sustainable development of the region of seismic centre in Taiwan after the 1999 Chi-Chi Earthquake. Data analyzed in this study were collected from a face-to-face interview survey conducted in the research site of Tzu-Shan Town, Nan-Tau County, an area close to the epicentre of Chi-Chi Town, Nan-Tau County. The analysis of this study indicates that before the earthquake the residen...

  17. Semileptonic decays of B meson into charmed meson

    International Nuclear Information System (INIS)

    Recent results on semileptonic decays of B meson into charmed meson using the CLEO detector at CESR are summarized. Ratios of the inclusive semileptonic branching fractions, B(B-→D0Xl-bar ν), B(bar B0→D+Xl-bar νXl-bar ν), and B(bar B0→D+) average B meson semileptonic branching fraction are reported. The branching fractions of the exclusive final states, B-→D0l-bar ν, B-→D0l-bar ν, and bar B0→D+l-bar ν are measured. The ratio of B(B-→D0l-bar ν) to B(B-→D0l-bar ν) and the polarization of the D*+ are obtained and compared with theoretical models. The value of |Vcb| is calculated from the exclusive branching fractions for various models. Finally, the lifetime ratio of the charged and neutral B's (τ+/τ0) is determined from the ratio of B(B-→D0l-bar ν) to B(bar B0→D+l-bar ν) to be 0.85±0.20+0.22-0.16

  18. Bottomonium spectroscopy and radiative transitions involving the chi_bJ(1P,2P) states at BABAR

    CERN Document Server

    Lees, J P

    2014-01-01

    We use $(121\\pm1)$ million $\\Upsilon(3S)$ and $(98\\pm1)$ million $\\Upsilon(2S)$ mesons recorded by the BABAR detector at the PEP-II $e^+e^-$ collider at SLAC to perform a study of radiative transitions involving the $\\chi_{b\\mathrm{J}}(1P,2P)$ states in exclusive decays with $\\mu^+\\mu^-\\gamma\\gamma$ final states. We reconstruct twelve channels in four cascades using two complementary methods. In the first we identify both signal photon candidates in the Electromagnetic Calorimeter (EMC), employ a calorimeter timing-based technique to reduce backgrounds, and determine branching-ratio products and fine mass splittings. These results include the best observational significance yet for the $\\chi_{b0}(2P)\\rightarrow\\gamma\\Upsilon(2S)$ and $\\chi_{b0}(1P)\\rightarrow\\gamma\\Upsilon(1S)$ transitions. In the second method, we identify one photon candidate in the EMC and one which has converted into an $e^+e^-$ pair due to interaction with detector material, and we measure absolute product branching fractions. This metho...

  19. Two-body Charmed $B$ Meson Decays In Factorization Assisted Topological Amplitude Approach

    CERN Document Server

    Lu, Cai-Dian

    2016-01-01

    We analyze the two-body charmed $B$ meson decays $B_{u,d,s} \\to D^{(*)}P(V)$ in the factorization assisted topological amplitude approach, where $P(V)$ denoting a light pseudoscalar (vector) meson. Different from the conventional topological diagram approach, flavor $SU(3)$ symmetry breaking effects are taken into account. Therefore only four universal nonperturbative parameters are introduced to describe the contribution from non-factorization diagrams for all the decay channels. The number of free parameters and the $\\chi^2$ per degree of freedom are both significantly reduced comparing with the conventional topological diagram approach. With the 4 fitted parameters, we predict the branching fractions of 120 decay modes induced by both $b\\to c$ and $b\\to u$ transitions, which are well consistent with the measured data or to be tested on the future experiments. We also investigated the relative size of different topological diagrams, isospin violation, flavor $SU(3)$ symmetry breaking effects, compared with ...

  20. Dicty_cDB: CHI458 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHI458 (Link to dictyBase) - - - Contig-U15607-1 CHI458P (Link to Original ... n*il nnnnynknnhqkhtlkkhkn*nkkkke*nn*kkiekimfqkv*lk*mis *qnlnh*ikll nlfhqmvivyikqlqtny*likilmkkrvkvmqrn*eq* ...

  1. Mesons on a transverse lattice

    CERN Document Server

    Dalley, S

    2001-01-01

    The meson eigenstates of the light-cone Hamiltonian in a coarse transverse lattice gauge theory are investigated. Building upon previous work in pure gauge theory, the Hamiltonian and its Fock space are expanded in powers of dynamical fields. In the leading approximation, the couplings appearing in the Hamiltonian are renormalised by demanding restoration of space-time symmetries broken by the cut-off. Additional requirements from chiral symmetry are discussed and difficulties in imposing them from first principles in the leading approximation are noted. A phenomenological calculation is then performed, in which chiral symmetry in spontaneously broken form is modelled by imposing the physical pion-rho mass splitting as a constraint. The light-cone wavefunctions of the resulting Hamiltonian are used to compute decay constants, form factors and quark momentum and spin distributions for the pion and rho mesons. Extensions beyond leading order, and the implications for first principles calculations, are briefly d...

  2. Measurement of Charm Meson Lifetimes

    International Nuclear Information System (INIS)

    We report measurements of the D0 , D+ , and D+s meson lifetimes using 3.7 fb-1 of e+e- annihilation data collected near the Υ(4S) resonance with the CLEO detector. The measured lifetimes of the D0 , D+ , and D+s mesons are 408.5±4.1+3.5-3.4 fs , 1033.6±22.1+9.9-12.7 fs , and 486.3±15.0+4.9-5.1 fs . The precision of these lifetimes are comparable to those of the best previous measurements, and the systematic errors are very different. In a single experiment we find that the ratio of the D+s and D0 lifetimes is 1.19±0.04 . copyright 1999 The American Physical Society

  3. Resurrection of the $\\sigma$ meson

    CERN Document Server

    Törnqvist, N A; Tornqvist, Nils A; Roos, Matts

    1995-01-01

    It is shown from a very general model and an analysis of data on the lightest 0++ meson nonet that the f0(980) and f0(1200) resonance poles are two manifestations of the same ss state. Similarily the a0(980) and the a0(1450) are likely to be two manifestations of the same qq state. On the other hand, the uu+dd state, when unitarized and strongly distorted by hadronic mass shifts, becomes an extremely broad Breit-Wigner-like background, m=860 MeV, Gamma=880 MeV, with its pole at s=(0.158-i0.235) GeV^2. This we identify with the sigma meson required by models for spontaneous breaking of chiral symmetry.

  4. Primakoff production of hybrid mesons

    International Nuclear Information System (INIS)

    The viability of Primakoff technique in searching for hybrid states, and exotic JPC = 1-+ isovector meson bar ρ in particular, is discussed. Results of searches for Primakoff production of an bar ρ in ρπ and ηπ final states produced in high energy interactions of pions with large-Z nuclei are reviewed, and the limits for the radiative coupling Γ( bar ρ+ → π+γ) are presented. Based on available experimental information, electromagnetic production rate estimates are given for the favored bar ρ → πf1(1285) channel. It is argued that a dedicated Primakoff production experiment can be sensitive to values of Γ( bar ρ+ → π+γ) ∼ keV, which makes such measurement a very interesting option for doing spectroscopy of gluonic (and conventional) meson states in the 1.5 ∼ 3 GeV mass range. 18 references, 2 figures

  5. Model Waveform Accuracy Requirements for the $\\chi^2$ Discriminator

    CERN Document Server

    Lindblom, Lee

    2016-01-01

    This paper derives accuracy standards for model gravitational waveforms required to ensure proper use of the $\\chi^2$ discriminator test in gravitational wave (GW) data analysis. These standards are different from previously established requirements for detection and waveform parameter measurement based on signal-to-noise optimization. We present convenient formulae both for evaluating and interpreting the contribution of model errors to measured $\\chi^2$ values. Motivated by these formula, we also present an enhanced, complexified variant of the standard $\\chi^2$ statistic used in GW searches. While our results are not directly relevant to current searches (which use the $\\chi^2$ test only to veto signal candidates with extremely high $\\chi^2$ values), they could be useful in future GW searches and as figures of merit for model gravitational waveforms.

  6. Baryons and Mesons with Beauty

    OpenAIRE

    Goldstein, Gary R.; Wali, Kameshwar C.

    2007-01-01

    Recent experimental findings of several mesons and baryons with "beauty" and "charm" as flavors remind us of the days when strangeness was discovered, and how its inclusion led to SU(3)-flavor symmetry with enormous success in the classification of the "proliferated" states into SU(3) multiplets. One of the key elements was the successful application of the first order perturbation in symmetry breaking, albeit what then appeared to be huge mass differences, and the prediction of new states th...

  7. Properties of the D mesons

    International Nuclear Information System (INIS)

    A review is given of the nonleptonic decays of D mesons. Included are measurements of the psi(3772), the accurate determination of D masses and their consequences, and inclusive measurements and tagged events. It is noted that the distinction between the above designated events is that in the former one detects a D decay and ignores the remainder of the event, while in the tagged events a D decay is detected and also the remainder of the event is studied. 39 references

  8. Exclusive meson production at HERMES

    CERN Document Server

    Manaenkov, Sergey

    2016-01-01

    The data were accumulated with the HERMES forward spectrometer using the 27.6 GeV longitudinally polarized electron or positron beam of HERA. Exclusive electroproduction of $\\omega$ mesons on unpolarized hydrogen and deuterium targets is studied in the kinematic region of $Q^2>1.0$ GeV$^2$, 3.0 GeV $< W <$ 6.3 GeV, and $-t'< 0.2 $ GeV$^{2}$, while for $\\rho^0$-meson production on a transversely polarized hydrogen target $-t'< 0.4$ GeV$^{2}$ is used. Spin-density matrix elements for $\\omega$ production are presented in projections of $Q^2$ or $-t'$, while the ratios of the helicity amplitudes for the reaction $\\gamma^*+p \\to \\rho^0+p$ are obtained in the entire kinematic region. The usage of the transversely polarized target allows for the first time the extraction of the ratios of certain nucleon-helicity-flip amplitudes to the natural-parity exchange amplitude $T_{0\\frac{1}{2}0\\frac{1}{2}}$ without the nucleon-helicity flip describing the longitudinal $\\rho^0$-meson production by the longitudinal...

  9. Dynamical meson melting in holography

    International Nuclear Information System (INIS)

    We discuss mesons in thermalizing gluon backgrounds in the N=2 supersymmetric QCD using the gravity dual. We numerically compute the dynamics of a probe D7-brane in the Vaidya-AdS geometry that corresponds to a D3-brane background thermalizing from zero to finite temperatures by energy injection. In static backgrounds, it has been known that there are two kinds of brane embeddings where the brane intersects the black hole or not. They correspond to the phases with melted or stable mesons. In our dynamical setup, we obtain three cases depending on final temperatures and injection time scales. The brane stays outside of the black hole horizon when the final temperature is low, while it intersects the horizon and settles down to the static equilibrium state when the final temperature is high. Between these two cases, we find the overeager case where the brane dynamically intersects the horizon although the final temperature is not high enough for a static brane to intersect the horizon. The interpretation of this phenomenon in the dual field theory is meson melting due to non-thermal effects caused by rapid energy injection. In addition, we comment on the late time evolution of the brane and a possibility of its reconnection

  10. From the ψ to charmed mesons

    International Nuclear Information System (INIS)

    This talk deals with the author's recollections about the discoveries of the J/ψ the ψ' as well as psion spectroscopy and charmed mesons. He gives a chronology for the ψ and ψ' discoveries. He also discusses the events which led to the charmed meson discovery as well as detailed discussions on the proof that the resonance observed in the K- π+ system, at 1,865 MeV, was indeed the predicted charmed meson

  11. Meson's Correlation Functions in a Nuclear Medium

    CERN Document Server

    Park, Chanyong

    2016-01-01

    We investigate meson's spectrum, decay constant and form factor in a nuclear medium through holographic two- and three-point correlation functions. To describe a nuclear medium composed of protons and neutrons, we consider a hard wall model on the thermal charged AdS geometry and show that due to the isospin interaction with a nuclear medium, there exist splittings of the meson's spectrum, decay constant and form factor relying on the isospin charge. In addition, we show that the rho-meson's form factor describing an interaction with pseudoscalar fluctuation decreases when the nuclear density increases, while the interaction with a longitudinal part of an axial vector meson increases.

  12. D mesons in a magnetic field

    CERN Document Server

    Gubler, Philipp; Lee, Su Houng; Oka, Makoto; Ozaki, Sho; Suzuki, Kei

    2015-01-01

    We investigate the mass spectra of open heavy flavor mesons in an external constant magnetic field within QCD sum rules. Spectral ans\\"atze on the phenomenological side are proposed in order to properly take into account mixing effects between the pseudoscalar and vector channels, and the Landau levels of charged mesons. The operator product expansion is implemented up to dimension--5 operators. As a result, we find for neutral D mesons a significant positive mass shift that goes beyond simple mixing effects. In contrast, charged D mesons are further subject to Landau level effects, which together with the mixing effects almost completely saturate the mass shifts obtained in our sum rule analysis.

  13. Meson's correlation functions in a nuclear medium

    Science.gov (United States)

    Park, Chanyong

    2016-09-01

    We investigate meson's spectrum, decay constant and form factor in a nuclear medium through holographic two- and three-point correlation functions. To describe a nuclear medium composed of protons and neutrons, we consider a hard wall model on the thermal charged AdS geometry and show that due to the isospin interaction with a nuclear medium, there exist splittings of the meson's spectrum, decay constant and form factor relying on the isospin charge. In addition, we show that the ρ-meson's form factor describing an interaction with pseudoscalar fluctuation decreases when the nuclear density increases, while the interaction with a longitudinal part of an axial vector meson increases.

  14. Photoproduction of vector mesons in nuclei

    International Nuclear Information System (INIS)

    The mass of vector mesons in the nuclear medium is of great interest in strong interaction dynamics because vector meson masses could decrease with increasing baryonic density as a consequence of chiral symmetry restoration. The purpose of this work is to define an observable sensitive to vector meson masses at nuclear matter density. This short paper reports some preliminary results which suggest that the quantum interference between (e+e-) pairs emitted in the photoproduction of ρ- and ω- mesons near threshold in heavy nuclei could be such quantity. (J.S.). 4 refs., 2 figs

  15. Single spin asymmetry for charm mesons

    Energy Technology Data Exchange (ETDEWEB)

    Dominguez Zacarias, G. [PIMAyC, Eje Central Lazaro Cardenas No. 152, Apdo. Postal 14-805, D.F. (Mexico); Herrera, G.; Mercado, J. [Centro de Investigacion y de Estudios Avanzados, Apdo. Postal 14-740, D.F. (Mexico)

    2007-08-15

    We study single spin asymmetries of D{sup 0} and D{sup -} mesons in polarized proton-proton collisions. A two component model is used to describe charm meson production. The production of D mesons occurs by recombination of the constituents present in the initial state as well as by fragmentation of quarks in the final state. This model has proved to describe the production of charm. The recombination component involves a mechanism of spin alignment that ends up in a single spin asymmetry. Experimental measurements of single spin asymmetry for pions at RHIC are compared with the model. Predictions for the asymmetry in D mesons are presented. (orig.)

  16. Single spin asymmetry for charm mesons

    International Nuclear Information System (INIS)

    We study single spin asymmetries of D0 and D- mesons in polarized proton-proton collisions. A two component model is used to describe charm meson production. The production of D mesons occurs by recombination of the constituents present in the initial state as well as by fragmentation of quarks in the final state. This model has proved to describe the production of charm. The recombination component involves a mechanism of spin alignment that ends up in a single spin asymmetry. Experimental measurements of single spin asymmetry for pions at RHIC are compared with the model. Predictions for the asymmetry in D mesons are presented. (orig.)

  17. Site responses in the Taipei basin during the 1999 Chi-Chi, Taiwan earthquake sequence

    International Nuclear Information System (INIS)

    On September 20, 1999 a magnitude ML 7.3 earthquake struck Taichung and Nantou in central Taiwan. Taipei basin located more than 100 km from the epicenter but also had many buildings damaged during the earthquake. In this study we use the main shock and aftershocks data of Chi-Chi earthquake to analyze the site effect of Taipei basin. The results show that the dominant low frequency band response is located in the western part of Taipei basin and Songshan area; the main high frequency band response areas are near the edge of basin. Another hand, comparing the results of amplification pattern with the location of damaged buildings found that the tall damaged buildings are located at the high response areas of low frequency band and the low-rise damaged structures are located at the high response areas of higher frequency band. From these results we can find the relationship between the site amplification and damaged structure distribution in the Taipei basin area during earthquakes. (authors)

  18. Tai Chi Chuan Exercise for Patients with Cardiovascular Disease

    Directory of Open Access Journals (Sweden)

    Ching Lan

    2013-01-01

    Full Text Available Exercise training is the cornerstone of rehabilitation for patients with cardiovascular disease (CVD. Although high-intensity exercise has significant cardiovascular benefits, light-to-moderate intensity aerobic exercise also offers health benefits. With lower-intensity workouts, patients may be able to exercise for longer periods of time and increase the acceptance of exercise, particularly in unfit and elderly patients. Tai Chi Chuan (Tai Chi is a traditional Chinese mind-body exercise. The exercise intensity of Tai Chi is light to moderate, depending on its training style, posture, and duration. Previous research has shown that Tai Chi enhances aerobic capacity, muscular strength, balance, and psychological well-being. Additionally, Tai Chi training has significant benefits for common cardiovascular risk factors, such as hypertension, diabetes mellitus, dyslipidemia, poor exercise capacity, endothelial dysfunction, and depression. Tai Chi is safe and effective in patients with acute myocardial infarction (AMI, coronary artery bypass grafting (CABG surgery, congestive heart failure (HF, and stroke. In conclusion, Tai Chi has significant benefits to patients with cardiovascular disease, and it may be prescribed as an alternative exercise program for selected patients with CVD.

  19. Dos and don'ts of reduced chi-squared

    CERN Document Server

    Andrae, Rene; Melchior, Peter

    2010-01-01

    Reduced chi-squared is a very popular method for model assessment, model comparison, convergence diagnostic, and error estimation in astronomy. In this manuscript, we discuss the pitfalls involved in using reduced chi-squared. There are two independent problems: (a) The number of degrees of freedom can only be estimated for linear models. Concerning nonlinear models, the number of degrees of freedom is unknown, i.e., it is not possible to compute the value of reduced chi-squared. (b) Due to random noise in the data, also the value of reduced chi-squared itself is subject to noise, i.e., the value is uncertain. This uncertainty impairs the usefulness of reduced chi-squared for differentiating between models or assessing convergence of a minimisation procedure. The impact of noise on the value of reduced chi-squared is surprisingly large, in particular for small data sets, which are very common in astrophysical problems. We conclude that reduced chi-squared can only be used with due caution for linear models, w...

  20. Strong decays of vector mesons to pseudoscalar mesons in the relativistic quark model

    CERN Document Server

    Ebert, D; Galkin, V O

    2014-01-01

    Strong decays of vector ($^3S_1$) mesons to the pair of pseudoscalar ($^1S_0$) mesons are considered in the framework of the microscopic decay mechanism and the relativistic quark model based on the quasipotential approach. The quark-antiquark potential, which was previously used for the successful description of meson spectroscopy and electroweak decays, is employed as the source of the $q\\bar q$ pair creation. The relativistic structure of the decay matrix element, relativistic contributions and boosts of the meson wave functions are comprehensively taken into account. The calculated rates of strong decays of light, heavy-light mesons and heavy quarkonia agree well with available experimental data.

  1. Dicty_cDB: CHI575 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHI575 (Link to dictyBase) - - - Contig-U16427-1 - (Link to Original site) ... yfg*ytlyiyiiq*nviffrtdfrkdgfhr*ry*ihgns*sck*irkryf*ngs ... nl*k*ncykiisins*fsk*csrkcc*mfrfin*ks*rftsnrny*yiik ... n--- Homology vs CSM-cDNA Score E Sequences producing s ignificant alignments: (bits) Value CHI575 (CHI575 ... 003.10. 2 Homology vs DNA Score E Sequences producing s ignificant alignments: (bits) Value N AC116956 |AC ... 12. 7 Homology vs Protein Score E Sequences producing s ignificant alignments: (bits) Value (Q86KD1) RecNa ...

  2. Inclusive decays of -meson to / and 1 using 386 × 106 $B \\bar{B}$ events

    Indian Academy of Sciences (India)

    Rajeev Kumar

    2016-02-01

    The inclusive decays of -mesons to charmonium have been studied in a data sample of 386 million $B\\bar{B}$ events. The data sample has been collected by the Belle detector at the KEKB asymmetric energy +− collider operating at the $\\Upsilon (4S)$ resonance. The branching fractions have been measured for the inclusive decays to $J/\\psi + X$ and $\\chi_{c1} +X$. The measured branching fraction for $J/\\psi + X$ is $\\mathcal{B}(B \\rightarrow J/\\psi (\\rightarrow e^{+}e^{−}) + X) = (1.10 \\pm 0.005 \\pm 0.057)\\%$ and $\\mathcal{B}(B \\rightarrow J/\\psi (\\rightarrow \\mu^{+}\\mu^{−})+X) = (1.08 \\pm 0.004 \\pm 0.056)\\%$, while the inclusive $\\chi_{c1} +X$ branching fraction is found to be $\\mathcal{B}(B \\rightarrow \\chi_{c1} + X) = (0.44 \\pm 0.01 \\pm 0.06)\\%$. The feed-down contribution from higher charmonium states is subtracted from the measured branching fractions and the direct branching fractions are obtained to be $\\mathcal{B}(B \\rightarrow J/\\psi +X) = (0.77\\pm 0.04 \\pm 0.06)\\%$ and $\\mathcal{B}(B \\rightarrow \\chi_{c1} +X) =(0.41 \\pm 0.01 \\pm 0.06)\\%$.

  3. η meson photoproduction on deuterium

    International Nuclear Information System (INIS)

    Measurements of the total and differential cross sections for η-meson photoproduction on a D2 liquid target from threshold to 1.2 GeV, have been taken using the tagged Bremsstrahlung photon beam produced by the electrons extracted from the ELSA storage ring at Bonn. The reaction was identified by detecting the eta decay products in the neutral meson spectrometer SPES0-2π, while the recoil baryons (proton, neutron or deuteron) were detected by a variety of large angle scintillator detectors. We succeeded to identify completely the final states corresponding to the production of an η meson on a Quasi-Free (QF) proton, a QF neutron and the coherent deuteron. The differential cross sections corresponding to the production of a coherent deuteron n the final state have been measured, from threshold to 800 MeV; they are 6 times smaller the only previous measurement reported by Anderson and Prepost in 1969. This is consistent with an Isoscalar part of the Amplitude much smaller than the Isovector one. The differential cross sections are in good agreement with the theoretical prediction on the impulse approximation mechanism; indicating in particular, fairly small contributions from rescattering terms. A direct measurement of the neutron to proton cross section ratios has been obtained by integrating the counting rates on the corresponding QF peaks and is 0.70 ± 0.03, from 700 MeV to 900 MeV, with a small angular dependence. These two results by comparison to the measured free proton data should allow to reconstruct the free neutron cross sections in a rather model-independent way. (authors). 56 refs., 90 figs., 13 tabs

  4. Heavy Mesons in Nuclear Matter and Nuclei

    CERN Document Server

    Tolos, Laura; Garcia-Recio, Carmen; Molina, Raquel; Nieves, Juan; Oset, Eulogio; Ramos, Angels; Romanets, Olena; Salcedo, Lorenzo Luis; Torres-Rincon, Juan M

    2014-01-01

    Heavy mesons in nuclear matter and nuclei are analyzed within different frameworks, paying a special attention to unitarized coupled-channel approaches. Possible experimental signatures of the properties of these mesons in matter are addressed, in particular in connection with the future FAIR facility at GSI.

  5. Heavy Mesons in Nuclear Matter and Nuclei

    International Nuclear Information System (INIS)

    Heavy mesons in nuclear matter and nuclei are analyzed within different frameworks, paying a special attention to unitarized coupled-channel approaches. Possible experimental signatures of the properties of these mesons in matter are addressed, in particular in connection with the future FAIR facility at GSI

  6. Experimental evidence for hadroproduction of exotic mesons

    International Nuclear Information System (INIS)

    New measurements of peripheral meson production are presented. The data confirm the existence of exotic mesons at 1.4 and 1.6 GeV/c2. The latter state dominates the eta'pi- decay spectrum. The data on eta pi+pi-pi- decay show large strength in several exotic (Jpc = 1- +) waves as well

  7. New results of radiative meson decays

    International Nuclear Information System (INIS)

    We have investigated Coulomb dissociation (the Primakoff effect) of high energy charged r and K mesons on heavy nuclei. New values for the electromagnetic transition rates G(p-→rg) and G(K-→K-g) have been extracted from the data. Some preliminary data for the Primakoff production of higher meson excitations will also be presented

  8. Pseudotensor mesons as three-body resonances

    CERN Document Server

    Roca, L

    2011-01-01

    We show that the lightest pseudotensor mesons J^{PC}=2^-+ can be regarded as molecules made of a pseudoscalar (P) 0^-+ and a tensor 2^++ meson, where the latter is itself made of two vector (V) mesons. The idea stems from the fact that the vector-vector interaction in s-wave and spin 2 is very strong, to the point of generating the 2^++ tensor mesons. On the other hand the interaction of a pseudoscalar with a vector meson in s-wave is also very strong and it generates dynamically the lightest axial-vector mesons. Therefore we expect the PVV interaction to be strongly attractive and thus able to build up quasibound PVV resonances. We calculate the three body PVV interaction by using the fixed center approximation to the Faddeev equations where the two vectors are clustered forming a tensor meson. We find clear resonant structures which can be identified with the pi_2(1670), eta_2(1645) and K^*_2(1770) (2^-+) pseudotensor mesons.

  9. Scalar and axial-vector mesons

    CERN Document Server

    Van Beveren, E; Beveren, Eef van; Rupp, George

    2007-01-01

    Nowadays, there exists an abundance of theoretical approaches towards the mesonic spectrum, ranging from confinement models of all kinds, i.e., glueballs, and quark-antiquark, multiquark and hybrid configurations, to models in which only mesonic degrees of freedom are taken into account. Nature seems to come out somewhere in the middle, neither preferring pure bound states, nor effective meson-meson physics with only coupling constants and possibly form factors. As a matter of fact, apart from a few exceptions, like pions and kaons, Nature does not allow us to study mesonic bound states of any kind, which is equivalent to saying that such states do not really exist. Hence, instead of extrapolating from pions and kaons to the remainder of the meson family, it is more democratic to consider pions and kaons mesonic resonances that happen to come out below the lowest threshold for strong decay. Nevertheless, confinement is an important ingredient for understanding the many regularities observed in mesonic spectra...

  10. Sigma meson in heavy ion collision

    International Nuclear Information System (INIS)

    We want to present a short theoretical prediction of the behaviour of the sigma meson in heavy ion collisions. It is considered that the sigma meson is a pion-pion correlation, resulting from the decay of the N*(1440) resonance. There will be presented some QMD simulations. (authors)

  11. Studies of Excited $D$ mesons in $B$ meson decays

    CERN Document Server

    AUTHOR|(CDS)2082679

    This thesis documents the studies of several three-body B + meson decays, each with a charged charmed meson in the final state. All analyses presented use a data sample recorded by the LHCb detector in 2011 and 2012, corresponding to an integrated luminosity of 3.0 $fb^{-1}$ of $pp$ collision data. The $B^{+} \\to D^{-}K^{+}\\pi^{+}$ and $B^{+} \\to D^{+}K^{+}\\pi^{-}$ decay modes are observed for the first time. The branching fraction of the favoured $B^{+} \\to D^{-}K^{+}\\pi^{+}$ decay mode is measured relative to the topologically similar $B^{+} \\to D^{-}\\pi^{+}\\pi^{+}$ decay and the $B^{+} \\to D^{-}K^{+}\\pi^{+}$ final state is used as a normalisation channel for the suppressed $B^{+} \\to D^{+}K^{+}\\pi^{-}$ decay branching fraction measurement. Searches are performed for the quasi-two-body decays $B^{+} \\to D^{+}K^{*}(892)^{0}$ and $B^{+} \\to D_{2}^{*}(2460)^{0}K^{+}$, using the sample of $B^{+} \\to D^{+}K^{+}\\pi^{-}$ candidate decays. No significant signals are observed for either decay mode and upper limits a...

  12. Light meson radial Regge trajectories

    OpenAIRE

    Badalian, A.M.; Bakker, B. L. G.; Simonov, Yu. A.

    2002-01-01

    A new physical mechanism is suggested to explain the universal depletion of high meson excitations. It takes into account the appearance of holes inside the string world sheet due to $q\\bar{q}$ pair creation when the length of the string exceeds the critical value $R_1 \\simeq 1.4$ fm. It is argued that a delicate balance between large $N_c$ loop suppression and a favorable gain in the action, produced by holes, creates a new metastable (predecay) stage with a renormalized string tension which...

  13. ν' meson as pseudoscalar gluonium

    International Nuclear Information System (INIS)

    The problem of the ν' meson as a pseudoscalar gluonium within the systematic approach to the resonance physics is considered. QCD sum rules induced by the current Gsub(μν)sup(α)Gsub(μν)sup(α) tilde constructed form gluon field operators are derived. By saturating the sum rules the ν' rough estimates fro the ν' mass and its residue are given. The difference between the ν' and typical quark states such as the rho is noted. Breaking of the operator expansion by the instanton effects is discussed

  14. Status of chiral meson physics

    Energy Technology Data Exchange (ETDEWEB)

    Bijnens, Johan [Department of Astronomy and Theoretical Physics, Lund University, Sölvegatan 14A, SE 22362 Lund (Sweden)

    2016-01-22

    This talk includes a short introduction to Chiral Perturbation Theory in the meson sector concentrating on a number of recent developments. I discuss the latest fit of the low-energy constants. Finite volume corrections are discussed for the case with twisted boundary conditions for form-factors and first results at two-loops for three flavours for masses. The last part discusses the extension to other symmetry breaking patterns relevant for technicolour and related theories as well as the calculation of leading logarithms to high loop orders.

  15. Results for light pseudoscalar mesons

    CERN Document Server

    Bazavov, A; DeTar, C; Du, X; Freeman, W; Gottlieb, Steven; Heller, Urs M; Hetrick, J E; Laiho, J; Levkova, L; Oktay, M B; Osborn, J; Sugar, R; Toussaint, D; Van de Water, R S

    2010-01-01

    We present the current status of the MILC collaboration's calculations of the properties of the light pseudoscalar meson sector. We use asqtad staggered ensembles with 2+1 dynamical flavors down to $a \\approx 0.045$ fm and light quark mass down to 0.05 $m_s$. Here we describe fits to the data using chiral forms from SU(3) chiral perturbation theory, including all staggered taste violations at NLO and the continuum NNLO chiral logarithms. We emphasize issues of convergence of the chiral expansion.

  16. Use of dipole sum rules to estimate upper and lower bounds for radiative and total widths of chi (3414), chi (3508), and chi (3552)

    International Nuclear Information System (INIS)

    Upper and lower bounds on the widths for chi/sub J/→γpsi (3095) can be estimated by assuming E1 transitions and approximate Russell-Saunders coupling for the cc-bar system. Experimental widths for psi (3684) →γchi/sub J/ the lower bound more restrictive, giving radiative widths of 160→240, 230→400, and 280→480 keV for 3414-, 3508-, and 3552-MeV states, respectively. Cascade branching ratio data permit estimation of the total widths as >1.6, 0.3-1.5, and 0.6-4 MeV, respectively

  17. Tai chi: physiological characteristics and beneficial effects on health

    OpenAIRE

    Li, J.; Hong, Y.; Chan, K.

    2001-01-01

    Objectives—To assess the characteristic effects of Tai Chi Chuan (TCC) exercise on metabolism and cardiorespiratory response, and to measure its effect on cardiorespiratory function, mental control, immune capacity, and the prevention of falls in elderly people.

  18. Dicty_cDB: CHI228 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHI228 (Link to dictyBase) - - - Contig-U16517-1 - (Link to Original site) ... *edmqvqv* ekviy*elkiffhlqevllnvvykvfqifilninhyymif*ivf *rtn*kkplihtyqql nqerdhkm*lylwlvvslmkrh*pftllil*ilv ...

  19. Vector meson mixing and charge symmetry violation

    International Nuclear Information System (INIS)

    We discuss the consistency of the traditional vector meson dominance (VMD) model for photons coupling to matter with the vanishing of vector meson-meson- and meson-photon mixing self-energies at q2 = O. This vanishing of vector mixing has been demonstrated in the context of rho-omega mixing for a large class of effective theories. As a further constraint on these models, we here apply them to a study of photon-meson mixing and VMD. We compare the predicted momentum dependence of two models with that extracted experimentally. We find that one model produces a momentum-dependence which is consistent with the data, while the other does not. Hence we conclude that comparison with VMD phenomenology provides a powerful constraint on such models. (author). 34 refs., 1 fig

  20. D-meson diffusion in hadronic matter

    International Nuclear Information System (INIS)

    We present effective-field-theory results with unitarized interactions on the D-meson transport coefficients in a gas populated by light mesons and baryons at finite temperature and baryochemical potential. The Fokker-Planck equation is used to compute the drag force, the relaxation time and the diffusion coefficients of D mesons for collisions at FAIR. At finite baryochemical potential, the combined effect of net baryonic density and sizable meson-baryon interaction makes the D mesons to relax more efficiently than in the μB = 0 case. We also describe the connection with the quark-gluon plasma phase in adiabatic trajectories on the phase diagram at both zero and finite baryochemical potential.

  1. Light Vector Mesons in the Nuclear Medium

    Energy Technology Data Exchange (ETDEWEB)

    Wood, Michael; Nasseripour, Rakhsha; Weygand, Dennis; Djalali, Chaden; Tur, Clarisse; Mosel, Ulrich; Muehlich, Pascal; Adams, Gary; Amaryan, Moscov; Amaryan, Moskov; Ambrozewicz, Pawel; Anghinolfi, Marco; Asryan, Gegham; Avagyan, Harutyun; Baghdasaryan, Hovhannes; Baillie, Nathan; Ball, James; Baltzell, Nathan; Barrow, Steve; Battaglieri, Marco; Bedlinskiy, Ivan; Bektasoglu, Mehmet; Bellis, Matthew; Benmouna, Nawal; Berman, Barry; Biselli, Angela; Blaszczyk, Lukasz; Bouchigny, Sylvain; Boyarinov, Sergey; Bradford, Robert; Branford, Derek; Briscoe, William; Brooks, William; Burkert, Volker; Butuceanu, Cornel; Calarco, John; Careccia, Sharon; Carman, Daniel; Carnahan, Bryan; Casey, Liam; Chen, Shifeng; Cheng, Lu; Cole, Philip; Collins, Patrick; Coltharp, Philip; Crabb, Donald; Crannell, Hall; Crede, Volker; Cummings, John; Dashyan, Natalya; De Vita, Raffaella; De Sanctis, Enzo; Degtiarenko, Pavel; Denizli, Haluk; Dennis, Lawrence; Deur, Alexandre; Dharmawardane, Kahanawita; Dickson, Richard; Dodge, Gail; Doughty, David; Dugger, Michael; Dytman, Steven; Dzyubak, Oleksandr; Egiyan, Hovanes; Egiyan, Kim; Elfassi, Lamiaa; Elouadrhiri, Latifa; Eugenio, Paul; Fedotov, Gleb; Feldman, Gerald; Feuerbach, Robert; Fradi, Ahmed; Funsten, Herbert; Garcon, Michel; Gavalian, Gagik; Gilfoyle, Gerard; Giovanetti, Kevin; Girod, Francois-Xavier; Goetz, John; Gordon, Christopher; Gothe, Ralf; Griffioen, Keith; Guidal, Michel; Guler, Nevzat; Guo, Lei; Gyurjyan, Vardan; Hadjidakis, Cynthia; Hafidi, Kawtar; Hakobyan, Hayk; Hakobyan, Rafael; Hanretty, Charles; Hardie, John; Hassall, Neil; Hersman, F.; Hicks, Kenneth; Hleiqawi, Ishaq; Holtrop, Maurik; Hyde, Charles; Ilieva, Yordanka; Ireland, David; Ishkhanov, Boris; Isupov, Evgeny; Ito, Mark; Jenkins, David; Jo, Hyon-Suk; Johnstone, John; Joo, Kyungseon; Juengst, Henry; Kalantarians, Narbe; Kellie, James; Khandaker, Mahbubul; Khetarpal, Puneet; Kim, Wooyoung; Klein, Andreas; Klein, Franz; Klimenko, Alexei; Kossov, Mikhail; Krahn, Zebulun; Kramer, Laird; Kubarovsky, Valery; Kuhn, Joachim; Kuhn, Sebastian; Kuleshov, Sergey; Lachniet, Jeff; Laget, Jean; Langheinrich, Jorn; Lawrence, David; Li, Ji; Livingston, Kenneth; Lu, Haiyun; MacCormick, Marion; Markov, Nikolai; Mattione, Paul; McAleer, Simeon; McKinnon, Bryan; McNabb, John; Mecking, Bernhard; Mehrabyan, Surik; Melone, Joseph; Mestayer, Mac; Meyer, Curtis; Mibe, Tsutomu; Mikhaylov, Konstantin; Minehart, Ralph; Mirazita, Marco; Miskimen, Rory; Mokeev, Viktor; Moriya, Kei; Morrow, Steven; Moteabbed, Maryam; Mueller, James; Munevar Espitia, Edwin; Mutchler, Gordon; Nadel-Turonski, Pawel; Niccolai, Silvia; Niculescu, Gabriel; Niculescu, Maria-Ioana; Niczyporuk, Bogdan; Niroula, Megh; Niyazov, Rustam; Nozar, Mina; Osipenko, Mikhail; Ostrovidov, Alexander; Park, Kijun; Pasyuk, Evgueni; Paterson, Craig; Pereira, Sergio; Pierce, Joshua; Pivnyuk, Nikolay; Pocanic, Dinko; Pogorelko, Oleg; Pozdnyakov, Sergey; Preedom, Barry; Price, John; Prok, Yelena; Protopopescu, Dan; Raue, Brian; Riccardi, Gregory; Ricco, Giovanni; Ripani, Marco; Ritchie, Barry; Ronchetti, Federico; Rosner, Guenther; Rossi, Patrizia; Sabatie, Franck; Salamanca, Julian; Salgado, Carlos; Santoro, Joseph; Sapunenko, Vladimir; Schumacher, Reinhard; Serov, Vladimir; Sharabian, Youri; Sharov, Dmitri; Shvedunov, Nikolay; Smith, Elton; Smith, Lee; Sober, Daniel; Sokhan, Daria; Stavinsky, Aleksey; Stepanyan, Stepan; Stepanyan, Samuel; Stokes, Burnham; Stoler, Paul; Strakovski, Igor; Strauch, Steffen; Taiuti, Mauro; Tedeschi, David; Tkabladze, Avtandil; Tkachenko, Svyatoslav; Todor, Luminita; Ungaro, Maurizio; Vineyard, Michael; Vlassov, Alexander; Watts, Daniel; Weinstein, Lawrence; Williams, Michael; Wolin, Elliott; Yegneswaran, Amrit; Zana, Lorenzo; Zhang, Bin; Zhang, Jixie; Zhao, Bo; Zhao, Zhiwen

    2008-07-01

    The light vector mesons ($\\rho$, $\\omega$, and $\\phi$) were produced in deuterium, carbon, titanium, and iron targets in a search for possible in-medium modifications to the properties of the $\\rho$ meson at normal nuclear densities and zero temperature. The vector mesons were detected with the CEBAF Large Acceptance Spectrometer (CLAS) via their decays to $e^{+}e^{-}$. The rare leptonic decay was chosen to reduce final-state interactions. A combinatorial background was subtracted from the invariant mass spectra using a well-established event-mixing technique. The $\\rho$ meson mass spectrum was extracted after the $\\omega$ and $\\phi$ signals were removed in a nearly model-independent way. Comparisons were made between the $\\rho$ mass spectra from the heavy targets ($A > 2$) with the mass spectrum extracted from the deuterium target. With respect to the $\\rho$-meson mass, we obtain a small shift compatible with zero. Also, we measure widths consistent with standard nuclear many-body eff

  2. Strange and charm mesons at FAIR

    CERN Document Server

    Tolos, L; Gamermann, D; Garcia-Recio, C; Molina, R; Nieves, J; Oset, E; Ramos, A

    2009-01-01

    We study the properties of strange and charm mesons in hot and dense matter within a self-consistent coupled-channel approach for the experimental conditions of density and temperature expected for the CBM experiment at FAIR/GSI. The in-medium solution at finite temperature accounts for Pauli blocking effects, mean-field binding of all the baryons involved, and meson self-energies. We analyze the behaviour in this hot and dense environment of dynamically-generated baryonic resonances together with the evolution with density and temperature of the strange and open-charm meson spectral functions. We test the spectral functions for strange mesons using energy-weighted sum rules and finally discuss the implications of the properties of charm mesons on the D_{s0}(2317) and the predicted X(3700) scalar resonances.

  3. Tai Chi Chuan Exercise for Patients with Cardiovascular Disease

    OpenAIRE

    Ching Lan; Ssu-Yuan Chen; May-Kuen Wong; Jin Shin Lai

    2013-01-01

    Exercise training is the cornerstone of rehabilitation for patients with cardiovascular disease (CVD). Although high-intensity exercise has significant cardiovascular benefits, light-to-moderate intensity aerobic exercise also offers health benefits. With lower-intensity workouts, patients may be able to exercise for longer periods of time and increase the acceptance of exercise, particularly in unfit and elderly patients. Tai Chi Chuan (Tai Chi) is a traditional Chinese mind-body exercise. T...

  4. Tai Chi Quan and Stroke Prevention and Rehabilitation

    OpenAIRE

    Yoshinaga, Shuri; Cai, Dingfang

    2013-01-01

    Stroke is a major cause of mortality and disability across the globe and remains the third leading cause of death in China, with the total stroke incidence increasing 6.7% annually from 1984 to 2004. The prevention of strokes is more important than their treatment. Tai Chi Quan is a slow and graceful Chinese exercise that includes a form of mindful meditation known for its health benefits. Many studies have shown that Tai Chi Quan not only improves gait, balance cap...

  5. Dicty_cDB: CHI718 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHI718 (Link to dictyBase) - G20569 DDB0188420 Contig-U11787-1 CHI718P (Lin ... 4 (Q9QZ71) RecName: Full=Xenotropic and polytropic retrovirus ... rece... 82 2e-14 (Q9R031) RecName: Full=Xenotropic ... and polytropic retrovirus ... rece... 82 2e-14 AF131096_1( AF131096 |pid:none) M ...

  6. CHI '13 Extended Abstracts on Human Factors in Computing Systems

    DEFF Research Database (Denmark)

    The CHI Papers and Notes program is continuing to grow along with many of our sister conferences. We are pleased that CHI is still the leading venue for research in human-computer interaction. CHI 2013 continued the use of subcommittees to manage the review process. Authors selected the subcommit......The CHI Papers and Notes program is continuing to grow along with many of our sister conferences. We are pleased that CHI is still the leading venue for research in human-computer interaction. CHI 2013 continued the use of subcommittees to manage the review process. Authors selected the...... tremendous amount of work from all areas of the human-computer interaction community. As co-chairs of the process, we are amazed at the ability of the community to organize itself to accomplish this task. We would like to thank the 2680 individual reviewers for their careful consideration of these papers. We...... that you enjoy these papers and notes, which represent the best research in human-computer interaction....

  7. The Viscosity of Meson Matter

    CERN Document Server

    Dobado, A; Dobado, Antonio; Llanes-Estrada, Felipe J.

    2003-01-01

    We report a calculation of the shear viscosity in a relativistic multicomponent meson gas as a function of temperature and chemical potentials. We approximately solve the Uehling-Uhlenbeck transport equation of kinetic theory, appropriate for a boson gas, with relativistic kinematics. Since at low temperatures the gas can be taken as mostly composed of pions, with a fraction of kaons and etas, we explore the region where binary elastic collisions with at least one pion are the dominant scattering processes. Our input meson scattering phase shifts are fits to the experimental data obtained from chiral perturbation theory and the Inverse Amplitude Method. Our results take the correct non-relativistic limit (viscosity proportional to the square root of the temperature), show a viscosity of order the cubed of the pion mass up to temperatures somewhat below that mass, and then a large increase due to kaons and etas. Our approximation may break down at even higher temperatures, where the viscosity follows a tempera...

  8. Mesons in relativistic quark model

    International Nuclear Information System (INIS)

    In the relativistic quark model formulated in the infinite momentum frame a self-consistent description has been obtained for a pion, ω- and ρ-mesons, K- and K*-mesons. The role of the relativistic effects in the description of radiative, leptonic and semileptonic decays of heavy quarkonia is studied. The relativistic effects are shown to lead to noticeable suppression of the ψ → ηcγ decay width predicted in nonrelativistic approximation; however the discrepancy with the experimental data still remains. Predictions are obtained for amplitudes of D → μν, Ds → μν, B → μν, D → πeν and D → Keν decays. The relativistic effects are shown to lead to strong supperssion of coupling constants of D → μν, Ds → μν, B → μν decays. The prediction obtained for the coupling constant FD = 230-270 MeV is close to the boundary of available experimental restriction. 46 refs.; 2 figs.; 5 tabs

  9. Pseudocalar meson and vector meson interactions and dynamically generated axial-vector mesons

    OpenAIRE

    Zhou, Yu; Ren, Xiu-Lei; Chen, Hua-Xing; Geng, Li-Sheng

    2014-01-01

    The axial-vector mesons $a_1(1260)$, $b_1(1235)$, $f_1(1285)$, $h_1(1170)$, $h_1(1380)$, and $K_1(1270)$ are dynamically generated in the unitized chiral perturbation theory. Such a picture has been tested extensively in the past few years. In this work, we calculate the interaction kernel up to $\\mathcal{O}(p^2)$ and study the impact on the dynamically generated axial-vector states. In anticipation of future lattice QCD simulations, we calculate the scattering lengths and the pole positions ...

  10. Strong Couplings of Three Mesons with Charm(ing) Involvement

    CERN Document Server

    Lucha, Wolfgang; Sazdjian, Hagop; Simula, Silvano

    2016-01-01

    We determine the strong couplings of three mesons that involve, at least, one $\\eta_c$ or $J/\\psi$ meson, within the framework of a constituent-quark model by means of relativistic dispersion formulations. For strong couplings of $J/\\psi$ mesons to two charmed mesons, our approach leads to predictions roughly twice as large as those arising from QCD sum rules.

  11. Effects of the hanging wall and footwall on peak acceleration during the Jiji (Chi-Chi), Taiwan Province, earthquake

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    The M=7.6 Jiji (Chi-Chi) earthquake, Taiwan Province, on September 21, 1999 (local time) is a thrust fault style earthquake. The empirical attenuation relations of the horizontal and vertical peak ground accelerations (PGA) for the Jiji (Chi-Chi) earthquake are developed by regression method. By examining the residuals from the Jiji (Chi-Chi) earthquake-specific peak acceleration attenuation relations, it is found that there are systematic differences between PGA on the hanging-wall and footwall. The recorded peak accelerations are higher on the hanging-wall and lower on the footwall. The clear asymmetry of PGA distribution to the surface rupture trace can also be seen from the PGA contour map. These evidences indicate that the PGA attenuates faster on the hanging-wall than on the footwall. In the study of near-source strong motion, seismic hazard assessment, scenario earthquake and seis-mic disaster prediction, the style-of-faulting must be considered in order that the attenuation model can reflect the characteristic of ground motion in various seismic environmental regions.

  12. Thermal Spectrum of Heavy Vector and Axial Vector Mesons in the Framework of QCD Sum Rules Method

    CERN Document Server

    Yazici, Enis

    2016-01-01

    The masses and the leptonic decay constants of vector and axial vector heavy-heavy mesons are calculated using the thermal QCD sum rules approach. While obtaining the QCD sum rules, additional operators in the Wilson expansion and also temperature dependency of the continuum threshold are taken into account. The masses and the decay constants remained unchanged up to $T\\simeq100~MeV$. After that point, they start to diminish. At the critical temperature, the masses decreased about $3\\%$, $5\\%$ and $14\\%$ for the vector mesons $\\Upsilon$, $B_{c}$ and $J/\\psi$; $6\\%$, $7\\%$ and $22\\%$ for the axial vector mesons $\\chi_{b1}$, $B_{c}$ and $\\chi_{c1}$, respectively. The decay constants reached about less than $20\\%$ of their vacuum values. The obtained results of the thermal mass and decay constant calculations at zero temperature are in a very good agreement with the other non-perturbative calculations at vacuum as well as with the experimental data.

  13. Distortion of the HBT images by meson clouds

    CERN Document Server

    Hattori, K

    2009-01-01

    We study the effects of mesonic final state interactions on the Hanbury Brown and Twiss (HBT) intensity interferometry for mesons in ultra-relativistic heavy ion collisions. Modification of the one-body amplitude of emitted mesons while going through a cloud of other mesons is estimated in the semiclassical approximation with a mesonic optical potential which incorporates both coherent forward scattering with other mesons and the absorption due to the incoherent scattering in the meson clouds. We show how these effects results in the distortion of the HBT images.

  14. Physiological responses to Tai Chi in stable patients with COPD.

    Science.gov (United States)

    Qiu, Zhi-Hui; Guo, Hong-Xi; Lu, Gan; Zhang, Ning; He, Bai-Ting; Zhou, Lian; Luo, Y M; Polkey, M I

    2016-01-15

    We compared the physiological work, judged by oxygen uptake, esophageal pressure swing and diaphragm electromyography, elicited by Tai Chi compared with that elicited by constant rate treadmill walking at 60% of maximal load in eleven patients with COPD (Mean FEV1 61% predicted, FEV1/FVC 47%). Dynamic hyperinflation was assessed by inspiratory capacity and twitch quadriceps tension (TwQ) elicited by supramaximal magnetic stimulation of the femoral nerve was also measured before and after both exercises. The EMGdi and esophageal pressure at the end of exercise were similar for both treadmill exercise and Tai Chi (0.109±0.047 mV vs 0.118±0.061 mV for EMGdi and 22.3±7.1 cmH2O vs 21.9±8.1 cmH2O for esophageal pressure). Moreover the mean values of oxygen uptake during Tai Chi and treadmill exercise did not differ significantly: 11.3 ml/kg/min (51.1% of maximal oxygen uptake derived from incremental exercise) and 13.4 ml/kg/min (52.5%) respectively, p>0.05. Respiratory rate during Tai Chi was significantly lower than that during treadmill exercise. Both Tai Chi and treadmill exercise elicited a fall in IC at end exercise, indicating dynamic hyperinflation, but this was statistically significant only after treadmill exercise. TwQ decreased significantly after Tai Chi but not after treadmill. We conclude that Tai Chi constitutes a physiologically similar stimulus to treadmill exercise and may therefore be an acceptable modality for pulmonary rehabilitation which may be culturally more acceptable in some parts of the world. PMID:26549554

  15. Exclusive φ meson production in HERMES

    Energy Technology Data Exchange (ETDEWEB)

    Golembiovskaya, Mayya

    2014-03-15

    In the present work exclusive φ meson leptoproduction at HERMES experiment in DESY was studied using the data collected at HERA accelerator in the period from 1998 till 2000 and from 2006 till 2007 years. In the analysis unpolarized and longitudinally polarized hydrogen and deuteron targets were used, the beam consisted of longitudinally polarized leptons. Via measurement of the angular and momentum distribution of the φ meson decay products 23 spin density matrix elements (SDMEs) for the φ meson were obtained. The number of SDMEs was defined by the experiment conditions, e.g. by the beam and target polarization directions. For the mentioned time period φ meson SDMEs were defined at HERMES for the first time. The quantities U{sub 1}, U{sub 2} and U{sub 3} which can be used to check presence of unnatural parity exchange (UPE) mechanism in phi meson production were calculated from SDMEs. All the results were obtained in 3 kinematic bins of Q{sup 2}, 4 kinematic bins of t' and for the integrated kinematics. No statistically significant difference between the results for hydrogen and deuteron targets was observed. The UPE quantities were found to be zero within 2 σ for the integrated kinematics, indicating negligible contribution of UPE for the φ meson production which is in agreement with theory predictions. The test of s-channel helicity conservation hypothesis via comparison of corresponding SDME values showed helicity conservation for the φ meson production.

  16. Exclusive φ meson production in HERMES

    International Nuclear Information System (INIS)

    In the present work exclusive φ meson leptoproduction at HERMES experiment in DESY was studied using the data collected at HERA accelerator in the period from 1998 till 2000 and from 2006 till 2007 years. In the analysis unpolarized and longitudinally polarized hydrogen and deuteron targets were used, the beam consisted of longitudinally polarized leptons. Via measurement of the angular and momentum distribution of the φ meson decay products 23 spin density matrix elements (SDMEs) for the φ meson were obtained. The number of SDMEs was defined by the experiment conditions, e.g. by the beam and target polarization directions. For the mentioned time period φ meson SDMEs were defined at HERMES for the first time. The quantities U1, U2 and U3 which can be used to check presence of unnatural parity exchange (UPE) mechanism in phi meson production were calculated from SDMEs. All the results were obtained in 3 kinematic bins of Q2, 4 kinematic bins of t' and for the integrated kinematics. No statistically significant difference between the results for hydrogen and deuteron targets was observed. The UPE quantities were found to be zero within 2 σ for the integrated kinematics, indicating negligible contribution of UPE for the φ meson production which is in agreement with theory predictions. The test of s-channel helicity conservation hypothesis via comparison of corresponding SDME values showed helicity conservation for the φ meson production.

  17. GlueX: Meson Spectroscopy in Photoproduction

    Energy Technology Data Exchange (ETDEWEB)

    Salgado, Carlos [Norfolk State University, JLAB; Smith, Elton S. [JLAB

    2014-03-01

    The goal of the GlueX experiment \\cite{gluex} is to provide crucial data to help understand the soft gluonic fields responsible for binding quarks in hadrons. Hybrid mesons, and in particular exotic hybrid mesons, provide the ideal laboratory for testing QCD in the confinement regime since these mesons explicitly manifest the gluonic degrees of freedom. Photoproduction is expected to be effective in producing exotic hybrids but there is little data on the photoproduction of light mesons. GlueX will use the new 12-GeV electron beam at Jefferson Lab to produce a 9-GeV beam of linearly polarized photons using the technique of coherent bremsstrahlung. A solenoid-based hermetic detector is under construction, which will be used to collect data on meson production and decays. These data will also be used to study the spectrum of conventional mesons, including the poorly understood excited vector mesons. This talk will give an update on the experiment as well as describe theoretical developments \\cite{Dudek:2011bn} to help understand how these data can provide insights into the fundamental theory of strong interactions.

  18. Quantum field theory approaches to meson structure

    International Nuclear Information System (INIS)

    Meson spectroscopy became one of the most interesting topics in particle physics in the last ten years. In particular, the discovery of new unexpected states in the charmonium spectrum which cannot be simply explained by the constituent quark model attracted the interest of many theoretical efforts. In the present thesis we discuss different meson structures ranging from light and heavy quark-antiquark states to bound states of hadrons-hadronic molecules. Here we consider the light scalar mesons f0(980) and a0(980) and the charmonium-like Y(3940), Y(4140) and Z±(4430) states. In the discussion of the meson properties like mass spectrum, total and partial decay widths and production rates we introduce three different theoretical methods for the treatment and description of hadronic structure. For the study of bound states of mesons we apply a coupled channel approach which allows for the dynamical generation of meson-meson resonances. The decay properties of meson molecules are further on studied within a second model based on effective Lagrangians describing the interaction of the bound state and its constituents. Besides hadronic molecules the effective Lagrangian approach is also used to study the radiative and strong decay properties of ordinary quark-antiquark (q anti q) states. The AdS/QCD model forms the completion of the three theoretical methods introduced in the present thesis. This holographic model provides a completely different ansatz and is based on extra dimensions and string theory. Within this framework we calculate the mass spectrum of light and heavy mesons and their decay constants.

  19. Search for radiative B meson decays

    International Nuclear Information System (INIS)

    The Crystal Ball detector at the ε+ε- storage ring DORIS-II has been used to search for radiative B meson decays, especially of the type b→sγ. No mono-energetic γ-lines have been found in the inclusive photon spectrum from Υ(4S) decays, and upper limits are obtained for radiative decays of B mesons to various strange mesons and to the D*. Integrating the photon spectrum over the corresponding energy range, we find BR(B→γX)-3 at 90% confidence level for the mass range 892 MeV≤MX≤2045 MeV. (orig.)

  20. The η' meson from lattice QCD

    International Nuclear Information System (INIS)

    We study the flavour singlet pseudoscalar mesons from first principles using lattice QCD. With Nf=2 flavours of light quark, this is the so-called η2 meson and we discuss the phenomenological status of this. Using maximally twisted-mass lattice QCD, we extract the mass of the η2 meson at two values of the lattice spacing for lighter quarks than previously discussed in the literature. We are able to estimate the mass value in the limit of light quarks with their physical masses. (orig.)

  1. Meson facility. Powerful new research tool

    International Nuclear Information System (INIS)

    A meson facility is being built at the Institute of Nuclear Research, USSR Academy of Sciences, in Troitsk, where the Scientific Center, USSR Academy of Sciences is located. The facility will include a linear accelerator for protons and negative hydrogen ions with 600 MeV energy and 0.5-1 mA beam current. Some fundamental studies that can be studied at a meson facility are described in the areas of elementary particles, neutron physics, solid state physics, and applied research. The characteristics of the linear accelerator are given and the meson facility's experimental complex is described

  2. Recent progress on light scalar mesons

    OpenAIRE

    Peláez Sagredo, José Ramón

    2014-01-01

    This is a brief account of the recent developments on the determination of the mass and widths of the much debated scalar mesons, paying particular attention to the causes of major revision of the σ or f_0(500) meson in the last edition of the Review of Particle Physics, which has finally acknowledged that the situation concerning the mass and width of this controversial state has been settled, although this was already well-known to scalar meson practitioners for about a decade. I will brief...

  3. Measurement of the B0-meson lifetime

    International Nuclear Information System (INIS)

    We report a measurement of the lifetime of the B0 meson based upon 29-GeV e+e- annihilation data taken with the Mark II detector at the SLAC storage ring PEP. The B0 mesons are tagged by their decays into D*-e+ν and D*-μ+ν, where the D*- is tagged by its decay into π-bar D0. We reconstruct the decay vertices of 15 B0-meson candidates and measure the B0 lifetime to be 1.20+0.52-0.36+0.160.14 psec

  4. Bottom-strange mesons in hyperonic matter

    OpenAIRE

    Pathak, Divakar; Mishra, Amruta

    2014-01-01

    The in-medium behavior of bottom-strange pseudoscalar mesons in hot, isospin asymmetric and dense hadronic environment is studied using a chiral effective model. The same was recently generalized to the heavy quark sector and employed to study the behavior of open-charm and open-bottom mesons. The heavy quark (anti-quark) is treated as frozen and all medium modifications of these bottom-strange mesons are due to their strange anti-quark (quark) content. We observe a pronounced dependence of t...

  5. An Improved Measurement of Mixing-induced CP Violation in the Neutral B Meson System

    CERN Document Server

    Abe, K; Abe, N; Abe, R; Abe, T; Adachi, I; Ahn, B S; Aihara, H; Akatsu, M; Asai, M; Asano, Y; Aso, T; Aulchenko, V M; Aushev, T; Bakich, A M; Ban, Y; Banas, E; Banerjee, S; Bay, A; Bedny, I; Behera, P K; Beiline, D; Bizjak, I; Bondar, A; Bozek, A; Bracko, M; Brodzicka, J; Browder, T E; Casey, B C K; Chang, M C; Chang, P; Chao, Y; Chen, K F; Cheon, B G; Chistov, R; Choi, S K; Choi, Y; Choi, Y K; Danilov, M; Dong, L Y; Dowd, R; Dragic, J; Drutskoy, A; Eidelman, S; Eiges, V; Enari, Y; Everton, C W; Fang, F; Fujii, H; Fukunaga, C; Gabyshev, N I; Garmash, A; Gershon, T J; Golob, B; Gordon, A; Gotow, K; Guler, H; Guo, R; Haba, J; Hanagaki, K; Handa, F; Hara, K; Hara, T; Harada, Y; Hashimoto, K; Hastings, N C; Hayashii, H; Hazumi, M; Heenan, E M; Higuchi, I; Higuchi, T; Hinz, L; Hirai, T; Hojo, T; Hokuue, T; Hoshi, Y; Hoshina, K; Hou Wei Shu; Hsu, S C; Huang, H C; Igaki, T; Igarashi, Y; Iijima, T; Inami, K; Ishikawa, A; Ishino, H; Itoh, R; Iwamoto, M; Iwasaki, H; Iwasaki, Y; Jackson, D J; Jalocha, P; Jang, H K; Jones, M; Kagan, R; Kakuno, H; Kaneko, J; Kang, J H; Kang, J S; Kapusta, P; Kataoka, M; Kataoka, S U; Katayama, N; Kawai, H; Kawakami, Y; Kawamura, N; Kawasaki, T; Kichimi, H; Kim, D W; Kim, H; Kim, H J; Kim, H O; Kim, S K; Kim, T H; Kinoshita, K; Kobayashi, S; Koishi, S; Korotushenko, K; Korpar, S; Krizan, P; Krokovnyi, P P; Kulasiri, R; Kumar, S; Kurihara, E; Kuzmin, A; Kwon, Y J; Lange, J S; Leder, Gerhard; Lee, S H; Li, J; Limosani, A; Liventsev, D; Lu, R S; MacNaughton, J; Majumder, G; Mandl, F; Marlow, D; Matsubara, T; Matsuishi, T; Matsumoto, S; Matsumoto, T; Mikami, Y; Mitaroff, Winfried A; Miyabayashi, K; Miyabayashi, Y; Miyake, H; Miyata, H; Moffitt, L C; Moloney, G R; Moorhead, G F; Mori, S; Mori, T; Murakami, A; Nagamine, T; Nagasaka, Y; Nakadaira, T; Nakamura, T; Nakano, E; Nakao, M; Nakazawa, H; Nam, J W; Narita, S; Natkaniec, Z; Neichi, K; Nishida, S; Nitoh, O; Noguchi, S; Nozaki, T; Ofuji, A; Ogawa, S; Ohno, F; Ohshima, T; Ohshima, Y; Okabe, T; Okuno, S; Olsen, S L; Onuki, Y; Ostrowicz, W; Ozaki, H; Pakhlov, P; Palka, H; Park, C W; Park, H; Park, K S; Peak, L S; Perroud, Jean-Pierre; Peters, M; Piilonen, L E; Prebys, E J; Rodríguez, J L; Ronga, F J; Root, N; Rózanska, M; Rybicki, K; Ryuko, J; Sagawa, H; Saitoh, S; Sakai, Y; Sakamoto, H; Sakaue, H; Satapathy, M; Satpathy, A; Schneider, O; Schrenk, S; Schwanda, C; Semenov, S; Senyo, K; Settai, Y; Seuster, R; Sevior, M E; Shibuya, H; Shimoyama, M; Shwartz, B A; Sidorov, A; Sidorov, V; Singh, J B; Soni, N; Stanic, S; Staric, M; Sugi, A; Sugiyama, A; Sumisawa, K; Sumiyoshi, T; Suzuki, K; Suzuki, S; Suzuki, S Y; Swain, S K; Takahashi, T; Takasaki, F; Tamai, K; Tamura, N; Tanaka, J; Tanaka, M; Taylor, G N; Teramoto, Y; Tokuda, S; Tomoto, M; Tomura, T; Tovey, Stuart N; Trabelsi, K; Trischuk, W; Tsuboyama, T; Tsukamoto, T; Uehara, S; Ueno, K; Unno, Y; Uno, S; Ushiroda, Y; Vahsen, S E; Varner, G; Varvell, K E; Wang Chao Cheng; Wang, C H; Wang, J G; Wang, M Z; Watanabe, Y; Won, E; Yabsley, B D; Yamada, Y; Yamaguchi, A; Yamamoto, H; Yamanaka, T; Yamashita, Y; Yamauchi, M; Yanai, H; Yanaka, S; Yashima, J; Yeh, P; Yokoyama, M; Yoshida, K; Yuan, Y; Yusa, Y; Yuta, H; Zhang, C C; Zhang, J; Zhang, Z P; Zheng, Y; Zhilich, V N; Zhu, Z M

    2002-01-01

    We present an improved measurement of the standard model CP violation parameter sin2phi_1 (also known as sin2beta) based on a sample of 85 times 10^6 B Bbar pairs collected at the Upsilon(4S) resonance with the Belle detector at the KEKB asymmetric-energy e+e- collider. One neutral B meson is reconstructed in a J/psi K_S, psi(2S) K_S, chi_{c1} K_S, eta_c K_S, J/psi K^{*0}, or J/psi K_L CP-eigenstate decay channel and the flavor of accompanying B meson is identified from itsdecay products. From the asymmetry in the distribution of the time intervals between the two B meson decay points, we obtain sin2phi_1 = 0.719 +/- 0.074(stat) +/- 0.035(syst). We also report measurements of CP violation parameters for the related B^0 -> J/psi pi^0 decay mode and the penguin-dominated processes B^0 -> eta' K_S, phi K_S and K^+K^- K_S.

  6. Weak decays of the Bc meson to Bs and B mesons in the relativistic quark model

    International Nuclear Information System (INIS)

    Semileptonic and non-leptonic decays of the Bc meson to Bs and B mesons, caused by the c→s,d quark transitions, are studied in the framework of the relativistic quark model. The heavy quark expansion in inverse powers of the active c and spectator anti b quark is used to simplify calculations while the final s and d quarks in the Bs and B mesons are treated relativistically. The decay form factors are explicitly expressed through the overlap integrals of the meson wave functions in the whole accessible kinematical range. The obtained results are compared with the predictions of other approaches. (orig.)

  7. Tetraquarks in the 1/N expansion and meson-meson resonances

    CERN Document Server

    Maiani, L; Riquer, V.

    2016-01-01

    Diquarks are found to have the right degrees of freedom to describe the tetraquark poles in hidden-charm to open-charm meson-meson amplitudes. Compact tetraquarks result as intermediate states in non-planar diagrams of the 1/N expansion and the corresponding resonances are narrower than what estimated before. The proximity of tetraquarks to meson-thresholds has an apparent role in this analysis and, in the language of meson molecules, an halving rule in the counting of states is obtained.

  8. Consumer Acceptance of Functional Foods in Ho Chi Minh City

    Directory of Open Access Journals (Sweden)

    Duy Tung BUI

    2015-11-01

    Full Text Available The aim of this paper is to identify and evaluate the underlying factors affecting consumer acceptance of functional foods. The contribution of this study is to better understand customer willingness to buy such products in Ho Chi Minh City by shedding light on how socio-demographic, cognitive and attitudinal determinants affect consumer's choices of foods. We conducted a survey using 217 respondents from Ho Chi Minh City. Next, we develop a binary-probit model to quantify the impact of each factor on consumer acceptance. The results show that having a sick relative, beliefs in health benefits positively affect acceptance level. Other than that, old people in Ho Chi Minh City tend to reject the use of functional foods. However, when they are provided with enough knowledge, they are the most intensive buyers of these products. Implications and further researches are also discussed.

  9. Modified meson-nucleus optical potentials

    CERN Document Server

    Wilkin, C

    1973-01-01

    The author argues that the energy dependence of the meson-nucleus optical potential should be treated in a more dynamical fashion. When this is done, some of the difficulties found in phenomenological applications are eliminated. (13 refs).

  10. (→ + - 0) meson photoproduction on proton

    Indian Academy of Sciences (India)

    Swapan Das

    2010-10-01

    The cross-section for the + - 0 invariant mass distribution in the $ p$ reaction in the GeV region is calculated. This reaction is assumed to proceed through the formation of the -meson in the intermediate state, because the production cross-section for this meson in the reaction in the GeV region is significant and it has a large branching ratio (88.8%) in the + − 0 channel. The cross-sections for this reaction are calculated using the energy-dependent reaction amplitude, → (0), extracted from the latest -meson photoproduction data. We use established procedure to calculate other factors, like width and propagator of the -meson, so that our calculation can provide reliable cross-section. The calculated results reproduce the measured + - 0 invariant mass distribution spectra in the reaction.

  11. Kaons in flavor tagged B meson decays

    International Nuclear Information System (INIS)

    Using the ARGUS detector at the e+e- storage ring DORIS II, measurements of multiplicities of pseudoscalar kaons, of K*(892) and of φ(1020) in B meson decays have been performed through studies of angular and charge correlations between the above particles and high momentum leptons produced in semileptonic B decays. The method has made it possible to measure the multiplicities separately for B-mesons and anti-B-mesons. The excess of like charge lepton-kaon pairs over opposite charge pairs in semileptonic decays was used for estimating the ratio of charmed decays over all decays, and thus also the fraction of charmless decays. A search for an excess of fast neutral kaons from rare B decays was also made. All the results obtained support the assumption that almost all B mesons decay through b → c transitions into charmed hadrons. (66 refs.)

  12. Atoms and mesons. Atomy i mezony

    Energy Technology Data Exchange (ETDEWEB)

    Kirillov-Ygryumov, V.G.; Nikitin, Yu.P.; Sergeev, F.M.

    1980-01-01

    A study is made of interactions between muons and hadrons and matter. Investigations are made of hadron-nuclear and lepton-nuclear interactions in the energy range that is characteristic of meson factories (up to 200 MeV). Considerable attention is given to meson and nuclear interactions in the bound state as well as to nuclear capture of mesons. An examination is made of the formation of high-energy and ..mu..-nucleon atoms, elastic and inelastic meson scattering on nuclei, the connection between scattering processes and mesoatoms, and their role in the structural analysis of nuclei and elementary particles. A phase analysis is made of experimental results for elastic scattering on nucleons and nuclei. The book is intended for scientists specializing in the physics of low energies. It might also be used by graduate and senior undergraduate students majoring in physics and physical engineering. 103 references, 31 figures, 18 tables.

  13. Photo and electroproduction of heavy mesons

    International Nuclear Information System (INIS)

    This report reviews first the η0 photoproduction then the photoproduction vector mesons and presents some results. Finally, some notes on the experimental devices which should have to be developed to undertake this study are given

  14. Measurement of charm mixing parameters and the neutral D meson decaying to a negative kaon-positive pion strong phase using quantum correlated neutral D meson-neutral anti-D meson pairs

    Science.gov (United States)

    Lincoln, Adam J.

    The decays of D0 and D0 mesons produced from e +e- annihilations at the psi'' resonance reflect quantum correlations so that decay rates are sensitive to interference between indistinguishable final states. Using the CLEO-c detector at the Cornell Electron Storage Ring, we measure the time-independent decay rates of D0 decays to K-pi +, K+pi-, several CP eigenstates, and semileptonic states. We make use of both partially and fully reconstructed D0 - D0 pairs. A chi2 minimization fitter extracts from these decay rates mixing and doubly Cabibbo suppressed decay parameters x2, y, r 2, and cos delta, along with isolated D 0 branching fractions for all input final states. By constraining the branching fractions and r2 with independent measurements, a first measurement of cos delta can be made.

  15. A CHI wiggler ubitron amplifier experiment: Wiggler characterization

    Energy Technology Data Exchange (ETDEWEB)

    Taccetti, J.M.; Jackson, R.H.; Freund, H.P. [Naval Research Lab., Washington, DC (United States)] [and others

    1995-12-31

    A 35 GHz CHI (Coaxial Hybrid Iron) wiggler ubitron amplifier experiment is under construction at the Naval Research Laboratory. The CHI wiggler configuration has the potential of generating high wiggler magnetic fields at short periods with excellent beam focusing and transport properties. This makes it a desirable configuration for the generation of high power coherent radiation in relatively compact systems. The CHI wiggler consists of alternating rings of magnetic and non-magnetic materials concentric with a central rod of similar alternating design but shifted along the axis by half a period. Once inserted in a solenoidal magnetic field, the CHI structure deforms the axial field to create a radial field oscillating with the same periodicity as the rings. An annular electron beam is propagated through the coaxial gap where the oscillating radial field imparts an azimuthal wiggle motion. The principal goals of the experiment are to investigate the performance tradeoffs involved in the CHI configuration for high frequency amplifiers operating at low voltages with small wiggler periods. The nominal design parameters are a center frequency of 35 GHz, wiggler period of 0.75 cm, and beam voltage of approximately 150 kV. Calculations have shown an intrinsic (untapered) efficiency of {approximately} 7% when operating at 6.3 kG axial field (wiggler field, B{sub w}{approximately}1270 G). The calculated gain was 36 dB, saturating at a distance of 46 cm. These parameters yield an instantaneous amplifier bandwidth of {approximately} 25%. There appears to be room for further improvement in efficiency, a matter which will be scrutinized more closely in the final design. A prototype CHI wiggler is presently being fabricated for use in conjunction with an existing 30 kG superconducting solenoid. The performance properties of the prototype will be characterized and compared with linear and non-linear calculations.

  16. Chi-squared goodness of fit tests with applications

    CERN Document Server

    Balakrishnan, N; Nikulin, MS

    2013-01-01

    Chi-Squared Goodness of Fit Tests with Applications provides a thorough and complete context for the theoretical basis and implementation of Pearson's monumental contribution and its wide applicability for chi-squared goodness of fit tests. The book is ideal for researchers and scientists conducting statistical analysis in processing of experimental data as well as to students and practitioners with a good mathematical background who use statistical methods. The historical context, especially Chapter 7, provides great insight into importance of this subject with an authoritative author team

  17. Dicty_cDB: CHI642 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHI642 (Link to dictyBase) - - - Contig-U14351-1 CHI642E (Link to Original ... 37 (Q4G069) RecName: Full=Regulator of microtubule dynamics ... protein... 154 3e-36 AF151848_1( AF151848 |pid:non ... 36 (Q96DB5) RecName: Full=Regulator of microtubule dynamics ... protein... 153 5e-36 (Q5R8E4) RecName: Full=Regula ...

  18. The Shape of the Noncentral Chi-square Density

    CERN Document Server

    Yu, Yaming

    2011-01-01

    A noncentral chi-square density is log-concave if the degree of freedom is nu>=2. We complement this known result by showing that, for each 00 such that the chi-square with nu degrees of freedom and noncentrality parameter lambda has a decreasing density if lambda <= lambda_nu, and is bi-modal otherwise. The critical lambda_nu is characterized by an equation involving a ratio of modified Bessel functions. When an interior mode exists we derive precise bounds on its location.

  19. Chi-squared and Associations in Tabular Audiology Data

    OpenAIRE

    Muhammad N. Anwar; Michael P. Oakes; Ken McGarry

    2010-01-01

    In this paper, we have used the chi-squared test and Yule’s Q measure to discover associations in tables of patient audiology data. These records are examples of heterogeneous medical records, since they contain audiograms, textual notes and typical relational fields. In our first experiment we used the chi-squared measure to discover associations between the different fields of audiology data such as patient gender and patient age with diagnosis. Then, in our second experiment we used Yule’s...

  20. Dicty_cDB: CHI478 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHI478 (Link to dictyBase) - G01678 DDB0185605 Contig-U11784-1 CHI478P (Lin ... lis melanin b... 82 4e-14 ( P07524 ) RecName: Full=Tyrosinase ; EC=1.14.18.1; AltNam... 81 9e-14 AP009493_2447( A ... us subsp. gri... 80 2e-13 ( P06845 ) RecName: Full=Tyrosinase ; EC=1.14.18.1; AltNam... 79 4e-13 A24089( A24089 ) ...

  1. Quasinormal modes and meson decay rates

    Energy Technology Data Exchange (ETDEWEB)

    Hoyos, C. [Department of Physics, University of Wales Swansea, Swansea, SA2 8PP (United Kingdom); Landsteiner, K.; Montero, S. [Instituto de Fisica Teorica, C-XVI Universidad Autonoma de Madrid, 28049 Madrid (Spain)

    2007-05-15

    We model meson melting in a hot plasma by the quasinormal modes of D7-brane fluctuations of embeddings that fall into the horizon of a black hole in Ads{sub 5} x S{sup 5} geometry. The inverse of the imaginary part of the quasinormal frequency gives the lifetime of the meson in the plasma. We briefly comment on the possible application of our model to quarkonium suppression. (Abstract Copyright [2007], Wiley Periodicals, Inc.)

  2. Quasinormal modes and meson decay rates

    International Nuclear Information System (INIS)

    We model meson melting in a hot plasma by the quasinormal modes of D7-brane fluctuations of embeddings that fall into the horizon of a black hole in Ads5 x S5 geometry. The inverse of the imaginary part of the quasinormal frequency gives the lifetime of the meson in the plasma. We briefly comment on the possible application of our model to quarkonium suppression. (Abstract Copyright [2007], Wiley Periodicals, Inc.)

  3. Meson condensation in dense matter revisited

    CERN Document Server

    Yabu, H; Kubodera, K; Yabu, Hiroyuki

    1994-01-01

    The results for meson condensation in the literature vary markedly depending on whether one uses chiral perturbation theory or the current-algebra-plus-PCAC approach. To elucidate the origin of this discrepancy, we re-examine the role of the sigma-term in meson condensation. We find that the resolution of the existing discrepancy requires a knowledge of terms in the Lagrangian that are higher order in density than hitherto considered.

  4. THE ETA-MESON PHOTOPRODUCTION ON PROTON

    Czech Academy of Sciences Publication Activity Database

    Donoval, Jan; Bydžovský, Petr

    2011-01-01

    Roč. 26, 3-4 (2011), s. 645-646. ISSN 0217-751X. [11th International Workshop on Meson Production, Properties and Interaction. Krakow, 10.06.2010-15.06.2010] R&D Projects: GA ČR GA202/08/0984 Institutional research plan: CEZ:AV0Z10480505 Keywords : Eta-meson photoproduction * form factors * nucleon resonances Subject RIV: BG - Nuclear, Atomic and Molecular Physics , Colliders Impact factor: 1.053, year: 2011

  5. Rare meson decays into very light neutralinos

    CERN Document Server

    O'Leary, Ben

    2009-01-01

    Results are presented for the two-body decays of mesons into light neutralinos and from the first complete calculation of the loop-induced decays of kaons to pions plus light neutralinos and of B mesons to kaons plus light neutralinos. The branching ratios are shown to be strongly suppressed within the MSSM with minimal flavor violation, and no bounds on the neutralino mass can be inferred from experimental data, i.e. a massless neutralino is allowed.

  6. A light exotic qantiqg hermaphrodite meson

    International Nuclear Information System (INIS)

    It is suggested that qantiqg mesons may exist as low as 1Gev in mass. The exotic Jsup(PC)=1-+ multiplet will have distinctive decay modes and perhaps be relatively stable. The bag model spectrum of the lowest lying qantiqg multiplet including hyperfine splittings is computed analogously to Jaffe's (Phys. Lett.; 60B:201 (1976)) qantiqqantiq bag model multiplets. Relevance to light meson phenomenology is discussed. (author)

  7. Oscillations of neutral B mesons systems

    OpenAIRE

    Boucrot, J.

    1999-01-01

    The oscillation phenomenon in the neutral B mesons systems is now well established. The motivations and principles of the measurements are given; then the most recent results from the LEP experiments, the CDF collaboration at Fermilab and the SLD collaboration at SLAC are reviewed. The present world average of the $\\bd$ meson oscillation frequency is $\\dmd = 0.471 \\pm 0.016 \\ps$ and the lower limit on the $\\bs$ oscillation frequency is $\\dms > 12.4 \\ps at 95% CL$.

  8. Meson and baryon spectroscopy on the lattice

    Energy Technology Data Exchange (ETDEWEB)

    David Richards

    2010-12-01

    Recent progress at understanding the excited state spectrum of mesons and baryons is described. I begin by outlining the application of the variational method to compute the spectrum, and the program of anisotropic clover lattice generation designed for hadron spectroscopy. I present results for the excited meson spectrum, with continuum quantum numbers of the states clearly delineated. I conclude with recent results for the low lying baryon spectrum, and the prospects for future calculations.

  9. The interactions of heavy mesons with nuclei

    International Nuclear Information System (INIS)

    Data obtained from interactions of heavy mesons with nuclei is reviewed. Nucleon-nucleon reactions followed by p + d (or d+p) reactions and nucleon-nucleus reactions are described. A meson decay experiment is discussed. The fundamental importance of S11 (1535) in η-nucleon is stressed. The propagation of resonances through nuclear matter is considered. Improvements in this research field require the developement of a new accelerator generation

  10. Potential for discoveries in charm meson physics

    International Nuclear Information System (INIS)

    The possibility of using charm meson physics to test the Standard Model (SM) is reviewed. In the case of D0-bar D0 mixing, the SM contributions are carefully considered and the existence of a window for the observation of new physics is discussed. Some examples of extensions of the SM giving large mixing signals are presented. Finally, some distinctive aspects of CP violation and rare decays in charm mesons are discussed. copyright 1996 American Institute of Physics

  11. Bs mesons: semileptonic and nonleptonic decays

    Directory of Open Access Journals (Sweden)

    Albertus C.

    2014-01-01

    Full Text Available In this contribution we compute some nonleptonic and semileptonic decay widths of Bs mesons, working in the context of constituent quark models [1, 2]. For the case of semileptonic decays we consider reactions leading to kaons or different Jπ Ds mesons. The study of nonleptonic decays has been done in the factorisation approximation and includes the final states enclosed in Table 2.

  12. Beautiful mesons from QCD spectral sum rules

    Energy Technology Data Exchange (ETDEWEB)

    Narison, S. (OPM, Univ. Montpellier 2, 34 (France))

    1991-08-01

    We discuss the beautiful meson from the point of view of the QCD spectral sum rules (QSSR). The bottom quark mass and the mixed light quark-gluon condensates are determined quite accurately. The decay constant f{sub B} is estimated and we present some arguments supporting this result. The decay constants and the masses of the other members of the beautiful meson family are predicted. (orig.).

  13. Light $O^{++}$ Mesons: Scalargators in Florida

    OpenAIRE

    Pennington, M. R.

    2010-01-01

    Light scalar mesons abound in hadron processes, like the alligators in the Florida Everglades. Moreover, scalars are intimately tied to the vacuum structure of QCD. They are the product of many decays. Consequently, a rich source of recent information about them has come from experiments producing heavy flavour mesons. Indeed, scalars will continue to dominate many of the processes to be studied at forthcoming facilities like BESIII in Beijing, FAIR at GSI Darmstadt and the GlueX experiment a...

  14. Meson Condensation in Dense Matter Revisited

    OpenAIRE

    Yabu, Hiroyuki; Myhrer, F.; Kubodera, K.

    1994-01-01

    The results for meson condensation in the literature vary markedly depending on whether one uses chiral perturbation theory or the current-algebra-plus-PCAC approach. To elucidate the origin of this discrepancy, we re-examine the role of the sigma-term in meson condensation. We find that the resolution of the existing discrepancy requires a knowledge of terms in the Lagrangian that are higher order in density than hitherto considered.

  15. Exotic mesons in quenched lattice QCD

    CERN Document Server

    Bernard, C W; DeTar, C E; Gottlieb, S; Heller, U M; Hetrick, J E; McNeile, C; Rummukainen, K; Sugar, B; Toussaint, D; Wingate, M; Bernard, Claude; Grand, Thomas A. De; Tar, Carleton De; Gottlieb, Steven; Heller, Urs M.; Hetrick, James E.; Neile, Craig Mc; Rummukainen, Kari; Sugar, Bob; Toussaint, Doug; Wingate, Matthew

    1997-01-01

    Since gluons in QCD are interacting fundamental constituents just as quarks are, we expect that in addition to mesons made from a quark and an antiquark, there should also be glueballs and hybrids (bound states of quarks, antiquarks and gluons). In general, these states would mix strongly with the conventional q-bar-q mesons. However, they can also have exotic quantum numbers inaccessible to q-bar-q mesons. Confirmation of such states would give information on the role of "dynamical" color in low energy QCD. In the quenched approximation we present a lattice calculation of the masses of mesons with exotic quantum numbers. These hybrid mesons can mix with four quark (q-bar-q-bar-q-q) states. The quenched approximation partially suppresses this mixing. Nonetheless, our hybrid interpolating fields also couple to four quark states. Using a four quark source operator, we demonstrate this mixing for the 1-+ meson. Using the conventional Wilson quark action, we calculate both at reasonably light quark masses, intend...

  16. Spectroscopy of mesonic molecules with heavy-light flavour mesons

    CERN Document Server

    Rathaud, D P

    2016-01-01

    In this work, we have calculated the mass spectra and decay properties of dimesonic (meson-antimeson) bound state in the variational scheme. The intermesonic interaction considered as the Hellmann potential and One Pion Exchange potential. The mass spectra of the $D\\bar{D^{*}}$, $D\\bar{D_{s}^{*}}$, $D_{s}\\bar{D^{*}}$, $D_{s}\\bar{D_{s}^{*}}$, $D^{*}\\bar{D^{*}}$, $D_{s}^{*}\\bar{D_{s}^{*}}$, $D\\bar{B^{*}}$, $D\\bar{B_{s}^{*}}$, $D_{s}\\bar{B^{*}}$, $D_{s}\\bar{B_{s}^{*}}$, $B^{*}\\bar{D}$,$B^{*}\\bar{D_{s}}$, $B\\bar{B^{*}}$, $B_{s}\\bar{B^{*}}$, $B_{c}\\bar{B^{*}}$, $B^{*}\\bar{B^{*}}$, $B^{*}\\bar{B_{s}^{*}}$, $B_{s}^{*}\\bar{B_{s}^{*}}$ etc.. are calculated. The states X(3872), $X_{2c}(4013)$ ,$Z_{b}(10610)/X_{b}$ and $Z_{b}(10650)/X_{b2}$ are compared with $D\\bar{D^{*}}$, $D^{*}\\bar{D^{*}}$, $B\\bar{B^{*}}$ and $B^{*}\\bar{B^{*}}$ dimesonic bound states. To probe the molecular structure of the compared states, we have calculated the decay properties sensitive to their long and short distance structure of hadorinc molecul...

  17. Measurement of hadronic production of the chi /sub 1//sup ++/(3507) and the chi /sub 2//sup ++/(3553) through their radiative decay to J/ psi

    CERN Document Server

    Lemoigne, Y; Barate, R; Bareyre, P; Bonamy, P; Borgeaud, P; Brabson, B B; Crittenden, R R; David, M; Duane, A; Gentit, F X; Heinz, R M; King, G J; Krider, J; Laurens, G; Marshall, T; McEwen, J G; Namjoshi, R; Nandi, B C; Pietrzyk, B; Villet, G; Websdale, D M; Wiejak, J; Zaninotti, S

    1982-01-01

    The chi /sub 1//sup ++/(3507) and the chi /sub 2//sup ++/(3553) states have been observed in the Goliath spectrometer at the CERN SPS in 185 GeV/c\\pi^{-}-Be collisions. Their radiative decays contribute 27.7% (for the chi /sub 1//sup ++/) and 12.8% (for the chi /sub 2//sup ++/) to J/ psi production. At this energy, their cross sections are 65+or-19 nb and 96+or-29 nb, respectively.

  18. Anomalous effect in Schumann resonance phenomena observed in Japan, possibly associated with the Chi-chi earthquake in Taiwan

    Directory of Open Access Journals (Sweden)

    M. Hayakawa

    2005-06-01

    Full Text Available The Schumann resonance phenomenon has been monitored at Nakatsugawa (near Nagoya in Japan since the beginning of 1999, and due to the occurance of a severe earthquake (so-called Chi-chi earthquake on 21 September 1999 in Taiwan we have examined our Schumann resonance data at Nakatsugawa during the entire year of 1999. We have found a very anomalous effect in the Schumann resonance, possibly associated with two large land earthquakes (one is the Chi-chi earthquake and another one on 2 November 1999 (Chia-yi earthquake with a magnitude again greater than 6.0. Conspicuous effects are observed for the larger Chi-chi earthquake, so that we summarize the characteristics for this event. The anomaly is characterized mainly by the unusual increase in amplitude of the fourth Schumann resonance mode and a significant frequency shift of its peak frequency (~1.0Hz from the conventional value on the By magnetic field component which is sensitive to the waves propagating in the NS meridian plane. Anomalous Schumann resonance signals appeared from about one week to a few days before the main shock. Secondly, the goniometric estimation of the arrival angle of the anomalous signal is found to coincide with the Taiwan azimuth (the unresolved dual direction indicates toward South America. Also, the pulsed signals, such as the Q-bursts, were simultaneously observed with the "carrier" frequency around the peak frequency of the fourth Schumann resonance mode. The anomaly for the second event for the Chia-yi earthquake on 2 November had much in common. But, most likely due to a small magnitude, the anomaly appears one day before and lasts until one day after the main shock, with the enhancement at the fourth Schumann resonance mode being smaller in amplitude than the case of the Chi-chi earthquake. Yet, the other characteristics, including the goniometric direction finding result, frequency shift, etc., are nearly the same. Although the emphasis of

  19. Mass-producing B mesons

    International Nuclear Information System (INIS)

    Since the discovery of the upsilon resonances in 1977 the physics of the fifth quark - beauty - has played a vital role in establishing and consolidating today's Standard Model of particle physics. In recent years, a wealth of data on B particle (containing the beauty quark) has emerged from the detectors ARGUS (at the DORIS ring, DESY, Hamburg) and CLEO (at the Cornell CESR ring) as well as from CERN's LEP electron-positron collider and the proton-antiproton colliders at CERN and Fermilab. But the most challenging goal of this physics is to explore the mystery of CP violation, so far only seen in neutral kaon decays. This subtle mechanism - a disregard for the combined symmetry of particle antiparticle switching and left-right reflection - possibly moulded the evolution of the Universe after the Big Bang, providing a world dominated by matter, rather than one where matter and antimatter play comparable roles. To fully explore CP violation in the laboratory needs a dedicated machine - a particle 'factory' - to mass produce B mesons. Only when this full picture of CP violation has been revealed will physicists finally be able to solve its mysteries. As well as major proposals in the US and Japan, several ideas have been launched in Europe. Over the years, many working groups have accumulated an impressive amount of data and knowledge on the physics as well as on the machine and detectors. The spearheads of experimental B physics are the ARGUS and CLEO collaborations. Highlights include the determination of the parameters of the (Cabibbo-Kobayashi-Maskawa, CKM) quark mixing matrix, testing the consistency of the Standard Model with six quarks and three leptons, and giving the first indirect hint that the as yet unseen sixth ('top') quark is very heavy, together with initial indications of how it should decay. Valuable complementary information has come from proton-antiproton collider data and particularly from the LEP experiments at the

  20. Programme Note: Realities and Opportunities in Ho Chi Minh City.

    Science.gov (United States)

    Franchet, Chi Nguyen

    1996-01-01

    The current status of street children in Ho Chi Minh City, Vietnam, is characterized by marginalization from society through street vending, begging, theft, and prostitution. Evaluation of a drop-in center serving children without family linkages indicates need for needs assessments, follow-up activities, measurement of individual child progress,…

  1. Modulational instability in the nonlocal chi(2)-model

    DEFF Research Database (Denmark)

    Wyller, John Andreas; Krolikowski, Wieslaw; Bang, Ole;

    2007-01-01

    are recovered as the asymptotic limit of one of the branches of the plane waves (i.e. the adiabatic branch or the acoustic branch) of the full chi((2))-model by means of a singular perturbational approach. It is also proven that the stability results for the adiabatic branch continuously approach...

  2. Escape angles in bulk chi((2)) soliton interactions

    DEFF Research Database (Denmark)

    Johansen, Steffen Kjær; Bang, Ole; Sørensen, Mads Peter

    2002-01-01

    We develop a theory for nonplanar interaction between two identical type I spatial solitons propagating at opposite, but arbitrary transverse angles in quadratic nonlinear (or so-called chi((2))) bulk, media. We predict quantitatively the outwards escape angle, below which the solitons turn aroun...

  3. Dicty_cDB: CHI113 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHI113 (Link to dictyBase) - - - Contig-U14338-1 - (Link to Original site) ... 37591_59( DQ437591 |pid:none) Variola virus strain Sumatra ... 1970... 33 3.0 AL844504_205( AL844504 |pid:none) P ...

  4. Dicty_cDB: CHI816 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHI816 (Link to dictyBase) - G20190 DDB0202068 Contig-U14357-1 - (Link to O ... BD080275 |BD080275.1 Transgenic plant with altered morphology ... and endo-1,4-beta-glucanase gene, promoter and pro ...

  5. Bisimulation Lattice of Asymmetric Chi Calculus with Mismatch

    Institute of Scientific and Technical Information of China (English)

    Dong Xiaoju(董笑菊); Zhong Farong; Fu Yuxi

    2003-01-01

    This paper carries out a systematic investigation into the bisimulation lattice of asymmetric chi calculus with a mismatch combinator. It is shown that all the sixty three L-bisimilarities collapse to twelve distinct relations and they form a bisimulation lattice with respect to set inclusion. The top of the lattice coincides with the barbed bisimilarity.

  6. Dicty_cDB: CHI610 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHI610 (Link to dictyBase) - - - Contig-U14350-1 - (Link to Original site) ... CFFFFFWI*kk--- Translated Amino Acid sequence (All Frames ) Frame A: nsnthlthysqkkk**ink**in*ink*nfihi*lnfls* ...

  7. Measurement of $\\chi_{c1}$ and $\\chi_{c2}$ production with $\\sqrt{s}=7$ TeV $pp$ collisions at ATLAS

    CERN Document Server

    Aad, Georges; Abbott, Brad; Abdallah, Jalal; Abdel Khalek, Samah; Abdinov, Ovsat; Aben, Rosemarie; Abi, Babak; Abolins, Maris; AbouZeid, Ossama; Abramowicz, Halina; Abreu, Henso; Abulaiti, Yiming; Acharya, Bobby Samir; Adamczyk, Leszek; Adams, David; Addy, Tetteh; Adelman, Jahred; Adomeit, Stefanie; Adye, Tim; Aefsky, Scott; Agatonovic-Jovin, Tatjana; Aguilar-Saavedra, Juan Antonio; Agustoni, Marco; Ahlen, Steven; Ahmad, Ashfaq; Ahmadov, Faig; Aielli, Giulio; Åkesson, Torsten Paul Ake; Akimoto, Ginga; Akimov, Andrei; Alam, Muhammad Aftab; Albert, Justin; Albrand, Solveig; Alconada Verzini, Maria Josefina; Aleksa, Martin; Aleksandrov, Igor; Alessandria, Franco; Alexa, Calin; Alexander, Gideon; Alexandre, Gauthier; Alexopoulos, Theodoros; Alhroob, Muhammad; Aliev, Malik; Alimonti, Gianluca; Alio, Lion; Alison, John; Allbrooke, Benedict; Allison, Lee John; Allport, Phillip; Allwood-Spiers, Sarah; Almond, John; Aloisio, Alberto; Alon, Raz; Alonso, Alejandro; Alonso, Francisco; Altheimer, Andrew David; Alvarez Gonzalez, Barbara; Alviggi, Mariagrazia; Amako, Katsuya; Amaral Coutinho, Yara; Amelung, Christoph; Ammosov, Vladimir; Amor Dos Santos, Susana Patricia; Amorim, Antonio; Amoroso, Simone; Amram, Nir; Amundsen, Glenn; Anastopoulos, Christos; Ancu, Lucian Stefan; Andari, Nansi; Andeen, Timothy; Anders, Christoph Falk; Anders, Gabriel; Anderson, Kelby; Andreazza, Attilio; Andrei, George Victor; Anduaga, Xabier; Angelidakis, Stylianos; Anger, Philipp; Angerami, Aaron; Anghinolfi, Francis; Anisenkov, Alexey; Anjos, Nuno; Annovi, Alberto; Antonaki, Ariadni; Antonelli, Mario; Antonov, Alexey; Antos, Jaroslav; Anulli, Fabio; Aoki, Masato; Aperio Bella, Ludovica; Apolle, Rudi; Arabidze, Giorgi; Aracena, Ignacio; Arai, Yasuo; Arce, Ayana; Arfaoui, Samir; Arguin, Jean-Francois; Argyropoulos, Spyridon; Arik, Engin; Arik, Metin; Armbruster, Aaron James; Arnaez, Olivier; Arnal, Vanessa; Arslan, Ozan; Artamonov, Andrei; Artoni, Giacomo; Asai, Shoji; Asbah, Nedaa; Ask, Stefan; Åsman, Barbro; Asquith, Lily; Assamagan, Ketevi; Astalos, Robert; Astbury, Alan; Atkinson, Markus; Atlay, Naim Bora; Auerbach, Benjamin; Auge, Etienne; Augsten, Kamil; Aurousseau, Mathieu; Avolio, Giuseppe; Azuelos, Georges; Azuma, Yuya; Baak, Max; Bacci, Cesare; Bach, Andre; Bachacou, Henri; Bachas, Konstantinos; Backes, Moritz; Backhaus, Malte; Backus Mayes, John; Badescu, Elisabeta; Bagiacchi, Paolo; Bagnaia, Paolo; Bai, Yu; Bailey, David; Bain, Travis; Baines, John; Baker, Oliver Keith; Baker, Sarah; Balek, Petr; Balli, Fabrice; Banas, Elzbieta; Banerjee, Swagato; Banfi, Danilo; Bangert, Andrea Michelle; Bansal, Vikas; Bansil, Hardeep Singh; Barak, Liron; Baranov, Sergei; Barber, Tom; Barberio, Elisabetta Luigia; Barberis, Dario; Barbero, Marlon; Barillari, Teresa; Barisonzi, Marcello; Barklow, Timothy; Barlow, Nick; Barnett, Bruce; Barnett, Michael; Baroncelli, Antonio; Barone, Gaetano; Barr, Alan; Barreiro, Fernando; Barreiro Guimarães da Costa, João; Bartoldus, Rainer; Barton, Adam Edward; Bartos, Pavol; Bartsch, Valeria; Bassalat, Ahmed; Basye, Austin; Bates, Richard; Batkova, Lucia; Batley, Richard; Battistin, Michele; Bauer, Florian; Bawa, Harinder Singh; Beau, Tristan; Beauchemin, Pierre-Hugues; Beccherle, Roberto; Bechtle, Philip; Beck, Hans Peter; Becker, Anne Kathrin; Becker, Sebastian; Beckingham, Matthew; Beddall, Andrew; Beddall, Ayda; Bedikian, Sourpouhi; Bednyakov, Vadim; Bee, Christopher; Beemster, Lars; Beermann, Thomas; Begel, Michael; Behr, Katharina; Belanger-Champagne, Camille; Bell, Paul; Bell, William; Bella, Gideon; Bellagamba, Lorenzo; Bellerive, Alain; Bellomo, Massimiliano; Belloni, Alberto; Beloborodova, Olga; Belotskiy, Konstantin; Beltramello, Olga; Benary, Odette; Benchekroun, Driss; Bendtz, Katarina; Benekos, Nektarios; Benhammou, Yan; Benhar Noccioli, Eleonora; Benitez Garcia, Jorge-Armando; Benjamin, Douglas; Bensinger, James; Benslama, Kamal; Bentvelsen, Stan; Berge, David; Bergeaas Kuutmann, Elin; Berger, Nicolas; Berghaus, Frank; Berglund, Elina; Beringer, Jürg; Bernard, Clare; Bernat, Pauline; Bernhard, Ralf; Bernius, Catrin; Bernlochner, Florian Urs; Berry, Tracey; Berta, Peter; Bertella, Claudia; Bertolucci, Federico; Besana, Maria Ilaria; Besjes, Geert-Jan; Bessidskaia, Olga; Besson, Nathalie; Bethke, Siegfried; Bhimji, Wahid; Bianchi, Riccardo-Maria; Bianchini, Louis; Bianco, Michele; Biebel, Otmar; Bieniek, Stephen Paul; Bierwagen, Katharina; Biesiada, Jed; Biglietti, Michela; Bilbao De Mendizabal, Javier; Bilokon, Halina; Bindi, Marcello; Binet, Sebastien; Bingul, Ahmet; Bini, Cesare; Bittner, Bernhard

    2014-01-01

    The prompt and non-prompt production cross-sections for the $\\chi_{c1}$ and $\\chi_{c2}$ charmonium states are measured in $pp$ collisions at $\\sqrt{s}=7$ TeV with the ATLAS detector at the LHC using 4.5 fb-1 of integrated luminosity. The $\\chi_{c}$ states are reconstructed through the radiative decay $\\chi_{c}\\rightarrow J/\\psi\\,\\gamma$ (with $J/\\psi\\rightarrow\\mu^{+}\\mu^{-}$) where photons are reconstructed from $\\gamma\\rightarrow e^{+}e^{-}$ conversions. The production rate of the $\\chi_{c2}$ state relative to the $\\chi_{c1}$ state is measured for prompt and non-prompt $\\chi_{c}$ as a function of $J/\\psi$ transverse momentum. The prompt $\\chi_{c}$ cross-sections are combined with existing measurements of prompt $J/\\psi$ production to derive the fraction of prompt $J/\\psi$ produced in feed-down from $\\chi_{c}$ decays. The fractions of $\\chi_{c1}$ and $\\chi_{c2}$ produced in $b$-hadron decays are also measured. In addition to measurements of inclusive $\\chi_{c}$ production, the branching fraction ${\\cal B}(B^...

  8. Photoproduction and Decay of Light Mesons in CLAS

    Energy Technology Data Exchange (ETDEWEB)

    Amaryan, Moskov Jamalovich [Old Dominion University

    2013-08-01

    We present preliminary experimental results on photoproduction and decay of light mesons measured with CLAS setup at JLAB . This include Dalitz decay of pseudoscalar and vector mesons, radiative decay of pseudoscalar mesons as well hadronic decays of pseudoscalar and vector mesons. The collected high statistics in some of decay channels exceeds the world data by an order of magnitude and some other decay modes are observed for the first time. It is shown how the CLAS data will improve the world data on transition form factors of light mesons, Dalitz plot analyses, branching ratios of rare decay modes and other fundamental properties potentially accessible through the light meson decays.

  9. Oscillazioni del mesone D^0

    CERN Document Server

    Schiraldi, Vito; Morello, Michael Joseph

    In fisica delle particelle, con il termine di "oscillazione" si indica la trasformazione di una particella neutra nella sua antiparticella e viceversa, fenomeno dovuto al fatto che gli autostati di flavor non sono autostati della matrice di massa. Il Modello Standard delle interazioni fondamentali predice che l'oscillazione del mesone D^0 avvenga su tempi molto maggiori di una vita media, e appaia perciò come un effetto piccolo, inferiore al percento, in contrasto con il caso dei mesoni B^0 e B^0_s che oscillano con molta maggiore rapidità. Sperimentalmente, l'oscillazione dei mesoni D^0 è rimasta inosservata fino a tempi recenti: la prima evidenza sperimentale dell'esistenza di un effetto di oscillazione è stata ottenuta soltanto nella primavera del 2007 dagli esperimenti BaBar (SLAC, USA) e Belle (KEKB, Japan). Nell'agosto 2007 anche l’esperimento CDF (Fermilab, USA) ha presentato una evidenza simile, basata sull'analisi di una parte del campione di dati disponibile. La tesi descrive gli aspetti speri...

  10. Meson spectroscopy in the light quark sector

    International Nuclear Information System (INIS)

    Understanding the hadron spectrum is one of the fundamental issues in modern particle physics. We know that existing hadron configurations include baryons, made of three quarks, and mesons, made of quark-antiquark pairs. However most of the mass of the hadrons is not due to the mass of these elementary constituents but to their binding force. Studying the hadron spectrum is therefore a tool to understand one of the fundamental forces in nature, the strong force, and Quantum Chromo Dynamics (QCD), the theory that describes it. This investigation can provide an answer to fundamental questions as what is the origin of the mass of hadrons, what is the origin of quark confinement, what are the relevant degrees of freedom to describe these complex systems and how the transition between the elementary constituents, quarks and gluons, and baryons and mesons occurs. In this field a key tool is given by meson spectroscopy. Mesons, being made by a quark and an anti-quark, are the simplest quark bound system and therefore the ideal benchmark to study the interaction between quarks and understand what the role of gluons is. In this investigation, it is fundamental to precisely determine the spectrum and properties of mesons but also to search for possible unconventional states beyond the qq-bar configuration as tetra-quarks (qq q-bar q-bar), hybrids (qq-bar g) and glueballs. These states can be distinguished unambiguously from regular mesons when they have exotic quantum numbers, i.e. combinations of total angular momentum, spin and parity that are not allowed for qq-bar states. These are called exotic quantum numbers and the corresponding states are referred to as exotics. The study of the meson spectrum and the search for exotics is among the goals of several experiments in the world that exploit different reaction processes, as e+e- annihilation, pp-bar annihilation, pion scattering, proton-proton scattering and photo-production, to produce meson states. This intense effort

  11. Bottom-strange mesons in hyperonic matter

    CERN Document Server

    Pathak, Divakar

    2014-01-01

    The in-medium behavior of bottom-strange pseudoscalar mesons in hot, isospin asymmetric and dense hadronic environment is studied using a chiral effective model. The same was recently generalized to the heavy quark sector and employed to study the behavior of open-charm and open-bottom mesons. The heavy quark (anti-quark) is treated as frozen and all medium modifications of these bottom-strange mesons are due to their strange anti-quark (quark) content. We observe a pronounced dependence of their medium mass on baryonic density and strangeness content of the medium. Certain aspects of these in-medium interactions are similar to those observed for the strange-charmed mesons in a preceding investigation, such as the lifting of mass-degeneracy of $B_S^0$ and ${\\bar B}_S^0$ mesons in hyperonic matter, while the same is respected in vacuum as well as in nuclear matter. In general, however, there is a remarkable distinction between the two species, even though the formalism predicts a completely analogous in-medium...

  12. Rare meson decays into very light neutralinos

    CERN Document Server

    Dreiner, H K; Koschade, Daniel; Krämer, M; Langenfeld, Ulrich; O'Leary, Ben

    2009-01-01

    We investigate the bounds on the mass of the lightest neutralino from rare meson decays within the MSSM with and without minimal flavor violation. We present explicit formulae for the two-body decays of mesons into light neutralinos and perform the first complete calculation of the loop-induced decays of kaons to pions and light neutralinos and B mesons to kaons and light neutralinos. We find that the supersymmetric branching ratios are strongly suppressed within the MSSM with minimal flavor violation, and that no bounds on the neutralino mass can be inferred from experimental data, i.e. a massless neutralino is allowed. The branching ratios for kaon and B meson decays into light neutralinos may, however, be enhanced when one allows for non-minimal flavor violation. We find new constraints on the MSSM parameter space for such scenarios and discuss prospects for future kaon and B meson experiments. Finally, we comment on the search for light neutralinos in monojet signatures at the Tevatron and at the LHC.

  13. Rare meson decays into very light neutralinos

    Energy Technology Data Exchange (ETDEWEB)

    Dreiner, H.K.; Grab, S. [Bonn Univ. (Germany). Bethe Center for Theoretical Physics und Physikalisches Inst.; Koschade, D. [RWTH Aachen Univ. (Germany). Inst. fuer Theoretische Physik; London Univ. (United Kingdom). Centre for Reserach in String Theory; Kraemer, M.; O' Leary, B. [RWTH Aachen Univ. (Germany). Inst. fuer Theoretische Physik; Langenfeld, U. [Deutsches Elektronen-Synchrotron (DESY), Zeuthen (Germany)

    2009-05-15

    We investigate the bounds on the mass of the lightest neutralino from rare meson decays within the MSSM with and without minimal flavor violation. We present explicit formulae for the two-body decays of mesons into light neutralinos and perform the first complete calculation of the loop-induced decays of kaons to pions and light neutralinos and B mesons to kaons and light neutralinos. We find that the supersymmetric branching ratios are strongly suppressed within the MSSM with minimal flavor violation, and that no bounds on the neutralino mass can be inferred from experimental data, i.e. a massless neutralino is allowed. The branching ratios for kaon and B meson decays into light neutralinos may, however, be enhanced when one allows for non-minimal flavor violation. We find new constraints on the MSSM parameter space for such scenarios and discuss prospects for future kaon and B meson experiments. Finally, we comment on the search for light neutralinos in monojet signatures at the Tevatron and at the LHC. (orig.)

  14. Light Vector Mesons in the Nuclear Medium

    CERN Document Server

    Wood, M H; Weygand, D P; Djalali, C; Tur, C; Mosel, U; Mühlich, P; Adams, G; Amaryan, M J; Ambrozewicz, P; Anghinolfi, M; Asryan, G; Avakian, H; Bagdasaryan, H; Baillie, N; Ball, J P; Baltzell, N A; Barrow, S; Battaglieri, M; Bedlinskiy, I; Bektasoglu, M; Bellis, M; Benmouna, N; Berman, B L; Biselli, A S; Blaszczyk, L; Bouchigny, S; Boiarinov, S; Bradford, R; Branford, D; Briscoe, W J; Brooks, W K; Burkert, V D; Butuceanu, C; Calarco, J R; Careccia, S L; Carman, D S; Carnahan, B; Casey, L; Chen, S; Cheng, L; Cole, P L; Collins, P; Coltharp, P; Crabb, D; Crannell, H; Credé, V; Cummings, J P; Dashyan, N; De Vita, R; De Sanctis, E; Degtyarenko, P V; Denizli, H; Dennis, L; Deur, A; Dharmawardane, K V; Dickson, R; Dodge, G E; Doughty, D; Dugger, M; Dytman, S; Dzyubak, O P; Egiyan, H; Egiyan, K S; El Fassi, L; Elouadrhiri, L; Eugenio, P; Fedotov, G; Feldman, G; Feuerbach, R J; Fradi, A; Funsten, H; Garçon, M; Gavalian, G; Gilfoyle, G P; Giovanetti, K L; Girod, F X; Goetz, J T; Gordon, C I O; Gothe, R W; Griffioen, K A; Guidal, M; Guler, N; Guo, L; Gyurjyan, V; Hadjidakis, C; Hafidi, K; Hakobyan, H; Hakobyan, R S; Hanretty, C; Hardie, J; Hassall, N; Hersman, F W; Hicks, K; Hleiqawi, I; Holtrop, M; Hyde-Wright, C E; Ilieva, Y; Ireland, D G; Ishkhanov, B S; Isupov, E L; Ito, M M; Jenkins, D; Jo, H S; Johnstone, J R; Joo, K; Jüngst, H G; Kalantarians, N; Kellie, J D; Khandaker, M; Khetarpal, P; Kim, W; Klein, A; Klein, F J; Klimenko, A V; Kossov, M; Krahn, Z; Kramer, L H; Kubarovski, V; Kühn, J; Kuhn, S E; Kuleshov, S V; Lachniet, J; Laget, J M; Langheinrich, J; Lawrence, D; Ji, Li; Livingston, K; Lu, H Y; MacCormick, M; Markov, N; Mattione, P; McAleer, S; McKinnon, B; McNabb, J W C; Mecking, B A; Mehrabyan, S; Melone, J J; Mestayer, M D; Meyer, C A; Mibe, T; Mikhailov, K; Minehart, R; Mirazita, M; Miskimen, R; Mokeev, V; Moriya, K; Morrow, S A; Moteabbed, M; Müller, J; Munevar, E; Mutchler, G S; Nadel-Turonski, P; Niccolai, S; Niculescu, G; Niculescu, I; Niczyporuk, B B; Niroula, M R; Niyazov, R A; Nozar, M; Osipenko, M; Ostrovidov, A I; Park, K; Pasyuk, E; Paterson, C; Anefalos Pereira, S; Pierce, J; Pivnyuk, N; Pocanic, D; Pogorelko, O; Pozdniakov, S; Preedom, B M; Price, J W; Prok, Y; Protopopescu, D; Raue, B A; Riccardi, G; Ricco, G; Ripani, M; Ritchie, B G; Ronchetti, F; Rosner, G; Rossi, P; Sabati, F; Salamanca, J; Salgado, C; Santoro, J P; Sapunenko, V; Schumacher, R A; Serov, V S; Sharabyan, Yu G; Sharov, D; Shvedunov, N V; Smith, E S; Smith, L C; Sober, D I; Sokhan, D; Stavinsky, A; Stepanyan, S; Stepanyan, S S; Stokes, B E; Stoler, P; Strakovsky, I I; Strauch, S; Taiuti, M; Tedeschi, D J; Tkabladze, A; Tkachenko, S; Todor, L; Ungaro, M; Vineyard, M F; Vlassov, A V; Watts, D P; Weinstein, L B; Williams, M; Wolin, E; Yegneswaran, A; Zana, L; Zhang, B; Zhang, J; Zhao, B; Zhao, Z W

    2008-01-01

    The light vector mesons ($\\rho$, $\\omega$, and $\\phi$) were produced in deuterium, carbon, titanium, and iron targets in a search for possible in-medium modifications to the properties of the $\\rho$ meson at normal nuclear densities and zero temperature. The vector mesons were detected with the CEBAF Large Acceptance Spectrometer (CLAS) via their decays to $e^{+}e^{-}$. The rare leptonic decay was chosen to reduce final-state interactions. A combinatorial background was subtracted from the invariant mass spectra using a well-established event-mixing technique. The $\\rho$ meson mass spectrum was extracted after the $\\omega$ and $\\phi$ signals were removed in a nearly model-independent way. Comparisons were made between the $\\rho$ mass spectra from the heavy targets ($A > 2$) with the mass spectrum extracted from the deuterium target. With respect to the $\\rho$-meson mass, we obtain a small shift compatible with zero. Also, we measure widths consistent with standard nuclear many-body effects such as collisional...

  15. Rare meson decays into very light neutralinos

    International Nuclear Information System (INIS)

    We investigate the bounds on the mass of the lightest neutralino from rare meson decays within the MSSM with and without minimal flavor violation. We present explicit formulae for the two-body decays of mesons into light neutralinos and perform the first complete calculation of the loop-induced decays of kaons to pions and light neutralinos and B mesons to kaons and light neutralinos. We find that the supersymmetric branching ratios are strongly suppressed within the MSSM with minimal flavor violation, and that no bounds on the neutralino mass can be inferred from experimental data, i.e. a massless neutralino is allowed. The branching ratios for kaon and B meson decays into light neutralinos may, however, be enhanced when one allows for non-minimal flavor violation. We find new constraints on the MSSM parameter space for such scenarios and discuss prospects for future kaon and B meson experiments. Finally, we comment on the search for light neutralinos in monojet signatures at the Tevatron and at the LHC. (orig.)

  16. Static-light meson masses from twisted mass lattice QCD

    International Nuclear Information System (INIS)

    We compute the static-light meson spectrum using two-flavor Wilson twisted mass lattice QCD. We have considered five different values for the light quark mass corresponding to 300 MeVPSS mesons. (orig.)

  17. Review of meson spectroscopy: quark states and glueballs

    International Nuclear Information System (INIS)

    A group of three lectures on hadron spectroscopy are presented. Topics covered include: light L = 0 mesons, light L = 1 mesons, antiquark antiquark quark quark exotics, a catalogue of higher quark antiquark excitations, heavy quarkonium, and glueballs

  18. Auxiliary Field Meson Model at Finite Temperature and Density

    CERN Document Server

    Kouno, H; Kashiwa, K; Hamada, M; Tokudome, H; Matsuzaki, M; Yahiro, M

    2005-01-01

    Starting from many quark interactions, we construct a nonlinear sigma-omega model at finite temperature and density. The mesons are introduced as auxiliary fields. Effective quark-meson couplings are strongly related to effective meson masses, since they are derived simultaneously from the original many quark interactions. In this model, even if the effective omega-meson mass decreases due to the partial chiral restoration, the equation of state (EOS) of nuclear matter can become soft.

  19. Exclusive vector meson production at HERMES

    Directory of Open Access Journals (Sweden)

    Movsisyan Aram

    2014-06-01

    Full Text Available Exclusive electroproduction of vector mesons has been measured on hydrogen and deuterium targets at HERMES using the 27.6 GeV electron/positron beam of HERA. From this process, more information can be obtained about generalized parton distributions (GPDs, which provide a unified description of the structure of hadrons embedding longitudinal-momentum distributions (ordinary PDFs and transverse-position information (form factors. The study of the azimuthal distribution of the decay products via spin-density matrix elements provide constraints on helicity-amplitudes used to describe exclusive vector-meson production. Recent results from the HERMES experiment on the production of rho, omega and phi mesons will be presented.

  20. Exclusive vector meson production at HERMES

    Science.gov (United States)

    Movsisyan, Aram

    2014-06-01

    Exclusive electroproduction of vector mesons has been measured on hydrogen and deuterium targets at HERMES using the 27.6 GeV electron/positron beam of HERA. From this process, more information can be obtained about generalized parton distributions (GPDs), which provide a unified description of the structure of hadrons embedding longitudinal-momentum distributions (ordinary PDFs) and transverse-position information (form factors). The study of the azimuthal distribution of the decay products via spin-density matrix elements provide constraints on helicity-amplitudes used to describe exclusive vector-meson production. Recent results from the HERMES experiment on the production of rho, omega and phi mesons will be presented.

  1. Massive mesons in Weyl-Dirac theory

    Science.gov (United States)

    Mirabotalebi, S.; Ahmadi, F.; Salehi, H.

    2008-01-01

    In order to study the mass generation of the vector fields in the framework of a conformal invariant gravitational model, the Weyl-Dirac theory is considered. The mass of the Weyl’s meson fields plays a principal role in this theory, it connects basically the conformal and gauge symmetries. We estimate this mass by using the large-scale characteristics of the observed universe. To do this we firstly specify a preferred conformal frame as a cosmological frame, then in this frame, we introduce an exact possible solution of the theory. We also study the dynamical effect of the massive vector meson fields on the trajectories of an elementary particle. We show that a local change of the cosmological frame leads to a Hamilton-Jacobi equation describing a particle with an adjustable mass. The dynamical effect of the massive vector meson field presents itself in the form of a correction term for the mass of the particle.

  2. Magnetic properties of ground-state mesons

    CERN Document Server

    Simonis, Vytautas

    2016-01-01

    Starting with the bag model a method for the study of the magnetic properties (magnetic moments, magnetic dipole transition widths) of ground-state mesons is developed. We calculate the M1 transition moments and use them subsequently to estimate the corresponding decay widths. These are compared with experimental data, where available, and with the results obtained in other approaches. Finally, we give the predictions for the static magnetic moments of all ground-state vector mesons including those containing heavy quarks. We have a good agreement with experimental data for the M1 decay rates of light as well as heavy mesons. Therefore, we expect our predictions for the static magnetic properties (usual magnetic moments) to be of sufficiently high quality, too.

  3. Nuclear fission induced by Pi mesons

    International Nuclear Information System (INIS)

    Pi mesons are an important part of the interactions among strongly-interacting particles, and their reactions with complex nuclei involve reactions with a wide range of interactions and time scales, with the slowest being the familiar fission process. Decades of effort have produced a wide range of fission data with stopped and energetic charged beams, both positive and negative. These results are the result of many uncoordinated studies, but in total can give a very good view of pion-induced fission. This review will compare and combine the measurements, with comparisons to a range of theoretical expectations. It is found that the nature of fission induced by pi mesons is not significantly different from fission induced by other energetic particles, in spite of the special features of the mesonic beam. This specific arena of nuclear science may now be considered complete. (author)

  4. Mesons beyond the naive quark model

    CERN Document Server

    Amsler, C

    2004-01-01

    We discuss theoretical predictions for the existence of exotic (non-quark-model) mesons and review prominent experimental candidates. These are especially the f0(1500) and f0(1710) mesons for the scalar glueball, fJ(2220) for the tensor glueball, η(1410) for the pseudoscalar glueball, f0(600), f0(980), a0(980), the still to be firmly established κ(800) and the f2(1565) for or two-meson states, and π1(1400), π1(1600) for hybrid states. We conclude that some of these states exist, offer our views and discuss crucial issues that need to be investigated both theoretically and experimentally.

  5. Weak decays of K and π mesons

    International Nuclear Information System (INIS)

    Through a special interplay of strong and weak interactions, small but significant pieces with a ''wrong'' flavor could be introduced into wave functions of mesons. Thus, e.g., not only a (u bar s) pair, but also a (u bar d) pair can be found with some probability within K+, etc. The possible importance of such ''anomalous'' terms in understanding of K-meson decays is discussed in a new scheme. The scheme is characterized by diagrammatic calculations of full amplitudes in the long-distance environment. Two classes of models which correctly reproduce the main K-meson branching ratios and the ΔI=1/2 rule are constructed. The predictive power of the scheme is then tested in a decay of a kaon into a pion and a light hyperphoton

  6. Two, three, many body systems involving mesons

    CERN Document Server

    Oset, E; Khemchandani, K P; Roca, L; Yamagata, J

    2011-01-01

    In this talk we show recent developments on few body systems involving mesons. We report on an approach to Faddeev equations using chiral unitary dynamics, where an explicit cancellation of the two body off shell amplitude with three body forces stemming from the same chiral Lagrangians takes place. This removal of the unphysical off shell part of the amplitudes is most welcome and renders the approach unambiguous, showing that only on shell two body amplitudes need to be used. Within this approach, systems of two mesons and one baryon are studied, reproducing properties of the low lying $1/2^+$ states. On the other hand we also report on multirho and $K^*$ multirho states which can be associated to known meson resonances of high spin.

  7. Escape angles in bulk chi((2)) soliton interactions

    OpenAIRE

    Johansen, Steffen Kjær; Bang, Ole; Sørensen, Mads Peter

    2002-01-01

    We develop a theory for nonplanar interaction between two identical type I spatial solitons propagating at opposite, but arbitrary transverse angles in quadratic nonlinear (or so-called chi((2))) bulk, media. We predict quantitatively the outwards escape angle, below which the solitons turn around and collide, and above which they continue to move-away from each other. For in-plane interaction, the theory allows prediction of the Outcome of a collision through the inwards escape angle, i.e., ...

  8. Feynman Rules of Higher-order Poles in CHY Construction

    CERN Document Server

    Huang, Rijun; Luo, Ming-xing; Zhu, Chuan-Jie

    2016-01-01

    In this paper, we generalize the integration rules for scattering equations to situations where higher-order poles are present. We describe the strategy to deduce the Feynman rules of higher-order poles from known analytic results of simple CHY-integrands, and propose the Feynman rules for single double pole and triple pole as well as duplex-double pole and triplex-double pole structures. We demonstrate the validation and strength of these rules by ample non-trivial examples.

  9. Consumer Behaviour. Case: iPhone Ho Chi Minh City

    OpenAIRE

    Tran, Thi Xuan Oanh

    2016-01-01

    The main aim of this thesis is to figure out the factors that have influenced consumer behaviour of young iPhone users in Ho Chi Minh City. In this study, the author draw a conclusion based on the data collected from the survey and proposed some feasible recommendations for Apple and other high-end smartphone companies to understand their consumers and enhance brand equity. For the secondary data, a variety of theories, including consumers’ characteristics, promotion and the decision mak...

  10. eta' meson production in proton-proton collisions

    OpenAIRE

    K Nakayama; Arellano, H. F.; Durso, J.W.; Speth, J.(Institut für Kernphysik, Forschungszentrum Jülich, Jülich, D-52425, Germany)

    1999-01-01

    The pp -> pp eta' reaction is investigated within a relativistic meson-exchange model of hadronic interactions. We explore the role of nucleonic and mesonic, as well as the N* resonance currents, in producing eta' mesons. In order to learn more about the production mechanisms, new measurements in the energy region far from the threshold are required.

  11. Scalar mesons in a linear sigma model with (axial-)vector mesons

    CERN Document Server

    Parganlija, D; Wolf, Gy; Giacosa, F; Rischke, D H

    2012-01-01

    The structure of the scalar mesons has been a subject of debate for many decades. In this work we look for $\\bar{q}q$ states among the physical resonances using an extended Linear Sigma Model that contains scalar, pseudoscalar, vector, and axial-vector mesons both in the non-strange and strange sectors. We perform global fits of meson masses, decay widths and amplitudes in order to ascertain whether the scalar $\\bar{q}q$ states are below or above 1 GeV. We find the scalar states above 1 GeV to be preferred as $\\bar{q}q$ states.

  12. An Advanced Dictionary? Similarities and Differences between Duramazwi ReChiShona and Duramazwi Guru ReChiShona *

    Directory of Open Access Journals (Sweden)

    Emmanuel Chabata

    2011-10-01

    Full Text Available

    Abstract: In this article a comparative analysis of Duramazwi ReChiShona (DRC and Duramazwi Guru ReChiShona (DGC is made. Both DRC and DGC are monolingual Shona dictionaries compiled by a team of researchers under the African Languages Lexical (ALLEX Project, now the African Languages Research Institute (ALRI. During the compilation process, DRC was known as the General Shona Dictionary and DGC as the Advanced Shona Dictionary. A simple analysis of these titles shows that the dictionaries are similar in some ways and also different in others. The writer tries to show the ways in which DGC is regarded as a more advanced dictionary when compared to DRC. Although the argument of the article is mainly built on those differences which make DGC the more advanced, attention is also paid to the similarities between the dictionaries.

    Keywords: ALLEX PROJECT, ALRI, DURAMAZWI RECHISHONA, DURAMAZWI GURU RECHISHONA, DICTIONARY, SHONA, HEADWORD, SENSE, MONOLINGUAL DICTIONARY, CORPUS, IDIOM, PROVERB, PITHY SAYING

    Opsomming: 'n Gevorderde woordeboek? Ooreenkomste en verskille tussen Duramazwi ReChiShona en Duramazwi Guru ReChiShona. In hierdie artikel word 'n vergelykende ontleding van Duramazwi ReChiShona (DRC en Duramazwi Guru ReChiShona (DGC gemaak. Sowel die DRC en DGC is eentalige Sjonawoordeboeke, saamgestel deur ?n span navorsers by die African Languages Lexical (ALLEX Project, tans die African Languages Research Institute (ALRI. Gedurende die samestellingsproses was DRC bekend as die Algemene Sjonawoordeboek en DGC as die Gevorderde Sjonawoordeboek. 'n Eenvoudige ontleding van hierdie titels toon dat die woordeboeke op sommige maniere eenders en op ander ook verskillend is. Die skrywer probeer die maniere aantoon waarop DGC beskou word as 'n meer gevorderde woordeboek wanneer dit met DRC vergelyk word. Alhoewel die argument van die artikel hoofsaaklik gebou is op daardie verskille wat DGC die gevorderdste maak, word ook aandag gegee aan

  13. Scalar mesons from an effective Lagrangian approach

    CERN Document Server

    Fariborz, Amir H; Schechter, Joseph

    2007-01-01

    A brief discussion of the recent interest in light scalar mesons motivates the study of a generalized linear sigma model. In an SU(3) flavor invariant version of the model there is a prediction that the the lighter scalars have sizeable "four quark" content. It is further predicted that one of the singlet scalars should be exceptionally light. Due to the presence of scalar mesons, the model gives "controlled" corrections to the current algebra formula for threshold pion pion scattering. These corections act in the direction to improve agreement with current experiments.

  14. Light $O^{++}$ Mesons: Scalargators in Florida

    CERN Document Server

    Pennington, M R

    2010-01-01

    Light scalar mesons abound in hadron processes, like the alligators in the Florida Everglades. Moreover, scalars are intimately tied to the vacuum structure of QCD. They are the product of many decays. Consequently, a rich source of recent information about them has come from experiments producing heavy flavour mesons. Indeed, scalars will continue to dominate many of the processes to be studied at forthcoming facilities like BESIII in Beijing, FAIR at GSI Darmstadt and the GlueX experiment at JLab, making an understanding (or at least an excellent and theoretically consistent description) essential for the physics missions of these facilities.

  15. Heavy Meson Molecules in Effective Field Theory

    OpenAIRE

    AlFiky, Mohammad T.; Gabbiani, Fabrizio; Petrov, Alexey A.

    2006-01-01

    We consider the implications from the possibility that the recently observed state X(3872) is a meson-antimeson molecule. We write an effective Lagrangian consistent with the heavy-quark and chiral symmetries needed to describe X(3872). We explore the consequences of the assumption that X(3872) is a molecular bound state of D^{*0} and anti-D^0 mesons for the existence of bound states in the D^0-anti-D^0 and D^{*0}-anti-D^{*0}.

  16. Turbulent meson condensation in quark deconfinement

    Directory of Open Access Journals (Sweden)

    Koji Hashimoto

    2015-06-01

    Full Text Available In a QCD-like strongly coupled gauge theory at large Nc, using the AdS/CFT correspondence, we find that heavy quark deconfinement is accompanied by a coherent condensation of higher meson resonances. This is revealed in non-equilibrium deconfinement transitions triggered by static, as well as quenched electric fields even below the Schwinger limit. There, we observe a “turbulent” energy flow to higher meson modes, which finally results in the quark deconfinement. Our observation is consistent with seeing deconfinement as a condensation of long QCD strings.

  17. Mass shift of -meson in nuclear matter

    Indian Academy of Sciences (India)

    J R Morones-Ibarra; Mónica Menchaca Maciel; Ayax Santos-Guevara; Felipe Robledo Padilla

    2013-03-01

    The propagation of -meson in nuclear matter is studied in the Walecka model, by assuming that the sigma couples to a pair of nucleon–antinucleon states and to particle–hole states. The in-medium effect of - mixing is also studied. For completeness, the coupling of sigma to two virtual pions was also considered. It is found that the -meson mass decreases with respect to its value in vacuum and that the contribution of the - mixing effect on the mass shift is relatively small.

  18. Diffractive hadroproduction of charmed D mesons

    International Nuclear Information System (INIS)

    We have observed charmed D meson production from a hydrogen target in a 217 GeV/c π- beam. Hadronic decays in the K+-π+-π+- channels were reconstructed in the Chicago Cyclotron Spectrometer at Fermilab. The proton recoil angle and momentum transfer were programmed so that objects of mass near that of two D mesons would be produced in the forward direction. A mass peak in the 40-MeV bin at 1875 MeV was found in each channel. The cross section for D+- production is 6--10 μb

  19. Isospin-violating mixing in meson nonets

    International Nuclear Information System (INIS)

    Segregation into ideally mixed nonets results when the OZI-violating interaction which would mix u anti u, d anti d, and s anti s mesons into isospin and SU(3) eigenstates is much weaker than the s anti s-d anti d mass difference. We show that the d anti d-u anti u mass difference can begin to induce a similar segregation into d anti d and anti u mesons which leads to large isospin violations. An experimental example of such large isospin breaking (approx. 30%) which we predict has probably already been seen in f → K anti K. (orig.)

  20. CP violation in B meson decays

    Science.gov (United States)

    Noguchi, S.; Belle Group

    2003-06-01

    CP violation in neutral B meson decays has been observed confirming the prediction of the Kobayashi-Maskawa model where introduction of six quaks naturally induces CP violation in the weak interaction. The measurements of CP asymmetryc in B meson decays were made at the newly constructed Asymmetric B factories, which consist of high luminosity, ebergy-asymmetric e+e- colliders (KEKB and PEP-II) and detectors (Belle and BaBar). The results are in good agreement and are consistent with other experimental results within the framework of the Standard Model.

  1. Soft-wall modelling of meson spectra

    CERN Document Server

    Afonin, S S

    2016-01-01

    The holographic methods inspired by the gauge/gravity correspondence from string theory have been actively applied to the hadron spectroscopy in the last eleven years. Within the phenomenological bottom-up approach, the linear Regge-like trajectories for light mesons are naturally reproduced in the so-called "Soft-wall" holographic models. I will give a very short review of the underlying ideas and technical aspects related to the meson spectroscopy. A generalization of soft-wall description of Regge trajectories to arbitrary intercept is proposed. The problem of incorporation of the chiral symmetry breaking is discussed.

  2. $B$ and $B_s$ Meson Spectroscopy

    CERN Document Server

    Godfrey, S; Swanson, E S

    2016-01-01

    Properties of bottom and bottom-strange mesons are computed in two relativized quark models. Model masses and wavefunctions are used to predict radiative transition rates and the $^3P_0$ quark pair creation model is used to compute strong decay widths. A comparison to recently observed bottom and bottom-strange states is made. We find that there are numerous excited $B$ and $B_s$ mesons that have relatively narrow widths and significant branching ratios to simple final states such as $B\\pi$, $B^*\\pi$, $BK$, and $B^*K$ that could be observed in the near future.

  3. Light O++ Mesons: Scalargators in Florida

    International Nuclear Information System (INIS)

    Light scalar mesons abound in hadron processes, like the alligators in the Florida Everglades. Moreover, scalars are intimately tied to the vacuum structure of QCD. They are the product of many decays. Consequently, a rich source of recent information about them has come from experiments producing heavy flavour mesons. Indeed, scalars will continue to dominate many of the processes to be studied at forthcoming facilities like BESIII in Beijing, FAIR at GSI Darmstadt and the GlueX experiment at JLab, making an understanding (or at least an excellent and theoretically consistent description) essential for the physics missions of these facilities.

  4. Quasi-exotic open-flavor mesons

    CERN Document Server

    Hilger, T

    2016-01-01

    Meson states with exotic quantum numbers arise naturally in a covariant bound-state framework in QCD. We investigate the consequences of shifting quark masses such that the states are no longer restricted to certain C-parities, but only by J^P. Then, a priori, one can no longer distinguish exotic or conventional states. In order to identify signatures of the different states to look for experimentally, we provide the behavior of masses, leptonic decay constants, and orbital-angular-momentum decomposition of such mesons, as well as the constellations in which they could be found. Most prominently, we consider the case of charged quasi-exotic excitations of the pion.

  5. Pseudoscalar meson physics with four dynamical quarks

    CERN Document Server

    Bazavov, A; Bouchard, C; DeTar, C; Du, D; El-Khadra, A X; Foley, J; Freeland, E D; Gamiz, E; Gottlieb, Steven; Heller, U M; Hetrick, J E; Kim, J; Kronfeld, A S; Laiho, J; Levkova, L; Lightman, M; Mackenzie, P B; Neil, E T; Oktay, M; Simone, J N; Sugar, R L; Toussaint, D; Van de Water, R S; Zhou, R

    2012-01-01

    We present preliminary results for light, strange and charmed pseudoscalar meson physics from simulations using four flavors of dynamical quarks with the highly improved staggered quark (HISQ) action. These simulations include lattice spacings ranging from 0.15 to 0.06 fm, and sea-quark masses both above and at their physical value. The major results are charm meson decay constants f_D, f_{D_s} and f_{D_s}/f_D and ratios of quark masses. This talk will focus on our procedures for finding the decay constants on each ensemble, the continuum extrapolation, and estimates of systematic error.

  6. Amplitude analyses of the decays chi_c1 -> eta pi+ pi- and chi_c1 -> eta' pi+ pi-

    CERN Document Server

    Adams, G S; Ecklund, K M; Insler, J; Muramatsu, H; Park, C S; Pearson, L J; Thorndike, E H; Ricciardi, S; Thomas, C; Artuso, M; Blusk, S; Mountain, R; Skwarnicki, T; Stone, S; Zhang, L M; Bonvicini, G; Cinabro, D; Lincoln, A; Smith, M J; Zhou, P; Zhu, J; Naik, P; Rademacker, J; Asner, D M; Edwards, K W; Randrianarivony, K; Tatishvili, G; Briere, R A; Vogel, H; Onyisi, P U E; Rosner, J L; Alexander, J P; Cassel, D G; Das, S; Ehrlich, R; Gibbons, L; Gray, S W; Hartill, D L; Heltsley, B K; Kreinick, D L; Kuznetsov, V E; Patterson, J R; Peterson, D; Riley, D; Ryd, A; Sadoff, A J; Shi, X; Sun, W M; Yelton, J; Rubin, P; Lowrey, N; Mehrabyan, S; Selen, M; Wiss, J; Libby, J; Kornicer, M; Mitchell, R E; Shepherd, M R; Szczepaniak, A; Besson, D; Pedlar, T K; Cronin-Hennessy, D; Hietala, J; Dobbs, S; Metreveli, Z; Seth, K K; Tomaradze, A; Xiao, T; Martin, L; Powell, A; Wilkinson, G; Ge, J Y; Miller, D H; Shipsey, I P J; Xin, B

    2011-01-01

    Using a data sample of 2.59 x 10^7 psi(2S) decays obtained with the CLEO-c detector, we perform amplitude analyses of the complementary decay chains chi_c1 -> eta pi+ pi- and chi_c1 -> eta' pi+ pi-. We find evidence for a P-wave eta' pi scattering amplitude, which, if interpreted as a resonance, would have exotic J^PC = 1^-+ and parameters consistent with the pi_1(1600) state reported in other production mechanisms. We also make the first observation of the decay a_0(980) -> eta' pi and measure the ratio of branching fractions B(a_0(980) -> eta' pi)/B(a_0(980) -> eta pi) = 0.064 +- 0.014 +- 0.014. The pi pi spectrum produced with a recoiling eta is compared to that with eta' recoil.

  7. Issues in light meson spectroscopy: The case for meson spectroscopy at CEBAF

    Energy Technology Data Exchange (ETDEWEB)

    Godfrey, S. [Carleton Univ., Ottawa (Canada)

    1994-04-01

    The author reviews some outstanding issues in meson spectroscopy. The most important qualitative issue is whether hadrons with explicit gluonic degrees of freedom exist. To answer this question requires a much better understanding of conventional q{bar q} mesons. The author therefore begins by examining the status of conventional meson spectroscopy and how the situation can be improved. The expected properties of gluonic excitations are discussed with particular emphasis on hybrids to give guidance to experimental searches. Multiquark systems are commented upon as they are likely to be important in the mass region under study and will have to be understood better. In the final section the author discusses the opportunities that CEBAF can offer for the study of meson spectroscopy.

  8. Effects of isovector scalar meson on hyperon star

    CERN Document Server

    Biswal, S K; Patra, S K

    2016-01-01

    We study the effects of isovector-scalar ($\\delta$)-meson on neutron star. Influence of $\\delta$-meson on both static and rotating neutron star is discussed. Inclusion of $\\delta$-meson in a neutron star system consisting of proton, neutron and electron, make the equation of state stiffer in higher density and consequently increases the maximum mass of the star. But induction of $\\delta$-meson in the hyperon star decreases the maximum mass of the hyperon star. This is due to the early evolution of hyperons in presence of $\\delta-$meson.

  9. Three body resonances in two meson-one baryon systems

    OpenAIRE

    Martínez Torres, Alberto; Khemchandani, K. P.; Oset Báguena, Eulogio

    2007-01-01

    We report four $\\Sigma$'s and three $\\Lambda$'s, in the 1500 - 1800 MeV region, as two meson - one baryon S-wave $(1/2)^+$ resonances. We solve Faddeev equations in the coupled channel approach. The invariant mass of one of the meson-baryon pairs and that of the three particles have been varied and peaks in the squared three body $T$-matrix have been found very close to the existing $S$ = -1, $J^P= 1/2^+$ low lying baryon resonances. The input two-body $t$-matrices for meson-meson and meson-b...

  10. Two, three, many body systems involving mesons. Multimeson condensates

    CERN Document Server

    Oset, E; Dote, A; Hyodo, T; Khemchandani, P K; Liang, W H; Torres, A Martinez; Oka, M; Roca, L; Uchino, T; Xiao, C W

    2015-01-01

    In this talk we review results from studies with unconventional many hadron systems containing mesons: systems with two mesons and one baryon, three mesons, some novel systems with two baryons and one meson, and finally systems with many vector mesons, up to six, with their spins aligned forming states of increasing spin. We show that in many cases one has experimental counterparts for the states found, while in some other cases they remain as predictions, which we suggest to be searched in BESIII, Belle, LHCb, FAIR and other facilities.

  11. The best approximation of $P-$ metric space of $\\chi^{2}-$ defined by Musielak

    Directory of Open Access Journals (Sweden)

    NAGARAJAN SUBRAMANIAN

    2014-06-01

    Full Text Available In this paper, we introduce the idea of constructing sequence space $\\chi^{2}$ of best approximation in $p-$ metric defined by Musielak and also construct some general topological properties of approximation of $\\chi^{2}$

  12. Effect of tai chi exercise on proprioception of ankle and knee joints in old people

    OpenAIRE

    Xu, D.; Hong, Y; Li, J.; Chan, K.

    2004-01-01

    Objectives: To assess if tai chi, a traditional Chinese form of exercise, could improve proprioception in old people and if the effects of tai chi on proprioception are more evident than other exercise forms in the elderly.

  13. Nuclear matter with constituent meson quanta

    International Nuclear Information System (INIS)

    The authors discuss some nonperturbative techniques of field theory, where they dress nuclear matter as a whole with off-mass-shell pions. Here s-wave pion pairs simulate the effect of σ-meson of the mean field approach of Walecka. The signatures are in agreement with earlier results along with new physical insight

  14. New physics effects from meson decays

    Indian Academy of Sciences (India)

    Anirban Kundu

    2000-07-01

    In this talk, we point out some of the present and future possible signatures of physics beyond the Standard Model from -meson decays, taking -parity conserving and violating supersymmetry as illustrative examples. An expanded version is available on hep-ph archive.

  15. QED effects in the pseudoscalar meson sector

    Science.gov (United States)

    Horsley, R.; Nakamura, Y.; Perlt, H.; Pleiter, D.; Rakow, P. E. L.; Schierholz, G.; Schiller, A.; Stokes, R.; Stüben, H.; Young, R. D.; Zanotti, J. M.

    2016-04-01

    In this paper we present results on the pseudoscalar meson masses from a fully dynamical simulation of QCD+QED, concentrating particularly on violations of isospin symmetry. We calculate the π +- π 0 splitting and also look at other isospin violating mass differences. We have presented results for these isospin splittings in [1]. In this paper we give more details of the techniques employed, discussing in particular the question of how much of the symmetry violation is due to QCD, arising from the different masses of the u and d quarks, and how much is due to QED, arising from the different charges of the quarks. This decomposition is not unique, it depends on the renormalisation scheme and scale. We suggest a renormalisation scheme in which Dashen's theorem for neutral mesons holds, so that the electromagnetic self-energies of the neutral mesons are zero, and discuss how the self-energies change when we transform to a scheme such as overline{M S} , in which Dashen's theorem for neutral mesons is violated.

  16. Meson Screening Masses in Thermal QCD

    Directory of Open Access Journals (Sweden)

    Czerski Piotr

    2012-12-01

    Full Text Available The quark-gluon plasma (QGP excitations, corresponding to the scalar and pseudoscalar meson quantum numbers, for different temperatures are calculated. Analysis is performed in the Hard Thermal Loop (HTL Approximation and leads to a better understanding of the excitations of QGP in the deconfined phase and is also of relevance for lattice studies.

  17. Charming Mesons with Baryons and Nuclei

    Science.gov (United States)

    Tolos, Laura

    2013-11-01

    The properties of charmed mesons in nuclear matter and nuclei are reviewed. Different frameworks are discussed paying a special attention to unitarized coupled-channel approaches which incorporate heavy-quark spin symmetry. Several charmed baryon states with negative parity are generated dynamically by the s-wave interaction between pseudoscalar and vector meson multiplets with 1/2+ and 3/2+ baryons. These states are compared to experimental data. Moreover, the properties of open-charm mesons in matter are analyzed. The in-medium solution accounts for Pauli blocking effects, and for the meson self-energies in a self-consistent manner. The behavior in the nuclear medium of the rich spectrum of dynamically-generated baryon states is studied as well as their influence in the self-energy and, hence, the spectral function of open charm. The possible experimental signatures of the in-medium properties of open charm are finally addressed, such as the formation of charmed nuclei, in connection with the future FAIR facility.

  18. Charming mesons with baryons and nuclei

    CERN Document Server

    Tolos, Laura

    2013-01-01

    The properties of charmed mesons in nuclear matter and nuclei are reviewed. Different frameworks are discussed paying a special attention to unitarized coupled-channel approaches which incorporate heavy-quark spin symmetry. Several charmed baryon states with negative parity are generated dynamically by the s-wave interaction between pseudoscalar and vector meson multiplets with $1/2^+$ and $3/2^+$ baryons. These states are compared to experimental data. Moreover, the properties of open-charm mesons in matter are analyzed. The in-medium solution accounts for Pauli blocking effects, and for the meson self-energies in a self-consistent manner. The behavior in the nuclear medium of the rich spectrum of dynamically-generated baryon states is studied as well as their influence in the self-energy and, hence, the spectral function of open charm. The possible experimental signatures of the in-medium properties of open charm are finally addressed, such as the formation of charmed nuclei, in connection with the future F...

  19. Chiral dynamics of heavy-light mesons

    International Nuclear Information System (INIS)

    This thesis focuses on the physics of heavy-light mesons, i.e. quark-antiquark systems composed of a heavy (c or b) and a light (u, d or s) quark. The light-quark sector is treated within the framework of chiral effective field theory. Recent lattice QCD computations have progressed in determining the decay constants of charmed mesons and the scattering lengths of Nambu-Goldstone bosons (pions, kaons) off D mesons. These computations are performed for light quark masses larger than the physical ones. A chiral extrapolation down to physical masses is necessary. It is commonly performed using chiral perturbation theory. The related systematical uncertainties have to be examined carefully. In this thesis it is shown how these uncertainties can be reduced significantly by taking into account relativistic effects in the chiral extrapolations. As a byproduct, estimates are presented for several physical quantities that are related by heavy-quark spin and flavor symmetry. Furthermore, the investigation of the light-quark mass dependence of the scattering lengths of Nambu-Goldstone bosons off D mesons provides important information on the nature of one of the intriguing newly discovered resonances, the D*s0(2317). It is shown that this resonance can be dynamically generated from the coupled-channels DK interaction without a priori assumption of its existence. Finally we demonstrate how the underlying framework, unitarized chiral perturbation theory, can be improved by the inclusion of intermediate states with off-the-mass-shell kinematics.

  20. Hermaphrodite mesons and QCD sum rules

    International Nuclear Information System (INIS)

    We present a new evaluation of the two-point function built from the colourless operators g anti psilambdasup(α)γν(γ5)psiFsup(μν)sub(α). Previous calculations for the dimension-six vacuum condensate contributions were incomplete. We give new predictions for the masses and decay amplitudes of 1-+ and 0-- hermaphrodite mesons. (orig.)

  1. QED effects in the pseudoscalar meson sector

    International Nuclear Information System (INIS)

    We present results on the pseudoscalar meson masses from a fully dynamical simulation of QCD+QED. We concentrate particularly on violations of isospin symmetry. We calculate the π+-π0 splitting and also look at other isospin violating mass differences. We have presented results for these isospin splittings in arXiv:1508.06401 [hep-lat]. In this paper we give more details of the techniques employed, discussing in particular the question of how much of the symmetry violation is due to QCD, arising from the different masses of the u and d quarks, and how much is due to QED, arising from the different charges of the quarks. This decomposition is not unique, it depends on the renormalisation scheme and scale. We suggest a renormalisation scheme in which Dashen's theorem for neutral mesons holds, so that the electromagnetic self-energies of the neutral mesons are zero, and discuss how the self-energies change when we transform to a scheme such as MS, in which Dashen's theorem for neutral mesons is violated.

  2. On the Origin of the $XYZ$ Mesons

    CERN Document Server

    Valcarce, A

    2016-01-01

    In this talk we present a mechanism giving rise to exotic $XYZ$ four-quark states in the meson spectra within a constituent quark model approach. We discuss its generalization to five-quark states in the heavy baryon sector. Finally, we revise some other works in the literature and experimental data where this mechanism may be working.

  3. Composite vector mesons and string models

    International Nuclear Information System (INIS)

    The author discusses the general question of gauge mesons in extended supergravities, and whether such theories can produce the gauge mesons corresponding to a group at least as large as SU(3) x SU(2) x U(1). An exciting conjecture in this direction was made a few years ago by previous authors, who suggested that there might be composite SU(8) gauge mesons in a supergravity model known as the N=8 model. Until we have a consistent, renormalizable theory of supergravity we cannot really obtain any indication of the truth or falseness of that conjecture. One form of the Neveu-Schwarz string model has been shown to be a theory of supergravity; it is finite at the one-loop level and probably in any order of perturbation theory. The discussion is within the framework of this model. The author questions whether massive vector mesons can possibly lose their mass due to interactions. Arguments have been given on both sides of this question, and the author believes that this can occur under certain circumstances. Our conclusions is that the FNNS mechanism will create a gauge symmetry in addition to the rigid symmetry

  4. Mesons in the Constituent Quark Model

    Institute of Scientific and Technical Information of China (English)

    WANG Li; PING Jia-Lun

    2007-01-01

    The quark-antiquark (q(-q)) spectrum is studied by solving the Schrǒdinger equation in the framework of non-relativistic constituent quark model. An overall good fit to the experimental data of meson is obtained. The interactions between quark and antiquark consist of quadratic colour confinement-exchange, one-gluon-exchange, and Goldstone-boson-exchange potentials.

  5. Probing Polarized Parton Distributions with Meson Photoproduction

    CERN Document Server

    Afanasiev, A M; Wahlquist, C; Afanasev, Andrei; Carlson, Carl E.; Wahlquist, Christian

    1997-01-01

    Polarization asymmetries in photoproduction of high transverse momentum mesons are a flavor sensitive way to measure the polarized quark distributions. We calculate the expected asymmetries in several models, and find that the asymmetries are significant and also significantly different from model to model. Suitable data may come as a by-product of deep inelastic experiments to measure $g_1$ or from dedicated experiments.

  6. Mesonic spectroscopy of Minimal Walking Technicolor

    DEFF Research Database (Denmark)

    Del Debbio, Luigi; Lucini, Biagio; Patella, Agostino; Pica, Claudio; Rago, Antonio

    2010-01-01

    We investigate the structure and the novel emerging features of the mesonic non-singlet spectrum of the Minimal Walking Technicolor (MWT) theory. Precision measurements in the nonsinglet pseudoscalar and vector channels are compared to the expectations for an IR-conformal field theory and a QCD...

  7. L = 1 light quark mesons in QCD

    International Nuclear Information System (INIS)

    Using the Borel transformed QCD sum rule formalism, the masses of L = 1 light quark mesons with isospin I = 1 and I = 0 are calculated. Non-perturbative effects from higher dimensional operators up to dimension d = 6 in the operator product expansion are taken into account. (orig.)

  8. Meson spectroscopy in large-N QCD

    Energy Technology Data Exchange (ETDEWEB)

    Castagnini, Luca

    2015-06-23

    We present the results of a systematic, first-principles study of the spectrum and decay constants of mesons for different numbers of color charges N, via lattice computations. We discuss the extrapolations to the chiral, continuum and large-N limits and present a comparison of our results to some of the numerical computations and analytical predictions available in the literature.

  9. Lattice investigation of heavy meson interactions

    OpenAIRE

    Wagenbach, Björn; Bicudo, Pedro; Wagner, Marc

    2014-01-01

    We report on a lattice investigation of heavy meson interactions and of tetraquark candidates with two very heavy quarks. These two quarks are treated in the static limit, while the other two are up, down, strange or charm quarks of finite mass. Various isospin, spin and parity quantum numbers are considered.

  10. Bc mesons in the deconfined phase

    Directory of Open Access Journals (Sweden)

    Czerski Piotr

    2014-01-01

    Full Text Available Charmed B mesons in a deconfined quark-gluon plasma are studied. With the introduction of the bound state of a charm and a beauty quarks at finite temperature, the behavior of the heavy quarkonium is investigated in an energy region between the ψ and the ϒ states [1]. Calculations are performed within a potential model [2, 3].

  11. Scattering of vector mesons off nucleons

    International Nuclear Information System (INIS)

    We construct a relativistic and unitary approach to 'high' energy pion- and photon-nucleon reactions taking the πN, πΔ, ρN, ωN, ηN, K Λ, KΣ final states into account. Our scheme dynamically generates the s- and d-wave nucleon resonances N(1535), N(1650) and N(1520) and isobar resonances Δ(1620) and δ(1700) in terms of quasi-local interaction vertices. The description of photon-induced processes is based on a generalized vector-meson dominance assumption which directly relates the electromagnetic quasi-local 4-point interaction vertices to the corresponding vertices involving the ρ and ω fields. We obtain a satisfactory description of the elastic and inelastic pion- and photon-nucleon scattering data in the channels considered. The resulting s-wave ρ- and ω-nucleon scattering amplitudes are presented. Using these amplitudes we compute the leading density modification of the ρ and ω mass distributions in nuclear matter. We find a repulsive mass shift for the ω meson at small nuclear density but predict considerable strength in resonance-hole like ω-meson modes. Compared to previous calculations our result for the ρ-meson spectral function shows a significantly smaller in-medium effect. This reflects a not too large coupling strength of the N(1520) resonance to the ρN channel. (orig.)

  12. Meson spectroscopy in large-N QCD

    International Nuclear Information System (INIS)

    We present the results of a systematic, first-principles study of the spectrum and decay constants of mesons for different numbers of color charges N, via lattice computations. We discuss the extrapolations to the chiral, continuum and large-N limits and present a comparison of our results to some of the numerical computations and analytical predictions available in the literature.

  13. Summary of the {eta}-meson sessions

    Energy Technology Data Exchange (ETDEWEB)

    Chrien, R.E.

    1993-06-01

    This summary describes the contents of the nineteen talks related to research on the {eta} meson and presented at the Workshop of Future Directions. The subjects of this area include threshold {eta} production, {eta}-nuclear spectroscopy, baryon spectroscopy, {eta} decays, facilities, and instrumentation.

  14. Summary of the [eta]-meson sessions

    Energy Technology Data Exchange (ETDEWEB)

    Chrien, R.E.

    1993-01-01

    This summary describes the contents of the nineteen talks related to research on the [eta] meson and presented at the Workshop of Future Directions. The subjects of this area include threshold [eta] production, [eta]-nuclear spectroscopy, baryon spectroscopy, [eta] decays, facilities, and instrumentation.

  15. Finite-size scaling of meson propagators

    International Nuclear Information System (INIS)

    Using quenched chiral perturbation theory we compute meson correlation functions at finite volume and fixed gauge field topology. We also present the corresponding analytical predictions for the unquenched theory at fixed gauge field topology. These results can be used to measure the low-energy parameters of the chiral Langrangian from lattice simulations in volumes much smaller than one pion Compton wavelength. (orig.)

  16. QED effects in the pseudoscalar meson sector

    Energy Technology Data Exchange (ETDEWEB)

    Horsley, R. [Edinburgh Univ. (United Kingdom). School of Physics and Astronomy; Nakamura, Y. [RIKEN Advanced Institute for Computational Science, Kobe (Japan); Perlt, H. [Leipzig Univ. (Germany). Inst. fuer Theoretische Physik; Collaboration: QCDSF-UKQCD Collaboration; and others

    2015-09-15

    We present results on the pseudoscalar meson masses from a fully dynamical simulation of QCD+QED. We concentrate particularly on violations of isospin symmetry. We calculate the π{sup +}-π{sup 0} splitting and also look at other isospin violating mass differences. We have presented results for these isospin splittings in arXiv:1508.06401 [hep-lat]. In this paper we give more details of the techniques employed, discussing in particular the question of how much of the symmetry violation is due to QCD, arising from the different masses of the u and d quarks, and how much is due to QED, arising from the different charges of the quarks. This decomposition is not unique, it depends on the renormalisation scheme and scale. We suggest a renormalisation scheme in which Dashen's theorem for neutral mesons holds, so that the electromagnetic self-energies of the neutral mesons are zero, and discuss how the self-energies change when we transform to a scheme such as MS, in which Dashen's theorem for neutral mesons is violated.

  17. On hadronic production of the Bc meson

    International Nuclear Information System (INIS)

    Various approaches to the hadronic productions of the double heavy meson Bc are investigated in this paper. The resultant cross sections obtained by the approaches are compared with in several aspects. One may see that the differences are quite substantial. The advantages and shortcomings of the approaches are discussed. (author). 17 refs, 4 figs

  18. Meson Spectroscopy at JLab-12 GeV

    International Nuclear Information System (INIS)

    Meson, being the simplest hadronic bound system, is the ideal 'laboratory' to study the interaction between quarks, to understand the role of the gluons inside hadrons and to investigate the origin of color confinement. To perform such studies it is important to measure the meson spectrum, with precise determination of resonance masses and properties, looking for rare q q-bar states and for unconventional mesons with exotic quantum numbers (i.e. mesons with quantum numbers that are not compatible with a q q-bar structure). With the imminent advent of the 12 GeV upgrade of Jefferson Lab a new generation of meson spectroscopy experiments will start: 'Meson-Ex' in Hall B and 'GLUEX' in Hall D. Both will use photo-production to explore the spectrum of mesons in the light-quark sector, in the energy range of few GeVs.

  19. Meson Spectroscopy at JLab@12 GeV

    Energy Technology Data Exchange (ETDEWEB)

    Celentano, Andrea [INFN-GENOVA

    2013-03-01

    Meson, being the simplest hadronic bound system, is the ideal "laboratory" to study the interaction between quarks, to understand the role of the gluons inside hadrons and to investigate the origin of color confinement. To perform such studies it is important to measure the meson spectrum, with precise determination of resonance masses and properties, looking for rare qbar q states and for unconventional mesons with exotic quantum numbers (i.e. mesons with quantum numbers that are not compatible with a qbar q structure). With the imminent advent of the 12 GeV upgrade of Jefferson Lab a new generation of meson spectroscopy experiments will start: "Meson-Ex" in Hall B and "GLUEX" in Hall D. Both will use photo-production to explore the spectrum of mesons in the light-quark sector, in the energy range of few GeVs.

  20. Search for Factorization-Suppressed $B \\to{ chi_c} K^(*)$ Decays

    CERN Document Server

    Aubert, B; Boutigny, D; Couderc, F; Karyotakis, Yu; Lees, J P; Poireau, V; Tisserand, V; Zghiche, A; Graugès-Pous, E; Palano, A; Pompili, A; Chen, J C; Qi, N D; Rong, G; Wang, P; Zhu, Y S; Eigen, G; Ofte, I; Stugu, B; Abrams, G S; Borgland, A W; Breon, A B; Brown, D N; Button-Shafer, J; Cahn, R N; Charles, E; Day, C T; Gill, M S; Gritsan, A V; Groysman, Y; Jacobsen, R G; Kadel, R W; Kadyk, J; Kerth, L T; Kolomensky, Yu G; Kukartsev, G; Lynch, G; Mir, L M; Oddone, P J; Orimoto, T J; Pripstein, M; Roe, N A; Ronan, Michael T; Wenzel, W A; Barrett, M; Ford, K E; Harrison, T J; Hart, A J; Hawkes, C M; Morgan, S E; Watson, A T; Fritsch, M; Goetzen, K; Held, T; Koch, H; Lewandowski, B; Pelizaeus, M; Schröder, T; Steinke, M; Boyd, J T; Chevalier, N; Cottingham, W N; Kelly, M P; Latham, T E; Wilson, F F; Çuhadar-Dönszelmann, T; Hearty, C; Knecht, N S; Mattison, T S; McKenna, J A; Thiessen, D; Khan, A; Kyberd, P; Teodorescu, L; Blinov, A E; Blinov, V E; Druzhinin, V P; Golubev, V B; Ivanchenko, V N; Kravchenko, E A; Onuchin, A P; Serednyakov, S I; Skovpen, Yu I; Solodov, E P; Yushkov, A N; Best, D; Bruinsma, M; Chao, M; Eschrich, I; Kirkby, D; Lankford, A J; Mandelkern, M A; Mommsen, R K; Röthel, W; Stoker, D P; Buchanan, C; Hartfiel, B L; Weinstein, A J R; Foulkes, S D; Gary, J W; Long, O; Shen, B C; Wang, K; Del Re, D; Hadavand, H K; Hill, E J; MacFarlane, D B; Paar, H P; Rahatlou, S; Sharma, V; Berryhill, J W; Campagnari, C; Cunha, A; Dahmes, B; Hong, T M; Lu, A; Mazur, M A; Richman, J D; Verkerke, W; Beck, T W; Eisner, A M; Heusch, C A; Kroseberg, J; Lockman, W S; Nesom, G; Schalk, T; Schumm, B A; Seiden, A; Spradlin, P; Williams, D C; Wilson, M G; Albert, J; Chen, E; Dubois-Felsmann, G P; Dvoretskii, A; Hitlin, D G; Narsky, I; Piatenko, T; Porter, F C; Ryd, A; Samuel, A; Yang, S; Jayatilleke, S M; Mancinelli, G; Meadows, B T; Sokoloff, M D; Blanc, F; Bloom, P; Chen, S; Ford, W T; Nauenberg, U; Olivas, A; Rankin, P; Ruddick, W O; Smith, J G; Ulmer, K A; Zhang, J; Zhang, L; Chen, A; Eckhart, E A; Harton, J L; Soffer, A; Toki, W H; Wilson, R J; Zeng, Q; Spaan, B; Altenburg, D; Brandt, T; Brose, J; Dickopp, M; Feltresi, E; Hauke, A; Lacker, H M; Nogowski, R; Otto, S; Petzold, A; Schubert, J; Schubert, Klaus R; Schwierz, R; Sundermann, J E; Bernard, D; Bonneaud, G R; Grenier, P; Schrenk, S; Thiebaux, C; Vasileiadis, G; Verderi, M; Bard, D J; Clark, P J; Muheim, F; Playfer, S; Xie, Y; Andreotti, M; Azzolini, V; Bettoni, D; Bozzi, C; Calabrese, R; Cibinetto, G; Luppi, E; Negrini, M; Piemontese, L; Sarti, A; Anulli, F; Baldini-Ferroli, R; Calcaterra, A; De Sangro, R; Finocchiaro, G; Patteri, P; Peruzzi, I M; Piccolo, M; Zallo, A; Buzzo, A; Capra, R; Contri, R; Crosetti, G; Lo Vetere, M; Macri, M; Monge, M R; Passaggio, S; Patrignani, C; Robutti, E; Santroni, A; Tosi, S; Bailey, S; Brandenburg, G; Chaisanguanthum, K S; Morii, M; Won, E; Dubitzky, R S; Langenegger, U; Marks, J; Uwer, U; Bhimji, W; Bowerman, D A; Dauncey, P D; Egede, U; Gaillard, J R; Morton, G W; Nash, J A; Nikolich, M B; Taylor, G P; Charles, M J; Grenier, G J; Mallik, U; Cochran, J; Crawley, H B; Lamsa, J; Meyer, W T; Prell, S; Rosenberg, E I; Rubin, A E; Yi, J; Arnaud, N; Davier, M; Giroux, X; Grosdidier, G; Höcker, A; Le Diberder, F R; Lepeltier, V; Lutz, A M; Petersen, T C; Plaszczynski, S; Schune, M H; Wormser, G; Cheng, C H; Lange, D J; Simani, M C; Wright, D M; Bevan, A J; Chavez, C A; Coleman, J P; Forster, I J; Fry, J R; Gabathuler, Erwin; Gamet, R; Hutchcroft, D E; Parry, R J; Payne, D J; Touramanis, C; Cormack, C M; Di Lodovico, F; Brown, C L; Cowan, G; Flack, R L; Flächer, H U; Green, M G; Jackson, P S; McMahon, T R; Ricciardi, S; Salvatore, F; Winter, M A; Brown, D; Davis, C L; Allison, J; Barlow, N R; Barlow, R J; Hodgkinson, M C; Lafferty, G D; Williams, J C; Chen, C; Farbin, A; Hulsbergen, W D; Jawahery, A; Kovalskyi, D; Lae, C K; Lillard, V; Roberts, D A; Blaylock, G; Dallapiccola, C; Hertzbach, S S; Kofler, R; Koptchev, V B; Moore, T B; Saremi, S; Stängle, H; Willocq, S; Cowan, R; Koeneke, K; Sciolla, G; Sekula, S J; Taylor, F; Yamamoto, R K; Patel, P M; Robertson, S H; Lazzaro, A; Lombardo, V; Palombo, F; Bauer, J M; Cremaldi, L M; Eschenburg, V; Godang, R; Kroeger, R; Reidy, J; Sanders, D A; Summers, D J; Zhao, H W; Brunet, S; Côté, D; Taras, P; Nicholson, H; Cavallo, N; Fabozzi, F; Gatto, C; Lista, L; Monorchio, D; Paolucci, P; Piccolo, D; Sciacca, C; Baak, M; Bulten, H; Raven, G; Snoek, H L; Wilden, L; Jessop, C P; LoSecco, J M; Allmendinger, T; Benelli, G; Gan, K K; Honscheid, K; Hufnagel, D; Kagan, H; Kass, R; Pulliam, T; Rahimi, A M; Ter-Antonian, R; Wong, Q K; Brau, J E; Frey, R; Igonkina, O; Lu, M; Potter, C T; Sinev, N B; Strom, D; Torrence, E; Colecchia, F; Dorigo, A; Galeazzi, F; Margoni, M; Morandin, M; Posocco, M; Rotondo, M; Simonetto, F; Stroili, R; Voci, C; Benayoun, M; Briand, H; Chauveau, J; David, P; La Vaissière, C de; Del Buono, L; Hamon, O; John, M J J; Leruste, P; Malcles, J; Ocariz, J; Roos, L; Therin, G; Behera, P K; Gladney, L; Guo, Q H; Panetta, J; Biasini, M; Covarelli, R; Pioppi, M; Angelini, C; Batignani, G; Bettarini, S; Bondioli, M; Bucci, F; Calderini, G; Carpinelli, M; Forti, F; Giorgi, M A; Lusiani, A; Marchiori, G; Morganti, M; Neri, N; Paoloni, E; Rama, M; Rizzo, G; Simi, G; Walsh, J; Haire, M; Judd, D; Paick, K; Wagoner, D E; Danielson, N; Elmer, P; Lau, Y P; Lü, C; Miftakov, V; Olsen, J; Smith, A J S; Telnov, A V; Bellini, F; Cavoto, G; D'Orazio, A; Di Marco, E; Faccini, R; Ferrarotto, F; Ferroni, F; Gaspero, M; Li Gioi, L; Mazzoni, M A; Morganti, S; Pierini, M; Piredda, G; Polci, F; Safai-Tehrani, F; Voena, C; Christ, S; Schröder, H; Wagner, G; Waldi, R; Adye, T; De Groot, N; Franek, B J; Gopal, G P; Olaiya, E O; Aleksan, Roy; Emery, S; Gaidot, A; Ganzhur, S F; Giraud, P F; Hamel de Monchenault, G; Kozanecki, Witold; Legendre, M; London, G W; Mayer, B; Schott, G; Vasseur, G; Yéche, C; Zito, M; Purohit, M V; Weidemann, A W; Wilson, J R; Yumiceva, F X; Abe, T; Allen, M; Aston, D; Bartoldus, R; Berger, N; Boyarski, A M; Buchmüller, O L; Claus, R; Convery, M R; Cristinziani, M; De Nardo, Gallieno; Dingfelder, J C; Dong, D; Dorfan, J; Dujmic, D; Dunwoodie, W M; Fan, S; Field, R C; Glanzman, T; Gowdy, S J; Hadig, T; Halyo, V; Hast, C; Hrynóva, T; Innes, W R; Kelsey, M H; Kim, P; Kocian, M L; Leith, D W G S; Libby, J; Luitz, S; Lüth, V; Lynch, H L; Marsiske, H; Messner, R; Müller, D R; O'Grady, C P; Ozcan, V E; Perazzo, A; Perl, M; Ratcliff, B N; Roodman, A; Salnikov, A A; Schindler, R H; Schwiening, J; Snyder, A; Soha, A; Stelzer, J; Strube, J; Su, D; Sullivan, M K; Thompson, J; Vavra, J; Wagner, S R; Weaver, M; Wisniewski, W J; Wittgen, M; Wright, D H; Yarritu, A K; Young, C C; Burchat, Patricia R; Edwards, A J; Majewski, S A; Petersen, B A; Roat, C; Ahmed, M; Ahmed, S; Alam, M S; Ernst, J A; Saeed, M A; Saleem, M; Wappler, F R; Bugg, W; Krishnamurthy, M; Spanier, S M; Eckmann, R; Kim, H; Ritchie, J L; Satpathy, A; Schwitters, R F; Izen, J M; Kitayama, I; Lou, X C; Ye, S; Bianchi, F; Bóna, M; Gallo, F; Gamba, D; Bosisio, L; Cartaro, C; Cossutti, F; Della Ricca, G; Dittongo, S; Grancagnolo, S; Lanceri, L; Poropat, P; Vitale, L; Vuagnin, G; Martínez-Vidal, F; Panvini, R S; Banerjee, S; Bhuyan, B; Brown, C M; Fortin, D; Jackson, P D; Kowalewski, R V; Roney, J M; Sobie, R J; Back, J J; Harrison, P F; Mohanty, G B; Band, H R; Chen, X; Cheng, B; Dasu, S; Datta, M; Eichenbaum, A M; Flood, K T; Graham, M; Hollar, J J; Johnson, J R; Kutter, P E; Li, H; Liu, R; Mihályi, A; Pan, Y; Prepost, R; Tan, P; Von Wimmersperg-Töller, J H; Wu, J; Wu, S L; Yu, Z; Greene, M G; Neal, H

    2005-01-01

    We search for the factorization-suppressed decays B -> chi_c0 K(*) and B -> chi_c2 K(*), with chi_c0 and chi_c2 decaying into J/psi gamma using a sample of 124 10^6 BBbar events collected with the BABAR detector at the PEP-II storage ring of the Stanford Linear Accelerator Center.

  1. Tai Chi and Qi Gong for Health and Well-Being

    Medline Plus

    Full Text Available ... Tai Chi and Qi Gong for Health and Well-Being Share: taichi_nccamIMG_2962.jpg © Mariann Seriff ... Tai Chi and Qi Gong for Health and Well-Being Video › Tai Chi and Qi Gong for ...

  2. Dicty_cDB: CHI614 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 850F7 (Roswell Park Cancer Institute Human BAC Library) complete sequence. 38 0.53 5 CR382125 |CR382125.1 Kluyveromyces lact...AAACCTTATTATCCA ATATTTTATTATCAGGTTTTAGG Length of 3' end seq. 743 Connected seq. ID CHI614P Connected seq. >...IILVXIINXVYNXFSGHS SEHTKNXLKXASKTSKKX--- ---DNHTFLRENRDPVKKMKHLPQGIL*sksirerffigfgtwhwwcts...ENRDPVKKMKHLPQGIL*sksirerffigfgtwhwwctsfsqss*ti*lc isitllvatyss*yv*tlvlcrn*sfmrtqisiikhwsrsksystmskrw*nya*ysts...d in the head. 40 2.1 2 CR238085 |CR238085.1 Forward strand read from insert in 5'HPRT insertion

  3. Dicty_cDB: CHI740 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHI740 (Link to dictyBase) - - - Contig-U16419-1 - (Link to Original site) ... krftxchenctx** Frame B: ---xkttslvfkmxtks*m*i**prssmlc kgsp**mfikmshmamnvklitmvknvxsd pidhhhqkfvh*dahqnmnv ... slrcptwp*m*s*sqw*rmlxqi p*ttttrslfikmptkt*m*i**sw*kmlc kdsl**sl*frlw*rf*m*n*t*wfkmlc p frkttpttt*km**empxrp ... *m*s*stwkrmlrccp*txtkmlfkmstkt*m*sqpxw*r mlc *sspr*mfiemstrp*m*s*stwkrmxrccp*tttemlikmstkt*m*nqs ... lw*rml c *k*k*lfnl*rpktvkekvyxvp*klyxlik Homology vs CSM-cD ...

  4. Nuclear modification of psi^prime, chi_c and J/psi production in d+Au collisions at sqrt(s_NN) = 200 GeV

    CERN Document Server

    Adare, A; Ajitanand, N N; Akiba, Y; Al-Bataineh, H; Alexander, J; Angerami, A; Aoki, K; Apadula, N; Aramaki, Y; Atomssa, E T; Averbeck, R; Awes, T C; Azmoun, B; Babintsev, V; Bai, M; Baksay, G; Baksay, L; Barish, K N; Bassalleck, B; Basye, A T; Bathe, S; Baublis, V; Baumann, C; Bazilevsky, A; Belikov, S; Belmont, R; Bennett, R; Bhom, J H; Blau, D S; Bok, J S; Boyle, K; Brooks, M L; Buesching, H; Bumazhnov, V; Bunce, G; Butsyk, S; Campbell, S; Caringi, A; Chen, C -H; Chi, C Y; Chiu, M; Choi, I J; Choi, J B; Choudhury, R K; Christiansen, P; Chujo, T; Chung, P; Chvala, O; Cianciolo, V; Citron, Z; Cole, B A; del Valle, Z Conesa; Connors, M; Csanád, M; Csörgő, T; Dahms, T; Dairaku, S; Danchev, I; Das, K; Datta, A; David, G; Dayananda, M K; Denisov, A; Deshpande, A; Desmond, E J; Dharmawardane, K V; Dietzsch, O; Dion, A; Donadelli, M; Drapier, O; Drees, A; Drees, K A; Durham, J M; Durum, A; Dutta, D; D'Orazio, L; Edwards, S; Efremenko, Y V; Ellinghaus, F; Engelmore, T; Enokizono, A; En'yo, H; Esumi, S; Fadem, B; Fields, D E; Finger, M; Jr., \\,; Fleuret, F; Fokin, S L; Fraenkel, Z; Frantz, J E; Franz, A; Frawley, A D; Fujiwara, K; Fukao, Y; Fusayasu, T; Garishvili, I; Glenn, A; Gong, H; Gonin, M; Goto, Y; de Cassagnac, R Granier; Grau, N; Greene, S V; Grim, G; Perdekamp, M Grosse; Gunji, T; Gustafsson, H -Å; Haggerty, J S; Hahn, K I; Hamagaki, H; Hamblen, J; Han, R; Hanks, J; Haslum, E; Hayano, R; He, X; Heffner, M; Hemmick, T K; Hester, T; Hill, J C; Hohlmann, M; Holzmann, W; Homma, K; Hong, B; Horaguchi, T; Hornback, D; Huang, S; Ichihara, T; Ichimiya, R; Ikeda, Y; Imai, K; Inaba, M; Isenhower, D; Ishihara, M; Issah, M; Ivanischev, D; Iwanaga, Y; Jacak, B V; Jia, J; Jiang, X; Jin, J; Johnson, B M; Jones, T; Joo, K S; Jouan, D; Jumper, D S; Kajihara, F; Kamin, J; Kang, J H; Kapustinsky, J; Karatsu, K; Kasai, M; Kawall, D; Kawashima, M; Kazantsev, A V; Kempel, T; Khanzadeev, A; Kijima, K M; Kikuchi, J; Kim, A; Kim, B I; Kim, D J; Kim, E -J; Kim, Y -J; Kinney, E; Kiss, Á; Kistenev, E; Kleinjan, D; Kochenda, L; Komkov, B; Konno, M; Koster, J; Král, A; Kravitz, A; Kunde, G J; Kurita, K; Kurosawa, M; Kwon, Y; Kyle, G S; Lacey, R; Lai, Y S; Lajoie, J G; Lebedev, A; Lee, D M; Lee, J; Lee, K B; Lee, K S; Leitch, M J; Leite, M A L; Li, X; Lichtenwalner, P; Liebing, P; Levy, L A Linden; Liška, T; Liu, H; Liu, M X; Love, B; Lynch, D; Maguire, C F; Makdisi, Y I; Malik, M D; Manko, V I; Mannel, E; Mao, Y; Masui, H; Matathias, F; McCumber, M; McGaughey, P L; McGlinchey, D; Means, N; Meredith, B; Miake, Y; Mibe, T; Mignerey, A C; Miki, K; Milov, A; Mitchell, J T; Mohanty, A K; Moon, H J; Morino, Y; Morreale, A; Morrison, D P; Moukhanova, T V; Murakami, T; Murata, J; Nagamiya, S; Nagle, J L; Naglis, M; Nagy, M I; Nakagawa, I; Nakamiya, Y; Nakamura, K R; Nakamura, T; Nakano, K; Nam, S; Newby, J; Nguyen, M; Nihashi, M; Nouicer, R; Nyanin, A S; Oakley, C; O'Brien, E; Oda, S X; Ogilvie, C A; Oka, M; Okada, K; Onuki, Y; Oskarsson, A; Ouchida, M; Ozawa, K; Pak, R; Pantuev, V; Papavassiliou, V; Park, I H; Park, S K; Park, W J; Pate, S F; Pei, H; Peng, J -C; Pereira, H; Perepelitsa, D; Peressounko, D Yu; Petti, R; Pinkenburg, C; Pisani, R P; Proissl, M; Purschke, M L; Qu, H; Rak, J; Ravinovich, I; Read, K F; Rembeczki, S; Reygers, K; Riabov, V; Riabov, Y; Richardson, E; Roach, D; Roche, G; Rolnick, S D; Rosati, M; Rosen, C A; Rosendahl, S S E; Ružička, P; Sahlmueller, B; Saito, N; Sakaguchi, T; Sakashita, K; Samsonov, V; Sano, S; Sato, T; Sawada, S; Sedgwick, K; Seele, J; Seidl, R; Seto, R; Sharma, D; Shein, I; Shibata, T -A; Shigaki, K; Shimomura, M; Shoji, K; Shukla, P; Sickles, A; Silva, C L; Silvermyr, D; Silvestre, C; Sim, K S; Singh, B K; Singh, C P; Singh, V; Slunečka, M; Soltz, R A; Sondheim, W E; Sorensen, S P; Sourikova, I V; Stankus, P W; Stenlund, E; Stoll, S P; Sugitate, T; Sukhanov, A; Sziklai, J; Takagui, E M; Taketani, A; Tanabe, R; Tanaka, Y; Taneja, S; Tanida, K; Tannenbaum, M J; Tarafdar, S; Taranenko, A; Themann, H; Thomas, D; Thomas, T L; Togawa, M; Toia, A; Tomášek, L; Torii, H; Towell, R S; Tserruya, I; Tsuchimoto, Y; Vale, C; Valle, H; van Hecke, H W; Vazquez-Zambrano, E; Veicht, A; Velkovska, J; Vértesi, R; Virius, M; Vrba, V; Vznuzdaev, E; Wang, X R; Watanabe, D; Watanabe, K; Watanabe, Y; Wei, F; Wei, R; Wessels, J; White, S N; Winter, D; Woody, C L; Wright, R M; Wysocki, M; Yamaguchi, Y L; Yamaura, K; Yang, R; Yanovich, A; Ying, J; Yokkaichi, S; You, Z; Young, G R; Younus, I; Yushmanov, I E; Zajc, W A; Zhou, S

    2013-01-01

    We present results for three charmonia states (psi^prime, chi_c and J/psi) in d+Au collisions at |y|<0.35 and sqrt(s_NN)=200 GeV. We find that the modification of the psi^prime yield relative to that of the J/psi scales approximately with charged-particle multiplicity at midrapidity across p+A, d+Au, and A+A results from the Super Proton Synchrotron and the Relativistic Heavy Ion Collider. In large impact-parameter collisions we observe a similar suppression for the psi^prime and J/psi, while in small impact-parameter collisions the more weakly bound psi^prime is more strongly suppressed. Owing to the short time spent traversing the Au nucleus, the larger psi^prime suppression in central events is not explained by an increase of the nuclear absorption due to meson formation time effects.

  5. Two-Photon Widths of the chi_cJ States of Charmonium

    CERN Document Server

    Ecklund, K M; Savinov, V; López, A; Méndez, H; Ramírez, J; Ge, J Y; Miller, D H; Shipsey, I P J; Xin, B; Adams, G S; Anderson, M; Cummings, J P; Danko, I; Hu, D; Moziak, B; Napolitano, J; He, Q; Insler, J; Muramatsu, H; Park, C S; Thorndike, E H; Yang, F; Artuso, M; Blusk, S; Khalil, S; Li, J; Mountain, R; Nisar, S; Randrianarivony, K; Sultana, N; Skwarnicki, T; Stone, S; Wang, J C; Zhang, L M; Bonvicini, G; Cinabro, D; Dubrovin, M; Lincoln, A; Naik, P; Rademacker, J; Asner, D M; Edwards, K W; Reed, J; Briere, R A; Ferguson, T; Tatishvili, G; Vogel, H; Watkins, M E; Rosner, J L; Alexander, J P; Cassel, D G; Duboscq, J E; Ehrlich, R; Fields, L; Galik, R S; Gibbons, L; Gray, R; Gray, S W; Hartill, D L; Hertz, D; Hunt, J M; Kandaswamy, J; Kreinick, D L; Kuznetsov, V E; Ledoux, J; Mahlke-Krüger, H; Mohapatra, D; Onyisi, P U E; Patterson, J R; Peterson, D; Riley, D; Ryd, A; Sadoff, A J; Shi, X; Stroiney, S; Sun, W M; Wilksen, T; Athar, S B; Patel, R; Yelton, J; Rubin, P; Eisenstein, B I; Karliner, I; Mehrabyan, S; Lowrey, N; Selen, M; White, E J; Wiss, J; Mitchell, R E; Shepherd, M R; Besson, D; Pedlar, T K; Cronin-Hennessy, D; Gao, K Y; Hietala, J; Kubota, Y; Klein, T; Lang, B W; Poling, R; Scott, A W; Zweber, P; Dobbs, S; Metreveli, Z; Seth, K K; Tomaradze, A G; Libby, J; Powell, A; Wilkinson, G

    2008-01-01

    Using a data sample of 24.5 million psi(2S) the reactions psi(2S)->gamma chi_cJ, chi_cJ->gamma gamma have been studied for the first time to determine the two-photon widths of the chi_cJ states of charmonium in their decay into two photons. The measured quantities are B(psi(2S)->gamma chi_c0)xB(chi_c0->gamma gamma)=(2.22+-0.32+-0.10)x10^-5, and B(psi(2S)->gamma chi_c2)xB(chi_c2->gamma gamma)=(2.70+-0.28+-0.15)x10^-5. Using values for B(psi(2S)->gamma chi_c0,c2) and \\Gamma(chi_c0,c2) from the literature the two-photon widths are derived to be \\Gamma_{gamma gamma}(chi_c0)=(2.53+-0.37+-0.26) keV, \\Gamma_{gamma gamma}(chi_c2)=(0.60+-0.06+-0.06) keV, and R=\\Gamma_{gamma gamma}(chi_c2)/\\Gamma_{gamma gamma}(chi_c0)= 0.237+-0.043+-0.034. The importance of the measurement of R is emphasized. For the forbidden transition, chi_c1->gamma gamma, an upper limit of \\Gamma_{gamma gamma}(chi_c1)<0.03 keV is established.

  6. Two-photon widths of the $\\chi_{c0, 2}$ states and helicity analysis for $\\chi_{c2}\\ar\\gamma\\gamma$}

    CERN Document Server

    Ablikim, M; Ambrose, D J; An, F F; An, Q; An, Z H; Bai, J Z; Ferroli, R B; Ban, Y; Becker, J; Berger, N; Bertani, M B; Bian, J M; Boger, E; Bondarenko, O; Boyko, I; Briere, R A; Bytev, V; Cai, X; Calcaterra, A C; Cao, G F; Chang, J F; Chelkov, G; Chen, G; Chen, H S; Chen, J C; Chen, M L; Chen, S J; Chen, Y; Chen, Y B; Cheng, H P; Chu, Y P; Cronin-Hennessy, D; Dai, H L; Dai, J P; Dedovich, D; Deng, Z Y; Denig, A; Denysenko, I; Destefanis, M; Ding, W M; Ding, Y; Dong, L Y; Dong, M Y; Du, S X; Fang, J; Fang, S S; Fava, L; Feldbauer, F; Feng, C Q; Fu, C D; Fu, J L; Gao, Y; Geng, C; Goetzen, K; Gong, W X; Gradl, W; Greco, M; Gu, M H; Gu, Y T; Guan, Y H; Guo, A Q; Guo, L B; Guo, Y P; Han, Y L; Hao, X Q; Harris, F A; He, K L; He, M; He, Z Y; Held, T; Heng, Y K; Hou, Z L; Hu, H M; Hu, J F; Hu, T; Huang, B; Huang, G M; Huang, J S; Huang, X T; Huang, Y P; Hussain, T; Ji, C S; Ji, Q; Ji, X B; Ji, X L; Jia, L K; Jiang, L L; Jiang, X S; Jiao, J B; Jiao, Z; Jin, D P; Jin, S; Jing, F F; Kalantar-Nayestanaki, N; Kavatsyuk, M; Kuehn, W; Lai, W; Lange, J S; Leung, J K C; Li, C H; Li, Cheng; Li, Cui; Li, D M; Li, F; Li, G; Li, H B; Li, J C; Li, K; Li, Lei; Li, N B; Li, Q J; Li, S L; Li, W D; Li, W G; Li, X L; Li, X N; Li, X Q; Li, X R; Li, Z B; Liang, H; Liang, Y F; Liang, Y T; Liao, G R; Liao, X T; Liu, B J; Liu, B J; Liu, C L; Liu, C X; Liu, C Y; Liu, F H; Liu, Fang; Liu, Feng; Liu, H; Liu, H B; Liu, H H; Liu, H M; Liu, H W; Liu, J P; Liu, Kun; Liu, Kai; Liu, K Y; Liu, P L; Liu, S B; Liu, X; Liu, X H; Liu, Y B; Liu, Y; Liu, Z A; Liu, Zhiqiang; Liu, Zhiqing; Loehner, H; Lu, G R; Lu, H J; Lu, J G; Lu, Q W; Lu, X R; Lu, Y P; Luo, C L; Luo, M X; Luo, T; Luo, X L; Lv, M; Ma, C L; Ma, F C; Ma, H L; Ma, Q M; Ma, S; Ma, T; Ma, X Y; Ma, Y; Maas, F E; Maggiora, M; Malik, Q A; Mao, H; Mao, Y J; Mao, Z P; Messchendorp, J G; Min, J; Min, T J; Mitchell, R E; Mo, X H; Morales, C Morales; Motzko, C; Muchnoi, N Yu; Nefedov, Y; Nicholson, C; Nikolaev, I B; Ning, Z; Olsen, S L; Ouyang, Q; Pacetti, S P; Park, J W; Pelizaeus, M; Peters, K; Ping, J L; Ping, R G; Poling, R; Prencipe, E; Pun, C S J; Qi, M; Qian, S; Qiao, C F; Qin, X S; Qin, Y; Qin, Z H; Qiu, J F; Rashid, K H; Rong, G; Ruan, X D; Sarantsev, A; Schulze, J; Shao, M; Shen, C P; Shen, X Y; Sheng, H Y; Shepherd, M R; Song, X Y; Spataro, S; Spruck, B; Sun, D H; Sun, G X; Sun, J F; Sun, S S; Sun, X D; Sun, Y J; Sun, Y Z; Sun, Z J; Sun, Z T; Tang, C J; Tang, X; Thorndike, E H; Tian, H L; Toth, D; Ulrich, M U; Varner, G S; Wang, B; Wang, B Q; Wang, K; Wang, L L; Wang, L S; Wang, M; Wang, P; Wang, P L; Wang, Q; Wang, Q J; Wang, S G; Wang, X F; Wang, X L; Wang, Y D; Wang, Y F; Wang, Y Q; Wang, Z; Wang, Z G; Wang, Z Y; Wei, D H; Weidenkaff, P; Wen, Q G; Wen, S P; Werner, M W; Wiedner, U; Wu, L H; Wu, N; Wu, S X; Wu, W; Wu, Z; Xia, L G; Xiao, Z J; Xie, Y G; Xiu, Q L; Xu, G F; Xu, G M; Xu, H; Xu, Q J; Xu, X P; Xu, Y; Xu, Z R; Xue, F; Xue, Z; Yan, L; Yan, W B; Yan, Y H; Yang, H X; Yang, T; Yang, Y; Yang, Y X; Ye, H; Ye, M; Ye, M H; Yu, B X; Yu, C X; Yu, J S; Yu, S P; Yuan, C Z; Yuan, W L; Yuan, Y; Zafar, A A; Zallo, A Z; Zeng, Y; Zhang, B X; Zhang, B Y; Zhang, C C; Zhang, D H; Zhang, H H; Zhang, H Y; Zhang, J; Zhang, J G; Zhang, J Q; Zhang, J W; Zhang, J Y; Zhang, J Z; Zhang, L; Zhang, S H; Zhang, T R; Zhang, X J; Zhang, X Y; Zhang, Y; Zhang, Y H; Zhang, Y S; Zhang, Z P; Zhang, Z Y; Zhao, G; Zhao, H S; Zhao, J W; Zhao, K X; Zhao, Lei; Zhao, Ling; Zhao, M G; Zhao, Q; Zhao, S J; Zhao, T C; Zhao, X H; Zhao, Y B; Zhao, Z G; Zhemchugov, A; Zheng, B; Zheng, J P; Zheng, Y H; Zheng, Z P; Zhong, B; Zhong, J; Zhou, L; Zhou, X K; Zhou, X R; Zhu, C; Zhu, K; Zhu, K J; Zhu, S H; Zhu, X L; Zhu, X W; Zhu, Y M; Zhu, Y S; Zhu, Z A; Zhuang, J; Zou, B S; Zou, J H; Zuo, J X

    2012-01-01

    Based on a data sample of 106 M $\\psi^{\\prime}$ events collected with the BESIII detector, the decays $\\psi^{\\prime}\\ar\\gamma\\chi_{c0, 2}$,$\\chi_{c0, 2}\\ar\\gamma\\gamma$ are studied to determine the two-photon widths of the $\\chi_{c0, 2}$ states. The two-photon decay branching fractions are determined to be ${\\cal B}(\\chi_{c0}\\ar\\gamma\\gamma) = (2.24\\pm 0.19\\pm 0.12\\pm 0.08)\\times 10^{-4}$ and ${\\cal B}(\\chi_{c2}\\ar\\gamma\\gamma) = (3.21\\pm 0.18\\pm 0.17\\pm 0.13)\\times 10^{-4}$. From these, the two-photon widths are determined to be $\\Gamma_{\\gamma \\gamma}(\\chi_{c0}) = (2.33\\pm0.20\\pm0.13\\pm0.17)$ keV, $\\Gamma_{\\gamma \\gamma}(\\chi_{c2}) = (0.63\\pm0.04\\pm0.04\\pm0.04)$ keV, and $\\cal R$ $=\\Gamma_{\\gamma \\gamma}(\\chi_{c2})/\\Gamma_{\\gamma \\gamma}(\\chi_{c0})=0.271\\pm 0.029\\pm 0.013\\pm 0.027$, where the uncertainties are statistical, systematic, and those from the PDG ${\\cal B}(\\psi^{\\prime}\\ar\\gamma\\chi_{c0,2})$ and $\\Gamma(\\chi_{c0,2})$ errors, respectively. The ratio of the two-photon widths for helicity $\\lambda=0...

  7. Chi-Chi (Taiwan) earthquake of September 21, 1999. Findings for the nuclear installations in Switzerland: short report

    International Nuclear Information System (INIS)

    The Swiss Federal Nuclear Safety Inspectorate (HSK) has a great interest to be rapidly informed and documented on relevant consequences of major earthquakes in industrialized countries in the world, in particular with respect to nuclear installations. The main goal is to recognize within a short time after such events, if measures should be taken at the Swiss nuclear installations. Therefore, Basler and Hofmann have prepared a report on the Chi-Chi (1999) earthquake for HSK within a few weeks after the event. The information was obtained primarily from the Internet and by directly contacting local authorities and other selected organisations in Taiwan. This short report is a summary representation of the HSK report of November 23, 1999. No updated or additional information on the earthquake is included herein. The summary concentrates on the findings for the Swiss nuclear installations. Compared with Taiwan, Switzerland is situated in a seismically much less active region. However, similarities exist with respect to the focal mechanism (thrust), the compressional stress regime and the low focal depth. Thus, the pattern of the iso-seismal lines and the maximum acceleration values would be similar in Switzerland in the case of an equally strong event. Such a strong event has been considered as unrealistic to occur in Switzerland so far. In the PSA studies for the Swiss nuclear power plants, a maximum magnitude up to 7.5 was considered, but only with a low weight. Under the assumption of a magnitude 7.6 event in the seismically most active region in Switzerland (Valais), the SSE accelerations at the closest site (Muehleberg NPP) could probably be exceeded. Most effects at components observed during the Chi-Chi earthquake (at non-nuclear sites) are already known to HSK and they have been considered systematically at the Swiss NPPs. A rather sensitive point is the possible loss of power from emergency diesel generators, as observed at non-nuclear sites in Taiwan. The

  8. Studies on inclusive meson resonance and particle production

    International Nuclear Information System (INIS)

    Production and decay of meson resonances are studied in medium energy meson-proton collisions. Strong evidence is found that hadronic collisions are dominated by resonance production. Especially the vector mesons have often large inclusive cross sections, typically of the order of few millibarns at the present energies. In all, a majority of pions and kaons appear to be decay products of resonances or other unstable particles. The detailed kinematics of the parent resonance's decays is found to play an important role in determining inclusive pion spectra. The squared transverse momentum distributions of hadrons heavier than the pion appear to have in common an exponential behaviour, with a universal slope for the esponential fall-off. The observed vector meson yields suggest that only a small fraction of the direct lepton production observed at large transverse momentum in nucleon-nucleon interactions is accounted for by the ''old'' vector mesons. An attempt has been made to separate out the central production and fragmentation components of the meson production. Both the central production and the fragmentation of the incoming meson are found to be important mechanisms in the non-strange meson production whereas the central production of strange meson resonances is rare at our energies. The ratios of the observed meson yields are found to be generally in good agreement with a simple quark-counting model. (author)

  9. Spin O decay angular distribution for interfering mesons in electroproduction

    Energy Technology Data Exchange (ETDEWEB)

    Funsten, H.; Gilfoyle, G.

    1994-04-01

    Self analyzing meson electroproduction experiments are currently being planned for the CEBAF CLAS detector. These experiments deduce the spin polarization of outgoing unstable spin s (?)0 mesons from their decay angular distribution, W({theta},{psi}). The large angular acceptance of the CLAS detector permits kinematic tracking of a sufficient number of these events to accurately determine electroproduction amplitudes from the deduced polarization. Maximum polarization information is obtained from W({theta},{psi}) for decay into spin 0 daughters. The helicity of the decaying meson is transferred to the daughter`s relative orbital angular momentum m-projection; none is {open_quotes}absorbed{close_quotes} into daughter helicities. The decaying meson`s helicity maximally appears in W({theta},{psi}). W({theta},{psi}) for spin 0 daughters has been derived for (1) vector meson electroproduction and (2) general interfering mesons produced by incident pions. This paper derives W({theta},{psi}) for electroproduction of two interfering mesons that decay into spin 0 daughters. An application is made to the case of interfering scalar and vector mesons. The derivation is an extension of work by Schil using the general decay formalism of Martin. The expressions can be easily extended to the case of N interfering mesons since interference occurs pairwise in the observable W ({theta},{psi}), a quadratic function of the meson amplitudes. The derivation uses the virtual photon density matrix of Schil which is transformed by a meson electroproduction transition operator, T. The resulting density matrix for the interfering mesons is then converted into a corresponding statistical tensor and contracted into the efficiency tensor for spin 0 daughters.

  10. Tai Chi as a form of exercise training in people with chronic obstructive pulmonary disease.

    Science.gov (United States)

    Leung, Regina W M; McKeough, Zoe J; Alison, Jennifer A

    2013-12-01

    Tai Chi is an ancient Chinese martial art which incorporates elements of strengthening, balance, postural alignment and concentration. The benefits of Tai Chi in the healthy population have been widely examined. In comparison, only three studies have evaluated the effects of Tai Chi in people with chronic obstructive pulmonary disease (COPD). Existing evidence suggests that the exercise intensity of Tai Chi reaches a moderate level in people with COPD. Furthermore, a short-term program of Tai Chi improves exercise capacity, health-related quality of life, balance and quadriceps strength in people with mild to moderate COPD. More studies are warranted to examine the effects of different styles of Tai Chi and the long-term benefits of Tai Chi as an exercise regimen for people with COPD. PMID:24224506

  11. mRNA Expression of EgCHI1, EgCHI2, and EgCHI3 in Oil Palm Leaves (Elaeis guineesis Jacq. after Treatment with Ganoderma boninense Pat. and Trichoderma harzianum Rifai

    Directory of Open Access Journals (Sweden)

    Laila Naher

    2012-01-01

    Full Text Available Background. Basal stem rot (BSR disease caused by the fungus Ganoderma boninense is the most serious disease affecting the oil palm; this is because the disease escapes the early disease detection. The biocontrol agent Trichoderma harzianum can protect the disease only at the early stage of the disease. In the present study, the expression levels of three oil palm (Elaeis guineensis Jacq. chitinases encoding EgCHI1, EgCHI2, and EgCHI3 at 2, 5, and 8 weeks inoculation were measured in oil palm leaves from plants treated with G. boninense or T. harzianum alone or both. Methods. The five-month-old oil palm seedlings were treated with Gano-wood blocks inoculum and trichomulch. Expression of EgCHI1, EgCHI2, and EgCHI3 in treated leaves tissue was determined by real-time PCR. Results. Oil palm chitinases were not strongly expressed in oil palm leaves of plants treated with G. boninense alone compared to other treatments. Throughout the 8-week experiment, expression of EgCHI1 increased more than 3-fold in leaves of plants treated with T. harzianum and G. boninense when compared to those of control and other treated plants. Conclusion. The data illustrated that chitinase cDNA expression varied depending on tissue and the type of treatment.

  12. Long-period ground motion characteristic of the 1999 Jiji (Chi-Chi), Taiwan, mainshock and aftershocks

    Institute of Scientific and Technical Information of China (English)

    LI Chun-feng; ZHANG Yang; ZHAO Jin-bao; TANG Hui

    2006-01-01

    This paper investigates long-period ground motion characteristic of the 1999 Jiji (Chi-Chi), Taiwan, mainshock and aftershocks on the basis of lots of high quality digital strong motion records. The study attaches the importance to the variation of strength of the long-period ground motion with the magnitude, distance, and site condition. In the meantime, the near-fault long-period ground motion characteristic is analyzed. The result shows that the shape of the long-period response spectrum is mainly controlled by site condition and magnitude (the spectrum of class D+E is wider than that of class B+C, and the spectrum of larger magnitude is wider than that of smaller magnitude), and the effect of fault distance on the shape is not evident. And near-fault long-period ground motion characteristic depends on fault activity apparently, that is to say, the long-term ground motion in the hanger is stronger than that in the footwall, and the long-term ground motion in the north is stronger than that in the south.

  13. Heavy meson spectroscopy under strong magnetic field

    CERN Document Server

    Yoshida, Tetsuya

    2016-01-01

    Spectra of the neutral heavy mesons, $\\eta_c(1S,2S)$, $J/psi$, $\\psi(2S)$, $\\eta_b(1S,2S,3S)$, $\\Upsilon(1S,2S,3S)$, $D$, $D^\\ast$, $B$, $B^\\ast$, $B_s$ and $B_s^\\ast$, in a homogeneous magnetic field are analyzed in a potential model of constituent quarks. To obtain anisotropic wave functions and the corresponding eigenvalues, the cylindrical Gaussian expansion method is applied, where the wave functions for transverse and longitudinal directions in the cylindrical coordinate are expanded by the Gaussian bases separately. Energy level structures in the wide range of magnetic field are obtained and the deformation of the wave functions is shown, which reflects effects of the spin mixing, the Zeeman splitting and quark Landau levels. The contribution from the magnetic catalysis in heavy-light mesons is discussed as a change of the light constituent quark mass.

  14. Neutral-meson oscillations with torsion

    CERN Document Server

    Poplawski, Nikodem J

    2011-01-01

    We propose a simple mechanism that may explain the observed particle-antiparticle asymmetry in the Universe. In the Einstein-Cartan-Sciama-Kibble theory of gravity, the intrinsic spin of matter generates spacetime torsion. Classical Dirac fields in the presence of torsion obey the nonlinear Hehl-Datta equation which is asymmetric under a charge-conjugation transformation. Accordingly, at extremely high densities that existed in the very early Universe, fermions have higher effective masses than antifermions. As a result, a meson composed of a light quark and a heavy antiquark has a lower effective mass than its antiparticle. Neutral-meson oscillations in thermal equilibrium therefore favor the production of light quarks and heavy antiquarks, which may be related to baryogenesis.

  15. The lightest hybrid meson supermultiplet in QCD

    Energy Technology Data Exchange (ETDEWEB)

    Dudek, Jozef J

    2011-10-01

    We interpret the spectrum of meson states recently obtained in non-perturbative lattice QCD calculations in terms of constituent quark-antiquark bound states and states, called 'hybrids', in which the q{bar q} pair is supplemented by an excitation of the gluonic field. We identify a lightest supermultiplet of hybrid mesons with J{sup PC} = (0,1,2){sup {-+}}, 1{sup -} built from a gluonic excitation of chromomagnetic character coupled to q{bar q} in an S-wave. The next lightest hybrids are suggested to be quark orbital excitations with the same gluonic excitation, while the next distinct gluonic excitation is significantly heavier. Existing models of gluonic excitations are compared to these findings and possible phenomenological consequences explored.

  16. Exclusive electroproduction of $\\phi$ mesons at HERA

    CERN Document Server

    Chekanov, S; Adamczyk, L; Adamus, M; Adler, V; Aghuzumtsyan, G; Allfrey, P D; Antonioli, P; Antonov, A; Arneodo, M; Bailey, D S; Bamberger, A; Barakbaev, A N; Barbagli, G; Barbi, M; Bari, G; Barreiro, F; Bartsch, D; Basile, M; Behrens, U; Bell, M A; Bellagamba, L; Bellan, P M; Benen, A; Bertolin, A; Bhadra, S; Bloch, I; Bold, T; Boos, E G; Borras, K; Boscherini, D; Brock, I; Brook, N H; Brugnera, R; Brümmer, N; Bruni, A; Bruni, G; Bussey, P J; Butterworth, J M; Büttner, C; Bylsma, B; Caldwell, A; Capua, M; Cara Romeo, G; Carli, T; Carlin, R; Cassel, D G; Catterall, C D; Abramowicz, H; Chwastowski, J; Ciborowski, J; Ciesielski, R; Cifarelli, Luisa; Cindolo, F; Cole, J E; Collins-Tooth, C; Contin, A; Cooper-Sarkar, A M; Coppola, N; Corradi, M; Corriveau, F; Costa, M; Cottrell, A; Cui, Y; D'Agostini, G; Dal Corso, F; Danilov, P; De Pasquale, S; Dementiev, R K; Derrick, M; Devenish, R C E; Dhawan, S; Dobur, D; Dolgoshein, B A; Doyle, A T; Drews, G; Durkin, L S; Dusini, S; Eisenberg, Y; Ermolov, P F; Eskreys, Andrzej; Everett, A; Ferrando, J; Ferrero, M I; Figiel, J; Foster, B; Foudas, C; Fourletov, S; Fourletova, J; Fry, C; Gabareen, A; Galas, A; Gallo, E; Garfagnini, A; Geiser, A; Genta, C; Gialas, I; Giusti, P; Gladilin, L K; Gladkov, D; Glasman, C; Göbel, F; Goers, S; Goncalo, R; González, O; Gosau, T; Göttlicher, P; Grabowska-Bold, I; Graciani-Díaz, R; Grigorescu, G; Grijpink, S; Groys, M; Grzelak, G; Gutsche, O; Gwenlan, C; Haas, T; Hain, W; Hall-Wilton, R; Hamatsu, R; Hamilton, J; Hanlon, S; Hart, C; Hartmann, H; Hartner, G; Heaphy, E A; Heath, G P; Helbich, M; Hilger, E; Hochman, D; Holm, U; Horn, C; Iacobucci, G; Iga, Y; Irrgang, P; Jakob, H P; Jiménez, M; Jones, T W; Kagawa, S; Kahle, B; Kaji, H; Kananov, S; Karshon, U; Karstens, F; Kasemann, M; Kataoka, M; Katkov, I I; Kcira, D; Keramidas, A; Khein, L A; Kim, J Y; Kind, O; Kisielewska, D; Kitamura, S; Koffeman, E; Kohno, T; Kooijman, P; Koop, T; Korzhavina, I A; Kotanski, A; Kötz, U; Kowal, A M; Kowalski, H; Kramberger, G; Kreisel, A; Krumnack, N; Kulinski, P; Kuze, M; Kuzmin, V A; Labarga, L; Lammers, S; Lelas, D; Levchenko, B B; Levy, A; Li, L; Lightwood, M S; Lim, H; Limentani, S; Ling, T Y; Liu, C; Liu, X; Löhr, B; Lohrmann, E; Loizides, J H; Long, K R; Longhin, A; Lukasik, J; Lukina, O Yu; Luzniak, P; Ma, K J; Maddox, E; Magill, S; Malka, J; Mankel, R; Margotti, A; Marini, G; Martin, J F; Martínez, M; Mastroberardino, A; Matsuzawa, K; Mattingly, M C K; Melzer-Pellmann, I A; Menary, S R; Metlica, F; Meyer, U; Miglioranzi, S; Milite, M; Mirea, A; Monaco, V; Montanari, A; Musgrave, B; Nagano, K; Namsoo, T; Nania, R; Nguyen, C N; Nigro, A; Ning, Y; Noor, U; Notz, D; Nowak, R J; Nuncio-Quiroz, A E; Oh, B Y; Olkiewicz, K; Ota, O; Padhi, S; Palmonari, F; Patel, S; Paul, E; Pavel, Usan; Pawlak, J M; Pelfer, P G; Pellegrino, A; Pesci, A; Piotrzkowski, K; Plamondon, M; Plucinsky, P P; Pokrovskiy, N S; Polini, A; Proskuryakov, A S; Przybycien, M B; Rautenberg, J; Raval, A; Reeder, D D; Ren, Z; Renner, R; Repond, J; Ri, Y D; Rinaldi, L; Robins, S; Rosin, M; Ruspa, M; Ryan, P; Sacchi, R; Salehi, H; Santamarta, R; Sartorelli, G; Savin, A A; Saxon, D H; Schagen, S; Schioppa, M; Schlenstedt, S; Schleper, P; Schmidke, W B; Schneekloth, U; Schörner-Sadenius, T; Sciulli, F; Shcheglova, L M; Skillicorn, I O; Slominski, W; Smith, W H; Soares, M; Solano, A; Son, D; Sosnovtsev, V V; Stairs, D G; Stanco, L; Standage, J; Stifutkin, A; Stonjek, S; Stopa, P; Stösslein, U; Straub, P B; Suchkov, S; Susinno, G; Suszycki, L; Sutiak, J; Sutton, M R; Sztuk, J; Szuba, D; Szuba, J; Tapper, A D; Targett-Adams, C; Tassi, E; Tawara, T; Terron, J; Tiecke, H G; Tokushuku, K; Tsurugai, T; Turcato, M; Tymieniecka, T; Tyszkiewicz, A; Ukleja, A; Ukleja, J; Vázquez, M; Vlasov, N N; Voss, K C; Walczak, R; Walsh, R; Wang, M; Whitmore, J J; Whyte, J; Wichmann, K; Wick, K; Wiggers, L; Wills, H H; Wing, M; Wlasenko, M; Wolf, G; Yagues-Molina, A G; Yamada, S; Yamazaki, Y; Yoshida, R; Youngman, C; Zambrana, M; Zawiejski, L; Zeuner, W; Zhautykov, B O; Zhou, C; Zichichi, A; Ziegler, A; Zotkin, D S; Zotkin, S A; De Favereau, J; De Wolf, E; Del Peso, J

    2005-01-01

    Exclusive electroproduction of $\\phi$ mesons has been studied in $e^\\pm p$ collisions at $\\sqrt{s}=318 \\gev$ with the ZEUS detector at HERA using an integrated luminosity of 65.1 pb$^{-1}$. The $\\gamma^*p$ cross section is presented in the kinematic range $2mesons. The ratios $R$ of the cross sections for longitudinally and transversely polarized virtual photons are presented as functions of $Q^2$ and $W$. The data are also compared to predictions from theoretical models.

  17. Nonequilibrium meson production in strong fields

    CERN Document Server

    Juchnowski, L; Fischer, T; Smolyansky, S A

    2015-01-01

    We develop a kinetic equation approach to nonequilibrium pion and sigma meson production in a time-dependent, chiral symmetry breaking field (inertial mechanism). We investigate the question to what extent the low-momentum pion enhancement observed in heavy-ion collisions at CERN - LHC can be addressed within this formalism. In a first step, we consider the inertial mechanism for nonequilibrium production of $\\sigma-$mesons and their simultaneous decay into pion pairs for two cases of $\\sigma$ mass evolution. The resulting pion distribution shows a strong low-momentum enhancement which can be approximated by a thermal Bose distribution with a chemical potential that appears as a trace of the nonequilibrium process of its production.

  18. Glueballs and vector mesons at NICA

    CERN Document Server

    Parganlija, Denis

    2016-01-01

    Two interconnected fields of interest are suggested for NICA. Firstly, existence of glueballs is predicted by the theory of strong interaction but -- even after decades of research -- glueball identification in the physical spectrum is still unclear. NICA can help to ascertain experimental glueball candidates via J/Psi decays whose yield is expected to be large. Importance of glueballs is not limited to vacuum: since they couple to other meson states, glueballs can also be expected to influence signatures of chiral-symmetry restoration in the high-energy phase of strong dynamics. Mass shifting or in-medium broadening of vector and axial-vector mesons may occur there but the extent of such phenomena is still uncertain. Additionally, glueball properties could also be modified in medium. Exploration of these issues is the second suggested field of interest that can be pursued at NICA.

  19. QCD monopole and sigma meson coupling

    CERN Document Server

    Iwazaki, Aiichi

    2016-01-01

    Under the assumption of the Abelian dominance in QCD, we show that chiral condensate is locally present around a QCD monopole. The appearance of the chiral condensate around a GUT monopole was shown in the previous analysis of the Rubakov effect. We apply a similar analysis to the QCD monopole. It follows that the condensation of the monopole carrying the chiral condensate leads to the chiral symmetry breaking as well as quark confinement. To realize the result explicitly, we present a phenomenological linear sigma model coupled with the monopoles, in which the monopole condensation causes the chiral symmetry breaking as well as confinement. The monopoles are assumed to be described by a model of dual superconductor. We identify the monopoles with scalar isoscalar $f_0$ mesons with masses $1400\\sim 1700$ MeV as well as dual gauge fields with $h_1$ vector mesons with masses $\\sim 1500$MeV.

  20. Exploring $X(5568)$ as a meson molecule

    CERN Document Server

    Agaev, S S; Sundu, H

    2016-01-01

    The parameters, i.e. the mass and decay constant of the exotic $X_b(5568)$ state newly observed by D0 Collaboration, as well as the decay width of the process $X_b \\to B_s^{0}\\pi^{+}$ are explored using $B\\overline{K}$ molecule assumption on its structure. Computational methods employed here encompass QCD two-point and light-cone sum rules, latter being considered in the soft-meson approximation. The obtained results are compared with the data of the D0 Collaboration, as well as with the predictions of the diquark-antidiquark model. This comparison strengthens the diquark-antidiquark picture for the $X_b(5568)$ state rather than a meson molecule structure.

  1. Meson exchange and neutral weak currents

    International Nuclear Information System (INIS)

    Measurements of parity-violating electron scattering asymmetries to determine weak neutral currents in nuclei will be effected by the presence of meson exchange currents. Present low momentum transfer calculations, based on a flavor independent framework, show these effects to be small. In general, however, as the momentum transfer increases to values typical of deep-inelastic scattering, fragmentation functions show a clear flavor dependence. It is suggested that a good experimental starting point for understanding the flavor dependence of meson production and exchange currents is the Q2 dependence of parity-violating asymmetry in inclusive single pion electroproduction. A CEBAF facility with doubled energy is necessary to approach momentum transfers where this process begins to scale

  2. Vector mesons in strongly interacting matter

    Indian Academy of Sciences (India)

    Volker Metag

    2010-08-01

    Properties of hadrons in strongly interacting matter provide a link between quantum chromodynamics in the strong coupling regime and experimental observables. QCD sum rules show that changes in chiral and higher-order condensates, partially associated with a restoration of chiral symmetry in the nuclear medium, will lead to significant changes in the low-energy spectrum of hadrons. Heavy-ion collisions and reactions with elementary probes have been used to extract experimental information on in-medium properties of hadrons. Results on the light vector mesons ρ, , and , are summarized and compared. Almost all experiments report a softening of the spectral functions with increases in width depending on the density and temperature of the hadronic environment. No evidence for mass shifts is found in majority of the experiments. Remaining inconsistencies among experimental results demonstrate the need for further measurements with higher statistics and inrceased acceptance in particular for low-momentum vector mesons.

  3. Diffractive hadronic production of D mesons

    International Nuclear Information System (INIS)

    A search for charmed D mesons was made with a 217 GeV π- beam on a liquid hydrogen target. The Chicago Cyclotron Spectrometer at Fermilab was used to analyze the hadronic decay of a D meson in coincidence with a prompt muon and a recoil proton. A total of 50 +- 12 D+- events were observed with equal numbers in the two channels K+-π-+π-+. Some of the cuts selected diffractive events. When these cuts were removed the signal remained the same, although the background was greatly increased. The Feynman X and angular distributions were consistent with diffractive production. A diffractive model yielded a cross section of (6 to 10) +- 4 μb

  4. Meson exchange and neutral weak currents

    Energy Technology Data Exchange (ETDEWEB)

    Beck, D.H. [Univ. of Illinois, Urbana, IL (United States)

    1994-04-01

    Measurements of parity-violating electron scattering asymmetries to determine weak neutral currents in nuclei will be effected by the presence of meson exchange currents. Present low momentum transfer calculations, based on a flavor independent framework, show these effects to be small. In general, however, as the momentum transfer increases to values typical of deep-inelastic scattering, fragmentation functions show a clear flavor dependence. It is suggested that a good experimental starting point for understanding the flavor dependence of meson production and exchange currents is the Q{sup 2} dependence of parity-violating asymmetry in inclusive single pion electroproduction. A CEBAF facility with doubled energy is necessary to approach momentum transfers where this process begins to scale.

  5. Rotational Spectra of the Baryons and Mesons

    CERN Document Server

    Akers, D

    2003-01-01

    An investigation of the rotational spectra of baryons and mesons is conducted. Diakonov, Petrov and Polyakov claimed that all light baryons are rotational excitations. A study of the history of particle physics indicates that the ideas of rotational spectra can be originally attributed to a constituent-quark (CQ) model as proposed by Mac Gregor. Later research advanced spin-orbit splitting in a deformed model as suggested by Bhaduri and others. In the present work, we show from current data that the rotational spectra of baryons and mesons are in agreement with the original claims of Mac Gregor: namely, the values for the rotational energies Erot of particles merge with those of nuclear rotational bands in light nuclei. It is also shown that particles of different isotopic spins are separated in mass by a 70 MeV quantum, which is related to the SU(3) decuplet mass spacing as originally proposed by Gell-Mann.

  6. LHCb: LHCb results on $B$ meson mixing

    CERN Multimedia

    Eitschberger, U

    2013-01-01

    On the poster three LHCb results on B meson mixing using a datasample of 1 fb$^{-1}$ of $pp$ collisions at $\\sqrt{s} =$ 7 TeV are presented. The B meson oscillation frequencies are measured as $\\Delta m_d = 0.5156 \\pm 0.0051 (\\text{stat}) \\pm 0.0033 (\\text{syst}) \\text{ps}^{-1}$ and $\\Delta m_s = 17.768 \\pm 0.023 (\\text{stat}) \\pm 0.006 (\\text{syst}) \\text{ps}^{-1}$. The CP violation observables in the decay channel $B^0 \\rightarrow J/\\psi K^0_S$ are determined as $S_{J/\\psi K^0_S} = 0.73 \\pm 0.07 (\\text{stat})\\pm 0.04 (\\text{syst})$ and $C_{J/\\psi K^0_S} = 0.03 \\pm 0.09 (\\text{stat})\\pm 0.01 (\\text{syst})$.

  7. Antinucleon nucleon annihilations into two mesons

    International Nuclear Information System (INIS)

    We study two aspects of the antinucleon-nucleon annihilation into two mesons (antiNN → M1M2), starting from simple Born diagrams. On one hand, we discuss the possibility of modelling the antiNN optical potential with the box diagrams related to the M1M2 channels. We include the lightest pseudoscalar, scalar and vector mesons with effective coupling constants. Much more channels appear to be needed in order to achieve sensible results. On the other hand, we show that a simple phenomenological optical potential, successfull in reproducing antiNN elastic scattering and total annihilation data can be further used to make predictions on the antiNN → M1M2 processes, which prove to be in good agreement with experiment. We find a lower bound of 17% on the relative contribution of these reactions to the antiNN annihilation. Also, the model favours a rather small effective radius for the nucleon

  8. Electroproduction of tensor mesons in QCD

    Science.gov (United States)

    Braun, V. M.; Kivel, N.; Strohmaier, M.; Vladimirov, A. A.

    2016-06-01

    Due to multiple possible polarizations hard exclusive production of tensor mesons by virtual photons or in heavy meson decays offers interesting possibilities to study the helicity structure of the underlying short-distance process. Motivated by the first measurement of the transition form factor γ∗γ → f 2(1270) at large momentum transfers by the BELLE collaboration we present an improved QCD analysis of this reaction in the framework of collinear factorization including contributions of twist-three quark-antiquark-gluon operators and an estimate of soft end-point corrections using light-cone sum rules. The results appear to be in good agreement with the data, in particular the predicted scaling behavior is reproduced in all cases.

  9. Electroproduction of tensor mesons in QCD

    CERN Document Server

    Braun, V M; Strohmaier, M; Vladimirov, A A

    2016-01-01

    Due to multiple possible polarizations hard exclusive production of tensor mesons by virtual photons or in heavy meson decays offers interesting possibilities to study the helicity structure of the underlying short-distance process. Motivated by the first measurement of the transition form factor $\\gamma^*\\gamma \\to f_2(1270)$ at large momentum transfers by the BELLE collaboration we present an improved QCD analysis of this reaction in the framework of collinear factorization including contributions of twist-three quark-antiquark-gluon operators and an estimate of soft end-point corrections using light-cone sum rules. The results appear to be in a very good agreement with the data, in particular the predicted scaling behavior is reproduced in all cases.

  10. Polarization observables in φ-meson photoproduction

    International Nuclear Information System (INIS)

    We analyze polarization observables of the φ-meson photoproduction from a proton within the uud-ss bar cluster model as a probe of strangeness in the proton. Our consideration is based on the relativistic quark model that takes into account the Lorentz-contraction effects of the intrinsic hadron wave functions. We show that transverse target-recoil and longitudinal beam-target double polarizations in the diffractive vector meson dominance model are different from those of the knockout mechanisms and the difference between them is as much as 20∼80% if only 0.2∼0.3% strangeness admixture in proton wave function is assumed. This strong effect may be studied experimentally. 17 refs., 4 figs

  11. mRNA Expression of EgCHI1, EgCHI2, and EgCHI3 in Oil Palm Leaves (Elaeis guineesis Jacq.) after Treatment with Ganoderma boninense Pat. and Trichoderma harzianum Rifai

    OpenAIRE

    Laila Naher; Soon Guan Tan; Chai Ling Ho; Umi Kalsom Yusuf; Siti Hazar Ahmad; Faridah Abdullah

    2012-01-01

    Background. Basal stem rot (BSR) disease caused by the fungus Ganoderma boninense is the most serious disease affecting the oil palm; this is because the disease escapes the early disease detection. The biocontrol agent Trichoderma harzianum can protect the disease only at the early stage of the disease. In the present study, the expression levels of three oil palm (Elaeis guineensis Jacq.) chitinases encoding EgCHI1, EgCHI2, and EgCHI3 at 2, 5, and 8 weeks inoculation were measured in oil pa...

  12. High-level expression and characterization of two chitinases, ChiCH and ChiCW, of Bacillus cereus 28-9 in Escherichia coli

    International Nuclear Information System (INIS)

    Many chitinase genes have been cloned and sequenced from prokaryotes and eukaryotes but overexpression of chitinases in Escherichia coli cells was less reported. ChiCH and ChiCW of Bacillus cereus 28-9 belong to two distinct groups based on their amino acid sequences of catalytic domains, and in addition, domain structures of two enzymes are different. In this study, we established an ideal method for high-level expression of chitinases in E. coli as glutathione-S-transferase fusion proteins using pGEX-6P-1 vector. Both ChiCH and ChiCW were successfully highly expressed in E. coli cells as soluble GST-chitinase fusion proteins, and recombinant native ChiCH and ChiCW could be purified after cleavage with PreScission protease to remove GST tag. Purified chitinases were used for biochemical characterization of kinetics, hydrolysis products, and binding activities. The results indicate that ChiCW is an endo-chitinase and effectively hydrolyzes chitin and chito-multimers to chito-oligomers and the end product chitobiose, and ChiCH is an exo-chitinase and degrades chito-oligomers to produce chitobiose. Furthermore, due to higher affinity of ChiCW toward colloidal chitin than Avicel, C-terminal domain of ChiCW should be classified as a chitin-binding domain not a cellulose-binding domain although that was revealed as a cellulose-binding domain by conserved domain analysis. Therefore, the method of high-level expression of chitinases is helpful to studies and applications of chitinases

  13. LAMPF: the meson factory. A LASL monograph

    Energy Technology Data Exchange (ETDEWEB)

    Allred, J.C.

    1977-08-01

    A general and simplified introduction to the entire concept of LAMPF is given in terms of its experimental capabilities. Parts of the current experimental program are used as illustrative examples. Topics discussed include: (1) the evolution of the meson factory; (2) accelerator construction; (3) strong focusing; (4) accelerator innovations at LAMPF; (5) photons and pions; (6) muons as nuclear probes; (7) nuclear chemistry; (8) radiobiology and medical applications; (9) radioisotope production; (10) materials testing; and (11) LAMPF management and users group. (PMA)

  14. Radiative widths of K and rho mesons

    International Nuclear Information System (INIS)

    The dissociation of K and π mesons in the nuclear Coulomb field has been studied. Results are: GAMMA(rho→πγ) = 67 +- 7 KeV., GAMMA(K*(890)→Kπ) = 60 +- 15 KeV; and the observation of Coulomb excitation of the following states: K*(1420,1700),A2,A1,B. The measured widths are in rough agreement with a simple quark model

  15. Non-conventional mesons at PANDA

    Science.gov (United States)

    Giacosa, Francesco

    2015-04-01

    Non-conventional mesons, such as glueballs and tetraquarks, will be in the focus of the PANDA experiment at the FAIR facility. In this lecture we recall the basic properties of QCD and describe some features of unconventional states. We focus on the search of the not-yet discovered glueballs and the use of the extended Linear Sigma Model for this purpose, and on the already discovered but not-yet understood X, Y, Z states.

  16. B meson physics and related new physics

    International Nuclear Information System (INIS)

    We have surveyed the some models focusing on the mixings, the CP violation and the rare decay in the B meson system. The ARGUS data of the Bd0-B-bard0 mixing gives us some constraints as to parameters of these models. Especially, we have investigated the composite scale in detail using the ARGUS data of the Bd0-B-bard0 mixing and obtained some interesting results. (author)

  17. Remarks on the exotic U-meson

    International Nuclear Information System (INIS)

    In expectation of imminent results from the new hyperon beam experiment at CERN concerning the exotic U-meson at 3.1 GeV, we propose a detailed program of experimental tests to check the suggestion that U is a qqq-barq-bar ''M-diquonium'' state. Apart from some very characteristic decay modes, the U is expected to occur together with several analogous states with various quantum numbers to which it is intimately related. (author)

  18. Non-perturbative effects in heavy mesons

    International Nuclear Information System (INIS)

    The existence of a non-trivial vacuum has influences on bound states. We calculate its effects on heavy pseudoscalar mesons parameterizing the non-perturbative properties by gluon condensates and using a non-relativistic approximation. We derive and effective Hamiltonian taking into account the interaction with the gluonic vacuum. The background gauge formalism used preserves gauge invariance. Non-perturbative effects are shown to be more important in higher excited states. (author)

  19. Bubble chamber: D meson production and decay

    CERN Multimedia

    1978-01-01

    This event shows real particle tracks from the Big European Bubble Chamber (BEBC), which was used to observe neutrino and hadron beams between 1973 and 1984 from the PS and SPS accelerators. In this event a neutrino interacts with a proton producing an excited D meson. A labeled diagram is seen on the right as the particles spiral in the magnetic field of the detector.

  20. Understanding the baryon and meson spectra

    Energy Technology Data Exchange (ETDEWEB)

    Pennington, Michael R. [JLAB

    2013-10-01

    A brief overview is given of what we know of the baryon and meson spectra, with a focus on what are the key internal degrees of freedom and how these relate to strong coupling QCD. The challenges, experimental, theoretical and phenomenological, for the future are outlined, with particular reference to a program at Jefferson Lab to extract hadronic states in which glue unambiguously contributes to their quantum numbers.

  1. Leading logarithms for mesons and nucleons

    OpenAIRE

    Bijnens, Johan; Kampf, Karol; Vladimirov, Alexey

    2015-01-01

    This talk describes the work done in calculating leading logarithms in massive effective field theories. We discuss shortly leading logarithms in renormalizable theories and how they can be calculated using only one-loop calculations in effective field theories. The remainder of the talk discusses masses, decay constants, condensates and anomalous processes in mesonic effective field theories like Chiral Perturbation Theory and the expansion of the nucleon mass.

  2. Euclidean fields: vector mesons and photons

    International Nuclear Information System (INIS)

    Free transverse vector fields of mass >= 0 are studied. The model is related to the usual free vector meson and electromagnetic quantum field theories by extension of the field operators from transverse to arbitrary test functions. The one-particle states in transverse gauge and their localization are described. Reflexion positivity is proved and derived are free Feynman-Kac-Nelson formulas. An Euclidean approach to a photon field in a spherical world using dilatation covariance and inversions is given

  3. Vector meson production from a polarized nucleon

    International Nuclear Information System (INIS)

    We provide a framework to analyze the electroproduction process ep→epρ with a polarized target, writing the angular distribution of the ρ decay products in terms of spin density matrix elements that parameterize the hadronic subprocess γ*p → ρp. Using the helicity basis for both photon and meson, we find a representation in which the expressions for a polarized and unpolarized target are related by simple substitution rules. (orig.)

  4. Vector meson contributions in ε'/ε

    International Nuclear Information System (INIS)

    The CP-violating parameter -bar '/-bar is computed using the low-energy dynamics of the chiral theory supplemented by vector resonances. The divergent contributions coming from strong π-π scattering are tamed by vector-meson exchange terms. This amounts to softening the fast growing high-energy behaviour of π-π scattering. The final result for ε'/ε shows a smooth dependence on the cut-off where low energy dynamics is matched with that of QCD

  5. Exclusive hadronic decays of B mesons

    International Nuclear Information System (INIS)

    Using the ARGUS detector at the e+e- storage ring DORIS II, we have measured B decays into exclusive final states containing a D or D* meson plus several pions, or containing a J/ψ or ψ' meson plus a strange particle. Some of these channels have not been seen before, while others represent updated measurements of previous results. The branching ratios are compared with the predictions of the model of Bauer, Stech and Wirbel. Using the cleanest decay channels, the mass of the charged and neutral B meson are found to be msub(B-)=(5280.5±1.0±2.0) MeV/c2 and msub(B0)=(5279.6±0.7±2.0) MeV/c2 respectively, yielding a mass difference msub(B0)-msub(B-)=(-0.9±1.2±0.5) MeV/c2. (orig.)

  6. Leptonic Decays of Charged Pseudoscalar Mesons - 2015

    CERN Document Server

    Rosner, Jonathan L; Van de Water, Ruth S

    2015-01-01

    We review the physics of purely leptonic decays of $\\pi^\\pm$, $K^\\pm$, $D^{\\pm}$, $D_s^\\pm$, and $B^\\pm$ pseudoscalar mesons. The measured decay rates are related to the product of the relevant weak-interaction-based CKM matrix element of the constituent quarks and a strong interaction parameter related to the overlap of the quark and antiquark wave-functions in the meson, called the decay constant $f_P$. The leptonic decay constants for $\\pi^\\pm$, $K^\\pm$, $D^{\\pm}$, $D_s^\\pm$, and $B^\\pm$ mesons can be obtained with controlled theoretical uncertainties and high precision from {\\it ab initio} lattice-QCD simulations. The combination of experimental leptonic decay-rate measurements and theoretical decay-constant calculations enables the determination of several elements of the CKM matrix within the standard model. These determinations are competitive with those obtained from semileptonic decays, and also complementary because they are sensitive to different quark flavor-changing currents. They can also be use...

  7. Κ-meson decays and parity violation

    International Nuclear Information System (INIS)

    Between 1948 and 1954 many Κ-meson decay modes were observed, including the tau, pion and xi positives, in emulsion experiments all with masses around 500 MeV. An attempt was made to rationalize the various names for the new particles being discovered. A period of experimental consolidation followed. An attempt was then made to determine the spin parity of the three-pion system from tau plus decay using matrix calculations. New stripped emulsion techniques now permitted a secondary-particle track to be followed to its endpoint. Stacked emulsions were flown in balloons to study Κ mesons and hyperons using cosmic radiation. Later similar work used the new particle accelerators, the Cosmotron and the Bevatron as sources. The author showed that the tau plus and theta plus were competing decay modes of the same Κ+ meson, but this meant that parity conservation was violated. Later theoreticians T D Lee and C N Yang provided evidence for this surprising idea from their work on semileptonic weak interactions. (UK)

  8. Holographic Picture of Heavy Vector Meson Melting

    CERN Document Server

    Braga, Nelson R F; Diles, Saulo

    2016-01-01

    The fraction of heavy vector mesons produced in a heavy ion collision, as compared to a proton proton collision, serves as an important indication of the formation of a thermal medium, the quark gluon plasma. This sort of analysis strongly depends on understanding the thermal effects of a medium like the plasma on the states of heavy mesons. In particular, it is crucial to know the temperature ranges where they undergo a thermal dissociation, or melting. AdS/QCD models are know to provide an important tool for the calculation of hadronic masses, but in general are not consistent with the observation that decay constants of heavy vector mesons decrease with excitation level. It has recently been shown that this problem can be overcome using a soft wall background and introducing an extra energy parameter, through the calculation of correlation functions at a finite position of anti-de Sitter space. This approach leads to the evaluation of masses and decay constants of S wave quarkonium states with just one fla...

  9. Meson F1 spin and parity measurement

    International Nuclear Information System (INIS)

    Data of several series of antiproton-proton annihilation events produced at 1,1 to 2,04 GeV/c are analyzed. The meson resonances three-body disintegration (KantiKπ) and particularly the F1 meson of which quantum numbers spin and parity were not quite determinated, were studied. In the antiproton-proton reaction, it was possible to put into evidence the F1 meson existence. To test the spin, in this experiment were used the following processes: the 'angular correlation' test using the production of F1 associated with the omega as well as the desintegrations in series F1→K*K, K*→Kπ; the 'positivity' test which are directly bound to the positivity conditions of the F1 polarization density operator and use only F1→K*K desintegration. The coherence in the measures obtained in several independent tests allowed to conclude with a good experimental evidence that the spin-parity hypothesis Jsub(F1)sup(P)=2- is the most probable

  10. Decays of mesons with charm quarks on the lattice

    International Nuclear Information System (INIS)

    We investigate mesons containing charm quarks on fine lattices with a-1 ∝ 5 GeV. The quenched approximation is employed using theWilson gauge action at β = 6.6 and nonperturbatively O(a) improvedWilson quarks. We present results for decay constants using various interpolating fields and give preliminary results for form factors of semileptonic decays of Ds mesons to light pseudoscalar mesons. (orig.)

  11. Spin O decay angular distribution for interfering mesons in electroproduction

    International Nuclear Information System (INIS)

    Self analyzing meson electroproduction experiments are currently being planned for the CEBAF CLAS detector. These experiments deduce the spin polarization of outgoing unstable spin s (?)0 mesons from their decay angular distribution, W(θ,ψ). The large angular acceptance of the CLAS detector permits kinematic tracking of a sufficient number of these events to accurately determine electroproduction amplitudes from the deduced polarization. Maximum polarization information is obtained from W(θ,ψ) for decay into spin 0 daughters. The helicity of the decaying meson is transferred to the daughter's relative orbital angular momentum m-projection; none is open-quotes absorbedclose quotes into daughter helicities. The decaying meson's helicity maximally appears in W(θ,ψ). W(θ,ψ) for spin 0 daughters has been derived for (1) vector meson electroproduction and (2) general interfering mesons produced by incident pions. This paper derives W(θ,ψ) for electroproduction of two interfering mesons that decay into spin 0 daughters. An application is made to the case of interfering scalar and vector mesons. The derivation is an extension of work by Schil using the general decay formalism of Martin. The expressions can be easily extended to the case of N interfering mesons since interference occurs pairwise in the observable W (θ,ψ), a quadratic function of the meson amplitudes. The derivation uses the virtual photon density matrix of Schil which is transformed by a meson electroproduction transition operator, T. The resulting density matrix for the interfering mesons is then converted into a corresponding statistical tensor and contracted into the efficiency tensor for spin 0 daughters

  12. Inclusive spectra of hadrons in B-meson decays

    International Nuclear Information System (INIS)

    The inclusive spectra of hadrons (mainly pions) produced in the semileptonic and nonleptonic decays of B-mesons are calculated. Parameters of spectra for different types of hard qq-bar-strings, appearing in the B-meson decays, are determined using the data on e+e-annihilation. Numerical results for B-meson decay induced by both b→b and b→u transitions are presented. 10 refs.; 5 figs

  13. Open flavour charmed mesons in a quantum chromodynamics potential model

    Indian Academy of Sciences (India)

    Krishna Kingkar Pathak; D K Choudhury

    2012-12-01

    We modify the mesonic wave function by using a short distance scale 0 in analogy with hydrogen atom and estimate the values of masses and decay constants of the open flavour charm mesons , $D_{s}$ and $B_{c}$ within the framework of a QCD potential model. We also calculate leptonic decay widths of these mesons to study branching ratios and lifetime. The results are in good agreement with experimental and other theoretical values.

  14. Central exclusive meson pair production in the perturbative regime

    CERN Document Server

    Harland-Lang, L A; Ryskin, M G; Stirling, W J

    2011-01-01

    We present a study of the central exclusive production (CEP) of meson pairs, MMbar, at sufficiently high invariant mass that a perturbative QCD formalism is applicable. Within this framework, MMbar production proceeds via the gg --> MMbar hard scattering sub-process, which can be calculated within the hard exclusive formalism. We present explicit calculations for the gg --> MMbar helicity amplitudes for different meson states and, using these, show results for meson pair CEP in the perturbative regime.

  15. Hadronic D and D_s Meson Decays

    CERN Document Server

    Ryd, Anders

    2009-01-01

    We provide a comprehensive review of hadronic decays of D and D_s mesons. We discuss current theoretical and experimental challenges and successes in understanding of hadronic transitions of those mesons. A brief overview of the theoretical and experimental tools are given before discussing the absolute branching fractions for D and D_s mesons. Cabibbo suppressed and rare hadronic decays are discussed and compared with theory before discussing our understanding of hadronic multibody decays.

  16. Chiral phase transition scenarios from the vector meson extended Polyakov quark meson model

    CERN Document Server

    Kovács, Péter

    2015-01-01

    Chiral phase transition is investigated in an $SU(3)_L \\times SU(3)_R$ symmetric vector meson extended linear sigma model with additional constituent quarks and Polyakov loops (extended Polyakov quark meson model). The parameterization of the Lagrangian is done at zero temperature in a hybrid approach, where the mesons are treated at tree-level, while the constituent quarks at 1-loop level. The temperature and baryochemical potential dependence of the two assumed scalar condensates are calculated from the hybrid 1-loop level equations of states. The order of the phase transition along the $T=0$ and $\\mu_B=0$ axes are determined for various parameterization scenarios. We find that in order to have a first order phase transition at $T=0$ as a function of $\\mu_B$ a light isoscalar particle is needed.

  17. The CHY representation of tree-level primitive QCD amplitudes

    CERN Document Server

    de la Cruz, Leonardo; Weinzierl, Stefan

    2015-01-01

    In this paper we construct a CHY representation for all tree-level primitive QCD amplitudes. The quarks may be massless or massive. We define a generalised cyclic factor $\\hat{C}(w,z)$ and a generalised permutation invariant function $\\hat{E}(z,p,\\varepsilon)$. The amplitude is then given as a contour integral encircling the solutions of the scattering equations with the product $\\hat{C} \\hat{E}$ as integrand. Equivalently, it is given as a sum over the inequivalent solutions of the scattering equations, where the summand consists of a Jacobian times the product $\\hat{C} \\hat{E}$. This representation separates information: The generalised cyclic factor does not depend on the helicities of the external particles, the generalised permutation invariant function does not depend on the ordering of the external particles.

  18. The CHY representation of tree-level primitive QCD amplitudes

    Science.gov (United States)

    de la Cruz, Leonardo; Kniss, Alexander; Weinzierl, Stefan

    2015-11-01

    In this paper we construct a CHY representation for all tree-level primitive QCD amplitudes. The quarks may be massless or massive. We define a generalised cyclic factor Ĉ( w, z) and a generalised permutation invariant function Ê( z, p, ɛ). The amplitude is then given as a contour integral encircling the solutions of the scattering equations with the product ĈÊ as integrand. Equivalently, it is given as a sum over the inequivalent solutions of the scattering equations, where the summand consists of a Jacobian times the product Ĉ Ê. This representation separates information: The generalised cyclic factor does not depend on the helicities of the external particles, the generalised permutation invariant function does not depend on the ordering of the external particles.

  19. Study of $B^+_c$ decays to the $K^+K^-\\pi^+$ final state and evidence for the decay $B^+_c\\to\\chi_{c0}\\pi^+$

    CERN Document Server

    Aaij, Roel; Adinolfi, Marco; Ajaltouni, Ziad; Akar, Simon; Albrecht, Johannes; Alessio, Federico; Alexander, Michael; Ali, Suvayu; Alkhazov, Georgy; Alvarez Cartelle, Paula; Alves Jr, Antonio Augusto; Amato, Sandra; Amerio, Silvia; Amhis, Yasmine; An, Liupan; Anderlini, Lucio; Andreassi, Guido; Andreotti, Mirco; Andrews, Jason; Appleby, Robert; Aquines Gutierrez, Osvaldo; Archilli, Flavio; d'Argent, Philippe; Arnau Romeu, Joan; Artamonov, Alexander; Artuso, Marina; Aslanides, Elie; Auriemma, Giulio; Baalouch, Marouen; Babuschkin, Igor; Bachmann, Sebastian; Back, John; Badalov, Alexey; Baesso, Clarissa; Baldini, Wander; Barlow, Roger; Barschel, Colin; Barsuk, Sergey; Barter, William; Batozskaya, Varvara; Batsukh, Baasansuren; Battista, Vincenzo; Bay, Aurelio; Beaucourt, Leo; Beddow, John; Bedeschi, Franco; Bediaga, Ignacio; Bel, Lennaert; Bellee, Violaine; Belloli, Nicoletta; Belous, Konstantin; Belyaev, Ivan; Ben-Haim, Eli; Bencivenni, Giovanni; Benson, Sean; Benton, Jack; Berezhnoy, Alexander; Bernet, Roland; Bertolin, Alessandro; Betti, Federico; Bettler, Marc-Olivier; van Beuzekom, Martinus; Bezshyiko, Iaroslava; Bifani, Simone; Billoir, Pierre; Bird, Thomas; Birnkraut, Alex; Bitadze, Alexander; Bizzeti, Andrea; Blake, Thomas; Blanc, Frederic; Blouw, Johan; Blusk, Steven; Bocci, Valerio; Boettcher, Thomas; Bondar, Alexander; Bondar, Nikolay; Bonivento, Walter; Borgheresi, Alessio; Borghi, Silvia; Borisyak, Maxim; Borsato, Martino; Bossu, Francesco; Boubdir, Meriem; Bowcock, Themistocles; Bowen, Espen Eie; Bozzi, Concezio; Braun, Svende; Britsch, Markward; Britton, Thomas; Brodzicka, Jolanta; Buchanan, Emma; Burr, Christopher; Bursche, Albert; Buytaert, Jan; Cadeddu, Sandro; Calabrese, Roberto; Calvi, Marta; Calvo Gomez, Miriam; Camboni, Alessandro; Campana, Pierluigi; Campora Perez, Daniel; Campora Perez, Daniel Hugo; Capriotti, Lorenzo; Carbone, Angelo; Carboni, Giovanni; Cardinale, Roberta; Cardini, Alessandro; Carniti, Paolo; Carson, Laurence; Carvalho Akiba, Kazuyoshi; Casse, Gianluigi; Cassina, Lorenzo; Castillo Garcia, Lucia; Cattaneo, Marco; Cauet, Christophe; Cavallero, Giovanni; Cenci, Riccardo; Charles, Matthew; Charpentier, Philippe; Chatzikonstantinidis, Georgios; Chefdeville, Maximilien; Chen, Shanzhen; Cheung, Shu-Faye; Chobanova, Veronika; Chrzaszcz, Marcin; Cid Vidal, Xabier; Ciezarek, Gregory; Clarke, Peter; Clemencic, Marco; Cliff, Harry; Closier, Joel; Coco, Victor; Cogan, Julien; Cogneras, Eric; Cogoni, Violetta; Cojocariu, Lucian; Collazuol, Gianmaria; Collins, Paula; Comerma-Montells, Albert; Contu, Andrea; Cook, Andrew; Coquereau, Samuel; Corti, Gloria; Corvo, Marco; Costa Sobral, Cayo Mar; Couturier, Benjamin; Cowan, Greig; Craik, Daniel Charles; Crocombe, Andrew; Cruz Torres, Melissa Maria; Cunliffe, Samuel; Currie, Robert; D'Ambrosio, Carmelo; Dall'Occo, Elena; Dalseno, Jeremy; David, Pieter; Davis, Adam; De Aguiar Francisco, Oscar; De Bruyn, Kristof; De Capua, Stefano; De Cian, Michel; De Miranda, Jussara; De Paula, Leandro; De Serio, Marilisa; De Simone, Patrizia; Dean, Cameron Thomas; Decamp, Daniel; Deckenhoff, Mirko; Del Buono, Luigi; Demmer, Moritz; Derkach, Denis; Deschamps, Olivier; Dettori, Francesco; Dey, Biplab; Di Canto, Angelo; Dijkstra, Hans; Dordei, Francesca; Dorigo, Mirco; Dosil Su{á}rez, Alvaro; Dovbnya, Anatoliy; Dreimanis, Karlis; Dufour, Laurent; Dujany, Giulio; Dungs, Kevin; Durante, Paolo; Dzhelyadin, Rustem; Dziurda, Agnieszka; Dzyuba, Alexey; D{é}l{é}age, Nicolas; Easo, Sajan; Ebert, Marcus; Egede, Ulrik; Egorychev, Victor; Eidelman, Semen; Eisenhardt, Stephan; Eitschberger, Ulrich; Ekelhof, Robert; Eklund, Lars; Elsasser, Christian; Ely, Scott; Esen, Sevda; Evans, Hannah Mary; Evans, Timothy; Falabella, Antonio; Farley, Nathanael; Farry, Stephen; Fay, Robert; Fazzini, Davide; Ferguson, Dianne; Fernandez Albor, Victor; Fernandez Prieto, Antonio; Ferrari, Fabio; Ferreira Rodrigues, Fernando; Ferro-Luzzi, Massimiliano; Filippov, Sergey; Fini, Rosa Anna; Fiore, Marco; Fiorini, Massimiliano; Firlej, Miroslaw; Fitzpatrick, Conor; Fiutowski, Tomasz; Fleuret, Frederic; Fohl, Klaus; Fontana, Marianna; Fontanelli, Flavio; Forshaw, Dean Charles; Forty, Roger; Franco Lima, Vinicius; Frank, Markus; Frei, Christoph; Fu, Jinlin; Furfaro, Emiliano; F{ä}rber, Christian; Gallas Torreira, Abraham; Galli, Domenico; Gallorini, Stefano; Gambetta, Silvia; Gandelman, Miriam; Gandini, Paolo; Gao, Yuanning; Garcia Martin, Luis Miguel; Garc{í}a Pardi{ñ}as, Juli{á}n; Garra Tico, Jordi; Garrido, Lluis; Garsed, Philip John; Gascon, David; Gaspar, Clara; Gavardi, Laura

    2016-01-01

    A study of $B_c^+\\to K^+K^-\\pi^+$ decays is performed for the first time using data corresponding to an integrated luminosity of 3.0 $\\mathrm{fb}^{-1}$ collected by the LHCb experiment in $pp$ collisions at centre-of-mass energies of $7$ and $8$ TeV. Evidence for the decay $B_c^+\\to\\chi_{c0}(\\to K^+K^-)\\pi^+$ is reported with a significance of 4.0 standard deviations, resulting in the measurement of $\\frac{\\sigma(B_c^+)}{\\sigma(B^+)}\\times\\mathcal{B}(B_c^+\\to\\chi_{c0}\\pi^+)$ to be $(9.8^{+3.4}_{-3.0}(\\mathrm{stat})\\pm 0.8(\\mathrm{syst}))\\times 10^{-6}$. Here $\\mathcal{B}$ denotes a branching fraction while $\\sigma(B_c^+)$ and $\\sigma(B^+)$ are the production cross-sections for $B_c^+$ and $B^+$ mesons. An indication of $\\overline b c$ weak annihilation is found for the region $m(K^-\\pi^+)<1.834\\mathrm{\\,Ge\\kern -0.1em V\\!/}c^2$, with a significance of 2.4 standard deviations.

  20. Observations and Measurements of Orbitally Excited L=1 B Mesons at the D0 Experiment

    Energy Technology Data Exchange (ETDEWEB)

    Williams, Mark Richard James; /Lancaster U.

    2008-09-01

    This thesis describes investigations of the first set of orbitally excited (L = 1) states for both the B{sub d}{sup 0} and B{sub s}{sup 0} meson systems (B**{sub d} and B**{sub s}). The data sample corresponds to 1.35 fb{sup -1} of integrated luminosity, collected in 2002-2006 by the D0 detector, during the Run IIa operation of the Tevatron p{bar p} colliding beam accelerator. The B**{sub d} states are fully reconstructed in decays to B{sup (*)+} {pi}{sup -}, with B{sup (*)+} {yields} {gamma} J/{psi}K{sup +}, J/{psi} {yields} {mu}{sup +}{mu}{sup -}, yielding 662 {+-} 91 events, and providing the first strong evidence for the resolution of two narrow resonances, B{sub 1} and B*{sub 2}. The masses are extracted from a binned {chi}{sup 2} fit to the invariant mass distribution, giving M(B{sub 1}) = 5720.7 {+-} 2.4(stat.) {+-} 1.3(syst.) {+-} 0.5 (PDG) MeV/c{sup 2} and M(B*{sub 2}) = 5746.9 {+-} 2.4(stat.) {+-} 1.0(syst.) {+-} 0.5(PDG) MeV/c{sup 2}. The production rate of narrow B**{sub d} {yields} B{pi} resonances relative to the B{sup +} meson is determined to be [13.9 {+-} 1.9(stat.) {+-} 3.2(syst.)]%. The same B{sup +} sample is also used to reconstruct the analogous states in the B{sub s}{sup 0} system, in decays B**{sub s} {yields} B{sup (*)+} K{sup -}. A single resonance in the invariant mass distribution is found with a statistical significance of 5{sigma}, interpreted as the B*{sub s2} state. The mass is determined to be M(B*{sub s2}) = 5839.6 {+-} 1.1(stat.) {+-} 0.4(syst.) {+-} 0.5(PDG) MeV/c{sup 2}, and the production rate of B*{sub s2} {yields} BK resonances is measured to be a fraction (2.14 {+-} 0.43 {+-} 0.24)% of the corresponding rate for B{sup +} mesons. Alternative fitting hypotheses give inconclusive evidence for the presence of the lighter B{sub s1} meson.

  1. The Meson Spectroscopy Program at the Jefferson Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Filippi, Alessandro [Istituto Nazionale di Fisica Nucleare (INFN), Torino (Italy). et al.

    2015-06-01

    The experimental techniques that will be applied by the next generation meson spectroscopy experiments at JLab are described. For the first time, these experiments will be able to exploit the features of a photon beam of unprecedented intensity and momentum resolution, that will allow to perform precision studies of meson states with masses below 3 GeV/c2. Photon induced reactions will enhance the production of spin-1 mesons, that are of particular interest according to the most recent Lattice QCD calculations of the lightest exotic hybrid meson.

  2. Scattering amplitudes to all orders in meson exchange

    International Nuclear Information System (INIS)

    As the number of colors in QCD, NC, becomes large, it is possible to sum up all meson-exchange contributions, however arbitrarily complicated, to meson-baryon and baryon-baryon scattering. A semi-classical structure for the two-flavor theory emerges, in close correspondence to vector-meson-augmented Skyrme models. In this limit, baryons act as extended static sources for the classical meson fields. This leads to non-linear differential equations for the classical meson fields which can be solved numerically for static radial (hedgehog-like) solutions. The non-linear terms in the equations of motion for the quantized meson fields can then be simplified, to leading order in 1/NC, by replacing all factors of the meson field but one by the previously-found classical field. This results in linear, Schroedinger-like equations, which are easily solved. For the meson-baryon case the solution can be subsequently analyzed to obtain the phase shifts for the scattering and, from these, the baryon resonance spectrum of the model. As the warm-up, we have carried out this calculation for the simple case of σ mesons only, finding sensible results. 8 refs., 3 figs

  3. Mesons in Nuclei and Partial Restoration of Chiral Symmetry

    CERN Document Server

    Jido, Daisuke

    2016-01-01

    Recent topics on mesons in nuclei are discussed by especially emphasizing the role of the partial restoration of chiral symmetry in the nuclear medium. The spontaneously broken chiral symmetry in vacuum is considered to be incompletely restored in finite nuclear density systems with moderate reduction of the magnitude of the quark condensate. On the partial restoration of chiral symmetry, the wave function renormalization is important to be taken into account for the Nambu-Goldstone bosons. We also discuss the possible change of the meson properties in the nuclear medium and meson-nucleus systems for the $\\bar K$, $\\eta$, $K^{+}$ and $\\eta^{\\prime}$ mesons.

  4. Search for medium modifications of the rho meson.

    Science.gov (United States)

    Nasseripour, R; Wood, M H; Djalali, C; Weygand, D P; Tur, C; Mosel, U; Muehlich, P; Adams, G; Amaryan, M J; Ambrozewicz, P; Anghinolfi, M; Asryan, G; Avakian, H; Bagdasaryan, H; Baillie, N; Ball, J P; Baltzell, N A; Barrow, S; Battaglieri, M; Bedlinskiy, I; Bektasoglu, M; Bellis, M; Benmouna, N; Berman, B L; Biselli, A S; Blaszczyk, L; Bouchigny, S; Boiarinov, S; Bradford, R; Branford, D; Briscoe, W J; Brooks, W K; Bültmann, S; Burkert, V D; Butuceanu, C; Calarco, J R; Careccia, S L; Carman, D S; Carnahan, B; Casey, L; Chen, S; Cole, P L; Collins, P; Coltharp, P; Crabb, D; Crannell, H; Crede, V; Cummings, J P; Dashyan, N; De Masi, R; De Vita, R; De Sanctis, E; Degtyarenko, P V; Denizli, H; Dennis, L; Deur, A; Dharmawardane, K V; Dickson, R; Dodge, G E; Doughty, D; Dugger, M; Dytman, S; Dzyubak, O P; Egiyan, H; Egiyan, K S; El Fassi, L; Elouadrhiri, L; Eugenio, P; Fedotov, G; Feldman, G; Feuerbach, R J; Funsten, H; Garçon, M; Gavalian, G; Gilfoyle, G P; Giovanetti, K L; Girod, F X; Goetz, J T; Gordon, C I O; Gothe, R W; Griffioen, K A; Guidal, M; Guler, N; Guo, L; Gyurjyan, V; Hadjidakis, C; Hafidi, K; Hakobyan, H; Hakobyan, R S; Hanretty, C; Hardie, J; Hersman, F W; Hicks, K; Hleiqawi, I; Holtrop, M; Hyde-Wright, C E; Ilieva, Y; Ireland, D G; Ishkhanov, B S; Isupov, E L; Ito, M M; Jenkins, D; Jo, H S; Johnstone, J R; Joo, K; Juengst, H G; Kalantarians, N; Kellie, J D; Khandaker, M; Kim, W; Klein, A; Klein, F J; Klimenko, A V; Kossov, M; Krahn, Z; Kramer, L H; Kubarovsky, V; Kuhn, J; Kuhn, S E; Kuleshov, S V; Lachniet, J; Laget, J M; Langheinrich, J; Lawrence, D; Li, Ji; Livingston, K; Lu, H Y; Maccormick, M; Markov, N; Mattione, P; McAleer, S; McKinnon, B; McNabb, J W C; Mecking, B A; Mehrabyan, S; Melone, J J; Mestayer, M D; Meyer, C A; Mibe, T; Mikhailov, K; Minehart, R; Mirazita, M; Miskimen, R; Mokeev, V; Moriya, K; Morrow, S A; Moteabbed, M; Mueller, J; Munevar, E; Mutchler, G S; Nadel-Turonski, P; Niccolai, S; Niculescu, G; Niculescu, I; Niczyporuk, B B; Niroula, M R; Niyazov, R A; Nozar, M; Osipenko, M; Ostrovidov, A I; Park, K; Pasyuk, E; Paterson, C; Anefalos Pereira, S; Pierce, J; Pivnyuk, N; Pocanic, D; Pogorelko, O; Pozdniakov, S; Preedom, B M; Price, J W; Prok, Y; Protopopescu, D; Raue, B A; Riccardi, G; Ricco, G; Ripani, M; Ritchie, B G; Ronchetti, F; Rosner, G; Rossi, P; Sabatié, F; Salamanca, J; Salgado, C; Santoro, J P; Sapunenko, V; Schumacher, R A; Serov, V S; Sharabian, Y G; Sharov, D; Shvedunov, N V; Smith, E S; Smith, L C; Sober, D I; Sokhan, D; Stavinsky, A; Stepanyan, S S; Stepanyan, S; Stokes, B E; Stoler, P; Strakovsky, I I; Strauch, S; Taiuti, M; Tedeschi, D J; Tkabladze, A; Tkachenko, S; Todor, L; Ungaro, M; Vineyard, M F; Vlassov, A V; Watts, D P; Weinstein, L B; Williams, M; Wolin, E; Yegneswaran, A; Zana, L; Zhang, B; Zhang, J; Zhao, B; Zhao, Z W

    2007-12-31

    The photoproduction of vector mesons on various nuclei has been studied using the CLAS detector at Jefferson Laboratory. The vector mesons, rho, omega, and varphi, are observed via their decay to e;{+}e;{-}, in order to reduce the effects of final-state interactions in the nucleus. Of particular interest are possible in-medium effects on the properties of the rho meson. The rho mass spectrum is extracted from the data on various nuclei, 2H, C, Fe, and Ti. We observe no significant mass shift and some broadening consistent with expected collisional broadening for the rho meson. PMID:18233570

  5. Deep inelastic scattering operators in meson-nucleon theory

    International Nuclear Information System (INIS)

    Nonrelativistic meson-nucleon theory of deep-inelastic scattering (DIS) of leptons on the deuteron is considered. Explicit expressions of nonrelativistic composed operators of DIS in the framework of the operator product expansion method are obtained in terms of interacting meson-nucleon fields. An analytic expression of the second moment of the structure functions (up to g2 accuracy( is obtained with particular emphasis on self-energy contributions and meson exchange currents (MEC). Deuteron moments are shown to be expressed in terms of constituent (nucleons and mesons) observables. The energy conservation law is restored by taking into account MEC

  6. Search for gluonic excitations in light unconventional mesons

    Energy Technology Data Exchange (ETDEWEB)

    Paul Eugenio

    2007-07-01

    Studies of meson spectra via strong decays provide insight regarding QCD at the confinement scale. These studies have led to phenomenologicalmodels for QCD such as the constituent quark model. However, QCD allows for a much richer spectrum of meson states which include extra states such as exotics, hybrids, multi-quarks, and glueballs. First discussion of the status of exotic meson searches is given followed by a discussion of plans at Jefferson Lab to double the energy of the machine to 12 GeV, which will allow us to access photoproduction of mesons in search for gluonic excited states.

  7. Meson masses and decay constants from unquenched lattice QCD

    International Nuclear Information System (INIS)

    We report results for the masses of the flavour non-singlet light 0++, 1--, and 1+- mesons from unquenched lattice QCD at two lattice spacings. The twisted mass formalism was used with two flavours of sea quarks. For the 0++ and 1+- mesons we look for the effect of decays on the mass dependence. For the light vector mesons we study the chiral extrapolations of the mass. We report results for the leptonic and transverse decay constants of the meson. We test the mass dependence of the KRSF relations. (orig.)

  8. Heavy mesons in a hadronic medium: interaction and transport coefficients

    CERN Document Server

    Torres-Rincon, Juan M; Cabrera, Daniel; Romanets, Olena; Tolos, Laura

    2015-01-01

    We review the recent results of heavy meson diffusion in thermal hadronic matter. The interactions of D and B-bar mesons with other hadrons (light mesons and baryons) are extracted from effective field theories based on chiral and heavy-quark symmetries. When these guiding principles are combined with exact unitarity, physical values of the cross sections are obtained. These cross sections (which contain resonant contributions) are used to calculate the drag and diffusion coefficients of heavy mesons immersed in a thermal and dense medium. The transport coefficients are computed using a Fokker-Planck reduction of the Boltzmann equation.

  9. NN-bar vacuum polarization and nuclear meson exchange interactions

    International Nuclear Information System (INIS)

    The relativistic Hartree equations for a finite nucleus are solved taking into account negative energy nucleons. This formulation yields the nuclear mean meson fields suppressed and the nuclear radius increased owing to the contribution of negative energy nucleons. Secondly, taking the positive energy nucleon sector picture of a nucleus, we derive the nuclear meson exchange interactions between positive energy nucleons modified by the NN-bar vacuum polarization on the cause of the meson exchanges. The vacuum polarization suppresses the meson exchange interactions and increases the interaction ranges. (author)

  10. The hybrid mesons quest: the MesonEx experiment at Jefferson Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Rizzo, Alessandro [Univ. of Rome Tor Vergata (Italy)

    2016-03-01

    The meson spectroscopy plays nowadays a central role in the investigation of hadron structure thanks to the possible existence of exotic hybrid mesons, quark-antiquark-gluon bound states. Their explicit gluonic degrees of freedom which should clearly emerge from a Partial Wave Analysis (PWA) of the corresponding Dalitz plot of the exotic particle decay, may result in final JPC configurations not allowed in the constituent quark model. Besides this clear signature, hybrid mesons are also expected to have a large particle multiplicity decays, requiring for their search an experimental apparatus with high performances in terms of rate capability, resolution and almost a full acceptance to apply PWA methods. New-generation experiments are planned at Thomas Jefferson National Laboratory (VA, USA) for which an unprecedented statistics of large multiplicity decay events with fully reconstructed kinematics will be available. In particular for the MesonEx (CLAS12) experiment in Hall B, a wide scientific program that will start in 2016 has been deployed to study the meson spectrum at energies up to 11 GeV. A key role in such program is played by the Forward Tagger apparatus of the experiment, which will allow to extend the study of meson electro-production to very low Q2 values, in a quasi-real photo production kinematical region, where the production of hybrid mesons is expected to be favorite. Currently a new analysis framework for the search of the hybrid mesons is being set up by the HASPECT network, an international structure which gather people involved into theoretical and experimental hadronic physics all over the world. The goals of the network is to develop new analysis models and statistical techniques to unfold the signal and background distributions in high-statistics datasets. In this work are briefly presented the first preliminary results from the application of a statistical technique, namely the sPlot, to the data already acquired by the CLAS experiment for

  11. The hybrid mesons quest: the MesonEx experiment at Jefferson Laboratory

    Science.gov (United States)

    Rizzo, A.; CLAS Collaboration

    2016-02-01

    The meson spectroscopy plays nowadays a central role in the investigation of hadron structure thanks to the possible existence of exotic hybrid mesons, quark-antiquark-gluon bound states. Their explicit gluonic degrees of freedom which should clearly emerge from a Partial Wave Analysis (PWA) of the corresponding Dalitz plot of the exotic particle decay, may result in final JPC configurations not allowed in the constituent quark model. Besides this clear signature, hybrid mesons are also expected to have a large particle multiplicity decays, requiring for their search an experimental apparatus with high performances in terms of rate capability, resolution and almost a full acceptance to apply PWA methods. New-generation experiments are planned at Thomas Jefferson National Laboratory (VA, USA) for which an unprecedented statistics of large multiplicity decay events with fully reconstructed kinematics will be available. In particular for the MesonEx (CLAS12) experiment in Hall B, a wide scientific program that will start in 2016 has been deployed to study the meson spectrum at energies up to 11 GeV. A key role in such program is played by the Forward Tagger apparatus of the experiment, which will allow to extend the study of meson electro-production to very low Q2 values, in a quasi-real photo production kinematical region, where the production of hybrid mesons is expected to be favorite. Currently a new analysis framework for the search of the hybrid mesons is being set up by the HASPECT network, an international structure which gather people involved into theoretical and experimental hadronic physics all over the world. The goals of the network is to develop new analysis models and statistical techniques to unfold the signal and background distributions in high-statistics datasets. In this work are briefly presented the first preliminary results from the application of a statistical technique, namely the sPlot, to the data already acquired by the CLAS experiment for

  12. Two-dimensional Co-Seismic Surface Displacements Field of the Chi-Chi Earthquake Inferred from SAR Image Matching

    Directory of Open Access Journals (Sweden)

    Jian-Jun Zhu

    2008-10-01

    Full Text Available The Mw=7.6 Chi-Chi earthquake in Taiwan occurred in 1999 over the Chelungpu fault and caused a great surface rupture and severe damage. Differential Synthetic Aperture Radar Interferometry (DInSAR has been applied previously to study the co-seismic ground displacements. There have however been significant limitations in the studies. First, only one-dimensional displacements along the Line-of-Sight (LOS direction have been measured. The large horizontal displacements along the Chelungpu fault are largely missing from the measurements as the fault is nearly perpendicular to the LOS direction. Second, due to severe signal decorrelation on the hangling wall of the fault, the displacements in that area are un-measurable by differential InSAR method. We estimate the co-seismic displacements in both the azimuth and range directions with the method of SAR amplitude image matching. GPS observations at the 10 GPS stations are used to correct for the orbital ramp in the amplitude matching and to create the two-dimensional (2D co-seismic surface displacements field using the descending ERS-2 SAR image pair. The results show that the co-seismic displacements range from about -2.0 m to 0.7 m in the azimuth direction (with the positive direction pointing to the flight direction, with the footwall side of the fault moving mainly southwards and the hanging wall side northwards. The displacements in the LOS direction range from about -0.5 m to 1.0 m, with the largest displacement occuring in the northeastern part of the hanging wall (the positive direction points to the satellite from ground. Comparing the results from amplitude matching with those from DInSAR, we can see that while only a very small fraction of the LOS displacement has been recovered by the DInSAR mehtod, the azimuth displacements cannot be well detected with the DInSAR measurements as they are almost perpendicular to the LOS. Therefore, the amplitude matching method is obviously more

  13. The property of the nuclear meson by detecting the meson-nuclear system and symmetry of the strong interaction

    International Nuclear Information System (INIS)

    This paper introduces the current state of studies on the binding system between π meson/ η meson/ η(958) meson, and nuclei. Experimental studies on π meson atoms have been carried out by injecting π mesons with low energy into materials. Currently, a high accuracy of π meson atomic spectroscopy has been achieved based on (d, 3He) reaction, and studies on π meson atoms are developing through the systematic study on a number of binding states in various nuclei. As the characteristics of the system of η meson atomic nuclei, the strong bond between ηN and N*(1535) is picked up. In the model describing the resonance N*(1535), there are a chiral doublet model and chiral unitary model. The mass origin of η(958) meson is considered due to UA(1) quantum anomaly effect. When the change in mass in nucleus has been observed, it is expected to obtain information on the changes in the contribution of UA(1) quantum anomaly to the mass. (A.O.)

  14. Observation of direct ion heating in double-pulsing CHI in helicity injected spherical torus plasmas

    International Nuclear Information System (INIS)

    Anomalous ion heating has been observed for the first time during flux/current amplification by double-pulsing coaxial helicity injection (CHI) in the helicity injected spherical torus (HIST) device. Doppler ion temperature increases significantly near the separatrix on the inboard side during the second CHI pulse, whereas electron temperature remains constant. The experimental results indicate that selective ion heating may be associated with viscous damping of poloidal flows driven by the CHI pulse. (author)

  15. Training in ChiRunning to reduce blood pressure: a randomized controlled pilot study

    OpenAIRE

    McDermott, Kelly; Kumar, Deepak; Goldman, Veronica; Feng, Haojun; Mehling, Wolf; Moskowitz, Judith T.; Souza, Richard B.; Frederick M Hecht

    2015-01-01

    Background People with prehypertension (120–130/80–90 mmHg) are at increased risk of progressing to hypertension. Recommendations for prehypertension include engaging in regular physical activity. We aimed to assess feasibility and acceptability and collect preliminary outcome data on ChiRunning for people with elevated blood pressure. ChiRunning is a commercially available running program based on the mindful movements of Tai Chi, which is aimed at decreasing injury by both increasing body a...

  16. In-medium QCD sum rules for {omega} meson, nucleon and D meson

    Energy Technology Data Exchange (ETDEWEB)

    Thomas, Ronny

    2008-07-01

    The modifications of hadronic properties caused by an ambient nuclear medium are investigated within the scope of QCD sum rules. This is exemplified for the cases of the {omega} meson, the nucleon and the D meson. By virtue of the sum rules, integrated spectral densities of these hadrons are linked to properties of the QCD ground state, quantified in condensates. For the cases of the {omega} meson and the nucleon it is discussed how the sum rules allow a restriction of the parameter range of poorly known four-quark condensates by a comparison of experimental and theoretical knowledge. The catalog of independent four-quark condensates is covered and relations among these condensates are revealed. The behavior of four-quark condensates under the chiral symmetry group and the relation to order parameters of spontaneous chiral symmetry breaking are outlined. In this respect, also the QCD condensates appearing in differences of sum rules of chiral partners are investigated. Finally, the effects of an ambient nuclear medium on the D meson are discussed and relevant condensates are identified. (orig.)

  17. Search for exotic mesons and study of rare mesonic radiative decays at lepton spectrometer

    International Nuclear Information System (INIS)

    Results of experiments carried out using the ''Lepton-F'' spectrometer, are presented. A new C(1480)-meson with quantum numbers IJPC = 11--, which is a candidate to exotic states, as well as a rare radiation decay D(1285) → Φγ, are detected

  18. Chiral Quark-Meson model of N and DELTA with vector mesons

    International Nuclear Information System (INIS)

    Vector mesons rho, A1 and ω are introduced in the Chiral Quark-Meson Theory (CQMT) of N and Δ. We propose a new viewpoint for developing CQMT from QCD at the mean-field level. The SU(2) x SU(2) chiral Lagrangian incorporates universal coupling. Accordingly, rho is coupled to the conserved isospin current, A to the partially conserved axial-vector current (PCAC), and ω to the conserved baryon current. As a result the only parameter of the model not directly related to experiment is the quark-pion coupling constant. A fully self-consistent mean-field solution to the model is found for fields in the hedgehog ansatz. The vector mesons play a very important role in the system. They contribute significantly to the values of observables and produce a high-quality fit to many data. The classical stability of the system with respect to hedgehog excitations is analyzed through the use of the Quark-Meson RPA equations (QMRPA)

  19. In-medium QCD sum rules for ω meson, nucleon and D meson

    International Nuclear Information System (INIS)

    The modifications of hadronic properties caused by an ambient nuclear medium are investigated within the scope of QCD sum rules. This is exemplified for the cases of the ω meson, the nucleon and the D meson. By virtue of the sum rules, integrated spectral densities of these hadrons are linked to properties of the QCD ground state, quantified in condensates. For the cases of the ω meson and the nucleon it is discussed how the sum rules allow a restriction of the parameter range of poorly known four-quark condensates by a comparison of experimental and theoretical knowledge. The catalog of independent four-quark condensates is covered and relations among these condensates are revealed. The behavior of four-quark condensates under the chiral symmetry group and the relation to order parameters of spontaneous chiral symmetry breaking are outlined. In this respect, also the QCD condensates appearing in differences of sum rules of chiral partners are investigated. Finally, the effects of an ambient nuclear medium on the D meson are discussed and relevant condensates are identified. (orig.)

  20. Study of {chi}{sub c} production using HERA-B data

    Energy Technology Data Exchange (ETDEWEB)

    Aleksandrov, Aleksandar

    2010-07-15

    In this thesis the production of the charmonium states {chi}{sub c1} and {chi}{sub c2} in protonnucleus collisions at a proton-nucleon center-of-mass energy {radical}(s)=41.6 GeV was studied. The data used for the analysis have been taken by the fixed-target experiment HERA-B that uses the HERA proton beam to scatter protons off the nuclei of different wire targets. About 122.10{sup 3} recorded muonic J/{psi} decays, J/{psi}{yields}{mu}{sup +}{mu}{sup -}, resulted in almost 10000 reconstructed {chi}{sub c}{yields}J/{psi}{gamma}. The ratio R{sub {chi}{sub c}}= sum {sub i=1,2}{sigma}({chi}{sub ci})Br({chi}{sub ci}{yields}J/{psi}{gamma})/{sigma}(J/{psi}), which is the ratio of J/{psi} from {chi}{sub c} decays to all produced J/{psi}, was measured in the kinematical range -0.35chi}{sub c}}=0.190{sub -0.029}{sup +0.030}. Despite the small separation of the masses of the two {chi}{sub c} states, comparable to the detector resolution, the ratio R{sub 12}=R{sub {chi}{sub c}{sub 1}}/R{sub {chi}{sub c}{sub 2}} was measured yielding R{sub 12}=1.30{sub -0.37}{sup +0.59} which corresponds to a production cross section ratio ({sigma}({chi}{sub c1}))/({sigma}({chi}{sub c2}))=0.74{sub -0.22}{sup +0.34}. By using the known J/{psi} production cross section, the {chi}{sub c1} and {chi}{sub c2} production cross sections are calculated to be {sigma}({chi}{sub c1})=(153{+-}27) nb/nucleon and {sigma}({chi}{sub c2})=(207{+-}39) nb/nucleon, respectively. All results were obtained under the assumption that both the J/{psi} and {chi}{sub c} states are produced without polarization. In addition a study of possible deviations of R{sub {chi}{sub c}} and R{sub 12} due to the polarization of J/{psi} and {chi}{sub c} was performed. By varying the polarization parameter, {lambda}{sub obs}, of all produced J/{psi} by 2{sigma} around the value measured by HERA-B, and assuming fully

  1. Mesonic and isobar modes in matter

    International Nuclear Information System (INIS)

    Experiments with heavy ion collisions, like the ones performed at the GSI, are a tool to gain insight in the structure of matter. One key point needed to understand the experimental data is the theoretical description of the in medium properties of mesons and baryons. In this thesis we first developed a self-consistent description for the light vector mesons, ρ and ω, and the pion at finite temperature and in a baryon free environment. A generalisation of these calculations towards finite densities mandatorily needs a reliable description for the pion and the Δ(1232) resonance. Here we extended the approaches discussed in literature by the inclusion of vertex corrections and a selfconsistent and completely relativistic description. Within these models we were able to show that even at high temperatures the ρ-meson properties are not changed dramatically when temperature effects are considered only. In contrast to this the behaviour of the pion and the Δ-isobar is dramatically changed a finite density. The isobar mass-shift is given by an appropriate choice of the mean-fields. Therefore we can not draw a final conclusion about such shifts within our model. In order to do so more calculations, especially of the photo absorption on the nucleus, have to be performed. A further aspect of the calculations presented is that due to a consistent consideration of vertex corrections we were able to achieve a description of the Δ-resonance without the usually used soft formfactor. This is especially important for the in-medium calculations because only in this way we can guarantee that soft modes of the spectrum are treated consistently. The techniques developed within this thesis allow for a straight forward generalisation of the presented models with respect to the consideration of more resonances or couplings. Doing so the here obtained description of the in-medium properties of the considered particles can be refined. (orig.)

  2. Mesonic and isobar modes in matter

    Energy Technology Data Exchange (ETDEWEB)

    Riek, Felix C.

    2007-07-01

    Experiments with heavy ion collisions, like the ones performed at the GSI, are a tool to gain insight in the structure of matter. One key point needed to understand the experimental data is the theoretical description of the in medium properties of mesons and baryons. In this thesis we first developed a self-consistent description for the light vector mesons, {rho} and {omega}, and the pion at finite temperature and in a baryon free environment. A generalisation of these calculations towards finite densities mandatorily needs a reliable description for the pion and the {delta}(1232) resonance. Here we extended the approaches discussed in literature by the inclusion of vertex corrections and a selfconsistent and completely relativistic description. Within these models we were able to show that even at high temperatures the {rho}-meson properties are not changed dramatically when temperature effects are considered only. In contrast to this the behaviour of the pion and the {delta}-isobar is dramatically changed a finite density. The isobar mass-shift is given by an appropriate choice of the mean-fields. Therefore we can not draw a final conclusion about such shifts within our model. In order to do so more calculations, especially of the photo absorption on the nucleus, have to be performed. A further aspect of the calculations presented is that due to a consistent consideration of vertex corrections we were able to achieve a description of the {delta}-resonance without the usually used soft formfactor. This is especially important for the in-medium calculations because only in this way we can guarantee that soft modes of the spectrum are treated consistently. The techniques developed within this thesis allow for a straight forward generalisation of the presented models with respect to the consideration of more resonances or couplings. Doing so the here obtained description of the in-medium properties of the considered particles can be refined. (orig.)

  3. Semileptonic Ds+(1968) decays as a scalar meson probe

    International Nuclear Information System (INIS)

    The unusual multiplet structures associated with the light spin zero mesons have recently attracted a good deal of theoretical attention. Here we discuss some aspects associated with the possibility of getting new experimental information on this topic from semileptonic decays of heavy charged mesons into an isosinglet scalar or pseudoscalar plus leptons.

  4. Exotic states of matter in heavy meson decays

    OpenAIRE

    Rosner, Jonathan L.

    2003-01-01

    The potential of decays of mesons containing heavy quarks [including $B$ mesons and the $\\Upsilon(1S)$] for producing final states of matter with unusual quark configurations, such as $q q \\bar q \\bar q$ or $q q q q \\bar q$, is investigated. The usefulness of antineutron detection in such searches is stressed.

  5. Beauty vector meson decay constants from QCD sum rules

    International Nuclear Information System (INIS)

    We present the outcomes of a very recent investigation of the decay constants of nonstrange and strange heavy-light beauty vector mesons, with special emphasis on the ratio of any such decay constant to the decay constant of the corresponding pseudoscalar meson, by means of Borel-transformed QCD sum rules. Our results suggest that both these ratios are below unity

  6. Determining the quantum numbers of excited heavy mesons

    OpenAIRE

    Eilam, Gad; Krauss, Frank

    2000-01-01

    We discuss the decays X^* -> Xe^+e^- (``Dalitz decays'') of excited heavy mesons into their ground states and an electron-positron pair. We argue that the measurement of the invariant mass spectrum of the lepton pair gives clear indication on the quantum numbers of the excited meson and thus provides an experimental test of the quark model predictions.

  7. Beauty Vector Meson Decay Constants from QCD Sum Rules

    CERN Document Server

    Lucha, Wolfgang; Simula, Silvano

    2016-01-01

    We present the outcomes of a very recent investigation of the decay constants of nonstrange and strange heavy-light beauty vector mesons, with special emphasis on the ratio of any such decay constant to the decay constant of the corresponding pseudoscalar meson, by means of Borel-transformed QCD sum rules. Our results suggest that both these ratios are below unity.

  8. Beauty vector meson decay constants from QCD sum rules

    Science.gov (United States)

    Lucha, Wolfgang; Melikhov, Dmitri; Simula, Silvano

    2016-01-01

    We present the outcomes of a very recent investigation of the decay constants of nonstrange and strange heavy-light beauty vector mesons, with special emphasis on the ratio of any such decay constant to the decay constant of the corresponding pseudoscalar meson, by means of Borel-transformed QCD sum rules. Our results suggest that both these ratios are below unity.

  9. Beauty vector meson decay constants from QCD sum rules

    Energy Technology Data Exchange (ETDEWEB)

    Lucha, Wolfgang [Institute for High Energy Physics, Austrian Academy of Sciences, Nikolsdorfergasse 18, A-1050 Vienna (Austria); Melikhov, Dmitri [Institute for High Energy Physics, Austrian Academy of Sciences, Nikolsdorfergasse 18, A-1050 Vienna (Austria); D. V. Skobeltsyn Institute of Nuclear Physics, M. V. Lomonosov Moscow State University, 119991, Moscow (Russian Federation); Simula, Silvano [Istituto Nazionale di Fisica Nucleare, Sezione di Roma Tre, Via della Vasca Navale 84, I-00146, Roma (Italy)

    2016-01-22

    We present the outcomes of a very recent investigation of the decay constants of nonstrange and strange heavy-light beauty vector mesons, with special emphasis on the ratio of any such decay constant to the decay constant of the corresponding pseudoscalar meson, by means of Borel-transformed QCD sum rules. Our results suggest that both these ratios are below unity.

  10. First measurement of the B S meson mass

    Science.gov (United States)

    Buskulic, D.; De Bonis, I.; Decamp, D.; Ghez, P.; Goy, C.; Lees, J.-P.; Minard, M.-N.; Pietrzyk, B.; Ariztizabal, F.; Comas, P.; Crespo, J. M.; Delfino, M.; Efthymiopoulos, I.; Fernandez, E.; Fernandez-Bosman, M.; Gaitan, V.; Garrido, Ll.; Mattison, T.; Pacheco, A.; Padilla, C.; Pascual, A.; Creanza, D.; de Palma, M.; Farilla, A.; Iaselli, G.; Maggi, G.; Natali, S.; Nuzzo, S.; Quattromini, M.; Ranieri, A.; Raso, G.; Romano, F.; Ruggieri, F.; Selvaggi, G.; Silvestris, L.; Tempesta, P.; Zito, G.; Chai, Y.; Hu, H.; Huang, D.; Huang, X.; Lin, J.; Wang, T.; Xie, Y.; Xu, D.; Xu, R.; Zhang, J.; Zhang, L.; Zhao, W.; Blucher, E.; Bonvicini, G.; Boudreau, J.; Casper, D.; Drevermann, H.; Forty, R. W.; Ganis, G.; Gay, C.; Hagelberg, R.; Harvey, J.; Haywood, S.; Hilgart, J.; Jacobsen, R.; Jost, B.; Knobloch, J.; Lehraus, I.; Lohse, T.; Maggi, M.; Markou, C.; Martinez, M.; Mato, P.; Meinhard, H.; Minten, A.; Miotto, A.; Miquel, R.; Moser, H.-G.; Palazzi, P.; Pater, J. R.; Perlas, J. A.; Pusztaszeri, J.-F.; Ranjard, F.; Redlinger, G.; Rolandi, L.; Rothberg, J.; Ruan, T.; Saich, M.; Schlatter, D.; Schmelling, M.; Sefkow, F.; Tejessy, W.; Veenhof, R.; Wachsmuth, H.; Wiedenmann, W.; Wildish, T.; Witzeling, W.; Wotschack, J.; Ajaltouni, Z.; Badaud, F.; Bardadin-Otwinowska, M.; El Fellous, R.; Falvard, A.; Gay, P.; Guicheney, C.; Henrard, P.; Jousset, J.; Michel, B.; Montret, J.-C.; Pallin, D.; Perret, P.; Podlyski, F.; Proriol, J.; Prulhière, F.; Saadi, F.; Fearnley, T.; Hansen, J. D.; Hansen, J. R.; Hansen, P. H.; Møllerud, R.; Nilsson, B. S.; Kyriakis, A.; Simopoulou, E.; Vayaki, A.; Zachariadou, K.; Badier, J.; Blondel, A.; Bonneaud, G.; Brient, J. C.; Fouque, G.; Orteu, S.; Rougé, A.; Rumpf, M.; Tanaka, R.; Verderi, M.; Videau, H.; Candlin, D. J.; Parsons, M. I.; Veitch, E.; Focardi, E.; Moneta, L.; Parrini, G.; Corden, M.; Georgiopoulos, C.; Ikeda, M.; Lannutti, J.; Levinthal, D.; Sawyer, L.; Wasserbaech, S.; Antonelli, A.; Baldini, R.; Bencivenni, G.; Bologna, G.; Bossi, F.; Campana, P.; Capon, G.; Cerutti, F.; Chiarella, V.; D'Ettorre-Piazzoli, B.; Felici, G.; Laurelli, P.; Mannocchi, G.; Murtas, F.; Murtas, G. P.; Passalacqua, L.; Pepe-Altarelli, M.; Picchi, P.; Colrain, P.; ten Have, I.; Lynch, J. G.; Maitland, W.; Morton, W. T.; Raine, C.; Reeves, P.; Scarr, J. M.; Smith, K.; Smith, M. G.; Thompson, A. S.; Turnbull, R. M.; Brandl, B.; Braun, O.; Geweniger, C.; Hanke, P.; Hepp, V.; Kluge, E. E.; Maumary, Y.; Putzer, A.; Rensch, B.; Stahl, A.; Tittel, K.; Wunsch, M.; Beuselinck, R.; Binnie, D. M.; Cameron, W.; Cattaneo, M.; Colling, D. J.; Dornan, P. J.; Greene, A. M.; Hassard, J. F.; Lieske, N. M.; Moutoussi, A.; Nash, J.; Patton, S.; Payne, D. G.; Phillips, M. J.; San Martin, G.; Sedgbeer, J. K.; Tomalin, I. R.; Wright, A. G.; Girtler, P.; Kneringer, E.; Kuhn, D.; Rudolph, G.; Bowdery, C. K.; Brodbeck, T. J.; Finch, A. J.; Foster, F.; Hughes, G.; Jackson, D.; Keemer, N. R.; Nuttall, M.; Patel, A.; Sloan, T.; Snow, S. W.; Whelan, E. P.; Kleinknecht, K.; Raab, J.; Renk, B.; Sander, H.-G.; Schmidt, H.; Steeg, F.; Walther, S. M.; Wanke, R.; Wolf, B.; Bencheikh, A. M.; Benchouk, C.; Bonissent, A.; Carr, J.; Coyle, P.; Drinkard, J.; Etienne, F.; Nicod, D.; Papalexiou, S.; Payre, P.; Roos, L.; Rousseau, D.; Schwemling, P.; Talby, M.; Adlung, S.; Assmann, R.; Bauer, C.; Blum, W.; Brown, D.; Cattaneo, P.; Dehning, B.; Dietl, H.; Dydak, F.; Frank, M.; Halley, A. W.; Jacobs, K.; Lauber, J.; Lütjens, G.; Lutz, G.; Männer, W.; Richter, R.; Schröder, J.; Schwarz, A. S.; Settles, R.; Seywerd, H.; Stierlin, U.; Stiegler, U.; St. Denis, R.; Wolf, G.; Alemany, R.; Boucrot, J.; Callot, O.; Cordier, A.; Davier, M.; Duflot, L.; Grivaz, J.-F.; Heusse, Ph.; Jaffe, D. E.; Janot, P.; Kim, D. W.; Le Diberder, F.; Lefrançois, J.; Lutz, A.-M.; Schune, M.-H.; Veillet, J.-J.; Videau, I.; Zhang, Z.; Abbaneo, D.; Bagliesi, G.; Batignani, G.; Bottigli, U.; Bozzi, C.; Calderini, G.; Carpinelli, M.; Ciocci, M. A.; Dell'Orso, R.; Ferrante, I.; Fidecaro, F.; Foà, L.; Forti, F.; Giassi, A.; Giorgi, M. A.; Gregorio, A.; Ligabue, F.; Lusiani, A.; Mannelli, E. B.; Marrocchesi, P. S.; Messineo, A.; Palla, F.; Rizzo, G.; Sanguinetti, G.; Spagnolo, P.; Steinberger, J.; Tenchini, R.; Tonelli, G.; Triggiani, G.; Vannini, C.; Venturi, A.; Verdini, P. G.; Walsh, J.; Betteridge, A. P.; Carter, J. M.; Gao, Y.; Green, M. G.; March, P. V.; Mir, Ll. M.; Medcalf, T.; Quazi, I. S.; Strong, J. A.; West, L. R.; Botterill, D. R.; Clifft, R. W.; Edgecock, T. R.; Norton, P. R.; Thompson, J. C.; Bloch-Devaux, B.; Colas, P.; Duarte, H.; Emery, S.; Kozanecki, W.; Lançon, E.; Lemaire, M. C.; Locci, E.; Marx, B.; Perez, P.; Rander, J.; Renardy, J.-F.; Rosowsky, A.; Roussarie, A.; Schuller, J.-P.; Schwindling, J.; Si Mohand, D.; Vallage, B.; Johnson, R. P.; Litke, A. M.; Taylor, G.; Wear, J.; Ashman, J. G.; Babbage, W.; Booth, C. N.; Buttar, C.; Cartwright, S.; Combley, F.; Dawson, I.; Thompson, L. F.; Barberio, E.; Böhrer, A.; Brandt, S.; Cowan, G.; Grupen, C.; Lutters, G.; Rivera, F.; Schäfer, U.; Smolik, L.; Bosisio, L.; Della Marina, R.; Giannini, G.; Gobbo, B.; Ragusa, F.; Bellantoni, L.; Chen, W.; Cinabro, D.; Conway, J. S.; Feng, Z.; Ferguson, D. P. S.; Gao, Y. S.; Grahl, J.; Harton, J. L.; LeClaire, B. W.; Lishka, C.; Pan, Y. B.; Saadi, Y.; Schmitt, M.; Sharma, V.; Shi, Z. H.; Walsh, A. M.; Weber, F. V.; Wu, Sau Lan; Wu, X.; Zheng, M.; Zobernig, G.

    1993-07-01

    In a sample of about 1.1 million hadronic Z decays recorded with the ALEPH detector during the 1990-1992 running of LEP, two unambiguous B S meson candidates were observed. From these events the mass of the B S meson has been measured to be 5.3686 ± 0.0056 (stat.) ± 0.0015 (syst.) GeV.

  11. Strange and charm meson masses from twisted mass lattice QCD

    International Nuclear Information System (INIS)

    We present results of a twisted mass lattice QCD computation of the strange and charm meson spectrum with 2+1+1 dynamical quark flavors. Particular focus is put on excited D and Ds mesons and on a connection to the ''1/2,3/2 limit'' for the D(s)**.

  12. Recent trends in the mesonic description of nuclei

    International Nuclear Information System (INIS)

    A survey is given of some recent developments in the domain of meson induced phenomena in nuclei. The manifestations of mesonic degrees of freedom are considered in the context of exchange currents as well as that of effective interactions. The significance of past successes is reexamined in the light of recent progress towards a QCD based nuclear theory

  13. Bc-meson production in hadron-hadron collisions

    International Nuclear Information System (INIS)

    The Bc-meson production cross section was calculated in the perturbative QCD. Various distributions of the charged leptons from the Bc → lνJ/ψ(→l+l-) decay were obtained. The Bc-meson mass measurement from such decays is also discussed. 17 refs., 9 figs., 1 tab

  14. Hydrogen like classification for light nonstrange mesons

    OpenAIRE

    Afonin, S. S.

    2007-01-01

    The recent experimental results on the spectrum of highly excited light nonstrange mesons are known to reveal a high degree of degeneracy among different groups of states. We revise some suggestions about the nature of the phenomenon and put the relevant ideas into the final shape. The full group of approximate mass degeneracies is argued to be $SU(2)_f\\times I\\times O(4)$, where $I$ is the degeneracy of isosinglets and isotriplets and O(4) is the degeneracy group of the relativistic hydrogen...

  15. Two-scale scalar mesons in nuclei

    Energy Technology Data Exchange (ETDEWEB)

    K. Saito; H. Kouno; K. Tsushima; A.W. Thomas

    2005-03-01

    We generalize the linear sigma model in order to develop a chiral-invariant model of nuclear structure. The model is natural, and contains not only the usual sigma meson which is the chiral partner of the pion but also a new chiral-singlet that is responsible for the medium-range nucleon-nucleon attraction. This approach provides significant advantages in terms of its description of nuclear matter and finite nuclei in comparison with conventional models based on the linear sigma model.

  16. Massive Meson Fluctuation in NJL Model

    OpenAIRE

    Huang, Mei(Institute of High Energy Physics, Chinese Academy of Sciences, Beijing, 100049, P.R. China); Zhuang, Pengfei; Chao, Weiqin

    1999-01-01

    Based on the self-consistent scheme beyond mean-field approximation in the large $N_c$ expansion, including current quark mass explicitly, a general scheme of SU(2) NJL model is developed. To ensure the quark self-energy expanded in the proper order of $N_c$, an approximate internal meson propagator is deduced, which is in order of $O(1/N_c)$. In our scheme, adopting the method of external momentum expansion, all the Feynman diagrams are calculated in a unified way by only expanding the quark...

  17. Meson Mass Decomposition from Lattice QCD

    OpenAIRE

    Yang, Yi-Bo; Chen, Ying; Draper, Terrence; Gong, Ming; Liu, Keh-Fei; Liu, Zhaofeng; Ma, Jian-Ping

    2014-01-01

    Hadron masses can be decomposed as a sum of quark and glue components which are defined through hadronic matrix elements of QCD operators. The components consist of the quark mass term, the quark energy term, the glue energy term, and the trace anomaly term. We calculate these components for mesons with lattice QCD for the first time. The calculation is carried out with overlap fermion on $2+1$ flavor domain-wall fermion gauge configurations. We confirm that $\\sim 50\\%$ of the light pion mass...

  18. Nonleptonic weak decays of charmed mesons

    OpenAIRE

    Buccella, F.; Lusignoli, M.; Miele, G.; A. Pugliese; Santorelli, P.

    1994-01-01

    A previous analysis of two-body Cabibbo allowed nonleptonic decays of $D^0$ mesons and of Cabibbo allowed and first-forbidden decays of $D^+$ and $D_s^+$ has been adjourned using more recent experimental data and extended to the Cabibbo forbidden decays of $D^0$. Annihilation and W-exchange contributions as well as final state interaction effects (assumed to be dominated by nearby resonances) have been included and are in fact crucial to obtain a reasonable agreement with the experimental dat...

  19. Meson Photoproduction Experiments at ELPH, Tohoku University

    Science.gov (United States)

    Ishikawa, Takatsugu; Fujimura, Hisako; Fukasawa, Hiroshi; Hashimoto, Ryo; He, Qinghua; Honda, Yuki; Iwata, Takahiro; Kaida, Shun; Kasagi, Jirohta; Kawano, Atsushi; Kuwasaki, Shuzo; Maeda, Kazushige; Masumoto, Shin'ichi; Miyabe, Manabu; Miyahara, Fusashi; Mochizuki, Kei'ichi; Muramatsu, Norihito; Nakamura, Akihiko; Nawa, Ken'ichi; Ogushi, Shoei; Okada, Yasuyuki; Onodera, Yoshihito; Ozawa, Kyoichiro; Sakamoto, Yasunobu; Sato, Mamoru; Shimizu, Hajime; Sugai, Hiroyuki; Suzuki, Koutaku; Tajima, Yasuhisa; Takahashi, Shin'ichiro; Taniguchi, Yusuke; Tsuchikawa, Yusuke; Yamazaki, Hirohito; Yamazaki, Ryuji; Yoshida, Hiroshi Y.

    Meson photoproduction experiments have been conducted with an electromagnetic (EM) calorimeter FOREST at Research Center for Electron Photon Science (ELPH), Tohoku University. A narrow resonance observed at W = 1670 MeV in η photoproduction on the neutron is of great interest, which is a candidate of an anti-decuplet pentaquark baryon although its origin is still controversial. The preliminary results of the cross sections for π0 and η photoproduction on the deuteron are presented. The next generation FOREST experiments have been planned to study S11(1535) properties in the nuclear medium by searching for η-mesic nucleus states. The planned experiments are also shown in this contribution.

  20. Status of Meson Photoproduction Experiments with CLAS

    Energy Technology Data Exchange (ETDEWEB)

    Pasyuk, Eugene A.

    2014-01-01

    A large part of the experimental program in Hall B of the Jefferson Lab is dedicated to baryon spectroscopy. Meson photoproduction experiments are essential part of this program. CEBAF Large Acceptance Spectrometer (CLAS) and availability of circularly and linearly polarized tagged photon beams in combination with longitudinally and transversely polarized frozen spin targets provide unique conditions for this type of experiments. For the first time, a complete or nearly complete measurement became possible and will allow model independent extraction of the reaction amplitude. The measurements were complete with both proton and deuteron targets. An overview of the collected experimental data will be presented.

  1. Spectroscopic properties of the B meson

    Directory of Open Access Journals (Sweden)

    Devlani Nayneshkumar

    2015-01-01

    Full Text Available Investigation of the B(bq̄; q = u, d meson properties is carried out using variational method within phenomenological quark antiquark potential(coulomb plus power model using the Gaussian wave function. O(1/m correction to the potential energy term and relativistic corrections to the kinetic energy term of the hamiltonian are incorporated. Spin-orbit, spin-spin and tensor interactions are employed to obtain the mass spectra. Various other properties such as the decay constants, e1 and m1 transitions are also obtained

  2. Theoretical aspects of light meson spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Barnes, T. [Oak Ridge National Lab., TN (United States). Computational and Theoretical Physics Group]|[Univ. of Tennessee, Knoxville, TN (United States). Dept. of Physics and Astronomy

    1995-12-31

    In this pedagogical review the authors discuss the theoretical understanding of light hadron spectroscopy in terms of QCD and the quark model. They begin with a summary of the known and surmised properties of QCD and confinement. Following this they review the nonrelativistic quark potential model for q{anti q} mesons and discuss the quarkonium spectrum and methods for identifying q{anti q} states. Finally, they review theoretical expectations for non-q{anti q} states (glueballs, hybrids and multiquark systems) and the status of experimental candidates for these states.

  3. Weak decays of strongly decaying mesons

    International Nuclear Information System (INIS)

    Weak decays of the light mesons η, η', ρ, ω and κ* are considered. It is pointed out that a measurement of the decays η' → κπ, ρ → π, ω → κπ and κ* → ππ is within reach at LEAR. This would give valuable information on the mechanism behind the ΔI = 1/2 rule in weak nonleptonic decays. A possible strangeness asymmetry in these decays is proposed as a manifestation of CP violation. However, this asymmetry is estimated in the standard electroweak model to be too minute to be measurable at present. (orig.)

  4. Neutral meson oscillations on the lattice

    CERN Document Server

    Carrasco, Nuria

    2014-01-01

    Accurate measurements of K, D and B meson mixing amplitudes provide stringent constraints in the Unitary Triangle analysis, as well as useful bounds on New Physics scales. Lattice QCD provides a non perturbative tool to compute the hadronic matrix elements entering in the effective weak Hamiltonian, with errors at a few percent level and systematic uncertainties under control. I review recent lattice results for these hadronic matrix element performed with $N_f=2$, $N_f=2+1$ and $N_f=2+1+1$ dynamical sea quarks.

  5. Learn with SAT to Minimize Büchi Automata

    Directory of Open Access Journals (Sweden)

    Stephan Barth

    2012-10-01

    Full Text Available We describe a minimization procedure for nondeterministic Büchi automata (NBA. For an automaton A another automaton A_min with the minimal number of states is learned with the help of a SAT-solver. This is done by successively computing automata A' that approximate A in the sense that they accept a given finite set of positive examples and reject a given finite set of negative examples. In the course of the procedure these example sets are successively increased. Thus, our method can be seen as an instance of a generic learning algorithm based on a "minimally adequate teacher'' in the sense of Angluin. We use a SAT solver to find an NBA for given sets of positive and negative examples. We use complementation via construction of deterministic parity automata to check candidates computed in this manner for equivalence with A. Failure of equivalence yields new positive or negative examples. Our method proved successful on complete samplings of small automata and of quite some examples of bigger automata. We successfully ran the minimization on over ten thousand automata with mostly up to ten states, including the complements of all possible automata with two states and alphabet size three and discuss results and runtimes; single examples had over 100 states.

  6. Electromagnetic Currents and Magnetic Moments in $\\chi$EFT

    Energy Technology Data Exchange (ETDEWEB)

    Saori Pastore, Luca Girlanda, Rocco Schiavilla, Michele Viviani, Robert Wiringa

    2009-09-01

    A two-nucleon potential and consistent electromagnetic currents are derived in chiral effective field theory ($\\chi$EFT) at, respectively, $Q^{\\, 2}$ (or N$^2$LO) and $e\\, Q$ (or N$^3$LO), where $Q$ generically denotes the low-momentum scale and $e$ is the electric charge. Dimensional regularization is used to renormalize the pion-loop corrections. A simple expression is derived for the magnetic dipole ($M1$) operator associated with pion loops, consisting of two terms, one of which is determined, uniquely, by the isospin-dependent part of the two-pion-exchange potential. This decomposition is also carried out for the $M1$ operator arising from contact currents, in which the unique term is determined by the contact potential. Finally, the low-energy constants (LEC's) entering the N$^2$LO potential are fixed by fits to the $np$ S- and P-wave phase shifts up to 100 MeV lab energies. Three additional LEC's are needed to completely specify the $M1$ operator at N$^3$L

  7. High chi polymer development for DSA applications using RAFT technology

    Science.gov (United States)

    Sheehan, Michael T.; Farnham, William B.; Tran, Hoang V.; Londono, J. David; Brun, Yefim

    2013-03-01

    Directed self-assembly (DSA) of block copolymers is proving to be an interesting and innovative method to make three-dimensional periodic, uniform patterns useful in a variety of microelectronics applications. Attributes critical to acceptable DSA performance of block copolymers include molecular weight uniformity, final purity, and reproducibility in all the steps involved in producing the polymers. Reversible Addition Fragmentation Chain Transfer (RAFT) polymerization technology enables the production of such materials provided that careful process monitoring and compositional homogeneity measurement systems are employed. It is uniquely suited to construction of multiblocks with components of widely divergent surface energies and functionality. We describe a high chi diblock system comprising partially fluorinated methacrylates and substituted styrenics. While special new polymer separation strategies involving controlled polymer particle assembly in liquid media are required for some monomer systems and molecular weight regimes, we have been able to demonstrate high yield and compositionally homogeneous diblocks of lamellar and cylindrical morphology with polydispersities < 1.1. During purification processes, these diblock materials undergo assembly processes in liquid media, and with appropriate controls, this allows for removal of soluble homopolymer contaminants. SAXS analyses of solid polymer samples provide estimates of lamellar d-spacing, and a good correlation with molecular weight is shown. This system will be described.

  8. The challenges of water governance in Ho Chi Minh City.

    Science.gov (United States)

    van Leeuwen, Cornelis J; Dan, Nguyen P; Dieperink, Carel

    2016-04-01

    Population growth, urbanization, pollution, and climate change pose urgent water challenges in cities. In this study, the sustainability of integrated water resources management in Ho Chi Minh City (HCMC) was evaluated using the City Blueprint approach. The City Blueprint is a set of 24 dedicated indicators divided over 8 categories (i.e., water security, water quality, drinking water, sanitation, infrastructure, climate robustness, biodiversity and attractiveness, and governance including public participation). The analysis showed that the rapid increase of water use for urban, industrial, and agricultural activities in HCMC has resulted in depletion of groundwater and severe pollution of both groundwater and surface water. Surface water quality, groundwater quality, biodiversity, and the sanitation of domestic and industrial wastewater are matters that need serious improvement. Current and future water supply in HCMC is at risk. HCMC can cope with it, but the 7 governance gaps as described by the Organisation for Economic Co-operation and Development (OECD) are major obstacles for HCMC. Rainwater harvesting, pollution reduction, as well as wastewater reuse are among the practical options. Wastewater reuse could lower the water stress index to 10%. The window to do this is narrow and rapidly closing as a result of the unprecedented urbanization and economic growth of this region. PMID:26009880

  9. Acute Cardiovascular Response to Sign Chi Do Exercise

    Directory of Open Access Journals (Sweden)

    Carol E. Rogers

    2015-08-01

    Full Text Available Safe and gentle exercise may be important for older adults overcoming a sedentary lifestyle. Sign Chi Do (SCD, a novel form of low impact exercise, has shown improved balance and endurance in healthy older adults, and there have been no SCD-related injuries reported. Sedentary older adults are known to have a greater cardiovascular (CV response to physical activity than those who regularly exercise. However their CV response to SCD is unknown. This study explored the acute CV response of older adults to SCD. Cross-sectional study of 34 sedentary and moderately active adults over age 55 with no previous experience practicing SCD. Participants completed a 10 min session of SCD. CV outcomes of heart rate, blood pressure, rate pressure product were recorded at 0, 5, 10 min of SCD performance, and after 10 min of rest. HR was recorded every minute. There was no difference in CV scores of sedentary and moderately active older adults after a session of SCD-related activity. All CV scores increased at 5 min, were maintained at 10 min, and returned to baseline within 10 min post SCD (p < 0.05. SCD may be a safe way to increase participation in regular exercise by sedentary older adults.

  10. Charmed Mesons in Nuclei with Heavy-Quark Spin Symmetry

    Science.gov (United States)

    Tolos, L.; Garcia-Recio, C.; Nieves, J.; Romanets, O.; Salcedo, L. L.

    2013-08-01

    We study the properties of charmed pseudoscalar and vector mesons in dense matter within a unitary meson-baryon coupled-channel model which incorporates heavy-quark spin symmetry. This is accomplished by extending the SU(3) Weinberg-Tomozawa Lagrangian to incorporate spin-flavor symmetry and implement a suitable flavor symmetry breaking. Several resonances with negative parity are generated dynamically by the s-wave interaction between pseudoscalar and vector meson multiplets with 1/2+ and 3/2+ baryons. Those states are then compared to experimental data as well as theoretical models. Next, Pauli-blocking effects and meson self-energies are introduced in a self-consistent manner to obtain the open-charm meson spectral functions in a dense nuclear environment. We finally discuss the formation of D-mesic nuclei.

  11. Charmed mesons in nuclei with heavy-quark spin symmetry

    CERN Document Server

    Tolos, L; Nieves, J; Romanets, O; Salcedo, L L

    2012-01-01

    We study the properties of charmed pseudoscalar and vector mesons in dense matter within a unitary meson-baryon coupled-channel model which incorporates heavy-quark spin symmetry. This is accomplished by extending the SU(3) Weinberg-Tomozawa Lagrangian to SU(8) spin-flavor symmetry and implementing a suitable flavor symmetry breaking. Several resonances with negative parity are generated dynamically by the s-wave interaction between pseudoscalar and vector meson multiplets with $1/2^+$ and $3/2^+$ baryons. Those states are then compared to experimental data as well as theoretical models. Next, Pauli-blocking effects and meson self-energies are introduced in a self-consistent manner to obtain the open-charm meson spectral functions in a dense nuclear environment. We finally discuss the formation of $D$-mesic nuclei.

  12. Hyperfine meson splittings: chiral symmetry versus transverse gluon exchange

    CERN Document Server

    Llanes-Estrada, Felipe J; Swanson, Eric S; Szczepaniak, Adam P; Llanes-Estrada, Felipe J.; Cotanch, Stephen R.; Szczepaniak, Adam P.; Swanson, Eric S.

    2004-01-01

    Meson spin splittings are examined within an effective Coulomb gauge QCD Hamiltonian incorporating chiral symmetry and a transverse hyperfine interaction necessary for heavy quarks. For light and heavy quarkonium systems the pseudoscalar-vector meson spectrum is generated by approximate BCS-RPA diagonalizations. This relativistic formulation includes both $S$ and $D$ waves for the vector mesons which generates a set of coupled integral equations. A smooth transition from the heavy to the light quark regime is found with chiral symmetry dominating the $\\pi$-$\\rho$ mass difference. A good, consistent description of the observed meson spin splittings and chiral quantities, such as the quark condensate and the $\\pi$ mass, is obtained. Similar comparisons with TDA diagonalizations, which violate chiral symmetry, are deficient for light pseudoscalar mesons indicating the need to simultaneously include both chiral symmetry and a hyperfine interaction. The $\\eta_b$ mass is predicted to be around 9400 MeV consistent w...

  13. Meson turbulence at quark deconfinement from AdS/CFT

    CERN Document Server

    Hashimoto, Koji; Murata, Keiju; Oka, Takashi

    2014-01-01

    Based on the QCD string picture at confining phase, we conjecture that the deconfinement transition always accompanies a condensation of higher meson resonances with a power-law behavior, "meson turbulence". We employ the AdS/CFT correspondence to calculate the meson turbulence for $\\mathcal{N}=2$ supersymmetric QCD at large $N_c$ and at strong coupling limit, and find that the energy distribution to each meson level $n$ scales as $n^\\alpha$ with the universal scaling $\\alpha=-5$. The universality is checked for various ways to attain the quark deconfinement: a static electric field below/around the critical value, a time-dependent electric field quench, and a time-dependent quark mass quench, all result in the turbulent meson condensation with the universal power $\\alpha=-5$ around the deconfinement.

  14. Probing the perturbative dynamics of exclusive meson pair production

    Energy Technology Data Exchange (ETDEWEB)

    Harland-Lang, L.A., E-mail: lucian.harland-lang@durham.ac.uk [Department of Physics and Institute for Particle Physics Phenomenology, University of Durham, DH1 3LE (United Kingdom); Khoze, V.A. [Department of Physics and Institute for Particle Physics Phenomenology, University of Durham, DH1 3LE (United Kingdom); Petersburg Nuclear Physics Institute, NRC Kurchatov Institute, Gatchina, St. Petersburg, 188300 (Russian Federation); Ryskin, M.G. [Petersburg Nuclear Physics Institute, NRC Kurchatov Institute, Gatchina, St. Petersburg, 188300 (Russian Federation); Stirling, W.J. [Cavendish Laboratory, University of Cambridge, J.J. Thomson Avenue, Cambridge, CB3 0HE (United Kingdom)

    2013-10-01

    We present the results of a recent novel application of the ‘hard exclusive’ perturbative formalism to the process gg→MM{sup ¯} at large angles, where M (M{sup ¯}) is a light meson (anti-meson). As well as discussing the important theoretical features of the relevant leading-order gg→qq{sup ¯}(gg)qq{sup ¯}(gg) 6-parton amplitudes, we also comment on their phenomenological implications. In particular, we consider the central exclusive production of meson pairs at comparatively large transverse momentum k{sub ⊥}, which is expected to proceed via this mechanism. We show that this leads to various non-trivial predictions for a range of exclusive processes, and that the cross sections for the η{sup ′} and η mesons display significant sensitivity to any valence gg component of the meson wavefunctions.

  15. Probing the perturbative dynamics of exclusive meson pair production

    CERN Document Server

    Harland-Lang, L A; Ryskin, M G; Stirling, W J

    2013-01-01

    We present the results of a recent novel application of the `hard exclusive' perturbative formalism to the process gg --> MMbar at large angles, where M (Mbar) is a light meson (anti-meson). As well as discussing the important theoretical features of the relevant leading-order gg --> qqbar(gg) qqbar(gg) 6-parton amplitudes, we also comment on their phenomenological implications. In particular, we consider the central exclusive production of meson pairs at comparatively large transverse momentum k_t, which is expected to proceed via this mechanism. We show that this leads to various non-trivial predictions for a range of exclusive processes, and that the cross sections for the eta' and eta mesons display significant sensitivity to any valence gg component of the meson wavefunctions.

  16. Probing the perturbative dynamics of exclusive meson pair production

    Science.gov (United States)

    Harland-Lang, L. A.; Khoze, V. A.; Ryskin, M. G.; Stirling, W. J.

    2013-10-01

    We present the results of a recent novel application of the 'hard exclusive' perturbative formalism to the process gg → MMbar at large angles, where M (Mbar) is a light meson (anti-meson). As well as discussing the important theoretical features of the relevant leading-order gg → qqbar (gg) qqbar (gg) 6-parton amplitudes, we also comment on their phenomenological implications. In particular, we consider the central exclusive production of meson pairs at comparatively large transverse momentum k⊥, which is expected to proceed via this mechanism. We show that this leads to various non-trivial predictions for a range of exclusive processes, and that the cross sections for the η‧ and η mesons display significant sensitivity to any valence gg component of the meson wavefunctions.

  17. Valid QCD sum rules for vector mesons in nuclear matter

    International Nuclear Information System (INIS)

    QCD sum rules for vector mesons (ρ, ω, φ) in nuclear matter are re-examined with an emphasis on the reliability of various sum rules. Monitoring the continuum contribution and the convergence of the operator product expansion plays crucial role in determining the validity of a sum rule. The uncertainties arising from less than precise knowledge of the condensate values and other input parameters are analyzed via a Monte Carlo error analysis. Our analysis leaves no doubt that vector-meson masses decrease with increasing density. This resolves the current debate over the behavior of the vector-meson masses and the sum rules to be used in extracting vector meson properties in nuclear matter. We find a ratio of ρ-meson masses of mρ*/mρ = 0.78 ± 0.08 at nuclear matter saturation density. (author). 37 refs., 6 figs

  18. Quantum chromodynamics with infinite number of vector mesons

    International Nuclear Information System (INIS)

    It is supposed that families of vector mesons ρ, ψ, Υ contain an infinite number of resonances with gradually increasing widths. The asymptotic freedom requirement involves a relationship between the electronic width of a resonance and its mass derivative over the number. Using of this relationship it is shown that for the families of ψ and Υ mesons the moment from experimental function R(s)is egual to the sum of the moment from a bare quark loop and the edge term which arised from replacing of summation by integration. These equalities are fulfilled up to 1% for 60 moments in the ψ-meson family and up to 2% for 96 moments in the Υ-meson family. The electronic widths of the considered resonances and the ρ-meson mass are calculated

  19. Factorization for hard exclusive electroproduction of mesons in QCD

    International Nuclear Information System (INIS)

    We formulate and prove a QCD factorization theorem for hard exclusive electroproduction of mesons in QCD. The proof is valid for the leading power in Q and all logarithms. This generalizes previous work on vector meson production in the diffractive region of small x. The amplitude is expressed in terms of off-diagonal generalizations of the usual parton densities. The full theorem applies to all kinds of mesons and not just to vector mesons. The parton densities used include not only the ordinary parton density, but also the helicity density (g1 or Δq) and the transversity density (h1 or δq), and these can be probed by measuring the polarization of the produced mesons with unpolarized protons. copyright 1997 The American Physical Society

  20. Rapidity resummation for $B$-meson wave functions

    CERN Document Server

    Shen, Yue-Long

    2014-01-01

    Transverse-momentum dependent (TMD) hadronic wave functions develop light-cone divergences under QCD corrections, which are commonly regularized by the rapidity $\\zeta$ of gauge vector defining the non-light-like Wilson lines. The yielding rapidity logarithms from infrared enhancement need to be resummed for both hadronic wave functions and short-distance functions, to achieve scheme-independent calculations of physical quantities. We briefly review the recent progress on the rapidity resummation for $B$-meson wave functions which are the key ingredients of TMD factorization formulae for radiative-leptonic, semi-leptonic and non-leptonic $B$-meson decays. The crucial observation is that rapidity resummation induces a strong suppression of $B$-meson wave functions at small light-quark momentum, strengthening the applicability of TMD factorization in exclusive $B$-meson decays. The phenomenological consequence of rapidity-resummation improved $B$-meson wave functions is further discussed in the context of $B \\t...

  1. Statistical analysis of earthquakes after the 1999 MW 7.7 Chi-Chi, Taiwan, earthquake based on a modified Reasenberg-Jones model

    Science.gov (United States)

    Chen, Yuh-Ing; Huang, Chi-Shen; Liu, Jann-Yenq

    2015-12-01

    We investigated the temporal-spatial hazard of the earthquakes after the 1999 September 21 MW = 7.7 Chi-Chi shock in a continental region of Taiwan. The Reasenberg-Jones (RJ) model (Reasenberg and Jones, 1989, 1994) that combines the frequency-magnitude distribution (Gutenberg and Richter, 1944) and time-decaying occurrence rate (Utsu et al., 1995) is conventionally employed for assessing the earthquake hazard after a large shock. However, it is found that the b values in the frequency-magnitude distribution of the earthquakes in the study region dramatically decreased from background values after the Chi-Chi shock, and then gradually increased up. The observation of a time-dependent frequency-magnitude distribution motivated us to propose a modified RJ model (MRJ) to assess the earthquake hazard. To see how the models perform on assessing short-term earthquake hazard, the RJ and MRJ models were separately used to sequentially forecast earthquakes in the study region. To depict the potential rupture area for future earthquakes, we further constructed relative hazard (RH) maps based on the two models. The Receiver Operating Characteristics (ROC) curves (Swets, 1988) finally demonstrated that the RH map based on the MRJ model was, in general, superior to the one based on the original RJ model for exploring the spatial hazard of earthquakes in a short time after the Chi-Chi shock.

  2. Photoproduction of $\\eta '$-mesons off the deuteron

    CERN Document Server

    Jaegle, I; Fix, A; Huang, F; Nakayama, K; Tiator, L; Anisovich, A V; Bacelar, J C S; Bantes, B; Bartholomy, O; Bayadilov, D E; Beck, R; Beloglazov, Y A; Castelijns, R; Crede, V; Dutz, H; Elsner, D; Ewald, R; Frommberger, F; Funke, C; Gregor, R; Gridnev, A B; Gutz, E; Hillert, W; Hoeffgen, S; Junkersfeld, J; Kalinowsky, H; Kammer, S; Kleber, V; Klein, Frank; Klein, Friedrich; Klempt, E; Kotulla, M; Krusche, B; Lang, M; Loehner, H; Lopatin, I V; Lugert, S; Menze, D; Messchendorp, J G; Metag, V; Nikonov, V A; Nanova, M; Novinski, D V; Novotny, R; Ostrick, M; Pant, L M; van Pee, H; Pfeiffer, M; Roy, A; Sarantsev, A V; Schadmand, S; Schmidt, C; Schmieden, H; Schoch, B; Shende, S V; Sokhoyan, V; Suele, A; Sumachev, V V; Szczepanek, T; Thoma, U; Trnka, D; Varma, R; Walther, D; Wendel, C

    2010-01-01

    Quasi-free photoproduction of $\\eta '$ mesons off nucleons bound in the deuteron has been measured with the combined Crystal Barrel - TAPS detector. The experiment was done at a tagged photon beam of the ELSA electron accelerator in Bonn for incident photon energies from the production threshold up to 2.5 GeV. The $\\eta '$-mesons have been detected in coincidence with recoil protons and recoil neutrons. The quasi-free proton data are in good agreement with the results for free protons, indicating that nuclear effects have no significant impact. The coincidence with recoil neutrons provides the first data for the $\\gamma n \\rightarrow n\\eta '$ reaction. In addition, also first estimates for coherent $\\eta '$-production off the deuteron have been obtained. In agreement with model predictions, the total cross section for this channel is found to be very small, at most at the level of a few nb. The data are compared to model calculations taking into account contributions from nucleon resonances and $t$-channel ex...

  3. High-energy photoproduction of neutral mesons

    CERN Document Server

    Charity, Tim

    1987-01-01

    This thesis presents results from the first full period of data-taking of the experiment WA69 at the Omega^'^ectrometer, CERN, Geneva. The experiment used a tagged photon beam of energy 60-180 GeV incident on a liquid hydrogen target to study photoproduction of hadronic states. The various components of the experiment are described, with particular emphasis on the electromagnetic calorimeters, and the associated offline software for event reconstruction and acceptance calculation. The performance of the outer calorimeter is discussed, and the pi^0 detection and reconstruction efficiency is examined by comparison with pi^{+/- } production. Searches for photoproduction of neutral meson states reveal a clear signal for the pi^0, eta^0 , and omega^0 mesons. The cross-section for elastic omega^0 production is estimated, and found to be consistent with the established value of 1 mub. The cross-section for inclusive pi^0 and eta^0 production is studied using the variable Feynman-x (x_{F }), and pi^0 production as a ...

  4. Asymmetric vector mesons produced in nuclear collisions

    CERN Document Server

    Dremin, I M

    2016-01-01

    It is argued that the experimentally observed phenomenon of asymmetric shapes of vector mesons produced in nuclear media during high energy nucleus-nucleus collisions can be explained as Fano-Feshbach resonances. It has been observed that the mass distributions of lepton pairs created at meson decays decline from the traditional Breit-Wigner shape with some excess in the low-mass wing of the resonance. It is clear that the whole phenomenon is related to some interaction with the nuclear medium. Moreover, it can be further detalized in quantum mechanics as the interference of direct and continuum states in Fano-Feshbach effect. To reveal the nature of the interaction it is proposed to use a phenomenological model of the additional contribution due to Cherenkov gluons. They can be created because of the excess of the refractivity index over 1 just in the low-mass wing as required by the classical Cherenkov treatment. In quantum mechanics, this requirement is related to the positive real part of the interaction ...

  5. Beautiful mesons from QCD spectral sum rules

    Energy Technology Data Exchange (ETDEWEB)

    Narison, S.

    1988-08-18

    We apply q/sup 2/ = 0 moments within n (number of derivatives) and t/sub c/ (continuum threshold) stability criteria to the beautiful-meson systems. The optimal predictions are reached for the same ranges of n and t/sub c/ values leading to the previous estimate of the decay constant f/sub B/. The QCD scales (b-quark 'physical' mass, mixed and four-quark condensates) are strongly constrained by the observed B and B/sup */ masses. The predictions for the S- and P-state splittings are much affected by the definition of the b-quark mass (pole or euclidian) entering into the Wilson coefficients of the non-perturbative condensates. The size of the SU(3)/sub F/ breaking on the mass splittings cannot be accurately predicted due to the imprecise value of the / condensate ratio. We present new predictions for the B/sub c/ and B/sub c//sup */ mesons.

  6. Constraining New Physics with D meson decays

    International Nuclear Information System (INIS)

    Latest Lattice results on D form factors evaluation from first principles show that the Standard Model (SM) branching ratios prediction for the leptonic Ds→ℓνℓ decays and the semileptonic SM branching ratios of the D0 and D+ meson decays are in good agreement with the world average experimental measurements. It is possible to disprove New Physics hypothesis or find bounds over several models beyond the SM. Using the observed leptonic and semileptonic branching ratios for the D meson decays, we performed a combined analysis to constrain non-standard interactions which mediate the cs¯→lν¯ transition. This is done either by a model-independent way through the corresponding Wilson coefficients or in a model-dependent way by finding the respective bounds over the relevant parameters for some models beyond the Standard Model. In particular, we obtain bounds for the Two Higgs Doublet Model Type-II and Type III, the Left–Right model, the Minimal Supersymmetric Standard Model with explicit R-parity violation and Leptoquarks. Finally, we estimate the transverse polarization of the lepton in the D0 decay and we found it can be as high as PT=0.23.

  7. K+-meson production in nuclei

    International Nuclear Information System (INIS)

    This report summarises the results of the physics programme, performed in the years 1998-2003, which became possible after taking into operation the ANKE spectrometer at an internal target position of the accelerator facility COSY-Juelich. Primary goal when building ANKE was to provide a tool which allows one to study processes leading to K+-meson production in interactions of protons with atomic nuclei, in particular at beam energies far below the free nucleon-nucleon threshold. From such data one hopes to extract information about the influence of the nuclear medium on elementary K+-production processes (i.e. in free proton-proton interactions), about the in-medium properties of this meson, and about collective effects in nuclear matter. The construction of ANKE and the K+-detection systems was started in 1989. After the integration of ANKE into the COSY accelerator ring in 1998, inclusive K+-momentum spectra were measured in a first series of experiments (p+A → K+X for different target nuclei A=C, Cu, Ag, Au). These data reveal a high degree of collectivity in the target nuclei and, for the first time, allow one to extract the nuclear potential (or ''in-medium mass'') of K+ mesons at normal nuclear density with high accuracy. The ANKE data on K+ production in proton-deuteron interactions indicate a large production cross section on neutrons, as compared to proton targets. This fact must be taken into account, e.g., for the theoretical description of heavy ion data. In the second phase of the experimental program, K+ mesons from protoncarbon interactions were measured in coincidence with protons and deuterons (p+C → K+ (p or d)X). These novel data yield information about the kaon production mechanisms and give evidence for cluster-formation processes. Corresponding coincidence data for proton-proton collisions (p+p → K+ anti K0 d) revealed that K anti K -pair production close to threshold is dominated by kaons produced in a relative S-wave. This has been

  8. Observation of chi(cJ) decays to Lambda(Lambda)over-bar pi(+)pi(-)

    NARCIS (Netherlands)

    Ablikim, M.; Achasov, M. N.; Ambrose, D. J.; An, F. F.; An, Q.; An, Z. H.; Bai, J. Z.; Ban, Y.; Becker, J.; Bennett, J. V.; Bertani, M.; Bian, J. M.; Boger, E.; Bondarenko, O.; Boyko, I.; Briere, R. A.; Bytev, V.; Cai, X.; Cakir, O.; Calcaterra, A.; Cao, G. F.; Cetin, S. A.; Chang, J. F.; Chelkov, G.; Chen, G.; Chen, H. S.; Chen, J. C.; Chen, M. L.; Chen, S. J.; Chen, Y. B.; Cheng, H. P.; Chu, Y. P.; Cronin-Hennessy, D.; Dai, H. L.; Dai, J. P.; Dedovich, D.; Deng, Z. Y.; Denig, A.; Denysenko, I.; Destefanis, M.; Ding, W. M.; Ding, Y.; Dong, L. Y.; Dong, M. Y.; Du, S. X.; Fang, J.; Fang, S. S.; Fava, L.; Feldbauer, F.; Feng, C. Q.; Ferroli, R. B.; Fu, C. D.; Fu, J. L.; Gao, Y.; Geng, C.; Goetzen, K.; Gong, W. X.; Gradl, W.; Greco, M.; Gu, M. H.; Gu, Y. T.; Guan, Y. H.; Guo, A. Q.; Guo, L. B.; Guo, Y. P.; Han, Y. L.; Harris, F. A.; He, K. L.; He, M.; He, Z. Y.; Held, T.; Heng, Y. K.; Hou, Z. L.; Hu, H. M.; Hu, J. F.; Hu, T.; Huang, G. M.; Huang, J. S.; Huang, X. T.; Huang, Y. P.; Hussain, T.; Ji, C. S.; Ji, Q.; Ji, X. B.; Ji, X. L.; Jiang, L. L.; Jiang, X. S.; Jiao, J. B.; Jiao, Z.; Jin, D. P.; Jin, S.; Jing, F. F.; Kalantar-Nayestanaki, N.; Kavatsyuk, M.; Kuehn, W.; Lai, W.; Lange, J. S.; Li, C. H.; Li, Cheng; Li, Cui; Li, D. M.; Li, F.; Li, G.; Li, H. B.; Li, J. C.; Li, K.; Li, Lei; Li, Q. J.; Li, S. L.; Li, W. D.; Li, W. G.; Li, X. L.; Li, X. N.; Li, X. Q.; Li, X. R.; Li, Z. B.; Liang, H.; Liang, Y. F.; Liang, Y. T.; Liao, G. R.; Liao, X. T.; Liu, B. J.; Liu, C. L.; Liu, C. X.; Liu, C. Y.; Liu, F. H.; Liu, Fang; Liu, Feng; Liu, H.; Liu, H. B.; Liu, H. H.; Liu, H. M.; Liu, H. W.; Liu, J. P.; Liu, K. Y.; Liu, Kai; Liu, P. L.; Liu, Q.; Liu, S. B.; Liu, X.; Liu, X. H.; Liu, Y. B.; Liu, Z. A.; Liu, Zhiqiang; Liu, Zhiqing; Loehner, H.; Lu, G. R.; Lu, H. J.; Lu, J. G.; Lu, Q. W.; Lu, X. R.; Lu, Y. P.; Luo, C. L.; Luo, M. X.; Luo, T.; Luo, X. L.; Lv, M.; Ma, C. L.; Ma, F. C.; Ma, H. L.; Ma, Q. M.; Ma, S.; Ma, T.; Ma, X. Y.; Ma, Y.; Maas, F. E.; Maggiora, M.; Malik, Q. A.; Mao, Y. J.; Mao, Z. P.; Messchendorp, J. G.; Min, J.; Min, T. J.; Mitchell, R. E.; Mo, X. H.; Morales, C. Morales; Motzko, C.; Muchnoi, N. Yu.; Muramatsu, H.; Nefedov, Y.; Nicholson, C.; Nikolaev, I. B.; Ning, Z.; Olsen, S. L.; Ouyang, Q.; Pacetti, S.; Park, J. W.; Pelizaeus, M.; Peng, H. P.; Peters, K.; Ping, J. L.; Ping, R. G.; Poling, R.; Prencipe, E.; Qi, M.; Qian, S.; Qiao, C. F.; Qin, X. S.; Qin, Y.; Qin, Z. H.; Qiu, J. F.; Rashid, K. H.; Rong, G.; Ruan, X. D.; Sarantsev, A.; Schaefer, B. D.; Schulze, J.; Shao, M.; Shen, C. P.; Shen, X. Y.; Sheng, H. Y.; Shepherd, M. R.; Song, X. Y.; Spataro, S.; Spruck, B.; Sun, D. H.; Sun, G. X.; Sun, J. F.; Sun, S. S.; Sun, Y. J.; Sun, Y. Z.; Sun, Z. J.; Sun, Z. T.; Tang, C. J.; Tang, X.; Tapan, I.; Thorndike, E. H.; Toth, D.; Ullrich, M.; Varner, G. S.; Wang, B.; Wang, B. Q.; Wang, K.; Wang, L. L.; Wang, L. S.; Wang, M.; Wang, P.; Wang, P. L.; Wang, Q.; Wang, Q. J.; Wang, S. G.; Wang, X. L.; Wang, Y. D.; Wang, Y. F.; Wang, Y. Q.; Wang, Z.; Wang, Z. G.; Wang, Z. Y.; Wei, D. H.; Weidenkaff, P.; Wen, Q. G.; Wen, S. P.; Wiedner, U.; Wu, L. H.; Wu, N.; Wu, S. X.; Wu, W.; Wu, Z.; Xia, L. G.; Xiao, Z. J.; Xie, Y. G.; Xiu, Q. L.; Xu, G. F.; Xu, G. M.; Xu, H.; Xu, Q. J.; Xu, X. P.; Xu, Z. R.; Xue, F.; Xue, Z.; Yan, L.; Yan, W. B.; Yan, Y. H.; Yang, H. X.; Yang, Y.; Yang, Y. X.; Ye, H.; Ye, M.; Ye, M. H.; Yu, B. X.; Yu, C. X.; Yu, J. S.; Yu, S. P.; Yuan, C. Z.; Yuan, Y.; Zafar, A. A.; Zallo, A.; Zeng, Y.; Zhang, B. X.; Zhang, B. Y.; Zhang, C. C.; Zhang, D. H.; Zhang, H. H.; Zhang, H. Y.; Zhang, J. Q.; Zhang, J. W.; Zhang, J. Y.; Zhang, J. Z.; Zhang, S. H.; Zhang, X. J.; Zhang, X. Y.; Zhang, Y.; Zhang, Y. H.; Zhang, Y. S.; Zhang, Z. P.; Zhang, Z. Y.; Zhao, G.; Zhao, H. S.; Zhao, J. W.; Zhao, K. X.; Zhao, Lei; Zhao, Ling; Zhao, M. G.; Zhao, Q.; Zhao, S. J.; Zhao, T. C.; Zhao, X. H.; Zhao, Y. B.; Zhao, Z. G.; Zhemchugov, A.; Zheng, B.; Zheng, Y. H.; Zhong, B.; Zhong, J.; Zhou, L.; Zhou, X. K.; Zhou, X. R.; Zhu, C.; Zhu, K.; Zhu, K. J.; Zhu, S. H.; Zhu, X. L.; Zhu, X. W.; Zhu, Y. C.; Zhu, Y. M.; Zhu, Y. S.; Zhu, Z. A.; Zhuang, J.; Zou, B. S.; Zou, J. H.; Werner, M.J.; Zheng, J.P.

    2012-01-01

    Decays of the chi(cJ) states (J = 0, 1, 2) to Lambda(Lambda) over bar pi(+)pi(-), including processes with intermediate Sigma(1385), are studied through the E1 transition psi(1) -> gamma chi(cJ) using 106 x 10(6) psi(1) events collected with the BESIII detector at BEPCII. This is the first observati

  9. Higher-order multipole amplitude measurement in psi ' -> gamma chi(c2)

    NARCIS (Netherlands)

    Ablikim, M.; Achasov, M. N.; Alberto, D.; An, F. F.; An, Q.; An, Z. H.; Bai, J. Z.; Baldini, R.; Ban, Y.; Becker, J.; Berger, N.; Bertani, M.; Bian, J. M.; Boger, E.; Bondarenko, O.; Boyko, I.; Briere, R. A.; Bytev, V.; Cai, X.; Calcaterra, A. C.; Cao, G. F.; Chang, J. F.; Chelkov, G.; Chen, G.; Chen, H. S.; Chen, J. C.; Chen, M. L.; Chen, S. J.; Chen, Y.; Chen, Y. B.; Cheng, H. P.; Chu, Y. P.; Cronin-Hennessy, D.; Dai, H. L.; Dai, J. P.; Dedovich, D.; Deng, Z. Y.; Denysenko, I.; Destefanis, M.; Ding, Y.; Dong, L. Y.; Dong, M. Y.; Du, S. X.; Fang, J.; Fang, S. S.; Feng, C. Q.; Fu, C. D.; Fu, J. L.; Gao, Y.; Geng, C.; Goetzen, K.; Gong, W. X.; Greco, M.; Gu, M. H.; Gu, Y. T.; Guan, Y. H.; Guo, A. Q.; Guo, L. B.; Guo, Y. P.; Han, Y. L.; Hao, X. Q.; Harris, F. A.; He, K. L.; He, M.; He, Z. Y.; Heng, Y. K.; Hou, Z. L.; Hu, H. M.; Hu, J. F.; Hu, T.; Huang, B.; Huang, G. M.; Huang, J. S.; Huang, X. T.; Huang, Y. P.; Hussain, T.; Ji, C. S.; Ji, Q.; Ji, X. B.; Ji, X. L.; Jia, L. K.; Jiang, L. L.; Jiang, X. S.; Jiao, J. B.; Jiao, Z.; Jin, D. P.; Jin, S.; Jing, F. F.; Kalantar-Nayestanaki, N.; Kavatsyuk, M.; Kuehn, W.; Lai, W.; Lange, J. S.; Leung, J. K. C.; Li, C. H.; Li, Cheng; Li, Cui; Li, D. M.; Li, F.; Li, G.; Li, H. B.; Li, J. C.; Li, K.; Li, Lei; Li, N. B.; Li, Q. J.; Li, S. L.; Li, W. D.; Li, W. G.; Li, X. L.; Li, X. N.; Li, X. Q.; Li, X. R.; Li, Z. B.; Liang, H.; Liang, Y. F.; Liang, Y. T.; Liao, X. T.; Liu, B. J.; Liu, C. L.; Liu, C. X.; Liu, C. Y.; Liu, F. H.; Liu, Fang; Liu, Feng; Liu, H.; Liu, H. B.; Liu, H. H.; Liu, H. M.; Liu, H. W.; Liu, J. P.; Liu, K.; Liu, K.; Liu, K. Y.; Liu, Q.; Liu, S. B.; Liu, X.; Liu, X. H.; Liu, Y. B.; Liu, Y. W.; Liu, Yong; Liu, Z. A.; Liu, Zhiqiang; Liu, Zhiqing; Loehner, H.; Lu, G. R.; Lu, H. J.; Lu, J. G.; Lu, Q. W.; Lu, X. R.; Lu, Y. P.; Luo, C. L.; Luo, M. X.; Luo, T.; Luo, X. L.; Lv, M.; Ma, C. L.; Ma, F. C.; Ma, H. L.; Ma, Q. M.; Ma, S.; Ma, T.; Ma, X.; Ma, X. Y.; Maggiora, M.; Malik, Q. A.; Mao, H.; Mao, Y. J.; Mao, Z. P.; Messchendorp, J. G.; Min, J.; Min, T. J.; Mitchell, R. E.; Mo, X. H.; Muchnoi, N. Yu; Nefedov, Y.; Nikolaev, I. B.; Ning, Z.; Olsen, S. L.; Ouyang, Q.; Pacetti, S.; Park, J. W.; Pelizaeus, M.; Peters, K.; Ping, J. L.; Ping, R. G.; Poling, R.; Pun, C. S. J.; Qi, M.; Qian, S.; Qiao, C. F.; Qin, X. S.; Qiu, J. F.; Rashid, K. H.; Rong, G.; Ruan, X. D.; Sarantsev, A.; Schulze, J.; Shao, M.; Shen, C. P.; Shen, X. Y.; Sheng, H. Y.; Shepherd, M. R.; Song, X. Y.; Spataro, S.; Spruck, B.; Sun, D. H.; Sun, G. X.; Sun, J. F.; Sun, S. S.; Sun, X. D.; Sun, Y. J.; Sun, Y. Z.; Sun, Z. J.; Sun, Z. T.; Tang, C. J.; Tang, X.; Tian, H. L.; Toth, D.; Varner, G. S.; Wang, B.; Wang, B. Q.; Wang, K.; Wang, L. L.; Wang, L. S.; Wang, M.; Wang, P.; Wang, P. L.; Wang, Q.; Wang, Q. J.; Wang, S. G.; Wang, X. L.; Wang, Y. D.; Wang, Y. F.; Wang, Y. Q.; Wang, Z.; Wang, Z. G.; Wang, Z. Y.; Wei, D. H.; Wen, Q. G.; Wen, S. P.; Wiedner, U.; Wu, L. H.; Wu, N.; Wu, W.; Wu, Z.; Xiao, Z. J.; Xie, Y. G.; Xiu, Q. L.; Xu, G. F.; Xu, G. M.; Xu, H.; Xu, Q. J.; Xu, X. P.; Xu, Y.; Xu, Z. R.; Xu, Z. Z.; Xue, Z.; Yan, L.; Yan, W. B.; Yan, Y. H.; Yang, H. X.; Yang, T.; Yang, Y.; Yang, Y. X.; Ye, H.; Ye, M.; Ye, M. H.; Yu, B. X.; Yu, C. X.; Yu, S. P.; Yuan, C. Z.; Yuan, W. L.; Yuan, Y.; Zafar, A. A.; Zallo, A.; Zeng, Y.; Zhang, B. X.; Zhang, B. Y.; Zhang, C.; Zhang, C. C.; Zhang, D. H.; Zhang, H. H.; Zhang, H. Y.; Zhang, J.; Zhang, J. Q.; Zhang, J. W.; Zhang, J. Y.; Zhang, J. Z.; Zhang, L.; Zhang, S. H.; Zhang, T. R.; Zhang, X. J.; Zhang, X. Y.; Zhang, Y.; Zhang, Y. H.; Zhang, Y. S.; Zhang, Z. P.; Zhang, Z. Y.; Zhao, G.; Zhao, H. S.; Zhao, Jiawei; Zhao, Jingwei; Zhao, Lei; Zhao, Ling; Zhao, M. G.; Zhao, Q.; Zhao, S. J.; Zhao, T. C.; Zhao, X. H.; Zhao, Y. B.; Zhao, Z. G.; Zhao, Z. L.; Zhemchugov, A.; Zheng, B.; Zheng, J. P.; Zheng, Y. H.; Zheng, Z. P.; Zhong, B.; Zhong, J.; Zhong, L.; Zhou, L.; Zhou, X. K.; Zhou, X. R.; Zhu, C.; Zhu, K.; Zhu, K. J.; Zhu, S. H.; Zhu, X. L.; Zhu, X. W.; Zhu, Y. S.; Zhu, Z. A.; Zhuang, J.; Zou, B. S.; Zou, J. H.; Zuo, J. X.

    2011-01-01

    Using 106 x 10(6) psi' events collected with the BESIII detector at the BEPCII storage ring, the higher-order multipole amplitudes in the radiative transition psi' -> gamma chi(c2) -> gamma pi(+)pi(-)/gamma K+K- are measured. A fit to the chi(c2) production and decay angular distributions yields M2

  10. Quantum key distribution by swapping the entanglement of {chi}-type state

    Energy Technology Data Exchange (ETDEWEB)

    Gao Gan, E-mail: gaogan0556@163.co [Department of Electrical Engineering, Tongling University, Tongling 244000 (China)

    2010-06-01

    We propose a quantum key distribution protocol using entanglement swapping of {chi}-type state; in this protocol, Alice and Bob transmit a particle sequence to each other and perform {chi}-type state measurements. Alice's and Bob's roles are completely symmetric.

  11. Implementing e-Health through CHI: A Very Canadian Solution to a Very Canadian Problem

    Directory of Open Access Journals (Sweden)

    Tom Daniels

    2014-05-01

    Full Text Available Canada Health Infoway (CHI was established as an arms-length body by the federal government in 2001 to provide funding to provinces for the development of interoperable e-health systems. CHI was established in response to a number of reports calling on the government to act to make use of technological advances to improve health care quality and provide more rigorous data. In addition to these explicit goals, through establishing CHI the federal government also sought to avoid potential criticism if the implementation of e-health failed, increase its own popularity ahead of the 2000 election and subtly redistribute wealth between the provinces. The paper suggests that the major influence behind the policy to establish CHI came from Canadian institutions and the fact that the federal government was hamstrung by the Canadian Constitution and Canada Health Act. Evaluation of the reform shows that progress has been made by CHI in implementing e-health solutions, but that Canada still lags behind other comparable health systems in the use of technologies. SWOT analysis of the CHI implementation highlights the criticism that CHI could stifle provincial innovation but recognizes that it also offers the opportunity for best practice dissemination across Canada and ensures that ring-fenced funding is available for e-health implementation across the provinces. In conclusion, the paper suggests that, because of constitutional constraints, the federal government was limited in options to implement e-health and that CHI represents a fair compromise.

  12. $\\chi_{c2}$ formation in two-photon collisions at LEP

    CERN Document Server

    Acciarri, M; Adriani, O; Aguilar-Benítez, M; Alcaraz, J; Alemanni, G; Allaby, James V; Aloisio, A; Alviggi, M G; Ambrosi, G; Anderhub, H; Andreev, V P; Angelescu, T; Anselmo, F; Arefev, A; Azemoon, T; Aziz, T; Bagnaia, P; Baksay, L; Balandras, A; Ball, R C; Banerjee, S; Banerjee, Sw; Banicz, K; Barczyk, A; Barillère, R; Barone, L; Bartalini, P; Basile, M; Battiston, R; Bay, A; Becattini, F; Becker, U; Behner, F; Berdugo, J; Berges, P; Bertucci, B; Betev, B L; Bhattacharya, S; Biasini, M; Biland, A; Blaising, J J; Blyth, S C; Bobbink, Gerjan J; Böck, R K; Böhm, A; Boldizsar, L; Borgia, B; Bourilkov, D; Bourquin, Maurice; Braccini, S; Branson, J G; Brigljevic, V; Brochu, F; Buffini, A; Buijs, A; Burger, J D; Burger, W J; Busenitz, J K; Button, A M; Cai, X D; Campanelli, M; Capell, M; Cara Romeo, G; Carlino, G; Cartacci, A M; Casaus, J; Castellini, G; Cavallari, F; Cavallo, N; Cecchi, C; Cerrada-Canales, M; Cesaroni, F; Chamizo-Llatas, M; Chang, Y H; Chaturvedi, U K; Chemarin, M; Chen, A; Chen, G; Chen, G M; Chen, H F; Chen, H S; Chéreau, X J; Chiefari, G; Cifarelli, Luisa; Cindolo, F; Civinini, C; Clare, I; Clare, R; Coignet, G; Colijn, A P; Colino, N; Costantini, S; Cotorobai, F; de la Cruz, B; Csilling, Akos; Dai, T S; van Dalen, J A; D'Alessandro, R; De Asmundis, R; Déglon, P L; Degré, A; Deiters, K; Della Volpe, D; Denes, P; De Notaristefani, F; De Salvo, A; Diemoz, M; Van Dierendonck, D N; Di Lodovico, F; Dionisi, C; Dittmar, Michael; Dominguez, A; Doria, A; Dova, M T; Duchesneau, D; Dufournaud, D; Duinker, P; Durán, I; El-Mamouni, H; Engler, A; Eppling, F J; Erné, F C; Extermann, Pierre; Fabre, M; Faccini, R; Falagán, M A; Falciano, S; Favara, A; Fay, J; Fedin, O; Felcini, Marta; Ferguson, T; Ferroni, F; Fesefeldt, H S; Fiandrini, E; Field, J H; Filthaut, Frank; Fisher, P H; Fisk, I; Forconi, G; Fredj, L; Freudenreich, Klaus; Furetta, C; Galaktionov, Yu; Ganguli, S N; García-Abia, P; Gataullin, M; Gau, S S; Gentile, S; Gheordanescu, N; Giagu, S; Goldfarb, S; Gong, Z F; Grünewald, M W; van Gulik, R; Gupta, V K; Gurtu, A; Gutay, L J; Haas, D; Hartmann, B; Hasan, A; Hatzifotiadou, D; Hebbeker, T; Hervé, A; Hidas, P; Hirschfelder, J; Hofer, H; Holzner, G; Hoorani, H; Hou, S R; Iashvili, I; Jin, B N; Jones, L W; de Jong, P; Josa-Mutuberria, I; Khan, R A; Kamrad, D; Kapustinsky, J S; Kaur, M; Kienzle-Focacci, M N; Kim, D; Kim, D H; Kim, J K; Kim, S C; Kinnison, W W; Kirkby, Jasper; Kiss, D; Kittel, E W; Klimentov, A; König, A C; Kopp, A; Korolko, I; Koutsenko, V F; Krämer, R W; Krenz, W; Kunin, A; Lacentre, P E; Ladrón de Guevara, P; Laktineh, I; Landi, G; Lapoint, C; Lassila-Perini, K M; Laurikainen, P; Lavorato, A; Lebeau, M; Lebedev, A; Lebrun, P; Lecomte, P; Lecoq, P; Le Coultre, P; Lee, H J; Le Goff, J M; Leiste, R; Leonardi, E; Levchenko, P M; Li Chuan; Lin, C H; Lin, W T; Linde, Frank L; Lista, L; Liu, Z A; Lohmann, W; Longo, E; Lü, Y S; Lübelsmeyer, K; Luci, C; Luckey, D; Luminari, L; Lustermann, W; Ma Wen Gan; Maity, M; Majumder, G; Malgeri, L; Malinin, A; Maña, C; Mangeol, D J J; Marchesini, P A; Marian, G; Martin, J P; Marzano, F; Massaro, G G G; Mazumdar, K; McNeil, R R; Mele, S; Merola, L; Meschini, M; Metzger, W J; Von der Mey, M; Migani, D; Mihul, A; Milcent, H; Mirabelli, G; Mnich, J; Molnár, P; Monteleoni, B; Moulik, T; Muanza, G S; Muheim, F; Muijs, A J M; Nahn, S; Napolitano, M; Nessi-Tedaldi, F; Newman, H; Niessen, T; Nippe, A; Nisati, A; Nowak, H; Oh, Yu D; Organtini, G; Ostonen, R; Palomares, C; Pandoulas, D; Paoletti, S; Paolucci, P; Park, H K; Park, I H; Pascale, G; Passaleva, G; Patricelli, S; Paul, T; Pauluzzi, M; Paus, C; Pauss, Felicitas; Peach, D; Pedace, M; Pei, Y J; Pensotti, S; Perret-Gallix, D; Petersen, B; Petrak, S; Piccolo, D; Pieri, M; Piroué, P A; Pistolesi, E; Plyaskin, V; Pohl, M; Pozhidaev, V; Postema, H; Pothier, J; Produit, N; Prokofev, D; Prokofiev, D O; Quartieri, J; Rahal-Callot, G; Raja, N; Rancoita, P G; Raven, G; Razis, P A; Ren, D; Rescigno, M; Reucroft, S; Van Rhee, T; Riemann, S; Riles, K; Robohm, A; Rodin, J; Roe, B P; Romero, L; Rosier-Lees, S; Roth, S; Rubio, Juan Antonio; Ruschmeier, D; Rykaczewski, H; Sakar, S; Salicio, J; Sánchez, E; Sanders, M P; Sarakinos, M E; Schäfer, C; Shchegelskii, V; Schmidt-Kärst, S; Schmitz, D; Scholz, N; Schopper, Herwig Franz; Schotanus, D J; Schwenke, J; Schwering, G; Sciacca, C; Sciarrino, D; Servoli, L; Shevchenko, S; Shivarov, N; Shoutko, V; Shukla, J; Shumilov, E; Shvorob, A V; Siedenburg, T; Son, D; Smith, B; Spillantini, P; Steuer, M; Stickland, D P; Stone, A; Stone, H; Stoyanov, B; Strässner, A; Sudhakar, K; Sultanov, G G; Sun, L Z; Suter, H; Swain, J D; Szillási, Z; Tang, X W; Tauscher, Ludwig; Taylor, L; Timmermans, C; Ting, Samuel C C; Ting, S M; Tonwar, S C; Tóth, J; Tully, C; Tung, K L; Uchida, Y; Ulbricht, J; Valente, E; Vesztergombi, G; Vetlitskii, I; Viertel, Gert M; Villa, S; Vivargent, M; Vlachos, S; Vogel, H; Vogt, H; Vorobev, I; Vorobyov, A A; Vorvolakos, A; Wadhwa, M; Wallraff, W; Wang, J C; Wang, X L; Wang, Z M; Weber, A; Wilkens, H; Wu, S X; Wynhoff, S; Xia, L; Xu, Z Z; Yang, B Z; Yang, C G; Yang, H J; Yang, M; Ye, J B; Yeh, S C; You, J M; Zalite, A; Zalite, Yu; Zemp, P; Zeng, Y; Zhang, Z P; Zhu, G Y; Zhu, R Y; Zichichi, Antonino; Ziegler, F; Zilizi, G

    1999-01-01

    Two-photon formation of the charmonium resonance $\\chi_{{\\rm c}2}$ has been studied with the L3 detector at LEP. The $\\chi_{{\\rm c}2}$ is identified through its decay $\\chi_{{\\rm c}2} \\rightarrow \\gamma {\\rm J}$, with a subsequent decay ${\\rm J} \\rightarrow {\\mathrm{e^+ e^-}}$ or ${\\rm J} \\rightarrow {\\mathrm{\\mu^+ \\mu^-}}$. With an integrated luminosity of 140 pb$^{-1}$ at $\\sqrt{s} \\simeq$ 91~\\textrm{Ge\\kern -0.1em V} and 52 pb$^{-1}$ at $\\sqrt{s} \\simeq$ {Ge\\kern -0.1em V}, we measure the two-photon width of the $\\chi_{{\\rm c}2}$ to be \\begin{center} $\\Gamma_{\\gamma\\gamma}(\\chi_{{\\rm c}2})=1.02 \\pm 0.40 \\mbox{$\\;$(stat.)} \\pm 0.15 \\mbox{$\\;$(sys.)} \\pm 0.09(\\rm{BR.}) {\\mathrm{\\ ke\\kern -0.1em V}}$.

  13. An Assessment of Tai Chi Exercise on Cognitive Ability in Older Adults

    Directory of Open Access Journals (Sweden)

    Hung Manh NGUYEN

    2015-09-01

    Full Text Available The purpose of this study was to evaluate the effects of Tai Chi exercise on cognitive performance of community - dwelling elderly in Vinh city, Vietnam. It is a controlled trial. One hundred subjected were recruited. Subjects were divided randomly into two groups. Tai Chi group was assigned 6 - months Tai Chi training. Control group was instructed to maintain their routine daily activities. Participants in Tai Chi group reported significant improvement cognitive ability, part A with F(1, 68 = 75.36, p < .001, and in part B with F(1, 68= 172.83, p < .001 in comparison with Control group. Tai Chi is beneficial to improve cognitive performance of the elderly.

  14. The phi-meson and Chiral-mass-meson production in heavy-ion collisions as potential probes of quark-gluon-plasma and Chiral symmetry transitions

    Science.gov (United States)

    Takahashi, Y.; Eby, P. B.

    1985-01-01

    Possibilities of observing abundances of phi mesons and narrow hadronic pairs, as results of QGP and Chiral transitions, are considered for nucleus-nucleus interactions. Kinematical requirements in forming close pairs are satisfied in K+K decays of S(975) and delta (980) mesons with small phi, and phi (91020) mesons with large PT, and in pi-pi decays of familiar resonance mesons only in a partially restored chiral symmetry. Gluon-gluon dominance in QGP can enhance phi meson production. High hadronization rates of primordial resonance mesons which form narrow hadronic pairs are not implausible. Past cosmic ray evidences of anomalous phi production and narrow pair abundances are considered.

  15. On Decays of B Mesons to a Strange Meson and an η or η' Meson at Babar

    International Nuclear Information System (INIS)

    We describe studies of the decays of B mesons to final states ηK*(892), ηK*0(S-wave), ηK*2(1430), and η'K based on data collected with the BABAR detector at the PEP-II asymmetric-energy e+e- collier at the Stanford Linear Accelerator Center. We measure branching fractions and charge asymmetries for the decays B → ηK*, where K* indicates a spin 0, 1, or 2 Kπ system, making first observations of decays to final states ηK*00(S-wave), ηK*+0 (S-wave), and ηK*02(1430). We measure the time-dependent CP-violation parameters S and C for the decays B0 → η'K0, observing CP violation in a charmless B decay with 5σ significance considering both statistical and systematic uncertainties..

  16. Investigation of Semileptonic B Meson Decays to p -Wave Charm Mesons

    International Nuclear Information System (INIS)

    We have studied semileptonic B meson decays with a p -wave charm meson in the final state using 3.29x106 BB events collected with the CLEOII detector at the Cornell Electron-Positron Storage Ring. We find a value for the exclusive semileptonic product branching fraction B(B-→D01 ell -νell) B(D01→D*+ π-)=(0.373±0.085± 0.052±0.024)% and an upper limit for B(B-→D*02 ell -νell) B(D*02→D*+ π-)2 spectrum for B-→D01 ell - νell . copyright 1998 The American Physical Society

  17. Interaction of eta mesons with nuclei

    Science.gov (United States)

    Kelkar, N. G.; Khemchandani, K. P.; Upadhyay, N. J.; Jain, B. K.

    2013-06-01

    Back in the mid-1980s, a new branch of investigation related to the interaction of eta mesons with nuclei came into existence. It started with the theoretical prediction of possible exotic states of eta mesons and nuclei bound by the strong interaction and later developed into an extensive experimental program to search for such unstable states as well as understand the underlying interaction via eta-meson producing reactions. The vast literature of experimental as well as theoretical works that studied various aspects of eta-producing reactions such as the π+n → ηp, pd → 3Heη, p 6Li → 7Be η and γ 3He → η X, to name a few, had but one objective in mind: to understand the eta-nucleon (ηN) and hence the η-nucleus interaction which could explain the production data and confirm the existence of some η-mesic nuclei. In spite of these efforts, there remain uncertainties in the knowledge of the ηN and hence the η-nucleus interaction. Therefore, this review is an attempt to bind together the findings in these works and draw some global and specific conclusions which can be useful for future explorations. The ηN scattering length (which represents the strength of the η-nucleon interaction) using different theoretical models and analyzing the data on η production in pion, photon and proton induced reactions was found to be spread out in a wide range, namely, 0.18 ⩽ ℜe aηN ⩽ 1.03 fm and 0.16 ⩽ ℑm aηN ⩽ 0.49 fm. Theoretical searches of heavy η-mesic nuclei based on η-nucleus optical potentials and lighter ones based on Faddeev type few-body approaches predict the existence of several quasibound and resonant states. Although some hints of η-mesic states such as ^3_{\\eta} He and ^{25}_{\\eta} Mg do exist from previous experiments, the promise of clearer signals for the existence of η-mesic nuclei lies in the experiments to be performed at the J-PARC, MAMI and COSY facilities in the near future. This review is aimed at giving an overall

  18. A calculation of the physical mass of sigma meson

    Indian Academy of Sciences (India)

    J R Morones-Ibarra; Ayax Santos-Guevara

    2007-06-01

    We calculate the physical mass and the width of the sigma meson by considering that it couples in vacuum to two virtual pions. The mass is calculated by using the spectral function, and we find that it is about 600 MeV. In addition, we obtained 220 MeV as the value for the width of its spectral function. The value obtained for the mass is in good agreement with that reported in the Particle Data Book for the σ-meson, which is also named 0(600). This result also shows that -meson can be considered as a two-pion resonance.

  19. The {eta}' meson from lattice QCD

    Energy Technology Data Exchange (ETDEWEB)

    Jansen, K. [Deutsches Elektronen-Synchrotron (DESY), Zeuthen (Germany); Michael, C. [Liverpool Univ. (United Kingdom). Theoretical Physics Div.; Urbach, C. [Humboldt Univ. Berlin (Germany). Inst. fuer Elementarteilchenphysik

    2008-04-15

    We study the flavour singlet pseudoscalar mesons from first principles using lattice QCD. With N{sub f}=2 flavours of light quark, this is the so-called {eta}{sub 2} meson and we discuss the phenomenological status of this. Using maximally twisted-mass lattice QCD, we extract the mass of the {eta}{sub 2} meson at two values of the lattice spacing for lighter quarks than previously discussed in the literature. We are able to estimate the mass value in the limit of light quarks with their physical masses. (orig.)

  20. K meson leptonic decays progress in nuclear physics

    CERN Document Server

    Bailey, J; Jones, P B; Brink, D M; Mulvey, J H

    2013-01-01

    Progress in Nuclear Physics, Volume 12, Part 1: K Meson Leptonic Decay: The Anomalous Magnetic Moment of the Muon and Related Topics focuses on K Meson leptonic decay. The volume first discusses K Meson leptonic decay, including weak hadronic current, polarization of the muon, form of coupling, rate of partial decay, and density function of the Dalitz plot. The text then takes a look at the anomalous magnetic moment of the muon and other topics. The theory of the anomalous magnetic moment of electrons and muon and clock paradox, including muon and special relativity and lifetime of the muon in

  1. Latest results from meson photoproduction at ELSA and MAMI

    Directory of Open Access Journals (Sweden)

    Krusche B.

    2014-06-01

    Full Text Available Photoproduction of mesons plays a key role for the investigation of the excitation spectrum of the nucleon and thus for our understanding of the strong interaction in the non-perturbative regime. In this contribution we discuss recent results from the experiments at the tagged photon beams of the electron accelerators ELSA in Bonn and MAMI in Mainz. They include the measurement of cross sections and (double polarization observables for single meson production and production of meson pairs off free protons as well as of quasi-free nucleons bound in light nuclei (in particular the deuteron.

  2. Measuring Polarized Gluon and Quark Distributions with Meson Photoproduction

    CERN Document Server

    Afanasiev, A M; Wahlquist, C; Afanasev, Andrei; Carlson, Carl E.; Wahlquist, Christian

    1998-01-01

    We calculate polarization asymmetries in photoproduction of high transverse momentum mesons, focusing on charged pions, considering the direct, fragmentation, and resolved photon processes. The results at very high meson momentum measure the polarized quark distributions and are sensitive to differences among the existing models. The results at moderate meson momentum are sensitive to the polarized gluon distribution and can provide a good way to measure it. Suitable data may come as a by-product of deep inelastic experiments to measure $g_1$ or from dedicated experiments.

  3. Calculation of the D and B meson lifetimes

    International Nuclear Information System (INIS)

    Using the expansions of the heavy meson decay widths in the heavy quark mass and QCD sum rules for estimates of corresponding matrix elements the D±,O,S decay widths and the B±,O,S lifetime differences are calculated. The results for D mesons are in agreement with the data, while it is predicted that [Γ(BO)-Γ(B-)]/ΓB≅4%, and the lifetime difference of the BO and BS mesons is even smaller. The role of the weak annihilation and Pauli interference contributions to the lifetime differences are described in detail. 55 refs.; 10 figs

  4. Proposal of the meson theory by Hideki Yukawa

    International Nuclear Information System (INIS)

    In 1935 Hideki Yukawa courageously proposed a new field theory of the nuclear forces and predicted the existence of the meson, a particle responsible for the strong interaction. This was during a period when new particles were not welcomed in the domain of physics. Later, the meson theory greatly promoted the advancement of nuclear physics. The theory was verified after the π-meson was discovered in cosmic rays by C.P.Powell, a British physicist. Yukawa was awarded the Nobel Prize in 1949 for his contribution to physics

  5. Electroproduction of Roper Resonance in a Meson Cloud Model

    Institute of Scientific and Technical Information of China (English)

    CHEN Dian-Yong; DONG Yu-Bing

    2008-01-01

    The Q2 dependencies of Roper resonance (N* (1440)) helicity amplitudes have been discussed based on two assumptions:(I) the Roper resonance is an excitation of one of the three quarks,and (ii) the quarks are surrounded by a pion-meson cloud.Our study shows that the mixing of the ground state in the Roper wavefunction caused by the pion meson cloud together with the pion meson cloud itself is crucial for the predictions of the photoproduction amplitudes of the Roper resonance.It is found that our model can give a good description for the helicity amplitudes of the Roper resonance comparing with the experimental measurement.

  6. Calculation of the D and B Meson Lifetimes

    OpenAIRE

    Chernyak, Victor

    1994-01-01

    Using the expansions of the heavy meson decay widths in the heavy quark mass and QCD sum rules for estimates of corresponding matrix elements,\\, we calculate the $D^{\\pm,o,s}$ decay widths and the $B^{\\pm,o,s}$ lifetime differences. The results for D mesons are in agreement with the data,\\, while it is predicted that $[\\Gamma (B^o)-\\Gamma (B^-)]/\\Gamma_B\\se 4\\%\\,,$ and the lifetime difference of the $B^o$ and $B_s$ mesons is even smaller. The role of the weak annihilation and Pauli interferen...

  7. Transversity in hard exclusive electroproduction of pseudoscalar mesons

    International Nuclear Information System (INIS)

    Estimates for electroproduction of pseudoscalar mesons at small values of skewness are presented. Cross-sections and asymmetries for these processes are calculated within the handbag approach which is based on factorization in hard parton subprocesses and soft generalized parton distributions (GPDs). The latter are constructed from double distributions. Transversity GPDs are taken into account; they are accompanied by twist-3 meson wave functions. For most pseudoscalar-meson channels a combination of HT and anti ET plays a particularly prominent role. This combination of GPDs, which we constrain by moments obtained from lattice QCD, leads, with the exception of the π+ and η' channels, to large transverse cross-sections. (orig.)

  8. Measuring polarized gluon and quark distributions with meson photoproduction

    International Nuclear Information System (INIS)

    The authors calculate polarization asymmetries in photoproduction of high transverse momentum mesons, focusing on charged pions, considering the direct, fragmentation, and resolved photon processes. The results at very high meson momentum measure the polarized quark distributions and are sensitive to differences among the existing models. The results at moderate meson momentum are sensitive to the polarized gluon distribution and can provide a good way to measure it. Suitable data may come as a by-product of deep inelastic experiments to measure g1 or from dedicated experiments

  9. Quantum correlations in B and K meson systems

    CERN Document Server

    Banerjee, Subhashish; MacKenzie, Richard

    2014-01-01

    We study quantum correlations in meson-antimeson systems, as provided for example in meson factories used mainly to probe physics beyond the Standard Model of particle physics. We use a semigroup formalism to compute a trace-preserving density matrix for these systems, in spite of the fact that the particles are unstable. This is used to compute the time evolution of several measures of quantum correlations for three meson systems (KKbar, BdBdbar and BsBsbar). We find that the quantum correlations for these systems can be non-trivially different from their stable counterparts.

  10. Cross sections for inelastic meson-meson scattering via quark-antiquark annihilation

    Science.gov (United States)

    Shen, Zhen-Yu; Xu, Xiao-Ming; Weber, H. J.

    2016-08-01

    We study inelastic meson-meson scattering that is governed by quark-antiquark annihilation and creation involving a quark and an antiquark annihilating into a gluon, and subsequently the gluon creating another quark-antiquark pair. The resultant hadronic reactions include for I =1 : π π →ρ ρ , K K ¯→K*K¯*, K K¯*→K*K¯*, K*K ¯→K*K¯*, as well as π π →K K ¯, π ρ →K K¯*, π ρ →K*K ¯, and K K ¯→ρ ρ . In each reaction, one or two Feynman diagrams are involved in the Born approximation. We derive formulas for the unpolarized cross section, the transition amplitude, and the transition potential for quark-antiquark annihilation and creation. The unpolarized cross sections for the reactions are calculated at six temperatures, and prominent temperature dependence is found. It is due to differences among mesonic temperature dependence in hadronic matter.

  11. Temperature dependence of cross sections for meson-meson nonresonant reactions in hadronic matter

    CERN Document Server

    Shen, Zhen-Yu

    2014-01-01

    We study unpolarized cross sections for the endothermic nonresonant reactions: pion pion to rho rho for I=2, KK to K*K* for I=1, KK* to K*K* for I=1, pion K to rho K* for I=3/2, pion K* to rho K* for I=3/2, rho K to rho K* for I=3/2, and pion K* to rho K for I=3/2, which take place in hadronic matter. We provide a potential that is given by perturbative QCD with loop corrections at short distances, becomes a distance-independent and temperature-dependent value at long distances, and has a spin-spin interaction with relativistic modifications. The Schrodinger equation with the potential yields temperature-dependent meson masses and mesonic quark-antiquark relative-motion wave functions. In the first Born approximation with the quark-interchange mechanism, the temperature dependence of the potential, meson masses and wave functions brings about temperature dependence of unpolarized cross sections for the seven nonresonant reactions. Noticeably, rapid changes of pion and K radii cause an increase in peak cross s...

  12. Observation of charmless B meson decays

    International Nuclear Information System (INIS)

    Using the ARGUS detector at the e+e- storage ring DORIS II, we have observed charmless decays of B mesons into the final states panti pπ± and panti pπ+π-. The significance of the signal corresponds to more than five standard deviations. The branching ratios are (5.2±1.4±1.9)x10-4 for the three-body and (6.0±2.0±2.2)x10-4 for the four-body final state. These decays cannot proceed via the dominant b→c transitions, and we show that they are not the result of penguin-type processes. Thus, the observed decays must represent b→u quark transitions. Consequently, the Kobayashi-Maskawa matrix element Vub is non-zero. (orig.)

  13. Study of inclusive semileptonic B meson decays

    International Nuclear Information System (INIS)

    Using the ARGUS detector at the e+e- storage ring DORIS-II, we have measured the inclusive semileptonic decays of B-mesons into electrons and muons. The data originate from 220.5 events/pb on the Υ(4S) resonance. We find BR(B→e+veX)=(10.3±0.6±0.2)% and BR(B→μ+vμX)=(10.0±0.6±0.2)% using the model of Altarelli et al. for extrapolating over all lepton momenta, and BR(B→e+vceX)=(9.9±0.6)%, BR(B→μ+vμX)=(9.7±0.6)% using the model of Grinstein et al. For semileptonic decays into baryons, we obtain an upper limit of BR(B→anti pe+vX)<0.16%(90%CL). (orig.)

  14. Model discrimination in pseudoscalar-meson photoproduction

    CERN Document Server

    Nys, J; Ireland, D G; Glazier, D I

    2016-01-01

    To learn about a physical system of interest, experimental results must be able to discriminate among models. We introduce a geometrical measure to quantify the distance between models for pseudoscalar-meson photoproduction in amplitude space. Experimental observables, with finite accuracy, map to probability distributions in amplitude space, and the characteristic width scale of such distributions needs to be smaller than the distance between models if the observable data are going to be useful. We therefore also introduce a method for evaluating probability distributions in amplitude space that arise as a result of one or more measurements, and show how one can use this to determine what further measurements are going to be necessary to be able to discriminate among models.

  15. Delta, iota and other meson spectroscopies

    International Nuclear Information System (INIS)

    This talk is given from the point of view of an experimentalist. Meson spectroscopy in the 1 to 3 GeV region is interesting because experiments exploring this region, in particular radiative psi decay, have found a rich structure of resonances too complicated to unravel with any one experiment, and not easily interpreted with any one theoretical model. None of the theoretical calculations predicting all kinds of interesting and exotic objects in this region is very convincing or reliable. Additional input from anti pp annihilation can be very useful in helping to find the answers to the following open questions: what exactly is this spectrum, what are the masses and quantum numbers of the resonances, as determined from analysis of data without theoretical prejudices; how is this spectrum described by QCD, is there evidence for new kinds of states like glue-balls, hybrids, axions, Higgses or multiquark exotics, and is there any evidence for new physics beyond QCD. 20 refs

  16. Nonleptonic weak decays of charmed mesons

    Science.gov (United States)

    Buccella, F.; Lusignoli, M.; Miele, G.; Pugliese, A.; Santorelli, P.

    1995-04-01

    A previous analysis of two-body Cabibbo-allowed nonleptonic decays of D0 mesons and of Cabibbo-allowed and first-forbidden decays of D+ and D+s has been adjourned using more recent experimental data and extended to the Cabibbo-forbidden decays of D0. Annihilation and W-exchange contributions as well as final state interaction effects (assumed to be dominated by nearby resonances) have been included and are in fact crucial to obtain a reasonable agreement with the experimental data, which show large flavor SU(3) violations. New fitting parameters are necessary to describe rescattering effects for Cabibbo-forbidden D0 decays, given the lack of experimental information on isoscalar resonances. We keep their number to a minimum, three, using phenomenologically based considerations. We also discuss CP-violating asymmetries.

  17. Nonleptonic weak decays of charmed mesons

    CERN Document Server

    Buccella, F; Miele, G; Pugliese, A; Santorelli, P; Buccella, F; Lusignoli, M; Miele, G; Pugliese, A; Santorelli, P

    1995-01-01

    A previous analysis of two-body Cabibbo allowed nonleptonic decays of D^0 mesons and of Cabibbo allowed and first-forbidden decays of D^+ and D_s^+ has been adjourned using more recent experimental data and extended to the Cabibbo forbidden decays of D^0. Annihilation and W-exchange contributions as well as final state interaction effects (assumed to be dominated by nearby resonances) have been included and are in fact crucial to obtain a reasonable agreement with the experimental data, which show large flavour SU(3) violations. New fitting parameters are necessary to describe rescattering effects for Cabibbo forbidden D^0 decays, given the lack of experimental informations on isoscalar resonances. We keep their number to a minimum - three - using phenomenologically based considerations. We also discuss CP violating asymmetries.

  18. Nonleptonic weak decays of charmed mesons

    International Nuclear Information System (INIS)

    A previous analysis of two-body Cabibbo-allowed nonleptonic decays of D0 mesons and of Cabibbo-allowed and first-forbidden decays of D+ and Ds+ has been adjourned using more recent experimental data and extended to the Cabibbo-forbidden decays of D0. Annihilation and W-exchange contributions as well as final state interaction effects (assumed to be dominated by nearby resonances) have been included and are in fact crucial to obtain a reasonable agreement with the experimental data, which show large flavor SU(3) violations. New fitting parameters are necessary to describe rescattering effects for Cabibbo-forbidden D0 decays, given the lack of experimental information on isoscalar resonances. We keep their number to a minimum, three, using phenomenologically based considerations. We also discuss CP-violating asymmetries

  19. Form factors of heavy mesons in QCD

    International Nuclear Information System (INIS)

    Logarithmic corrections to form factors of mesons built from heavy quarks are dirived in the framework of quantum chromodynamics. The reactions e+e- → etasub(c)γ and H → J/PSIγ are considered as an example. A novel feature as compared to the well studied problem of the pion form factor is the existence of the transformations between the quark-antiquark state c anti c and the gluonic one. O(αsub(s)) corrections are calculated exactly. An infinite series of the leading logarithmic terms is summed up with the help of the operator technique. Apart from already known results for quark operators some new results referring to gluon operators and their mixing with the quark ones are used. Two alternative derivations of the multiplicatively renormalizable operators are given. The first one reduces to a direct computation of the mixing matrix and its diagonalization, the second derivation is based on conformal symmetry considerations

  20. Radiative meson decays in chiral perturbation theory

    International Nuclear Information System (INIS)

    Radiative meson decays are a fertile field for chiral perturbation theory. Chiral symmetry together with gauge invariance yield stringent constraints on radiative decay amplitudes. In addition to predicting decay rates and spectra, the chiral approach allows for a unified description of CP violation in radiative K decays. The chiral viewpoint in the recent controversy over the magnitude of two-photon exchange in the decay KL→ π0e+e- is exposed. The radiative decay η→π0γγ is discussed as an intriguing case where the leading result of chiral perturbation theory seems to be too small by two orders of magnitude in rate. 32 refs., 3 figs. (Author)

  1. Open charm meson production at LHC*

    Directory of Open Access Journals (Sweden)

    Luszczak Marta

    2012-12-01

    Full Text Available We discuss charm production at the LHC. The production of single cc¯$car c$ pairs is calculated in the kt-factorization approach. We use Kimber-Martin-Ryskin unintegrated gluon distributions in the proton. The hadronization is included with the help of Peterson fragmentation functions. Transverse momentum and pseudorapidity distributions of charmed mesons are presented and compared to recent results of the ALICE, LHCb and ATLAS collaborations. Furthermore we discuss production of two pairs of cc¯ $car c$ within a simple formalism of double-parton scattering (DPS. Surprisingly large cross sections, comparable to single-parton scattering (SPS, are predicted for LHC energies. We discuss perspectives how to identify the double scattering contribution. We predict much larger cross section for large rapidity distance between charm quarks from different hard parton scatterings compared to single scattering.

  2. Scaling Phenomenology in Meson Photoproduction from CLAS

    International Nuclear Information System (INIS)

    In the high energy limit, perturbative QCD predicts that hard scattering amplitudes should follow simple scaling laws. For hard scattering at 90o, we show that experiments support this prediction even in the 'medium energy' regime of 2.3 GeV (le) √s (le) 2.84 GeV, as long as there are no s-channel resonances present. Our data consists of high statistics measurements for five different exclusive meson photoproduction channels (pω, pη, pη(prime), K+Λ and K+(summation)0) recently obtained from CLAS at Jefferson Lab. The same power-law scaling also leads to 'saturated' Regge trajectories at high energies. That is, at large -t and -u, Regge trajectories must approach constant negative integers. We demonstrate the application of saturated Regge phenomenology by performing a partial wave analysis fit to the γyp → pη(prime) differential cross sections.

  3. Meson-proton scattering at high energies

    International Nuclear Information System (INIS)

    We use a model in which the energy dependence of hadronic scattering is driven at high energies primarily by semihard scattering of constituent gluons and quarks to calculate the elastic differential and total cross sections for πp and Kp scattering. Our model predicts that, as a direct consequence of the dominance of gluon and sea-quark interactions at small x, the total cross sections for all the meson-proton processes should approach equality in the TeV energy regime. The cross sections are strikingly large for energies in the upper range of cosmic-ray energies, and the expected evolution of hadronic air showers may be changed as a result

  4. B mesons phenomenology and lattice QCD

    International Nuclear Information System (INIS)

    We have studied some phenomenological aspects of the B meson physics by using lattice QCD, which is a non perturbative method (based on the first principles of Quantum Field Theory) of computing Green functions of the theory. Pionic couplings g1 and g2, parameterizing the effective chiral Lagrangian which describes interactions between heavy-light mesons and soft pions, have been computed beyond the quenched approximation (at Nf = 2). We have renormalized the operator q-barγμγ5q non perturbatively by using chiral Ward identities. We obtain g1 = 0.4/0.6 and g2 = -0.1/-0.3. We have estimated from an un-quenched simulation (at Nf = 2) the strange quark mass: the non perturbative renormalisation scheme RI-MOM has been applied. After the matching in the MS scheme the result is ms(2 GeV) = 101 ± 8(-0,+25) MeV. We have proposed a method to calculate on the lattice the Heavy Quark Effective Theory form factors of the semileptonic transitions B → D** at zero recoil. The renormalisation constant of the operator h-barγiγ5Djh has been computed at one-loop order of the perturbation theory. We obtain τ1/2(1) = 0.3/0.5 and τ3/2(1) 0.5/0.7. Eventually the bag parameter BBs associated the Bs - Bs-bar mixing amplitude in the Standard Model has been estimated in the quenched approximation by using for the strange quark an action which verifies the chiral symmetry at finite lattice spacing a. Thus systematic errors are significantly reduced in the renormalisation procedure because the spurious mixing of the four-fermion operator h-barγμLqh-barγμLq with four-fermion operators of different chirality is absent. The result is BBs = 0.92(3). (author)

  5. Production of charmed mesons in Z decays

    Science.gov (United States)

    Buskulic, D.; de Bonis, I.; Decamp, D.; Ghez, P.; Goy, C.; Lees, J.-P.; Minard, M.-N.; Pietrzyk, B.; Ariztizabal, F.; Comas, P.; Crespo, J. M.; Efthymiopoulos, I.; Fernandez, E.; Fernandez-Bosman, M.; Gaitan, V.; Garrido, Ll.; Mattison, T.; Orteu, S.; Pacheco, A.; Padilla, C.; Pascual, A.; Creanza, D.; de Palma, M.; Farilla, A.; Iaselli, G.; Maggi, G.; Marinelli, N.; Natali, S.; Nuzzo, S.; Ranieri, A.; Raso, G.; Romano, F.; Ruggieri, F.; Selvaggi, G.; Silvestris, L.; Tempesta, P.; Zito, G.; Chai, Y.; Hu, H.; Huang, D.; Huang, X.; Lin, J.; Wang, T.; Xie, Y.; Xu, D.; Xu, R.; Zhang, J.; Zhang, L.; Zhao, W.; Bonvicini, G.; Boudreau, J.; Casper, D.; Drevermann, H.; Forty, R. W.; Ganis, G.; Gay, C.; Girone, M.; Hagelberg, R.; Harvey, J.; Hilgart, J.; Jacobsen, R.; Jost, B.; Knobloch, J.; Lehraus, I.; Maggi, M.; Markou, C.; Martinez, M.; Mato, P.; Meinhard, H.; Minten, A.; Miquel, R.; Moser, H.-G.; Palazzi, P.; Pater, J. R.; Perlas, J. A.; Perrodo, P.; Pusztaszeri, J.-F.; Ranjard, F.; Rolandi, L.; Rothberg, J.; Ruan, T.; Saich, M.; Schlatter, D.; Schmelling, M.; Sefkow, F.; Tejessy, W.; Tomalin, I. R.; Veenhof, R.; Wachsmuth, H.; Wasserbaech, S.; Wiedemann, W.; Wildish, T.; Witzeling, W.; Wotschack, J.; Ajaltouni, Z.; Bardadin-Otwinowska, M.; Barres, A.; Boyer, C.; Falvard, A.; Gay, P.; Guicheney, C.; Henrard, P.; Jousset, J.; Michel, B.; Montret, J.-C.; Pallin, D.; Perret, P.; Podlyski, F.; Proriol, J.; Saadi, F.; Fearnley, T.; Hansen, J. B.; Hansen, J. D.; Hansen, J. R.; Hansen, P. H.; Johnson, S. D.; Møllerud, R.; Nilsson, B. S.; Kyriakis, A.; Simopoulou, E.; Siotis, I.; Vayaki, A.; Zachariadou, K.; Badier, J.; Blondel, A.; Bonneaud, G.; Brient, J. C.; Bourdon, B.; Fouque, G.; Passalacqua, L.; Rougé, A.; Rumpf, M.; Tanaka, R.; Verderi, M.; Videau, H.; Candlin, D. J.; Parsons, M. I.; Veitch, E.; Focardi, E.; Moneta, L.; Parrini, G.; Corden, M.; Delfino, M.; Georgiopoulos, C.; Ikeda, M.; Jaffe, D. E.; Levinthal, D.; Antonelli, A.; Bencivenni, G.; Bologna, G.; Bossi, F.; Campana, P.; Capon, G.; Cerutti, F.; Chiarella, V.; Felici, G.; Laurelli, P.; Mannocchi, G.; Murtas, F.; Murtas, G. P.; Pepe=Altarelli, M.; Salomone, S.; Colrain, P.; Ten Have, I.; Lynch, J. G.; Maitland, W.; Morton, W. T.; Raine, C.; Reeves, P.; Scarr, J. M.; Smith, K.; Smith, M. G.; Thompson, A. S.; Thorn, S.; Turnbull, R. M.; Brandl, B.; Braun, O.; Geweniger, C.; Graefe, G.; Hanke, P.; Hepp, V.; Karger, C.; Kluge, E. E.; Maumary, Y.; Putzer, A.; Rensch, B.; Stahl, A.; Tittel, K.; Wunsch, M.; Beuselinck, M.; Binnie, D. M.; Cameron, W.; Cattaneo, M.; Colling, D. J.; Dornan, P. J.; Hassard, J. F.; Lieske, N. M.; Moutoussi, A.; Nash, J.; Patton, S.; Payne, D. G.; Phillips, M. J.; San Martin, G.; Sedgbeer, J. K.; Wright, A. G.; Girtler, P.; Kuhn, D.; Rudolph, G.; Vogl, R.; Bowdery, C. K.; Brodbeck, T. J.; Finch, A. J.; Foster, F.; Hughes, G.; Jackson, D.; Keemer, N. R.; Nuttal, M.; Patel, A.; Sloan, T.; Snow, S. W.; Whelan, E. P.; Galla, A.; Greene, A. M.; Kleinknecht, K.; Raab, J.; Renk, B.; Sander, H.-G.; Schmidt, H.; Walther, S. M.; Wanke, R.; Wolf, B.; Bencheikh, A. M.; Benchouk, C.; Bonissent, A.; Calvet, D.; Carr, J.; Coyle, P.; Diaconu, C.; Drinkard, J.; Etienne, F.; Nicod, D.; Payre, P.; Roos, L.; Rousseau, D.; Schwemling, P.; Talby, M.; Adlung, S.; Assmann, R.; Bauer, C.; Blum, W.; Brown, D.; Cattaneo, P.; Dehning, B.; Dietl, H.; Dydak, F.; Frank, M.; Halley, A. W.; Jakobs, K.; Lauber, J.; Lütjens, G.; Lutz, G.; Männer, G.; Richter, R.; Schröder, J.; Schwarz, A. S.; Settles, R.; Seywerd, H.; Stierlin, H.; Stiegler, U.; Denis, R. St.; Wolf, G.; Alemany, R.; Boucrot, J.; Callot, O.; Cordier, A.; Davier, M.; Duflot, L.; Grivaz, J.-F.; Heusse, Ph.; Janot, P.; Kim, D. W.; Le Diberder, F.; Lefrançois, J.; Lutz, A.-M.; Musolino, G.; Schune, M.-H.; Veillet, J.-J.; Videau, I.; Abbaneo, D.; Bagliesi, G.; Batignani, G.; Bottigli, U.; Bozzi, C.; Calderini, G.; Carpinelli, M.; Ciocci, M. A.; Ciulli, V.; Dell'Orso, R.; Ferrante, I.; Fidecaro, F.; Foà, L.; Forti, F.; Giassi, A.; Giorgi, M. A.; Gregorio, A.; Ligabue, F.; Luisiani, A.; Mannelli, E. B.; Marrocchesi, P. S.; Messineo, A.; Palla, F.; Rizzo, G.; Sanguinetti, G.; Spagnolo, P.; Steinberger, J.; Tenchini, R.; Tonelli, G.; Triggiani, G.; Valassi, A.; Vannini, C.; Venturi, A.; Verdini, P. G.; Walsh, J.; Betteridge, A. P.; Gao, Y.; Green, M. G.; Johnson, D. L.; March, P. V.; Medcalf, T.; Mir, Ll. M.; Quazi, I. S.; Strong, J. A.; Bertin, V.; Botterill, D. R.; Clifft, R. W.; Edgecock, T. R.; Haywood, S.; Edwards, M.; Norton, P. R.; Thompson, J. C.; Bloch-Devaux, B.; Colas, P.; Duarte, H.; Emery, S.; Kozanecki, W.; Lançon, E.; Lemaire, M. C.; Locci, E.; Marx, B.; Perez, P.; Rander, J.; Renardy, J.-F.; Rosowsky, A.; Roussarie, A.; Schuller, J.-P.; Schwindling, J.; Si Mohand, D.; Vallage, B.; Johnson, R. P.; Litke, A. M.; Taylor, G.; Wear, J.; Babbage, W.; Booth, C. N.; Buttar, C.; Cartwright, S.; Combley, F.; Dawson, I.; Thompson, L. F.; Barberio, E.; Böhrer, A.; Brandt, S.; Cowan, G.; Grupen, C.; Lutters, G.; Rivera, F.; Schäfer, U.; Smolik, L.; Bosisio, L.; Della Marina, R.; Giannini, G.; Bobbo, B.; Pitis, L.; Ragusa, F.; Bellantoni, L.; Chen, W.; Conway, J. S.; Feng, Z.; Ferguson, D. P. S.; Gao, Y. S.; Grahl, J.; Harton, J. L.; Hayes, O. J.; Nachtman, J. M.; Pan, Y. B.; Saadi, Y.; Schmitt, M.; Scott, I.; Sharma, V.; Shi, Z. H.; Turk, J. D.; Walsh, A. M.; Weber, F. V.; Wu, Sau Lan; Wu, X.; Zheng, M.; Zobernig, G.

    1994-03-01

    The production of charmed mesonsmathop {D^0 }limits^{( - )} , D ± , and D *± is studied in a sample of 478,000 hadronic Z decays. The production rates are measured to be 10052_2005_Article_BF01559519_TeX2GIFE1.gif begin{gathered} {Γ (Z to D^{* ± } X)}/{Γ _{had }} = 0.187 ± 0.015(exp .) ± 0.013(BR), \\ {Γ (Z to D^ ± X)}/{Γ _{had }} = 0.251 ± 0.026(exp .) ± 0.025(BR), \\ {Γ (Z to mathop {D^0 }limits^{( - )} X)}/{Γ _{had }} = 0.518 ± 0.052(exp .) ± 0.035(BR), \\ where the errors from this analysis are separated from those coming from the D branching ratios (BR). The D *± momentum distribution is extracted separately forZ to cbar c andZ to bbar b events with the help of event shape variables. It is consistent with the prediction of the JETSET Monte Carlo program after adjustment of the charm fragmentation function. Constraining the shape of theZ to bbar b contribution, the average fraction of the beam energy taken by a D * meson produced in the fragmentation of a charm quark is extracted by a parametric fit to be c =0.495±0.011±0.007. Evidence for D **0 ( D 1(2420)0 and/or D {2/*}(2460)0) production is found in theD^{* ± } π ^ mp channel, accounting for a fraction (18±5±2)% of all D *± production. The relative production of vector and pseudoscalar mesons is dicussed, together with the possible effects of D ** production. The c-quark forward-backward Z-pole asymmetry is detrmined from that of high momentum D *± to be A {/FB 0,c }=(7.7±4.4)%.

  6. Tai chi training reduces self-report of inattention in healthy young adults.

    Science.gov (United States)

    Converse, Alexander K; Ahlers, Elizabeth O; Travers, Brittany G; Davidson, Richard J

    2014-01-01

    It is important to identify effective non-pharmacological alternatives to stimulant medications that reduce symptoms of attention deficit hyperactivity disorder (ADHD). In this study of healthy young adults, we measured the effects of training in tai chi, which involves mindful attention to the body during movement. Using a non-randomized, controlled, parallel design, students in a 15-week introductory tai chi course (n = 28) and control participants (n = 44) were tested for ADHD indicators and cognitive function at three points over the course of the 15-weeks. The tai chi students' self-report of attention, but not hyperactivity-impulsivity, improved compared to controls. At baseline, inattention correlated positively with reaction time variability in an affective go/no-go task across all participants, and improvements in attention correlated with reductions in reaction time variability across the tai chi students. Affective bias changed in the tai chi students, as reaction times to positive- and negative-valenced words equalized over time. These results converge to suggest that tai chi training may help improve attention in healthy young adults. Further studies are needed to confirm these results and to evaluate tai chi as therapy for individuals with ADHD. PMID:24478679

  7. Tai chi training reduces self-report of inattention in healthy young adults

    Directory of Open Access Journals (Sweden)

    Alexander K. Converse

    2014-01-01

    Full Text Available It is important to identify effective non-pharmacological alternatives to stimulant medications that reduce symptoms of attention deficit hyperactivity disorder (ADHD. In this study of healthy young adults, we measured the effects of training in tai chi, which involves mindful attention to the body during movement. Using a non-randomized, controlled, parallel design, students in a 15-week introductory tai chi course (n=28 and control participants (n=44 were tested for ADHD indicators and cognitive function at three points over the course of the 15 weeks. The tai chi students' self-report of attention, but not hyperactivity-impulsivity, improved compared to controls. At baseline, inattention correlated positively with reaction time variability in an affective go/no-go task across all participants, and improvements in attention correlated with reductions in reaction time variability across the tai chi students. Affective bias changed in the tai chi students, as reaction times to positive- and negative-valenced words equalized over time. These results converge to suggest that tai chi training may help improve attention in healthy young adults. Further studies are needed to confirm these results and to evaluate tai chi as therapy for individuals with ADHD.

  8. Measurement of the relative prompt production rate of $\\chi_{c2}$ and $\\chi_{c1}$ in pp collisions at $\\sqrt{s}$ = 7 TeV

    CERN Document Server

    Chatrchyan, Serguei; Sirunyan, Albert M; Tumasyan, Armen; Adam, Wolfgang; Aguilo, Ernest; Bergauer, Thomas; Dragicevic, Marko; Erö, Janos; Fabjan, Christian; Friedl, Markus; Fruehwirth, Rudolf; Ghete, Vasile Mihai; Hammer, Josef; Hörmann, Natascha; Hrubec, Josef; Jeitler, Manfred; Kiesenhofer, Wolfgang; Knünz, Valentin; Krammer, Manfred; Krätschmer, Ilse; Liko, Dietrich; Mikulec, Ivan; Pernicka, Manfred; Rahbaran, Babak; Rohringer, Christine; Rohringer, Herbert; Schöfbeck, Robert; Strauss, Josef; Taurok, Anton; Waltenberger, Wolfgang; Walzel, Gerhard; Widl, Edmund; Wulz, Claudia-Elisabeth; Mossolov, Vladimir; Shumeiko, Nikolai; Suarez Gonzalez, Juan; Bansal, Monika; Bansal, Sunil; Cornelis, Tom; De Wolf, Eddi A; Janssen, Xavier; Luyckx, Sten; Mucibello, Luca; Ochesanu, Silvia; Roland, Benoit; Rougny, Romain; Selvaggi, Michele; Staykova, Zlatka; Van Haevermaet, Hans; Van Mechelen, Pierre; Van Remortel, Nick; Van Spilbeeck, Alex; Blekman, Freya; Blyweert, Stijn; D'Hondt, Jorgen; Gonzalez Suarez, Rebeca; Kalogeropoulos, Alexis; Maes, Michael; Olbrechts, Annik; Van Doninck, Walter; Van Mulders, Petra; Van Onsem, Gerrit Patrick; Villella, Ilaria; Clerbaux, Barbara; De Lentdecker, Gilles; Dero, Vincent; Gay, Arnaud; Hreus, Tomas; Léonard, Alexandre; Marage, Pierre Edouard; Mohammadi, Abdollah; Reis, Thomas; Thomas, Laurent; Vander Marcken, Gil; Vander Velde, Catherine; Vanlaer, Pascal; Wang, Jian; Adler, Volker; Beernaert, Kelly; Cimmino, Anna; Costantini, Silvia; Garcia, Guillaume; Grunewald, Martin; Klein, Benjamin; Lellouch, Jérémie; Marinov, Andrey; Mccartin, Joseph; Ocampo Rios, Alberto Andres; Ryckbosch, Dirk; Strobbe, Nadja; Thyssen, Filip; Tytgat, Michael; Verwilligen, Piet; Walsh, Sinead; Yazgan, Efe; Zaganidis, Nicolas; Basegmez, Suzan; Bruno, Giacomo; Castello, Roberto; Ceard, Ludivine; Delaere, Christophe; Du Pree, Tristan; Favart, Denis; Forthomme, Laurent; Giammanco, Andrea; Hollar, Jonathan; Lemaitre, Vincent; Liao, Junhui; Militaru, Otilia; Nuttens, Claude; Pagano, Davide; Pin, Arnaud; Piotrzkowski, Krzysztof; Schul, Nicolas; Vizan Garcia, Jesus Manuel; Beliy, Nikita; Caebergs, Thierry; Daubie, Evelyne; Hammad, Gregory Habib; Alves, Gilvan; Correa Martins Junior, Marcos; De Jesus Damiao, Dilson; Martins, Thiago; Pol, Maria Elena; Henrique Gomes E Souza, Moacyr; Aldá Júnior, Walter Luiz; Carvalho, Wagner; Custódio, Analu; Da Costa, Eliza Melo; De Oliveira Martins, Carley; Fonseca De Souza, Sandro; Matos Figueiredo, Diego; Mundim, Luiz; Nogima, Helio; Oguri, Vitor; Prado Da Silva, Wanda Lucia; Santoro, Alberto; Soares Jorge, Luana; Sznajder, Andre; Souza Dos Anjos, Tiago; Bernardes, Cesar Augusto; De Almeida Dias, Flavia; Tomei, Thiago; De Moraes Gregores, Eduardo; Lagana, Caio; Da Cunha Marinho, Franciole; Mercadante, Pedro G; Novaes, Sergio F; Padula, Sandra; Genchev, Vladimir; Iaydjiev, Plamen; Piperov, Stefan; Rodozov, Mircho; Stoykova, Stefka; Sultanov, Georgi; Tcholakov, Vanio; Trayanov, Rumen; Vutova, Mariana; Dimitrov, Anton; Hadjiiska, Roumyana; Kozhuharov, Venelin; Litov, Leander; Pavlov, Borislav; Petkov, Peicho; Bian, Jian-Guo; Chen, Guo-Ming; Chen, He-Sheng; Jiang, Chun-Hua; Liang, Dong; Liang, Song; Meng, Xiangwei; Tao, Junquan; Wang, Jian; Wang, Xianyou; Wang, Zheng; Xiao, Hong; Xu, Ming; Zang, Jingjing; Zhang, Zhen; Asawatangtrakuldee, Chayanit; Ban, Yong; Guo, Yifei; Li, Wenbo; Liu, Shuai; Mao, Yajun; Qian, Si-Jin; Teng, Haiyun; Wang, Dayong; Zhang, Linlin; Zou, Wei; Avila, Carlos; Gomez, Juan Pablo; Gomez Moreno, Bernardo; Osorio Oliveros, Andres Felipe; Sanabria, Juan Carlos; Godinovic, Nikola; Lelas, Damir; Plestina, Roko; Polic, Dunja; Puljak, Ivica; Antunovic, Zeljko; Kovac, Marko; Brigljevic, Vuko; Duric, Senka; Kadija, Kreso; Luetic, Jelena; Morovic, Srecko; Attikis, Alexandros; Galanti, Mario; Mavromanolakis, Georgios; Mousa, Jehad; Nicolaou, Charalambos; Ptochos, Fotios; Razis, Panos A; Finger, Miroslav; Finger Jr, Michael; Assran, Yasser; Elgammal, Sherif; Ellithi Kamel, Ali; Khalil, Shaaban; Mahmoud, Mohammed; Radi, Amr; Kadastik, Mario; Müntel, Mait; Raidal, Martti; Rebane, Liis; Tiko, Andres; Eerola, Paula; Fedi, Giacomo; Voutilainen, Mikko; Härkönen, Jaakko; Heikkinen, Mika Aatos; Karimäki, Veikko; Kinnunen, Ritva; Kortelainen, Matti J; Lampén, Tapio; Lassila-Perini, Kati; Lehti, Sami; Lindén, Tomas; Luukka, Panja-Riina; Mäenpää, Teppo; Peltola, Timo; Tuominen, Eija; Tuominiemi, Jorma; Tuovinen, Esa; Ungaro, Donatella; Wendland, Lauri; Banzuzi, Kukka; Karjalainen, Ahti; Korpela, Arja; Tuuva, Tuure; Besancon, Marc; Choudhury, Somnath; Dejardin, Marc; Denegri, Daniel; Fabbro, Bernard; Faure, Jean-Louis; Ferri, Federico; Ganjour, Serguei; Givernaud, Alain; Gras, Philippe; Hamel de Monchenault, Gautier; Jarry, Patrick; Locci, Elizabeth; Malcles, Julie; Millischer, Laurent; Nayak, Aruna; Rander, John; Rosowsky, André; Shreyber, Irina; Titov, Maksym; Baffioni, Stephanie; Beaudette, Florian; Benhabib, Lamia; Bianchini, Lorenzo; Bluj, Michal; Broutin, Clementine; Busson, Philippe; Charlot, Claude; Daci, Nadir; Dahms, Torsten; Dobrzynski, Ludwik; Granier de Cassagnac, Raphael; Haguenauer, Maurice; Miné, Philippe; Mironov, Camelia; Naranjo, Ivo Nicolas; Nguyen, Matthew; Ochando, Christophe; Paganini, Pascal; Sabes, David; Salerno, Roberto; Sirois, Yves; Veelken, Christian; Zabi, Alexandre; Agram, Jean-Laurent; Andrea, Jeremy; Bloch, Daniel; Bodin, David; Brom, Jean-Marie; Cardaci, Marco; Chabert, Eric Christian; Collard, Caroline; Conte, Eric; Drouhin, Frédéric; Ferro, Cristina; Fontaine, Jean-Charles; Gelé, Denis; Goerlach, Ulrich; Juillot, Pierre; Le Bihan, Anne-Catherine; Van Hove, Pierre; Fassi, Farida; Mercier, Damien; Beauceron, Stephanie; Beaupere, Nicolas; Bondu, Olivier; Boudoul, Gaelle; Chasserat, Julien; Chierici, Roberto; Contardo, Didier; Depasse, Pierre; El Mamouni, Houmani; Fay, Jean; Gascon, Susan; Gouzevitch, Maxime; Ille, Bernard; Kurca, Tibor; Lethuillier, Morgan; Mirabito, Laurent; Perries, Stephane; Sordini, Viola; Tschudi, Yohann; Verdier, Patrice; Viret, Sébastien; Tsamalaidze, Zviad; Anagnostou, Georgios; Autermann, Christian; Beranek, Sarah; Edelhoff, Matthias; Feld, Lutz; Heracleous, Natalie; Hindrichs, Otto; Jussen, Ruediger; Klein, Katja; Merz, Jennifer; Ostapchuk, Andrey; Perieanu, Adrian; Raupach, Frank; Sammet, Jan; Schael, Stefan; Sprenger, Daniel; Weber, Hendrik; Wittmer, Bruno; Zhukov, Valery; Ata, Metin; Caudron, Julien; Dietz-Laursonn, Erik; Duchardt, Deborah; Erdmann, Martin; Fischer, Robert; Güth, Andreas; Hebbeker, Thomas; Heidemann, Carsten; Hoepfner, Kerstin; Klingebiel, Dennis; Kreuzer, Peter; Magass, Carsten; Merschmeyer, Markus; Meyer, Arnd; Olschewski, Mark; Papacz, Paul; Pieta, Holger; Reithler, Hans; Schmitz, Stefan Antonius; Sonnenschein, Lars; Steggemann, Jan; Teyssier, Daniel; Weber, Martin; Bontenackels, Michael; Cherepanov, Vladimir; Erdogan, Yusuf; Flügge, Günter; Geenen, Heiko; Geisler, Matthias; Haj Ahmad, Wael; Hoehle, Felix; Kargoll, Bastian; Kress, Thomas; Kuessel, Yvonne; Nowack, Andreas; Perchalla, Lars; Pooth, Oliver; Sauerland, Philip; Stahl, Achim; Aldaya Martin, Maria; Behr, Joerg; Behrenhoff, Wolf; Behrens, Ulf; Bergholz, Matthias; Bethani, Agni; Borras, Kerstin; Burgmeier, Armin; Cakir, Altan; Calligaris, Luigi; Campbell, Alan; Castro, Elena; Costanza, Francesco; Dammann, Dirk; Diez Pardos, Carmen; Eckerlin, Guenter; Eckstein, Doris; Flucke, Gero; Geiser, Achim; Glushkov, Ivan; Gunnellini, Paolo; Habib, Shiraz; Hauk, Johannes; Hellwig, Gregor; Jung, Hannes; Kasemann, Matthias; Katsas, Panagiotis; Kleinwort, Claus; Kluge, Hannelies; Knutsson, Albert; Krämer, Mira; Krücker, Dirk; Kuznetsova, Ekaterina; Lange, Wolfgang; Lohmann, Wolfgang; Lutz, Benjamin; Mankel, Rainer; Marfin, Ihar; Marienfeld, Markus; Melzer-Pellmann, Isabell-Alissandra; Meyer, Andreas Bernhard; Mnich, Joachim; Mussgiller, Andreas; Naumann-Emme, Sebastian; Olzem, Jan; Perrey, Hanno; Petrukhin, Alexey; Pitzl, Daniel; Raspereza, Alexei; Ribeiro Cipriano, Pedro M; Riedl, Caroline; Ron, Elias; Rosin, Michele; Salfeld-Nebgen, Jakob; Schmidt, Ringo; Schoerner-Sadenius, Thomas; Sen, Niladri; Spiridonov, Alexander; Stein, Matthias; Walsh, Roberval; Wissing, Christoph; Blobel, Volker; Draeger, Jula; Enderle, Holger; Erfle, Joachim; Gebbert, Ulla; Görner, Martin; Hermanns, Thomas; Höing, Rebekka Sophie; Kaschube, Kolja; Kaussen, Gordon; Kirschenmann, Henning; Klanner, Robert; Lange, Jörn; Mura, Benedikt; Nowak, Friederike; Peiffer, Thomas; Pietsch, Niklas; Rathjens, Denis; Sander, Christian; Schettler, Hannes; Schleper, Peter; Schlieckau, Eike; Schmidt, Alexander; Schröder, Matthias; Schum, Torben; Seidel, Markus; Sola, Valentina; Stadie, Hartmut; Steinbrück, Georg; Thomsen, Jan; Vanelderen, Lukas; Barth, Christian; Berger, Joram; Böser, Christian; Chwalek, Thorsten; De Boer, Wim; Descroix, Alexis; Dierlamm, Alexander; Feindt, Michael; Guthoff, Moritz; Hackstein, Christoph; Hartmann, Frank; Hauth, Thomas; Heinrich, Michael; Held, Hauke; Hoffmann, Karl-Heinz; Honc, Simon; Katkov, Igor; Komaragiri, Jyothsna Rani; Lobelle Pardo, Patricia; Martschei, Daniel; Mueller, Steffen; Müller, Thomas; Niegel, Martin; Nürnberg, Andreas; Oberst, Oliver; Oehler, Andreas; Ott, Jochen; Quast, Gunter; Rabbertz, Klaus; Ratnikov, Fedor; Ratnikova, Natalia; Röcker, Steffen; Scheurer, Armin; Schilling, Frank-Peter; Schott, Gregory; Simonis, Hans-Jürgen; Stober, Fred-Markus Helmut; Troendle, Daniel; Ulrich, Ralf; Wagner-Kuhr, Jeannine; Wayand, Stefan; Weiler, Thomas; Zeise, Manuel; Daskalakis, Georgios; Geralis, Theodoros; Kesisoglou, Stilianos; Kyriakis, Aristotelis; Loukas, Demetrios; Manolakos, Ioannis; Markou, Athanasios; Markou, Christos; Mavrommatis, Charalampos; Ntomari, Eleni; Gouskos, Loukas; Mertzimekis, Theodoros; Panagiotou, Apostolos; Saoulidou, Niki; Evangelou, Ioannis; Foudas, Costas; Kokkas, Panagiotis; Manthos, Nikolaos; Papadopoulos, Ioannis; Patras, Vaios; Bencze, Gyorgy; Hajdu, Csaba; Hidas, Pàl; Horvath, Dezso; Sikler, Ferenc; Veszpremi, Viktor; Vesztergombi, Gyorgy; Beni, Noemi; Czellar, Sandor; Molnar, Jozsef; Palinkas, Jozsef; Szillasi, Zoltan; Karancsi, János; Raics, Peter; Trocsanyi, Zoltan Laszlo; Ujvari, Balazs; Beri, Suman Bala; Bhatnagar, Vipin; Dhingra, Nitish; Gupta, Ruchi; Kaur, Manjit; Mehta, Manuk Zubin; Nishu, Nishu; Saini, Lovedeep Kaur; Sharma, Archana; Singh, Jasbir; Kumar, Ashok; Kumar, Arun; Ahuja, Sudha; Bhardwaj, Ashutosh; Choudhary, Brajesh C; Malhotra, Shivali; Naimuddin, Md; Ranjan, Kirti; Sharma, Varun; Shivpuri, Ram Krishen; Banerjee, Sunanda; Bhattacharya, Satyaki; Dutta, Suchandra; Gomber, Bhawna; Jain, Sandhya; Jain, Shilpi; Khurana, Raman; Sarkar, Subir; Sharan, Manoj; Abdulsalam, Abdulla; Choudhury, Rajani Kant; Dutta, Dipanwita; Kailas, Swaminathan; Kumar, Vineet; Mehta, Pourus; Mohanty, Ajit Kumar; Pant, Lalit Mohan; Shukla, Prashant; Aziz, Tariq; Ganguly, Sanmay; Guchait, Monoranjan; Maity, Manas; Majumder, Gobinda; Mazumdar, Kajari; Mohanty, Gagan Bihari; Parida, Bibhuti; Sudhakar, Katta; Wickramage, Nadeesha; Banerjee, Sudeshna; Dugad, Shashikant; Arfaei, Hessamaddin; Bakhshiansohi, Hamed; Etesami, Seyed Mohsen; Fahim, Ali; Hashemi, Majid; Hesari, Hoda; Jafari, Abideh; Khakzad, Mohsen; Mohammadi Najafabadi, Mojtaba; Paktinat Mehdiabadi, Saeid; Safarzadeh, Batool; Zeinali, Maryam; Abbrescia, Marcello; Barbone, Lucia; Calabria, Cesare; Chhibra, Simranjit Singh; Colaleo, Anna; Creanza, Donato; De Filippis, Nicola; De Palma, Mauro; Fiore, Luigi; Iaselli, Giuseppe; Lusito, Letizia; Maggi, Giorgio; Maggi, Marcello; Marangelli, Bartolomeo; My, Salvatore; Nuzzo, Salvatore; Pacifico, Nicola; Pompili, Alexis; Pugliese, Gabriella; Selvaggi, Giovanna; Silvestris, Lucia; Singh, Gurpreet; Venditti, Rosamaria; Zito, Giuseppe; Abbiendi, Giovanni; Benvenuti, Alberto; Bonacorsi, Daniele; Braibant-Giacomelli, Sylvie; Brigliadori, Luca; Capiluppi, Paolo; Castro, Andrea; Cavallo, Francesca Romana; Cuffiani, Marco; Dallavalle, Gaetano-Marco; Fabbri, Fabrizio; Fanfani, Alessandra; Fasanella, Daniele; Giacomelli, Paolo; Grandi, Claudio; Guiducci, Luigi; Marcellini, Stefano; Masetti, Gianni; Meneghelli, Marco; Montanari, Alessandro; Navarria, Francesco; Odorici, Fabrizio; Perrotta, Andrea; Primavera, Federica; Rossi, Antonio; Rovelli, Tiziano; Siroli, Gian Piero; Travaglini, Riccardo; Albergo, Sebastiano; Cappello, Gigi; Chiorboli, Massimiliano; Costa, Salvatore; Potenza, Renato; Tricomi, Alessia; Tuve, Cristina; Barbagli, Giuseppe; Ciulli, Vitaliano; Civinini, Carlo; D'Alessandro, Raffaello; Focardi, Ettore; Frosali, Simone; Gallo, Elisabetta; Gonzi, Sandro; Meschini, Marco; Paoletti, Simone; Sguazzoni, Giacomo; Tropiano, Antonio; Benussi, Luigi; Bianco, Stefano; Colafranceschi, Stefano; Fabbri, Franco; Piccolo, Davide; Fabbricatore, Pasquale; Musenich, Riccardo; Tosi, Silvano; Benaglia, Andrea; De Guio, Federico; Di Matteo, Leonardo; Fiorendi, Sara; Gennai, Simone; Ghezzi, Alessio; Malvezzi, Sandra; Manzoni, Riccardo Andrea; Martelli, Arabella; Massironi, Andrea; Menasce, Dario; Moroni, Luigi; Paganoni, Marco; Pedrini, Daniele; Ragazzi, Stefano; Redaelli, Nicola; Sala, Silvano; Tabarelli de Fatis, Tommaso; Buontempo, Salvatore; Carrillo Montoya, Camilo Andres; Cavallo, Nicola; De Cosa, Annapaola; Dogangun, Oktay; Fabozzi, Francesco; Iorio, Alberto Orso Maria; Lista, Luca; Meola, Sabino; Merola, Mario; Paolucci, Pierluigi; Azzi, Patrizia; Bacchetta, Nicola; Bisello, Dario; Branca, Antonio; Carlin, Roberto; Checchia, Paolo; Dorigo, Tommaso; Gasparini, Fabrizio; Gasparini, Ugo; Gozzelino, Andrea; Kanishchev, Konstantin; Lacaprara, Stefano; Lazzizzera, Ignazio; Margoni, Martino; Meneguzzo, Anna Teresa; Pazzini, Jacopo; Pozzobon, Nicola; Ronchese, Paolo; Simonetto, Franco; Torassa, Ezio; Tosi, Mia; Vanini, Sara; Zotto, Pierluigi; Zucchetta, Alberto; Zumerle, Gianni; Gabusi, Michele; Ratti, Sergio P; Riccardi, Cristina; Torre, Paola; Vitulo, Paolo; Biasini, Maurizio; Bilei, Gian Mario; Fanò, Livio; Lariccia, Paolo; Lucaroni, Andrea; Mantovani, Giancarlo; Menichelli, Mauro; Nappi, Aniello; Romeo, Francesco; Saha, Anirban; Santocchia, Attilio; Spiezia, Aniello; Taroni, Silvia; Azzurri, Paolo; Bagliesi, Giuseppe; Boccali, Tommaso; Broccolo, Giuseppe; Castaldi, Rino; D'Agnolo, Raffaele Tito; Dell'Orso, Roberto; Fiori, Francesco; Foà, Lorenzo; Giassi, Alessandro; Kraan, Aafke; Ligabue, Franco; Lomtadze, Teimuraz; Martini, Luca; Messineo, Alberto; Palla, Fabrizio; Rizzi, Andrea; Serban, Alin Titus; Spagnolo, Paolo; Squillacioti, Paola; Tenchini, Roberto; Tonelli, Guido; Venturi, Andrea; Verdini, Piero Giorgio; Barone, Luciano; Cavallari, Francesca; Del Re, Daniele; Diemoz, Marcella; Fanelli, Cristiano; Grassi, Marco; Longo, Egidio; Meridiani, Paolo; Micheli, Francesco; Nourbakhsh, Shervin; Organtini, Giovanni; Paramatti, Riccardo; Rahatlou, Shahram; Sigamani, Michael; Soffi, Livia; Amapane, Nicola; Arcidiacono, Roberta; Argiro, Stefano; Arneodo, Michele; Biino, Cristina; Cartiglia, Nicolo; Costa, Marco; Demaria, Natale; Mariotti, Chiara; Maselli, Silvia; Migliore, Ernesto; Monaco, Vincenzo; Musich, Marco; Obertino, Maria Margherita; Pastrone, Nadia; Pelliccioni, Mario; Potenza, Alberto; Romero, Alessandra; Sacchi, Roberto; Solano, Ada; Staiano, Amedeo; Usai, Emanuele; Vilela Pereira, Antonio; Belforte, Stefano; Candelise, Vieri; Cossutti, Fabio; Della Ricca, Giuseppe; Gobbo, Benigno; Marone, Matteo; Montanino, Damiana; Penzo, Aldo; Schizzi, Andrea; Heo, Seong Gu; Kim, Tae Yeon; Nam, Soon-Kwon; Chang, Sunghyun; Kim, Dong Hee; Kim, Gui Nyun; Kong, Dae Jung; Park, Hyangkyu; Ro, Sang-Ryul; Son, Dong-Chul; Son, Taejin; Kim, Jae Yool; Kim, Zero Jaeho; Song, Sanghyeon; Choi, Suyong; Gyun, Dooyeon; Hong, Byung-Sik; Jo, Mihee; Kim, Hyunchul; Kim, Tae Jeong; Lee, Kyong Sei; Moon, Dong Ho; Park, Sung Keun; Choi, Minkyoo; Kim, Ji Hyun; Park, Chawon; Park, Inkyu; Park, Sangnam; Ryu, Geonmo; Cho, Yongjin; Choi, Young-Il; Choi, Young Kyu; Goh, Junghwan; Kim, Min Suk; Kwon, Eunhyang; Lee, Byounghoon; Lee, Jongseok; Lee, Sungeun; Seo, Hyunkwan; Yu, Intae; Bilinskas, Mykolas Jurgis; Grigelionis, Ignas; Janulis, Mindaugas; Juodagalvis, Andrius; Castilla-Valdez, Heriberto; De La Cruz-Burelo, Eduard; Heredia-de La Cruz, Ivan; Lopez-Fernandez, Ricardo; Magaña Villalba, Ricardo; Martínez-Ortega, Jorge; Sánchez-Hernández, Alberto; Villasenor-Cendejas, Luis Manuel; Carrillo Moreno, Salvador; Vazquez Valencia, Fabiola; Salazar Ibarguen, Humberto Antonio; Casimiro Linares, Edgar; Morelos Pineda, Antonio; Reyes-Santos, Marco A; Krofcheck, David; Bell, Alan James; Butler, Philip H; Doesburg, Robert; Reucroft, Steve; Silverwood, Hamish; Ahmad, Muhammad; Ansari, Muhammad Hamid; Asghar, Muhammad Irfan; Hoorani, Hafeez R; Khalid, Shoaib; Khan, Wajid Ali; Khurshid, Taimoor; Qazi, Shamona; Shah, Mehar Ali; Shoaib, Muhammad; Bialkowska, Helena; Boimska, Bozena; Frueboes, Tomasz; Gokieli, Ryszard; Górski, Maciej; Kazana, Malgorzata; Nawrocki, Krzysztof; Romanowska-Rybinska, Katarzyna; Szleper, Michal; Wrochna, Grzegorz; Zalewski, Piotr; Brona, Grzegorz; Bunkowski, Karol; Cwiok, Mikolaj; Dominik, Wojciech; Doroba, Krzysztof; Kalinowski, Artur; Konecki, Marcin; Krolikowski, Jan; Almeida, Nuno; Bargassa, Pedrame; David Tinoco Mendes, Andre; Faccioli, Pietro; Ferreira Parracho, Pedro Guilherme; Gallinaro, Michele; Seixas, Joao; Varela, Joao; Vischia, Pietro; Belotelov, Ivan; Bunin, Pavel; Gavrilenko, Mikhail; Golutvin, Igor; Gorbunov, Ilya; Kamenev, Alexey; Karjavin, Vladimir; Kozlov, Guennady; Lanev, Alexander; Malakhov, Alexander; Moisenz, Petr; Palichik, Vladimir; Perelygin, Victor; Shmatov, Sergey; Smirnov, Vitaly; Volodko, Anton; Zarubin, Anatoli; Evstyukhin, Sergey; Golovtsov, Victor; Ivanov, Yury; Kim, Victor; Levchenko, Petr; Murzin, Victor; Oreshkin, Vadim; Smirnov, Igor; Sulimov, Valentin; Uvarov, Lev; Vavilov, Sergey; Vorobyev, Alexey; Vorobyev, Andrey; Andreev, Yuri; Dermenev, Alexander; Gninenko, Sergei; Golubev, Nikolai; Kirsanov, Mikhail; Krasnikov, Nikolai; Matveev, Viktor; Pashenkov, Anatoli; Tlisov, Danila; Toropin, Alexander; Epshteyn, Vladimir; Erofeeva, Maria; Gavrilov, Vladimir; Kossov, Mikhail; Lychkovskaya, Natalia; Popov, Vladimir; Safronov, Grigory; Semenov, Sergey; Stolin, Viatcheslav; Vlasov, Evgueni; Zhokin, Alexander; Belyaev, Andrey; Boos, Edouard; Dubinin, Mikhail; Dudko, Lev; Ershov, Alexander; Gribushin, Andrey; Klyukhin, Vyacheslav; Kodolova, Olga; Lokhtin, Igor; Markina, Anastasia; Obraztsov, Stepan; Perfilov, Maxim; Petrushanko, Sergey; Popov, Andrey; Sarycheva, Ludmila; Savrin, Viktor; Snigirev, Alexander; Andreev, Vladimir; Azarkin, Maksim; Dremin, Igor; Kirakosyan, Martin; Leonidov, Andrey; Mesyats, Gennady; Rusakov, Sergey V; Vinogradov, Alexey; Azhgirey, Igor; Bayshev, Igor; Bitioukov, Sergei; Grishin, Viatcheslav; Kachanov, Vassili; Konstantinov, Dmitri; Krychkine, Victor; Petrov, Vladimir; Ryutin, Roman; Sobol, Andrei; Tourtchanovitch, Leonid; Troshin, Sergey; Tyurin, Nikolay; Uzunian, Andrey; Volkov, Alexey; Adzic, Petar; Djordjevic, Milos; Ekmedzic, Marko; Krpic, Dragomir; Milosevic, Jovan; Aguilar-Benitez, Manuel; Alcaraz Maestre, Juan; Arce, Pedro; Battilana, Carlo; Calvo, Enrique; Cerrada, Marcos; Chamizo Llatas, Maria; Colino, Nicanor; De La Cruz, Begona; Delgado Peris, Antonio; Domínguez Vázquez, Daniel; Fernandez Bedoya, Cristina; Fernández Ramos, Juan Pablo; Ferrando, Antonio; Flix, Jose; Fouz, Maria Cruz; Garcia-Abia, Pablo; Gonzalez Lopez, Oscar; Goy Lopez, Silvia; Hernandez, Jose M; Josa, Maria Isabel; Merino, Gonzalo; Puerta Pelayo, Jesus; Quintario Olmeda, Adrián; Redondo, Ignacio; Romero, Luciano; Santaolalla, Javier; Soares, Mara Senghi; Willmott, Carlos; Albajar, Carmen; Codispoti, Giuseppe; de Trocóniz, Jorge F; Brun, Hugues; Cuevas, Javier; Fernandez Menendez, Javier; Folgueras, Santiago; Gonzalez Caballero, Isidro; Lloret Iglesias, Lara; Piedra Gomez, Jonatan; Brochero Cifuentes, Javier Andres; Cabrillo, Iban Jose; Calderon, Alicia; Chuang, Shan-Huei; Duarte Campderros, Jordi; Felcini, Marta; Fernandez, Marcos; Gomez, Gervasio; Gonzalez Sanchez, Javier; Graziano, Alberto; Jorda, Clara; Lopez Virto, Amparo; Marco, Jesus; Marco, Rafael; Martinez Rivero, Celso; Matorras, Francisco; Munoz Sanchez, Francisca Javiela; Rodrigo, Teresa; Rodríguez-Marrero, Ana Yaiza; Ruiz-Jimeno, Alberto; Scodellaro, Luca; Vila, Ivan; Vilar Cortabitarte, Rocio; Abbaneo, Duccio; Auffray, Etiennette; Auzinger, Georg; Bachtis, Michail; Baillon, Paul; Ball, Austin; Barney, David; Benitez, Jose F; Bernet, Colin; Bianchi, Giovanni; Bloch, Philippe; Bocci, Andrea; Bonato, Alessio; Botta, Cristina; Breuker, Horst; Camporesi, Tiziano; Cerminara, Gianluca; Christiansen, Tim; Coarasa Perez, Jose Antonio; D'Enterria, David; Dabrowski, Anne; De Roeck, Albert; Di Guida, Salvatore; Dobson, Marc; Dupont-Sagorin, Niels; Elliott-Peisert, Anna; Frisch, Benjamin; Funk, Wolfgang; Georgiou, Georgios; Giffels, Manuel; Gigi, Dominique; Gill, Karl; Giordano, Domenico; Giunta, Marina; Glege, Frank; Gomez-Reino Garrido, Robert; Govoni, Pietro; Gowdy, Stephen; Guida, Roberto; Hansen, Magnus; Harris, Philip; Hartl, Christian; Harvey, John; Hegner, Benedikt; Hinzmann, Andreas; Innocente, Vincenzo; Janot, Patrick; Kaadze, Ketino; Karavakis, Edward; Kousouris, Konstantinos; Lecoq, Paul; Lee, Yen-Jie; Lenzi, Piergiulio; Lourenco, Carlos; Magini, Nicolo; Maki, Tuula; Malberti, Martina; Malgeri, Luca; Mannelli, Marcello; Masetti, Lorenzo; Meijers, Frans; Mersi, Stefano; Meschi, Emilio; Moser, Roland; Mozer, Matthias Ulrich; Mulders, Martijn; Musella, Pasquale; Nesvold, Erik; Orimoto, Toyoko; Orsini, Luciano; Palencia Cortezon, Enrique; Perez, Emmanuelle; Perrozzi, Luca; Petrilli, Achille; Pfeiffer, Andreas; Pierini, Maurizio; Pimiä, Martti; Piparo, Danilo; Polese, Giovanni; Quertenmont, Loic; Racz, Attila; Reece, William; Rodrigues Antunes, Joao; Rolandi, Gigi; Rovelli, Chiara; Rovere, Marco; Sakulin, Hannes; Santanastasio, Francesco; Schäfer, Christoph; Schwick, Christoph; Segoni, Ilaria; Sekmen, Sezen; Sharma, Archana; Siegrist, Patrice; Silva, Pedro; Simon, Michal; Sphicas, Paraskevas; Spiga, Daniele; Tsirou, Andromachi; Veres, Gabor Istvan; Vlimant, Jean-Roch; Wöhri, Hermine Katharina; Worm, Steven; Zeuner, Wolfram Dietrich; Bertl, Willi; Deiters, Konrad; Erdmann, Wolfram; Gabathuler, Kurt; Horisberger, Roland; Ingram, Quentin; Kaestli, Hans-Christian; König, Stefan; Kotlinski, Danek; Langenegger, Urs; Meier, Frank; Renker, Dieter; Rohe, Tilman; Sibille, Jennifer; Bäni, Lukas; Bortignon, Pierluigi; Buchmann, Marco-Andrea; Casal, Bruno; Chanon, Nicolas; Deisher, Amanda; Dissertori, Günther; Dittmar, Michael; Donegà, Mauro; Dünser, Marc; Eugster, Jürg; Freudenreich, Klaus; Grab, Christoph; Hits, Dmitry; Lecomte, Pierre; Lustermann, Werner; Marini, Andrea Carlo; Martinez Ruiz del Arbol, Pablo; Mohr, Niklas; Moortgat, Filip; Nägeli, Christoph; Nef, Pascal; Nessi-Tedaldi, Francesca; Pandolfi, Francesco; Pape, Luc; Pauss, Felicitas; Peruzzi, Marco; Ronga, Frederic Jean; Rossini, Marco; Sala, Leonardo; Sanchez, Ann - Karin; Starodumov, Andrei; Stieger, Benjamin; Takahashi, Maiko; Tauscher, Ludwig; Thea, Alessandro; Theofilatos, Konstantinos; Treille, Daniel; Urscheler, Christina; Wallny, Rainer; Weber, Hannsjoerg Artur; Wehrli, Lukas; Amsler, Claude; Chiochia, Vincenzo; De Visscher, Simon; Favaro, Carlotta; Ivova Rikova, Mirena; Millan Mejias, Barbara; Otiougova, Polina; Robmann, Peter; Snoek, Hella; Tupputi, Salvatore; Verzetti, Mauro; Chang, Yuan-Hann; Chen, Kuan-Hsin; Kuo, Chia-Ming; Li, Syue-Wei; Lin, Willis; Liu, Zong-Kai; Lu, Yun-Ju; Mekterovic, Darko; Singh, Anil; Volpe, Roberta; Yu, Shin-Shan; Bartalini, Paolo; Chang, Paoti; Chang, You-Hao; Chang, Yu-Wei; Chao, Yuan; Chen, Kai-Feng; Dietz, Charles; Grundler, Ulysses; Hou, George Wei-Shu; Hsiung, Yee; Kao, Kai-Yi; Lei, Yeong-Jyi; Lu, Rong-Shyang; Majumder, Devdatta; Petrakou, Eleni; Shi, Xin; Shiu, Jing-Ge; Tzeng, Yeng-Ming; Wan, Xia; Wang, Minzu; Adiguzel, Aytul; Bakirci, Mustafa Numan; Cerci, Salim; Dozen, Candan; Dumanoglu, Isa; Eskut, Eda; Girgis, Semiray; Gokbulut, Gul; Gurpinar, Emine; Hos, Ilknur; Kangal, Evrim Ersin; Karaman, Turker; Karapinar, Guler; Kayis Topaksu, Aysel; Onengut, Gulsen; Ozdemir, Kadri; Ozturk, Sertac; Polatoz, Ayse; Sogut, Kenan; Sunar Cerci, Deniz; Tali, Bayram; Topakli, Huseyin; Vergili, Latife Nukhet; Vergili, Mehmet; Akin, Ilina Vasileva; Aliev, Takhmasib; Bilin, Bugra; Bilmis, Selcuk; Deniz, Muhammed; Gamsizkan, Halil; Guler, Ali Murat; Ocalan, Kadir; Ozpineci, Altug; Serin, Meltem; Sever, Ramazan; Surat, Ugur Emrah; Yalvac, Metin; Yildirim, Eda; Zeyrek, Mehmet; Gülmez, Erhan; Isildak, Bora; Kaya, Mithat; Kaya, Ozlem; Ozkorucuklu, Suat; Sonmez, Nasuf; Cankocak, Kerem; Levchuk, Leonid; Bostock, Francis; Brooke, James John; Clement, Emyr; Cussans, David; Flacher, Henning; Frazier, Robert; Goldstein, Joel; Grimes, Mark; Heath, Greg P; Heath, Helen F; Kreczko, Lukasz; Metson, Simon; Newbold, Dave M; Nirunpong, Kachanon; Poll, Anthony; Senkin, Sergey; Smith, Vincent J; Williams, Thomas; Basso, Lorenzo; Bell, Ken W; Belyaev, Alexander; Brew, Christopher; Brown, Robert M; Cockerill, David JA; Coughlan, John A; Harder, Kristian; Harper, Sam; Jackson, James; Kennedy, Bruce W; Olaiya, Emmanuel; Petyt, David; Radburn-Smith, Benjamin Charles; Shepherd-Themistocleous, Claire; Tomalin, Ian R; Womersley, William John; Bainbridge, Robert; Ball, Gordon; Beuselinck, Raymond; Buchmuller, Oliver; Colling, David; Cripps, Nicholas; Cutajar, Michael; Dauncey, Paul; Davies, Gavin; Della Negra, Michel; Ferguson, William; Fulcher, Jonathan; Futyan, David; Gilbert, Andrew; Guneratne Bryer, Arlo; Hall, Geoffrey; Hatherell, Zoe; Hays, Jonathan; Iles, Gregory; Jarvis, Martyn; Karapostoli, Georgia; Lyons, Louis; Magnan, Anne-Marie; Marrouche, Jad; Mathias, Bryn; Nandi, Robin; Nash, Jordan; Nikitenko, Alexander; Papageorgiou, Anastasios; Pela, Joao; Pesaresi, Mark; Petridis, Konstantinos; Pioppi, Michele; Raymond, David Mark; Rogerson, Samuel; Rose, Andrew; Ryan, Matthew John; Seez, Christopher; Sharp, Peter; Sparrow, Alex; Stoye, Markus; Tapper, Alexander; Vazquez Acosta, Monica; Virdee, Tejinder; Wakefield, Stuart; Wardle, Nicholas; Whyntie, Tom; Chadwick, Matthew; Cole, Joanne; Hobson, Peter R; Khan, Akram; Kyberd, Paul; Leggat, Duncan; Leslie, Dawn; Martin, William; Reid, Ivan; Symonds, Philip; Teodorescu, Liliana; Turner, Mark; Hatakeyama, Kenichi; Liu, Hongxuan; Scarborough, Tara; Charaf, Otman; Henderson, Conor; Rumerio, Paolo; Avetisyan, Aram; Bose, Tulika; Fantasia, Cory; Heister, Arno; St John, Jason; Lawson, Philip; Lazic, Dragoslav; Rohlf, James; Sperka, David; Sulak, Lawrence; Alimena, Juliette; Bhattacharya, Saptaparna; Cutts, David; Ferapontov, Alexey; Heintz, Ulrich; Jabeen, Shabnam; Kukartsev, Gennadiy; Laird, Edward; Landsberg, Greg; Luk, Michael; Narain, Meenakshi; Nguyen, Duong; Segala, Michael; Sinthuprasith, Tutanon; Speer, Thomas; Tsang, Ka Vang; Breedon, Richard; Breto, Guillermo; Calderon De La Barca Sanchez, Manuel; Chauhan, Sushil; Chertok, Maxwell; Conway, John; Conway, Rylan; Cox, Peter Timothy; Dolen, James; Erbacher, Robin; Gardner, Michael; Houtz, Rachel; Ko, Winston; Kopecky, Alexandra; Lander, Richard; Miceli, Tia; Pellett, Dave; Ricci-Tam, Francesca; Rutherford, Britney; Searle, Matthew; Smith, John; Squires, Michael; Tripathi, Mani; Vasquez Sierra, Ricardo; Andreev, Valeri; Cline, David; Cousins, Robert; Duris, Joseph; Erhan, Samim; Everaerts, Pieter; Farrell, Chris; Hauser, Jay; Ignatenko, Mikhail; Jarvis, Chad; Plager, Charles; Rakness, Gregory; Schlein, Peter; Traczyk, Piotr; Valuev, Vyacheslav; Weber, Matthias; Babb, John; Clare, Robert; Dinardo, Mauro Emanuele; Ellison, John Anthony; Gary, J William; Giordano, Ferdinando; Hanson, Gail; Jeng, Geng-Yuan; Liu, Hongliang; Long, Owen Rosser; Luthra, Arun; Nguyen, Harold; Paramesvaran, Sudarshan; Sturdy, Jared; Sumowidagdo, Suharyo; Wilken, Rachel; Wimpenny, Stephen; Andrews, Warren; Branson, James G; Cerati, Giuseppe Benedetto; Cittolin, Sergio; Evans, David; Golf, Frank; Holzner, André; Kelley, Ryan; Lebourgeois, Matthew; Letts, James; Macneill, Ian; Mangano, Boris; Padhi, Sanjay; Palmer, Christopher; Petrucciani, Giovanni; Pieri, Marco; Sani, Matteo; Sharma, Vivek; Simon, Sean; Sudano, Elizabeth; Tadel, Matevz; Tu, Yanjun; Vartak, Adish; Wasserbaech, Steven; Würthwein, Frank; Yagil, Avraham; Yoo, Jaehyeok; Barge, Derek; Bellan, Riccardo; Campagnari, Claudio; D'Alfonso, Mariarosaria; Danielson, Thomas; Flowers, Kristen; Geffert, Paul; Incandela, Joe; Justus, Christopher; Kalavase, Puneeth; Koay, Sue Ann; Kovalskyi, Dmytro; Krutelyov, Vyacheslav; Lowette, Steven; Mccoll, Nickolas; Pavlunin, Viktor; Rebassoo, Finn; Ribnik, Jacob; Richman, Jeffrey; Rossin, Roberto; Stuart, David; To, Wing; West, Christopher; Apresyan, Artur; Bornheim, Adolf; Chen, Yi; Di Marco, Emanuele; Duarte, Javier; Gataullin, Marat; Ma, Yousi; Mott, Alexander; Newman, Harvey B; Rogan, Christopher; Spiropulu, Maria; Timciuc, Vladlen; Veverka, Jan; Wilkinson, Richard; Xie, Si; Yang, Yong; Zhu, Ren-Yuan; Akgun, Bora; Azzolini, Virginia; Calamba, Aristotle; Carroll, Ryan; Ferguson, Thomas; Iiyama, Yutaro; Jang, Dong Wook; Liu, Yueh-Feng; Paulini, Manfred; Vogel, Helmut; Vorobiev, Igor; Cumalat, John Perry; Drell, Brian Robert; Edelmaier, Christopher; Ford, William T; Gaz, Alessandro; Heyburn, Bernadette; Luiggi Lopez, Eduardo; Smith, James; Stenson, Kevin; Ulmer, Keith; Wagner, Stephen Robert; Alexander, James; Chatterjee, Avishek; Eggert, Nicholas; Gibbons, Lawrence Kent; Heltsley, Brian; Khukhunaishvili, Aleko; Kreis, Benjamin; Mirman, Nathan; Nicolas Kaufman, Gala; Patterson, Juliet Ritchie; Ryd, Anders; Salvati, Emmanuele; Sun, Werner; Teo, Wee Don; Thom, Julia; Thompson, Joshua; Tucker, Jordan; Vaughan, Jennifer; Weng, Yao; Winstrom, Lucas; Wittich, Peter; Winn, Dave; Abdullin, Salavat; Albrow, Michael; Anderson, Jacob; Bauerdick, Lothar AT; Beretvas, Andrew; Berryhill, Jeffrey; Bhat, Pushpalatha C; Bloch, Ingo; Burkett, Kevin; Butler, Joel Nathan; Chetluru, Vasundhara; Cheung, Harry; Chlebana, Frank; Elvira, Victor Daniel; Fisk, Ian; Freeman, Jim; Gao, Yanyan; Green, Dan; Gutsche, Oliver; Hanlon, Jim; Harris, Robert M; Hirschauer, James; Hooberman, Benjamin; Jindariani, Sergo; Johnson, Marvin; Joshi, Umesh; Kilminster, Benjamin; Klima, Boaz; Kunori, Shuichi; Kwan, Simon; Leonidopoulos, Christos; Linacre, Jacob; Lincoln, Don; Lipton, Ron; Lykken, Joseph; Maeshima, Kaori; Marraffino, John Michael; Maruyama, Sho; Mason, David; McBride, Patricia; Mishra, Kalanand; Mrenna, Stephen; Musienko, Yuri; Newman-Holmes, Catherine; O'Dell, Vivian; Prokofyev, Oleg; Sexton-Kennedy, Elizabeth; Sharma, Seema; Spalding, William J; Spiegel, Leonard; Tan, Ping; Taylor, Lucas; Tkaczyk, Slawek; Tran, Nhan Viet; Uplegger, Lorenzo; Vaandering, Eric Wayne; Vidal, Richard; Whitmore, Juliana; Wu, Weimin; Yang, Fan; Yumiceva, Francisco; Yun, Jae Chul; Acosta, Darin; Avery, Paul; Bourilkov, Dimitri; Chen, Mingshui; Cheng, Tongguang; Das, Souvik; De Gruttola, Michele; Di Giovanni, Gian Piero; Dobur, Didar; Drozdetskiy, Alexey; Field, Richard D; Fisher, Matthew; Fu, Yu; Furic, Ivan-Kresimir; Gartner, Joseph; Hugon, Justin; Kim, Bockjoo; Konigsberg, Jacobo; Korytov, Andrey; Kropivnitskaya, Anna; Kypreos, Theodore; Low, Jia Fu; Matchev, Konstantin; Milenovic, Predrag; Mitselmakher, Guenakh; Muniz, Lana; Remington, Ronald; Rinkevicius, Aurelijus; Sellers, Paul; Skhirtladze, Nikoloz; Snowball, Matthew; Yelton, John; Zakaria, Mohammed; Gaultney, Vanessa; Hewamanage, Samantha; Lebolo, Luis Miguel; Linn, Stephan; Markowitz, Pete; Martinez, German; Rodriguez, Jorge Luis; Adams, Todd; Askew, Andrew; Bochenek, Joseph; Chen, Jie; Diamond, Brendan; Gleyzer, Sergei V; Haas, Jeff; Hagopian, Sharon; Hagopian, Vasken; Jenkins, Merrill; Johnson, Kurtis F; Prosper, Harrison; Veeraraghavan, Venkatesh; Weinberg, Marc; Baarmand, Marc M; Dorney, Brian; Hohlmann, Marcus; Kalakhety, Himali; Vodopiyanov, Igor; Adams, Mark Raymond; Anghel, Ioana Maria; Apanasevich, Leonard; Bai, Yuting; Bazterra, Victor Eduardo; Betts, Russell Richard; Bucinskaite, Inga; Callner, Jeremy; Cavanaugh, Richard; Evdokimov, Olga; Gauthier, Lucie; Gerber, Cecilia Elena; Hofman, David Jonathan; Khalatyan, Samvel; Lacroix, Florent; Malek, Magdalena; O'Brien, Christine; Silkworth, Christopher; Strom, Derek; Turner, Paul; Varelas, Nikos; Akgun, Ugur; Albayrak, Elif Asli; Bilki, Burak; Clarida, Warren; Duru, Firdevs; Griffiths, Scott; Merlo, Jean-Pierre; Mermerkaya, Hamit; Mestvirishvili, Alexi; Moeller, Anthony; Nachtman, Jane; Newsom, Charles Ray; Norbeck, Edwin; Onel, Yasar; Ozok, Ferhat; Sen, Sercan; Tiras, Emrah; Wetzel, James; Yetkin, Taylan; Yi, Kai; Barnett, Bruce Arnold; Blumenfeld, Barry; Bolognesi, Sara; Fehling, David; Giurgiu, Gavril; Gritsan, Andrei; Guo, Zijin; Hu, Guofan; Maksimovic, Petar; Rappoccio, Salvatore; Swartz, Morris; Whitbeck, Andrew; Baringer, Philip; Bean, Alice; Benelli, Gabriele; Grachov, Oleg; Kenny Iii, Raymond Patrick; Murray, Michael; Noonan, Daniel; Sanders, Stephen; Stringer, Robert; Tinti, Gemma; Wood, Jeffrey Scott; Zhukova, Victoria; Barfuss, Anne-Fleur; Bolton, Tim; Chakaberia, Irakli; Ivanov, Andrew; Khalil, Sadia; Makouski, Mikhail; Maravin, Yurii; Shrestha, Shruti; Svintradze, Irakli; Gronberg, Jeffrey; Lange, David; Wright, Douglas; Baden, Drew; Boutemeur, Madjid; Calvert, Brian; Eno, Sarah Catherine; Gomez, Jaime; Hadley, Nicholas John; Kellogg, Richard G; Kirn, Malina; Kolberg, Ted; Lu, Ying; Marionneau, Matthieu; Mignerey, Alice; Pedro, Kevin; Peterman, Alison; Skuja, Andris; Temple, Jeffrey; Tonjes, Marguerite; Tonwar, Suresh C; Twedt, Elizabeth; Apyan, Aram; Bauer, Gerry; Bendavid, Joshua; Busza, Wit; Butz, Erik; Cali, Ivan Amos; Chan, Matthew; Dutta, Valentina; Gomez Ceballos, Guillelmo; Goncharov, Maxim; Hahn, Kristan Allan; Kim, Yongsun; Klute, Markus; Krajczar, Krisztian; Li, Wei; Luckey, Paul David; Ma, Teng; Nahn, Steve; Paus, Christoph; Ralph, Duncan; Roland, Christof; Roland, Gunther; Rudolph, Matthew; Stephans, George; Stöckli, Fabian; Sumorok, Konstanty; Sung, Kevin; Velicanu, Dragos; Wenger, Edward Allen; Wolf, Roger; Wyslouch, Bolek; Yang, Mingming; Yilmaz, Yetkin; Yoon, Sungho; Zanetti, Marco; Cooper, Seth; Dahmes, Bryan; De Benedetti, Abraham; Franzoni, Giovanni; Gude, Alexander; Kao, Shih-Chuan; Klapoetke, Kevin; Kubota, Yuichi; Mans, Jeremy; Pastika, Nathaniel; Rusack, Roger; Sasseville, Michael; Singovsky, Alexander; Tambe, Norbert; Turkewitz, Jared; Cremaldi, Lucien Marcus; Kroeger, Rob; Perera, Lalith; Rahmat, Rahmat; Sanders, David A; Avdeeva, Ekaterina; Bloom, Kenneth; Bose, Suvadeep; Butt, Jamila; Claes, Daniel R; Dominguez, Aaron; Eads, Michael; Keller, Jason; Kravchenko, Ilya; Lazo-Flores, Jose; Malbouisson, Helena; Malik, Sudhir; Snow, Gregory R; Baur, Ulrich; Godshalk, Andrew; Iashvili, Ia; Jain, Supriya; Kharchilava, Avto; Kumar, Ashish; Shipkowski, Simon Peter; Smith, Kenneth; Alverson, George; Barberis, Emanuela; Baumgartel, Darin; Chasco, Matthew; Haley, Joseph; Nash, David; Trocino, Daniele; Wood, Darien; Zhang, Jinzhong; Anastassov, Anton; Kubik, Andrew; Mucia, Nicholas; Odell, Nathaniel; Ofierzynski, Radoslaw Adrian; Pollack, Brian; Pozdnyakov, Andrey; Schmitt, Michael; Stoynev, Stoyan; Velasco, Mayda; Won, Steven; Antonelli, Louis; Berry, Douglas; Brinkerhoff, Andrew; Hildreth, Michael; Jessop, Colin; Karmgard, Daniel John; Kolb, Jeff; Lannon, Kevin; Luo, Wuming; Lynch, Sean; Marinelli, Nancy; Morse, David Michael; Pearson, Tessa; Planer, Michael; Ruchti, Randy; Slaunwhite, Jason; Valls, Nil; Wayne, Mitchell; Wolf, Matthias; Bylsma, Ben; Durkin, Lloyd Stanley; Hill, Christopher; Hughes, Richard; Kotov, Khristian; Ling, Ta-Yung; Puigh, Darren; Rodenburg, Marissa; Vuosalo, Carl; Williams, Grayson; Winer, Brian L; Adam, Nadia; Berry, Edmund; Elmer, Peter; Gerbaudo, Davide; Halyo, Valerie; Hebda, Philip; Hegeman, Jeroen; Hunt, Adam; Jindal, Pratima; Lopes Pegna, David; Lujan, Paul; Marlow, Daniel; Medvedeva, Tatiana; Mooney, Michael; Olsen, James; Piroué, Pierre; Quan, Xiaohang; Raval, Amita; Safdi, Ben; Saka, Halil; Stickland, David; Tully, Christopher; Werner, Jeremy Scott; Zuranski, Andrzej; Acosta, Jhon Gabriel; Brownson, Eric; Huang, Xing Tao; Lopez, Angel; Mendez, Hector; Oliveros, Sandra; Ramirez Vargas, Juan Eduardo; Zatserklyaniy, Andriy; Alagoz, Enver; Barnes, Virgil E; Benedetti, Daniele; Bolla, Gino; Bortoletto, Daniela; De Mattia, Marco; Everett, Adam; Hu, Zhen; Jones, Matthew; Koybasi, Ozhan; Kress, Matthew; Laasanen, Alvin T; Leonardo, Nuno; Maroussov, Vassili; Merkel, Petra; Miller, David Harry; Neumeister, Norbert; Shipsey, Ian; Silvers, David; Svyatkovskiy, Alexey; Vidal Marono, Miguel; Yoo, Hwi Dong; Zablocki, Jakub; Zheng, Yu; Guragain, Samir; Parashar, Neeti; Adair, Antony; Boulahouache, Chaouki; Ecklund, Karl Matthew; Geurts, Frank JM; Padley, Brian Paul; Redjimi, Radia; Roberts, Jay; Zabel, James; Betchart, Burton; Bodek, Arie; Chung, Yeon Sei; Covarelli, Roberto; de Barbaro, Pawel; Demina, Regina; Eshaq, Yossof; Ferbel, Thomas; Garcia-Bellido, Aran; Goldenzweig, Pablo; Han, Jiyeon; Harel, Amnon; Miner, Daniel Carl; Vishnevskiy, Dmitry; Zielinski, Marek; Bhatti, Anwar; Ciesielski, Robert; Demortier, Luc; Goulianos, Konstantin; Lungu, Gheorghe; Malik, Sarah; Mesropian, Christina; Arora, Sanjay; Barker, Anthony; Chou, John Paul; Contreras-Campana, Christian; Contreras-Campana, Emmanuel; Duggan, Daniel; Ferencek, Dinko; Gershtein, Yuri; Gray, Richard; Halkiadakis, Eva; Hidas, Dean; Lath, Amitabh; Panwalkar, Shruti; Park, Michael; Patel, Rishi; Rekovic, Vladimir; Robles, Jorge; Rose, Keith; Salur, Sevil; Schnetzer, Steve; Seitz, Claudia; Somalwar, Sunil; Stone, Robert; Thomas, Scott; Cerizza, Giordano; Hollingsworth, Matthew; Spanier, Stefan; Yang, Zong-Chang; York, Andrew; Eusebi, Ricardo; Flanagan, Will; Gilmore, Jason; Kamon, Teruki; Khotilovich, Vadim; Montalvo, Roy; Osipenkov, Ilya; Pakhotin, Yuriy; Perloff, Alexx; Roe, Jeffrey; Safonov, Alexei; Sakuma, Tai; Sengupta, Sinjini; Suarez, Indara; Tatarinov, Aysen; Toback, David; Akchurin, Nural; Damgov, Jordan; Dragoiu, Cosmin; Dudero, Phillip Russell; Jeong, Chiyoung; Kovitanggoon, Kittikul; Lee, Sung Won; Libeiro, Terence; Roh, Youn; Volobouev, Igor; Appelt, Eric; Delannoy, Andrés G; Florez, Carlos; Greene, Senta; Gurrola, Alfredo; Johns, Willard; Johnston, Cody; Kurt, Pelin; Maguire, Charles; Melo, Andrew; Sharma, Monika; Sheldon, Paul; Snook, Benjamin; Tuo, Shengquan; Velkovska, Julia; Arenton, Michael Wayne; Balazs, Michael; Boutle, Sarah; Cox, Bradley; Francis, Brian; Goodell, Joseph; Hirosky, Robert; Ledovskoy, Alexander; Lin, Chuanzhe; Neu, Christopher; Wood, John; Yohay, Rachel; Gollapinni, Sowjanya; Harr, Robert; Karchin, Paul Edmund; Kottachchi Kankanamge Don, Chamath; Lamichhane, Pramod; Sakharov, Alexandre; Anderson, Michael; Belknap, Donald; Borrello, Laura; Carlsmith, Duncan; Cepeda, Maria; Dasu, Sridhara; Friis, Evan; Gray, Lindsey; Grogg, Kira Suzanne; Grothe, Monika; Hall-Wilton, Richard; Herndon, Matthew; Hervé, Alain; Klabbers, Pamela; Klukas, Jeffrey; Lanaro, Armando; Lazaridis, Christos; Leonard, Jessica; Loveless, Richard; Mohapatra, Ajit; Ojalvo, Isabel; Palmonari, Francesco; Pierro, Giuseppe Antonio; Ross, Ian; Savin, Alexander; Smith, Wesley H; Swanson, Joshua

    2012-01-01

    A measurement is presented of the relative prompt production rate of $\\chi_{c2}$ and $\\chi_{c1}$ with 4.6 inverse femtobarns of data collected by the CMS experiment at the LHC in pp collisions at $\\sqrt{s}$ = 7 TeV. The two states are measured via their radiative decays $\\chi_{c} \\to J/\\psi + \\gamma$, with the photon converting into a dielectron pair for J/$\\psi$ rapidity abs(y(J/$\\psi$)) 0.5 GeV. The measurement is given for six intervals of pt(J/$\\psi$) between 7 and 25 GeV. The results are compared to theoretical predictions.

  9. Characterization of new cell line stably expressing CHI3L1 oncogene

    Directory of Open Access Journals (Sweden)

    Chekhonin V. P.

    2011-06-01

    Full Text Available Aim. To characterize the immortalized 293 cell line after stable transfection with human oncogene (CHI3L1. Methods. 293 cells, stably transfected with pcDNA3.1_CHI3L1, and 293 cells, stably transfected with pcDNA3.1 as a negative control, were used throughout all experiments. The clones of CHI3L1-expressing 293 cells and 293 cells, transfected with pcDNA3.1, were analyzed by immunofluorescence and confocal microscopy. Cell proliferation was measured using MTT assay; analyses of ERK1/2 and AKT activation and their cellular localization were performed with anti-phospho-ERK and anti-phospho-AKT antibodies. Specific activation of MAP and PI3 kinases was measured by densitometric analysis of Western-blot signals. Results. The obtained results show quite modest ability of CHI3L1 to stimulate cell growth and reflect rather an improved cellular plating efficiency of the 293 cells stably transfected with pcDNA3.1_CHI3L1 as compared to the 293 cells transfected with an «empty» vector. ERK1/2 and AKT are activated in the 293_CHI3L1 cells. In these cells phosphorylated ERK1/2 were localized in both cell cytoplasm and nuclei while AKT only in cytoplasm. The 293_CHI3L1 cells differed from the 293 cells, transfected with an «empty» vector, in their size and ability to adhere to the culture plates. Conclusions. The overexpression of CHI3L1 is likely to have an important role in tumorigenesis via a mechanism which involves activation of PI3K and ERK1/2 pathways. The tumors which can be induced by orthotopic implantation of the transformed human cells with overexpressed human oncogene CHI3L1 into the rat brain can be used as a target for anticancer drug development.

  10. A {chi}{sup 2} veto for continuous gravitational wave searches

    Energy Technology Data Exchange (ETDEWEB)

    Sancho de la Jordana, Llucia; Sintes, Alicia M [Departament de Fisica, Universitat de les Illes Balears, Cra. Valldemossa Km. 7.5, E-07122 Palma de Mallorca (Spain)], E-mail: llucia.sancho@uib.es, E-mail: sintes@aei.mpg.de

    2008-09-21

    {chi}{sup 2} vetoes are commonly used in searching for gravitational waves, in particular for broadband signals, but they can also be applied to narrowband continuous wave signals, such as those expected from rapidly rotating neutron stars. In this paper, we present a {chi}{sup 2} veto adapted to the Hough transform searches for continuous gravitational wave signals; we characterize the {chi}{sup 2} significance plane for different frequency bands and discuss the expected performance of this veto in LIGO analysis.

  11. A proposal for a different chi-square function for Poisson distributions

    OpenAIRE

    Almeida Jr., F. M. L.; Barbi, M; Vale, M. A. B. do

    1999-01-01

    We obtain an approximate Gaussian distribution from a Poisson distribution after doing a change of variable. A new chi-square function is obtained which can be used for parameter estimations and goodness-of-fit testing when adjusting curves to histograms. Since the new distribution is approximately Gaussian we can use it even when the bin contents are small. The corresponding chi-square function can be used for curve fitting. This chi-square function is simple to implement and presents a fast...

  12. A randomized controlled trial of tai chi for long-term low back pain (TAI CHI: Study rationale, design, and methods

    Directory of Open Access Journals (Sweden)

    Hall Amanda M

    2009-05-01

    Full Text Available Abstract Background Low back pain persisting for longer than 3 months is a common and costly condition for which many current treatments have low-moderate success rates at best. Exercise is among the more successful treatments for this condition, however, the type and dosage of exercise that elicits the best results is not clearly defined. Tai chi is a gentle form of low intensity exercise that uses controlled movements in combination with relaxation techniques and is currently used as a safe form of exercise for people suffering from other chronic pain conditions such as arthritis. To date, there has been no scientific evaluation of tai chi as an intervention for people with back pain. Thus the aim of this study will be to examine the effects of a tai chi exercise program on pain and disability in people with long-term low back pain. Methods and design The study will recruit 160 healthy individuals from the community setting to be randomised to either a tai chi intervention group or a wait-list control group. Individuals in the tai chi group will attend 2 tai chi sessions (40 minutes/week for 8 weeks followed by 1 tai chi session/week for 2 weeks. The wait-list control will continue their usual health care practices and have the opportunity to participate in the tai chi program once they have completed the follow-up assessments. The primary outcome will be bothersomeness of back symptoms measured with a 0–10 numerical rating scale. Secondary outcomes include, self-reports of pain-related disability, health-related quality of life and global perceived effect of treatment. Statistical analysis of primary and secondary outcomes will be based on the intention to treat principle. Linear mixed models will be used to test for the effect of treatment on outcome at 10 weeks follow up. This trial has received ethics approval from The University of Sydney Human Research Ethics Committee. HREC Approval No.10452 Discussion This study will be the first

  13. Strong interaction physics: from quarks to mesons, baryons and nuclei

    International Nuclear Information System (INIS)

    We summarize some of the important physics issues confronted at the NATO Advanced Research Workshop in Cracow. The topics addressed include modern challenges in understanding baryon and meson structure, hadronic interactions and hadron properties in dense matter. (author)

  14. The Effect of Vector Meson Decays on Dihadron Fragmentation Functions

    CERN Document Server

    Matevosyan, Hrayr H; Bentz, Wolfgang

    2014-01-01

    Dihadron Fragmentation Functions (DFF) provide a vast amount of information on the intricate details of the parton hadronization process. Moreover, they provide a unique access to the "clean" extraction of nucleon transversity parton distribution functions in semi inclusive deep inelastic two hadron production process with a transversely polarised target. On the example of the u \\to \\pi^+ \\pi^-, we analyse the properties of unpolarised DFFs using their probabilistic interpretation. We use both the NJL-jet hadronization model and PYTHIA 8.1 event generator to explore the effect of the strong decays of the vector mesons produced in the quark hadronization process on the pseudoscalar DFFs. Our study shows that, even though it is less probable to produce vector mesons in the hadronization process than pseudo scalar mesons of the same charge, the products of their strong decays drastically affect the DFFs for pions because of the large combinatorial factors. Thus, an accurate description of both vector meson produ...

  15. Enhancement of φ Mesons in Relativistic Nucleus-Nucleus Collisions

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    The фmeson production in relativistic nucleus-nucleus collisions is investigated systematically usinga hadron-string cascade model LUCIAE. Within the framework of the model and relying on the collective

  16. Chiral symmetry and scalar meson in hadron and nuclear physics

    CERN Document Server

    Kunihiro, T

    1995-01-01

    After giving a short introduction to the Nambu-Jona-Lasinio model with an anomaly term, we show the importance of the scalar-scalar correlation in the low-energy hadron dynamics, which correlation may be summarized by a scalar-isoscalar meson, the sigma meson. The discussion is based on the chiral quark model with the sigma-meson degrees of freedom. Possible experiments are proposed to produce the elusive meson in a nucleus and detect it. In relation to a precursory soft mode for the chiral transition, the reason is clarified why the dynamic properties of the superconductor may be described by the diffusive time-dependent Ginzburg-Landau (TDGL) equation. We indicate the chiral symmetry plays a significant role also in nuclei; one may say that the stability of nuclei is due to the chiral symmetry of QCD.

  17. Exotic Behavior of Heavy-Flavored Meson Matter

    CERN Document Server

    Abreu, L M; da Silva, R Rodrigues

    2012-01-01

    In this work, we study the thermodynamic behavior of heavy-flavored meson matter in the framework of $(\\sigma,\\omega)$-meson-exchange model in relativistic mean field theory. We find a decreasing of the effective masses of $D$ and $B$ mesons as the temperature increases. By using the effective mass and maximum value of dissociation temperatures available from lattice QCD, the masses of the bound states $D \\bar{D}$ and $B \\bar{B}$ are estimated in 2 MeV for both molecules. For the $B$-meson matter, the pressure presents an exotic behavior, being negative for temperatures above 6.6 times the deconfinement transition temperature $T_c$. In addition, the ratio of pressure to energy density is similar to the value predicted for systems that behave as dark energy matter.

  18. Scalar mesons in a chiral quark model with glueball

    International Nuclear Information System (INIS)

    Ground-state scalar isoscalar mesons and a scalar glueball are described in a U(3)xU(3) chiral quark model of the Nambu-Jona-Lasinio (NJL) type with 't Hooft interaction. The latter interaction produces singlet-octet mixing in the scalar and pseudoscalar sectors. The glueball is introduced into the effective meson Lagrangian as a dilaton on the basis of scale invariance. The mixing of the glueball with scalar isoscalar quarkonia and amplitudes of their decays into two pseudoscalar mesons are shown to be proportional to current quark masses, vanishing in the chiral limit. Mass spectra of the scalar mesons and the glueball and their main modes of strong decay are described

  19. Sigma meson production in proton-nucleus collisions

    International Nuclear Information System (INIS)

    The sigma meson production is investigated in p + 40Ca and p + 208Pb at the incident energy 1.5 GeV within the Quantum Molecular Dynamics model. The simulation results indicate a distinctive A dependence of the sigma production that the increase of A is followed by an increase of the production cross section. We find that the sigma meson production is strongly medium dependent and the produced sigma mesons decaying in a dense medium experience a stronger mass shift towards lower masses. This mass shift is an experimentally accessible observable in the final state pion pairs, which did not suffer absorption by the surrounding nucleons. It is pointed out that the ratio of measured sigma cross-sections as a function of the sigma invariant-mass from various reactions is a good probe to explore the existence of the sigma meson in dense nuclear environment. (author)

  20. pi K scattering in effective chiral theory of mesons

    OpenAIRE

    Li, Bing An; Gao, Dao-Neng; Yan, Mu-Lin

    1998-01-01

    In the framework of an effective chiral theory of mesons, pi K scattering is stydied. The scattering lengths, phase shifts, and cross sections are calculated. Theoretical results agree well with data. There is no new parameter in this study.