
Sample records for chi b0-10235 mesons

  1. Production of $\\chi_{c2}$ Mesons in Photon-Photon Collisions at LEP

    CERN Document Server

    Ackerstaff, K.; Allison, John; Altekamp, N.; Anderson, K.J.; Anderson, S.; Arcelli, S.; Asai, S.; Ashby, S.F.; Axen, D.; Azuelos, G.; Ball, A.H.; Barberio, E.; Barlow, Roger J.; Bartoldus, R.; Batley, J.R.; Baumann, S.; Bechtluft, J.; Behnke, T.; Bell, Kenneth Watson; Bella, G.; Bellerive, A.; Bentvelsen, S.; Bethke, S.; Betts, S.; Biebel, O.; Biguzzi, A.; Bird, S.D.; Blobel, V.; Bloodworth, I.J.; Bobinski, M.; Bock, P.; Bohme, J.; Boutemeur, M.; Braibant, S.; Bright-Thomas, P.; Brown, Robert M.; Burckhart, H.J.; Burgard, C.; Burgin, R.; Capiluppi, P.; Carnegie, R.K.; Carter, A.A.; Carter, J.R.; Chang, C.Y.; Charlton, David G.; Chrisman, D.; Ciocca, C.; Clarke, P.E.L.; Clay, E.; Cohen, I.; Conboy, J.E.; Cooke, O.C.; Couyoumtzelis, C.; Coxe, R.L.; Cuffiani, M.; Dado, S.; Dallavalle, G.Marco; Davis, R.; De Jong, S.; del Pozo, L.A.; De Roeck, A.; Desch, K.; Dienes, B.; Dixit, M.S.; Dubbert, J.; Duchovni, E.; Duckeck, G.; Duerdoth, I.P.; Eatough, D.; Estabrooks, P.G.; Etzion, E.; Evans, H.G.; Fabbri, F.; Fanfani, A.; Fanti, M.; Faust, A.A.; Fiedler, F.; Fierro, M.; Fleck, I.; Folman, R.; Furtjes, A.; Futyan, D.I.; Gagnon, P.; Gary, J.W.; Gascon, J.; Gascon-Shotkin, S.M.; Gaycken, G.; Geich-Gimbel, C.; Giacomelli, G.; Giacomelli, P.; Gibson, V.; Gibson, W.R.; Gingrich, D.M.; Glenzinski, D.; Goldberg, J.; Gorn, W.; Grandi, C.; Gross, E.; Grunhaus, J.; Gruwe, M.; Hanson, G.G.; Hansroul, M.; Hapke, M.; Harder, K.; Hargrove, C.K.; Hartmann, C.; Hauschild, M.; Hawkes, C.M.; Hawkings, R.; Hemingway, R.J.; Herndon, M.; Herten, G.; Heuer, R.D.; Hildreth, M.D.; Hill, J.C.; Hillier, S.J.; Hobson, P.R.; Hocker, James Andrew; Homer, R.J.; Honma, A.K.; Horvath, D.; Hossain, K.R.; Howard, R.; Huntemeyer, P.; Igo-Kemenes, P.; Imrie, D.C.; Ishii, K.; Jacob, F.R.; Jawahery, A.; Jeremie, H.; Jimack, M.; Jones, C.R.; Jovanovic, P.; Junk, T.R.; Karlen, D.; Kartvelishvili, V.; Kawagoe, K.; Kawamoto, T.; Kayal, P.I.; Keeler, R.K.; Kellogg, R.G.; Kennedy, B.W.; Klier, A.; Kluth, S.; Kobayashi, T.; Kobel, M.; Koetke, D.S.; Kokott, T.P.; Kolrep, M.; Komamiya, S.; Kowalewski, Robert V.; Kress, T.; Krieger, P.; von Krogh, J.; Kuhl, T.; Kyberd, P.; Lafferty, G.D.; Lanske, D.; Lauber, J.; Lautenschlager, S.R.; Lawson, I.; Layter, J.G.; Lazic, D.; Lee, A.M.; Lellouch, D.; Letts, J.; Levinson, L.; Liebisch, R.; List, B.; Littlewood, C.; Lloyd, A.W.; Lloyd, S.L.; Loebinger, F.K.; Long, G.D.; Losty, M.J.; Ludwig, J.; Lui, D.; Macchiolo, A.; Macpherson, A.; Mader, W.; Mannelli, M.; Marcellini, S.; Markopoulos, C.; Martin, A.J.; Martin, J.P.; Martinez, G.; Mashimo, T.; Mattig, Peter; McDonald, W.John; McKenna, J.; Mckigney, E.A.; McMahon, T.J.; McPherson, R.A.; Meijers, F.; Menke, S.; Merritt, F.S.; Mes, H.; Meyer, J.; Michelini, A.; Mihara, S.; Mikenberg, G.; Miller, D.J.; Mir, R.; Mohr, W.; Montanari, A.; Mori, T.; Nagai, K.; Nakamura, I.; Neal, H.A.; Nellen, B.; Nisius, R.; O'Neale, S.W.; Oakham, F.G.; Odorici, F.; Ogren, H.O.; Oreglia, M.J.; Orito, S.; Palinkas, J.; Pasztor, G.; Pater, J.R.; Patrick, G.N.; Patt, J.; Perez-Ochoa, R.; Petzold, S.; Pfeifenschneider, P.; Pilcher, J.E.; Pinfold, J.; Plane, David E.; Poffenberger, P.; Poli, B.; Polok, J.; Przybycien, M.; Rembser, C.; Rick, H.; Robertson, S.; Robins, S.A.; Rodning, N.; Roney, J.M.; Roscoe, K.; Rossi, A.M.; Rozen, Y.; Runge, K.; Runolfsson, O.; Rust, D.R.; Sachs, K.; Saeki, T.; Sahr, O.; Sang, W.M.; Sarkisian, E.K.G.; Sbarra, C.; Schaile, A.D.; Schaile, O.; Scharf, F.; Scharff-Hansen, P.; Schieck, J.; Schmitt, B.; Schmitt, S.; Schoning, A.; Schroder, Matthias; Schumacher, M.; Schwick, C.; Scott, W.G.; Seuster, R.; Shears, T.G.; Shen, B.C.; Shepherd-Themistocleous, C.H.; Sherwood, P.; Siroli, G.P.; Sittler, A.; Skuja, A.; Smith, A.M.; Snow, G.A.; Sobie, R.; Soldner-Rembold, S.; Sproston, M.; Stahl, A.; Stephens, K.; Steuerer, J.; Stoll, K.; Strom, David M.; Strohmer, R.; Surrow, B.; Talbot, S.D.; Tanaka, S.; Taras, P.; Tarem, S.; Teuscher, R.; Thiergen, M.; Thomson, M.A.; von Torne, E.; Torrence, E.; Towers, S.; Trigger, I.; Trocsanyi, Z.; Tsur, E.; Turcot, A.S.; Turner-Watson, M.F.; Van Kooten, Rick J.; Vannerem, P.; Verzocchi, M.; Voss, H.; Wackerle, F.; Wagner, A.; Ward, C.P.; Ward, D.R.; Watkins, P.M.; Watson, A.T.; Watson, N.K.; Wells, P.S.; Wermes, N.; White, J.S.; Wilson, G.W.; Wilson, J.A.; Wyatt, T.R.; Yamashita, S.; Yekutieli, G.; Zacek, V.; Zer-Zion, D.


    We present an observation at LEP of the production of chi_c2 mesons in the collisions of two quasi-real photons using the OPAL detector. The chi_c2 mesons are reconstructed in the decay channel Chi_c2 to J/psi gamma to l+l- gamma (with l= e,mu) using all data taken at e+e- centre-of-mass energies of 91 and 183 GeV, corresponding to integrated luminosities of 167 and 55 pb-1 respectively. The two-photon width of the Chi_2 is determined to be 1.76 +- 0.47 +- 0.37 +- 0.15 keV where the first error is statistical, the second is systematic and the third comes from branching ratio uncertainties.

  2. Observation of chi(c1) Decays into Vector Meson Pairs phi phi, omega omega, and omega phi

    NARCIS (Netherlands)

    Ablikim, M.; Achasov, M. N.; An, L.; An, Q.; An, Z. H.; Bai, J. Z.; Baldini, R.; Ban, Y.; Becker, J.; Berger, N.; Bertani, M.; Bian, J. M.; Bondarenko, O.; Boyko, I.; Briere, R. A.; Bytev, V.; Cai, X.; Cao, G. F.; Cao, X. X.; Chang, J. F.; Chelkov, G.; Chen, G.; Chen, H. S.; Chen, J. C.; Chen, M. L.; Chen, S. J.; Chen, Y.; Chen, Y. B.; Cheng, H. P.; Chu, Y. P.; Cronin-Hennessy, D.; Dai, H. L.; Dai, J. P.; Dedovich, D.; Deng, Z. Y.; Denysenko, I.; Destefanis, M.; Ding, Y.; Dong, L. Y.; Dong, M. Y.; Du, S. X.; Duan, M. Y.; Fan, R. R.; Fang, J.; Fang, S. S.; Feng, C. Q.; Fu, C. D.; Fu, J. L.; Gao, Y.; Geng, C.; Goetzen, K.; Gong, W. X.; Greco, M.; Grishin, S.; Gu, M. H.; Gu, Y. T.; Guan, Y. H.; Guo, A. Q.; Guo, L. B.; Guo, Y. P.; Hao, X. Q.; Harris, F. A.; He, K. L.; He, M.; He, Z. Y.; Heng, Y. K.; Hou, Z. L.; Hu, H. M.; Hu, J. F.; Hu, T.; Huang, B.; Huang, G. M.; Huang, J. S.; Huang, X. T.; Huang, Y. P.; Hussain, T.; Ji, C. S.; Ji, Q.; Ji, X. B.; Ji, X. L.; Jia, L. K.; Jiang, L. L.; Jiang, X. S.; Jiao, J. B.; Jiao, Z.; Jin, D. P.; Jin, S.; Jing, F. F.; Kavatsyuk, M.; Komamiya, S.; Kuehn, W.; Lange, J. S.; Leung, J. K. C.; Li, Cheng; Li, Cui; Li, D. M.; Li, F.; Li, G.; Li, H. B.; Li, J. C.; Li, Lei; Li, N. B.; Li, Q. J.; Li, W. D.; Li, W. G.; Li, X. L.; Li, X. N.; Li, X. Q.; Li, X. R.; Li, Z. B.; Liang, H.; Liang, Y. F.; Liang, Y. T.; Liao, G. R.; Liao, X. T.; Liu, B. J.; Liu, B. J.; Liu, C. L.; Liu, C. X.; Liu, C. Y.; Liu, F. H.; Liu, Fang; Liu, Feng; Liu, G. C.; Liu, H.; Liu, H. B.; Liu, H. M.; Liu, H. W.; Liu, J. P.; Liu, K.; Liu, K. Y.; Liu, Q.; Liu, S. B.; Liu, X.; Liu, X. H.; Liu, Y. B.; Liu, Y. W.; Liu, Yong; Liu, Z. A.; Liu, Z. Q.; Loehner, H.; Lu, G. R.; Lu, H. J.; Lu, J. G.; Lu, Q. W.; Lu, X. R.; Lu, Y. P.; Luo, C. L.; Luo, M. X.; Luo, T.; Luo, X. L.; Ma, C. L.; Ma, F. C.; Ma, H. L.; Ma, Q. M.; Ma, T.; Ma, X.; Ma, X. Y.; Maggiora, M.; Malik, Q. A.; Mao, H.; Mao, Y. J.; Mao, Z. P.; Messchendorp, J. G.; Min, J.; Mitchell, R. E.; Mo, X. H.; Muchnoi, N. Yu.; Nefedov, Y.; Ning, Z.; Olsen, S. L.; Ouyang, Q.; Pacetti, S.; Pelizaeus, M.; Peters, K.; Ping, J. L.; Ping, R. G.; Poling, R.; Pun, C. S. J.; Qi, M.; Qian, S.; Qiao, C. F.; Qin, X. S.; Qiu, J. F.; Rashid, K. H.; Rong, G.; Ruan, X. D.; Sarantsev, A.; Schulze, J.; Shao, M.; Shen, C. P.; Shen, X. Y.; Sheng, H. Y.; Shepherd, M. R.; Song, X. Y.; Sonoda, S.; Spataro, S.; Spruck, B.; Sun, D. H.; Sun, G. X.; Sun, J. F.; Sun, S. S.; Sun, X. D.; Sun, Y. J.; Sun, Y. Z.; Sun, Z. J.; Sun, Z. T.; Tang, C. J.; Tang, X.; Tang, X. F.; Tian, H. L.; Toth, D.; Varner, G. S.; Wan, X.; Wang, B. Q.; Wang, K.; Wang, L. L.; Wang, L. S.; Wang, M.; Wang, P.; Wang, P. L.; Wang, Q.; Wang, S. G.; Wang, X. L.; Wang, Y. D.; Wang, Y. F.; Wang, Y. Q.; Wang, Z.; Wang, Z. G.; Wang, Z. Y.; Wei, D. H.; Wen, Q. G.; Wen, S. P.; Wiedner, U.; Wu, L. H.; Wu, N.; Wu, W.; Wu, Z.; Xiao, Z. J.; Xie, Y. G.; Xu, G. F.; Xu, G. M.; Xu, H.; Xu, Y.; Xu, Z. R.; Xu, Z. Z.; Xue, Z.; Yan, L.; Yan, W. B.; Yan, Y. H.; Yang, H. X.; Yang, M.; Yang, T.; Yang, Y.; Yang, Y. X.; Ye, M.; Ye, M. H.; Yu, B. X.; Yu, C. X.; Yu, L.; Yuan, C. Z.; Yuan, W. L.; Yuan, Y.; Zafar, A. A.; Zallo, A.; Zeng, Y.; Zhang, B. X.; Zhang, B. Y.; Zhang, C. C.; Zhang, D. H.; Zhang, H. H.; Zhang, H. Y.; Zhang, J.; Zhang, J. W.; Zhang, J. Y.; Zhang, J. Z.; Zhang, L.; Zhang, S. H.; Zhang, T. R.; Zhang, X. J.; Zhang, X. Y.; Zhang, Y.; Zhang, Y. H.; Zhang, Z. P.; Zhang, Z. Y.; Zhao, G.; Zhao, H. S.; Zhao, Jiawei; Zhao, Jingwei; Zhao, Lei; Zhao, Ling; Zhao, M. G.; Zhao, Q.; Zhao, S. J.; Zhao, T. C.; Zhao, X. H.; Zhao, Y. B.; Zhao, Z. G.; Zhao, Z. L.; Zhemchugov, A.; Zheng, B.; Zheng, J. P.; Zheng, Y. H.; Zheng, Z. P.; Zhong, B.; Zhong, J.; Zhong, L.; Zhou, L.; Zhou, X. K.; Zhou, X. R.; Zhu, C.; Zhu, K.; Zhu, K. J.; Zhu, S. H.; Zhu, X. L.; Zhu, X. W.; Zhu, Y. S.; Zhu, Z. A.; Zhuang, J.; Zou, B. S.; Zou, J. H.; Zuo, J. X.; Zweber, P.


    Using (106 +/- 4) x 10(6) psi(3686) events accumulated with the BESIII detector at the BEPCII e(+) e(-) collider, we present the first measurement of decays of chi(c1) to vector meson pairs phi phi, omega omega, and omega phi. The branching fractions are measured to be (4.4 +/- 0.3 +/- 0.5) x

  3. Study of the exclusive production of the Meson $ \\chi_{c0}$ in CMS / LHC Experiment

    CERN Document Server

    Da Silva Ramos Carneiro, Marilia


    We present a study of the central exclusive pro duction of the c 0 meson in pp collisions at p s = 7 TeV in the CMS detector at the LHC collider. The c 0 is a c c meson state with the same quantum numb ers as the Higgs b oson, so it's observation is a go o d opp ortunity to test the exclusive pro duction mechanism. We b egin with a brief description of the Standard Mo del, diraction physics and the exp erimental environment. The analysis was done using data collected in 2010 by CMS. We p erformed eciency studies using real data and a sample of simulated Monte Carlo events and a preliminary estimation of the cross section

  4. Tensor meson dominance and e+e--physics

    International Nuclear Information System (INIS)

    Genz, H.; Karlsruhe Univ.; Mallik, S.


    The phenomenological status of tensor meson dominance is reported. Some new results concerning hadronic decays of the 2 ++ -meson chi 2 (3.55) and the heavy lepton tau are also included. Considering experimental errors, tensor meson dominance is in agreement with experiment. (author)

  5. Measurement of the relative rate of prompt $\\chi_{c0}$, $\\chi_{c1}$ and $\\chi_{c2}$ production at $\\sqrt{s}=7$TeV

    CERN Document Server

    Aaij, R; Adinolfi, M; Adrover, C; Affolder, A; Ajaltouni, Z; Albrecht, J; Alessio, F; Alexander, M; Ali, S; Alkhazov, G; Alvarez Cartelle, P; Alves Jr, A A; Amato, S; Amerio, S; Amhis, Y; Anderlini, L; Anderson, J; Andreassen, R; Andrews, J E; Appleby, R B; Aquines Gutierrez, O; Archilli, F; Artamonov, A; Artuso, M; Aslanides, E; Auriemma, G; Baalouch, M; Bachmann, S; Back, J J; Baesso, C; Balagura, V; Baldini, W; Barlow, R J; Barschel, C; Barsuk, S; Barter, W; Bauer, Th; Bay, A; Beddow, J; Bedeschi, F; Bediaga, I; Belogurov, S; Belous, K; Belyaev, I; Ben-Haim, E; Bencivenni, G; Benson, S; Benton, J; Berezhnoy, A; Bernet, R; Bettler, M -O; van Beuzekom, M; Bien, A; Bifani, S; Bird, T; Bizzeti, A; Bjørnstad, P M; Blake, T; Blanc, F; Blouw, J; Blusk, S; Bocci, V; Bondar, A; Bondar, N; Bonivento, W; Borghi, S; Borgia, A; Bowcock, T J V; Bowen, E; Bozzi, C; Brambach, T; van den Brand, J; Bressieux, J; Brett, D; Britsch, M; Britton, T; Brook, N H; Brown, H; Burducea, I; Bursche, A; Busetto, G; Buytaert, J; Cadeddu, S; Callot, O; Calvi, M; Calvo Gomez, M; Camboni, A; Campana, P; Campora Perez, D; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carranza-Mejia, H; Carson, L; Carvalho Akiba, K; Casse, G; Castillo Garcia, L; Cattaneo, M; Cauet, Ch; Cenci, R; Charles, M; Charpentier, Ph; Chen, P; Chiapolini, N; Chrzaszcz, M; Ciba, K; Cid Vidal, X; Ciezarek, G; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Coca, C; Coco, V; Cogan, J; Cogneras, E; Collins, P; Comerma-Montells, A; Contu, A; Cook, A; Coombes, M; Coquereau, S; Corti, G; Couturier, B; Cowan, G A; Craik, D C; Cunliffe, S; Currie, R; D'Ambrosio, C; David, P; David, P N Y; Davis, A; De Bonis, I; De Bruyn, K; De Capua, S; De Cian, M; De Miranda, J M; De Paula, L; De Silva, W; De Simone, P; Decamp, D; Deckenhoff, M; Del Buono, L; Déléage, N; Derkach, D; Deschamps, O; Dettori, F; Di Canto, A; Dijkstra, H; Dogaru, M; Donleavy, S; Dordei, F; Dosil Suárez, A; Dossett, D; Dovbnya, A; Dupertuis, F; Durante, P; Dzhelyadin, R; Dziurda, A; Dzyuba, A; Easo, S; Egede, U; Egorychev, V; Eidelman, S; van Eijk, D; Eisenhardt, S; Eitschberger, U; Ekelhof, R; Eklund, L; El Rifai, I; Elsasser, Ch; Falabella, A; Färber, C; Fardell, G; Farinelli, C; Farry, S; Fave, V; Ferguson, D; Fernandez Albor, V; Ferreira Rodrigues, F; Ferro-Luzzi, M; Filippov, S; Fiore, M; Fitzpatrick, C; Fontana, M; Fontanelli, F; Forty, R; Francisco, O; Frank, M; Frei, C; Frosini, M; Furcas, S; Furfaro, E; Gallas Torreira, A; Galli, D; Gandelman, M; Gandini, P; Gao, Y; Garofoli, J; Garosi, P; Garra Tico, J; Garrido, L; Gaspar, C; Gauld, R; Gersabeck, E; Gersabeck, M; Gershon, T; Ghez, Ph; Gibson, V; Giubega, L; Gligorov, V V; Göbel, C; Golubkov, D; Golutvin, A; Gomes, A; Gordon, H; Grabalosa Gándara, M; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graziani, G; Grecu, A; Greening, E; Gregson, S; Griffith, P; Grünberg, O; Gui, B; Gushchin, E; Guz, Yu; Gys, T; Hadjivasiliou, C; Haefeli, G; Haen, C; Haines, S C; Hall, S; Hamilton, B; Hampson, T; Hansmann-Menzemer, S; Harnew, N; Harnew, S T; Harrison, J; Hartmann, T; He, J; Head, T; Heijne, V; Hennessy, K; Henrard, P; Hernando Morata, J A; van Herwijnen, E; Hicheur, A; Hicks, E; Hill, D; Hoballah, M; Hombach, C; Hopchev, P; Hulsbergen, W; Hunt, P; Huse, T; Hussain, N; Hutchcroft, D; Hynds, D; Iakovenko, V; Idzik, M; Ilten, P; Jacobsson, R; Jaeger, A; Jans, E; Jaton, P; Jawahery, A; Jing, F; John, M; Johnson, D; Jones, C R; Joram, C; Jost, B; Kaballo, M; Kandybei, S; Kanso, W; Karacson, M; Karbach, T M; Kenyon, I R; Ketel, T; Keune, A; Khanji, B; Kochebina, O; Komarov, I; Koopman, R F; Koppenburg, P; Korolev, M; Kozlinskiy, A; Kravchuk, L; Kreplin, K; Kreps, M; Krocker, G; Krokovny, P; Kruse, F; Kucharczyk, M; Kudryavtsev, V; Kvaratskheliya, T; La Thi, V N; Lacarrere, D; Lafferty, G; Lai, A; Lambert, D; Lambert, R W; Lanciotti, E; Lanfranchi, G; Langenbruch, C; Latham, T; Lazzeroni, C; Le Gac, R; van Leerdam, J; Lees, J -P; Lefèvre, R; Leflat, A; Lefrançois, J; Leo, S; Leroy, O; Lesiak, T; Leverington, B; Li, Y; Li Gioi, L; Liles, M; Lindner, R; Linn, C; Liu, B; Liu, G; Lohn, S; Longstaff, I; Lopes, J H; Lopez-March, N; Lu, H; Lucchesi, D; Luisier, J; Luo, H; Machefert, F; Machikhiliyan, I V; Maciuc, F; Maev, O; Malde, S; Manca, G; Mancinelli, G; Maratas, J; Marconi, U; Märki, R; Marks, J; Martellotti, G; Martens, A; Martín Sánchez, A; Martinelli, M; Martinez Santos, D; Martins Tostes, D; Massafferri, A; Matev, R; Mathe, Z; Matteuzzi, C; Maurice, E; Mazurov, A; Mc Skelly, B; McCarthy, J; McNab, A; McNulty, R; Meadows, B; Meier, F; Meissner, M; Merk, M; Milanes, D A; Minard, M -N; Molina Rodriguez, J; Monteil, S; Moran, D; Morawski, P; Mordà, A; Morello, M J; Mountain, R; Mous, I; Muheim, F; Müller, K; Muresan, R; Muryn, B; Muster, B; Naik, P; Nakada, T; Nandakumar, R; Nasteva, I; Needham, M; Neubert, S; Neufeld, N; Nguyen, A D; Nguyen, T D; Nguyen-Mau, C; Nicol, M; Niess, V; Niet, R; Nikitin, N; Nikodem, T; Nomerotski, A; Novoselov, A; Oblakowska-Mucha, A; Obraztsov, V; Oggero, S; Ogilvy, S; Okhrimenko, O; Oldeman, R; Orlandea, M; Otalora Goicochea, J M; Owen, P; Oyanguren, A; Pal, B K; Palano, A; Palutan, M; Panman, J; Papanestis, A; Pappagallo, M; Parkes, C; Parkinson, C J; Passaleva, G; Patel, G D; Patel, M; Patrick, G N; Patrignani, C; Pavel-Nicorescu, C; Pazos Alvarez, A; Pellegrino, A; Penso, G; Pepe Altarelli, M; Perazzini, S; Perez Trigo, E; Pérez-Calero Yzquierdo, A; Perret, P; Perrin-Terrin, M; Pessina, G; Petridis, K; Petrolini, A; Phan, A; Picatoste Olloqui, E; Pietrzyk, B; Pilař, T; Pinci, D; Playfer, S; Plo Casasus, M; Polci, F; Polok, G; Poluektov, A; Polycarpo, E; Popov, A; Popov, D; Popovici, B; Potterat, C; Powell, A; Prisciandaro, J; Pritchard, A; Prouve, C; Pugatch, V; Puig Navarro, A; Punzi, G; Qian, W; Rademacker, J H; Rakotomiaramanana, B; Rangel, M S; Raniuk, I; Rauschmayr, N; Raven, G; Redford, S; Reid, M M; dos Reis, A C; Ricciardi, S; Richards, A; Rinnert, K; Rives Molina, V; Roa Romero, D A; Robbe, P; Roberts, D A; Rodrigues, E; Rodriguez Perez, P; Roiser, S; Romanovsky, V; Romero Vidal, A; Rouvinet, J; Ruf, T; Ruffini, F; Ruiz, H; Ruiz Valls, P; Sabatino, G; Saborido Silva, J J; Sagidova, N; Sail, P; Saitta, B; Salustino Guimaraes, V; Salzmann, C; Sanmartin Sedes, B; Sannino, M; Santacesaria, R; Santamarina Rios, C; Santovetti, E; Sapunov, M; Sarti, A; Satriano, C; Satta, A; Savrie, M; Savrina, D; Schaack, P; Schiller, M; Schindler, H; Schlupp, M; Schmelling, M; Schmidt, B; Schneider, O; Schopper, A; Schune, M -H; Schwemmer, R; Sciascia, B; Sciubba, A; Seco, M; Semennikov, A; Senderowska, K; Sepp, I; Serra, N; Serrano, J; Seyfert, P; Shapkin, M; Shapoval, I; Shatalov, P; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, O; Shevchenko, V; Shires, A; Silva Coutinho, R; Sirendi, M; Skwarnicki, T; Smith, N A; Smith, E; Smith, J; Smith, M; Sokoloff, M D; Soler, F J P; Soomro, F; Souza, D; Souza De Paula, B; Spaan, B; Sparkes, A; Spradlin, P; Stagni, F; Stahl, S; Steinkamp, O; Stevenson, S; Stoica, S; Stone, S; Storaci, B; Straticiuc, M; Straumann, U; Subbiah, V K; Sun, L; Swientek, S; Syropoulos, V; Szczekowski, M; Szczypka, P; Szumlak, T; T'Jampens, S; Teklishyn, M; Teodorescu, E; Teubert, F; Thomas, C; Thomas, E; van Tilburg, J; Tisserand, V; Tobin, M; Tolk, S; Tonelli, D; Topp-Joergensen, S; Torr, N; Tournefier, E; Tourneur, S; Tran, M T; Tresch, M; Tsaregorodtsev, A; Tsopelas, P; Tuning, N; Ubeda Garcia, M; Ukleja, A; Urner, D; Ustyuzhanin, A; Uwer, U; Vagnoni, V; Valenti, G; Vallier, A; Van Dijk, M; Vazquez Gomez, R; Vazquez Regueiro, P; Vázquez Sierra, C; Vecchi, S; Velthuis, J J; Veltri, M; Veneziano, G; Vesterinen, M; Viaud, B; Vieira, D; Vilasis-Cardona, X; Vollhardt, A; Volyanskyy, D; Voong, D; Vorobyev, A; Vorobyev, V; Voß, C; Voss, H; Waldi, R; Wallace, C; Wallace, R; Wandernoth, S; Wang, J; Ward, D R; Watson, N K; Webber, A D; Websdale, D; Whitehead, M; Wicht, J; Wiechczynski, J; Wiedner, D; Wiggers, L; Wilkinson, G; Williams, M P; Williams, M; Wilson, F F; Wimberley, J; Wishahi, J; Witek, M; Wotton, S A; Wright, S; Wu, S; Wyllie, K; Xie, Y; Xing, Z; Yang, Z; Young, R; Yuan, X; Yushchenko, O; Zangoli, M; Zavertyaev, M; Zhang, F; Zhang, L; Zhang, W C; Zhang, Y; Zhelezov, A; Zhokhov, A; Zhong, L; Zvyagin, A


    Prompt production of charmonium $\\chi_{c0}$, $\\chi_{c1}$ and $\\chi_{c2}$ mesons is studied using proton-proton collisions at the LHC at a centre-of-mass energy of $\\sqrt{s}=7$TeV. The $\\chi_{c}$ mesons are identified through their decay to $J/\\psi\\gamma$, with $J/\\psi\\rightarrow\\mu^+mu^-$ using photons that converted in the detector. A data sample, corresponding to an integrated luminosity of $1.0\\mathrm{fb}^{-1}$ collected by the LHCb detector, is used to measure the relative prompt production rate of $\\chi_{c1}$ and $\\chi_{c2}$ in the rapidity range $2.0chi_{c0}$ meson production at a hadron collider is also presented.

  6. Measurement of the $\\chi_b(3P)$ mass and of the relative rate of $\\chi_{b1}(1P)$ and $\\chi_{b2}(1P)$ production

    CERN Document Server

    Aaij, Roel; Adinolfi, Marco; Affolder, Anthony; Ajaltouni, Ziad; Akar, Simon; Albrecht, Johannes; Alessio, Federico; Alexander, Michael; Ali, Suvayu; Alkhazov, Georgy; Alvarez Cartelle, Paula; Alves Jr, Antonio Augusto; Amato, Sandra; Amerio, Silvia; Amhis, Yasmine; An, Liupan; Anderlini, Lucio; Anderson, Jonathan; Andreassen, Rolf; Andreotti, Mirco; Andrews, Jason; Appleby, Robert; Aquines Gutierrez, Osvaldo; Archilli, Flavio; Artamonov, Alexander; Artuso, Marina; Aslanides, Elie; Auriemma, Giulio; Baalouch, Marouen; Bachmann, Sebastian; Back, John; Badalov, Alexey; Baesso, Clarissa; Baldini, Wander; Barlow, Roger; Barschel, Colin; Barsuk, Sergey; Barter, William; Batozskaya, Varvara; Battista, Vincenzo; Bay, Aurelio; Beaucourt, Leo; Beddow, John; Bedeschi, Franco; Bediaga, Ignacio; Belogurov, Sergey; Belous, Konstantin; Belyaev, Ivan; Ben-Haim, Eli; Bencivenni, Giovanni; Benson, Sean; Benton, Jack; Berezhnoy, Alexander; Bernet, Roland; Bettler, Marc-Olivier; van Beuzekom, Martinus; Bien, Alexander; Bifani, Simone; Bird, Thomas; Bizzeti, Andrea; Bjørnstad, Pål Marius; Blake, Thomas; Blanc, Frédéric; Blouw, Johan; Blusk, Steven; Bocci, Valerio; Bondar, Alexander; Bondar, Nikolay; Bonivento, Walter; Borghi, Silvia; Borgia, Alessandra; Borsato, Martino; Bowcock, Themistocles; Bowen, Espen Eie; Bozzi, Concezio; Brambach, Tobias; van den Brand, Johannes; Bressieux, Joël; Brett, David; Britsch, Markward; Britton, Thomas; Brodzicka, Jolanta; Brook, Nicholas; Brown, Henry; Bursche, Albert; Busetto, Giovanni; Buytaert, Jan; Cadeddu, Sandro; Calabrese, Roberto; Calvi, Marta; Calvo Gomez, Miriam; Campana, Pierluigi; Campora Perez, Daniel; Carbone, Angelo; Carboni, Giovanni; Cardinale, Roberta; Cardini, Alessandro; Carson, Laurence; Carvalho Akiba, Kazuyoshi; Casse, Gianluigi; Cassina, Lorenzo; Castillo Garcia, Lucia; Cattaneo, Marco; Cauet, Christophe; Cenci, Riccardo; Charles, Matthew; Charpentier, Philippe; Chefdeville, Maximilien; Chen, Shanzhen; Cheung, Shu-Faye; Chiapolini, Nicola; Chrzaszcz, Marcin; Ciba, Krzystof; Cid Vidal, Xabier; Ciezarek, Gregory; Clarke, Peter; Clemencic, Marco; Cliff, Harry; Closier, Joel; Coco, Victor; Cogan, Julien; Cogneras, Eric; Cojocariu, Lucian; Collins, Paula; Comerma-Montells, Albert; Contu, Andrea; Cook, Andrew; Coombes, Matthew; Coquereau, Samuel; Corti, Gloria; Corvo, Marco; Counts, Ian; Couturier, Benjamin; Cowan, Greig; Craik, Daniel Charles; Cruz Torres, Melissa Maria; Cunliffe, Samuel; Currie, Robert; D'Ambrosio, Carmelo; Dalseno, Jeremy; David, Pascal; David, Pieter; Davis, Adam; De Bruyn, Kristof; De Capua, Stefano; De Cian, Michel; De Miranda, Jussara; De Paula, Leandro; De Silva, Weeraddana; De Simone, Patrizia; Decamp, Daniel; Deckenhoff, Mirko; Del Buono, Luigi; Déléage, Nicolas; Derkach, Denis; Deschamps, Olivier; Dettori, Francesco; Di Canto, Angelo; Dijkstra, Hans; Donleavy, Stephanie; Dordei, Francesca; Dorigo, Mirco; Dosil Suárez, Alvaro; Dossett, David; Dovbnya, Anatoliy; Dreimanis, Karlis; Dujany, Giulio; Dupertuis, Frederic; Durante, Paolo; Dzhelyadin, Rustem; Dziurda, Agnieszka; Dzyuba, Alexey; Easo, Sajan; Egede, Ulrik; Egorychev, Victor; Eidelman, Semen; Eisenhardt, Stephan; Eitschberger, Ulrich; Ekelhof, Robert; Eklund, Lars; El Rifai, Ibrahim; Elsasser, Christian; Ely, Scott; Esen, Sevda; Evans, Hannah Mary; Evans, Timothy; Falabella, Antonio; Färber, Christian; Farinelli, Chiara; Farley, Nathanael; Farry, Stephen; Fay, Robert; Ferguson, Dianne; Fernandez Albor, Victor; Ferreira Rodrigues, Fernando; Ferro-Luzzi, Massimiliano; Filippov, Sergey; Fiore, Marco; Fiorini, Massimiliano; Firlej, Miroslaw; Fitzpatrick, Conor; Fiutowski, Tomasz; Fontana, Marianna; Fontanelli, Flavio; Forty, Roger; Francisco, Oscar; Frank, Markus; Frei, Christoph; Frosini, Maddalena; Fu, Jinlin; Furfaro, Emiliano; Gallas Torreira, Abraham; Galli, Domenico; Gallorini, Stefano; Gambetta, Silvia; Gandelman, Miriam; Gandini, Paolo; Gao, Yuanning; García Pardiñas, Julián; Garofoli, Justin; Garra Tico, Jordi; Garrido, Lluis; Gaspar, Clara; Gauld, Rhorry; Gavardi, Laura; Gavrilov, Gennadii; Geraci, Angelo; Gersabeck, Evelina; Gersabeck, Marco; Gershon, Timothy; Ghez, Philippe; Gianelle, Alessio; Gianì, Sebastiana; Gibson, Valerie; Giubega, Lavinia-Helena; Gligorov, V.V.; Göbel, Carla; Golubkov, Dmitry; Golutvin, Andrey; Gomes, Alvaro; Gotti, Claudio; Grabalosa Gándara, Marc; Graciani Diaz, Ricardo; Granado Cardoso, Luis Alberto; Graugés, Eugeni; Graziani, Giacomo; Grecu, Alexandru; Greening, Edward; Gregson, Sam; Griffith, Peter; Grillo, Lucia; Grünberg, Oliver; Gui, Bin; Gushchin, Evgeny; Guz, Yury; Gys, Thierry; Hadjivasiliou, Christos; Haefeli, Guido; Haen, Christophe; Haines, Susan; Hall, Samuel; Hamilton, Brian; Hampson, Thomas; Han, Xiaoxue; Hansmann-Menzemer, Stephanie; Harnew, Neville; Harnew, Samuel; Harrison, Jonathan; He, Jibo; Head, Timothy; Heijne, Veerle; Hennessy, Karol; Henrard, Pierre; Henry, Louis; Hernando Morata, Jose Angel; van Herwijnen, Eric; Heß, Miriam; Hicheur, Adlène; Hill, Donal; Hoballah, Mostafa; Hombach, Christoph; Hulsbergen, Wouter; Hunt, Philip; Hussain, Nazim; Hutchcroft, David; Hynds, Daniel; Idzik, Marek; Ilten, Philip; Jacobsson, Richard; Jaeger, Andreas; Jalocha, Pawel; Jans, Eddy; Jaton, Pierre; Jawahery, Abolhassan; Jing, Fanfan; John, Malcolm; Johnson, Daniel; Jones, Christopher; Joram, Christian; Jost, Beat; Jurik, Nathan; Kandybei, Sergii; Kanso, Walaa; Karacson, Matthias; Karbach, Moritz; Karodia, Sarah; Kelsey, Matthew; Kenyon, Ian; Ketel, Tjeerd; Khanji, Basem; Khurewathanakul, Chitsanu; Klaver, Suzanne; Klimaszewski, Konrad; Kochebina, Olga; Kolpin, Michael; Komarov, Ilya; Koopman, Rose; Koppenburg, Patrick; Korolev, Mikhail; Kozlinskiy, Alexandr; Kravchuk, Leonid; Kreplin, Katharina; Kreps, Michal; Krocker, Georg; Krokovny, Pavel; Kruse, Florian; Kucewicz, Wojciech; Kucharczyk, Marcin; Kudryavtsev, Vasily; Kurek, Krzysztof; Kvaratskheliya, Tengiz; La Thi, Viet Nga; Lacarrere, Daniel; Lafferty, George; Lai, Adriano; Lambert, Dean; Lambert, Robert W; Lanfranchi, Gaia; Langenbruch, Christoph; Langhans, Benedikt; Latham, Thomas; Lazzeroni, Cristina; Le Gac, Renaud; van Leerdam, Jeroen; Lees, Jean-Pierre; Lefèvre, Regis; Leflat, Alexander; Lefrançois, Jacques; Leo, Sabato; Leroy, Olivier; Lesiak, Tadeusz; Lespinasse, Mickael; Leverington, Blake; Li, Yiming; Likhomanenko, Tatiana; Liles, Myfanwy; Lindner, Rolf; Linn, Christian; Lionetto, Federica; Liu, Bo; Lohn, Stefan; Longstaff, Iain; Lopes, Jose; Lopez-March, Neus; Lowdon, Peter; Lu, Haiting; Lucchesi, Donatella; Luo, Haofei; Lupato, Anna; Luppi, Eleonora; Lupton, Oliver; Machefert, Frederic; Machikhiliyan, Irina V; Maciuc, Florin; Maev, Oleg; Malde, Sneha; Malinin, Alexander; Manca, Giulia; Mancinelli, Giampiero; Mapelli, Alessandro; Maratas, Jan; Marchand, Jean François; Marconi, Umberto; Marin Benito, Carla; Marino, Pietro; Märki, Raphael; Marks, Jörg; Martellotti, Giuseppe; Martens, Aurelien; Martín Sánchez, Alexandra; Martinelli, Maurizio; Martinez Santos, Diego; Martinez Vidal, Fernando; Martins Tostes, Danielle; Massafferri, André; Matev, Rosen; Mathe, Zoltan; Matteuzzi, Clara; Mazurov, Alexander; McCann, Michael; McCarthy, James; McNab, Andrew; McNulty, Ronan; McSkelly, Ben; Meadows, Brian; Meier, Frank; Meissner, Marco; Merk, Marcel; Milanes, Diego Alejandro; Minard, Marie-Noelle; Moggi, Niccolò; Molina Rodriguez, Josue; Monteil, Stephane; Morandin, Mauro; Morawski, Piotr; Mordà, Alessandro; Morello, Michael Joseph; Moron, Jakub; Morris, Adam Benjamin; Mountain, Raymond; Muheim, Franz; Müller, Katharina; Mussini, Manuel; Muster, Bastien; Naik, Paras; Nakada, Tatsuya; Nandakumar, Raja; Nasteva, Irina; Needham, Matthew; Neri, Nicola; Neubert, Sebastian; Neufeld, Niko; Neuner, Max; Nguyen, Anh Duc; Nguyen, Thi-Dung; Nguyen-Mau, Chung; Nicol, Michelle; Niess, Valentin; Niet, Ramon; Nikitin, Nikolay; Nikodem, Thomas; Novoselov, Alexey; O'Hanlon, Daniel Patrick; Oblakowska-Mucha, Agnieszka; Obraztsov, Vladimir; Oggero, Serena; Ogilvy, Stephen; Okhrimenko, Oleksandr; Oldeman, Rudolf; Onderwater, Gerco; Orlandea, Marius; Otalora Goicochea, Juan Martin; Owen, Patrick; Oyanguren, Maria Arantza; Pal, Bilas Kanti; Palano, Antimo; Palombo, Fernando; Palutan, Matteo; Panman, Jacob; Papanestis, Antonios; Pappagallo, Marco; Pappalardo, Luciano; Parkes, Christopher; Parkinson, Christopher John; Passaleva, Giovanni; Patel, Girish; Patel, Mitesh; Patrignani, Claudia; Pearce, Alex; Pellegrino, Antonio; Pepe Altarelli, Monica; Perazzini, Stefano; Perret, Pascal; Perrin-Terrin, Mathieu; Pescatore, Luca; Pesen, Erhan; Petridis, Konstantin; Petrolini, Alessandro; Picatoste Olloqui, Eduardo; Pietrzyk, Boleslaw; Pilař, Tomas; Pinci, Davide; Pistone, Alessandro; Playfer, Stephen; Plo Casasus, Maximo; Polci, Francesco; Poluektov, Anton; Polycarpo, Erica; Popov, Alexander; Popov, Dmitry; Popovici, Bogdan; Potterat, Cédric; Price, Eugenia; Prisciandaro, Jessica; Pritchard, Adrian; Prouve, Claire; Pugatch, Valery; Puig Navarro, Albert; Punzi, Giovanni; Qian, Wenbin; Rachwal, Bartolomiej; Rademacker, Jonas; Rakotomiaramanana, Barinjaka; Rama, Matteo; Rangel, Murilo; Raniuk, Iurii; Rauschmayr, Nathalie; Raven, Gerhard; Reichert, Stefanie; Reid, Matthew; dos Reis, Alberto; Ricciardi, Stefania; Richards, Sophie; Rihl, Mariana; Rinnert, Kurt; Rives Molina, Vincente; Roa Romero, Diego; Robbe, Patrick; Rodrigues, Ana Barbara; Rodrigues, Eduardo; Rodriguez Perez, Pablo; Roiser, Stefan; Romanovsky, Vladimir; Romero Vidal, Antonio; Rotondo, Marcello; Rouvinet, Julien; Ruf, Thomas; Ruiz, Hugo; Ruiz Valls, Pablo; Saborido Silva, Juan Jose; Sagidova, Naylya; Sail, Paul; Saitta, Biagio; Salustino Guimaraes, Valdir; Sanchez Mayordomo, Carlos; Sanmartin Sedes, Brais; Santacesaria, Roberta; Santamarina Rios, Cibran; Santovetti, Emanuele; Sarti, Alessio; Satriano, Celestina; Satta, Alessia; Saunders, Daniel Martin; Savrina, Darya; Schiller, Manuel; Schindler, Heinrich; Schlupp, Maximilian; Schmelling, Michael; Schmidt, Burkhard; Schneider, Olivier; Schopper, Andreas; Schune, Marie Helene; Schwemmer, Rainer; Sciascia, Barbara; Sciubba, Adalberto; Semennikov, Alexander; Sepp, Indrek; Serra, Nicola; Serrano, Justine; Sestini, Lorenzo; Seyfert, Paul; Shapkin, Mikhail; Shapoval, Illya; Shcheglov, Yury; Shears, Tara; Shekhtman, Lev; Shevchenko, Vladimir; Shires, Alexander; Silva Coutinho, Rafael; Simi, Gabriele; Sirendi, Marek; Skidmore, Nicola; Skwarnicki, Tomasz; Smith, Anthony; Smith, Edmund; Smith, Eluned; Smith, Jackson; Smith, Mark; Snoek, Hella; Sokoloff, Michael; Soler, Paul; Soomro, Fatima; Souza, Daniel; Souza De Paula, Bruno; Spaan, Bernhard; Sparkes, Ailsa; Spradlin, Patrick; Sridharan, Srikanth; Stagni, Federico; Stahl, Marian; Stahl, Sascha; Steinkamp, Olaf; Stenyakin, Oleg; Stevenson, Scott; Stoica, Sabin; Stone, Sheldon; Storaci, Barbara; Stracka, Simone; Straticiuc, Mihai; Straumann, Ulrich; Stroili, Roberto; Subbiah, Vijay Kartik; Sun, Liang; Sutcliffe, William; Swientek, Krzysztof; Swientek, Stefan; Syropoulos, Vasileios; Szczekowski, Marek; Szczypka, Paul; Szumlak, Tomasz; T'Jampens, Stephane; Teklishyn, Maksym; Tellarini, Giulia; Teubert, Frederic; Thomas, Christopher; Thomas, Eric; van Tilburg, Jeroen; Tisserand, Vincent; Tobin, Mark; Tolk, Siim; Tomassetti, Luca; Tonelli, Diego; Topp-Joergensen, Stig; Torr, Nicholas; Tournefier, Edwige; Tourneur, Stephane; Tran, Minh Tâm; Tresch, Marco; Trisovic, Ana; Tsaregorodtsev, Andrei; Tsopelas, Panagiotis; Tuning, Niels; Ubeda Garcia, Mario; Ukleja, Artur; Ustyuzhanin, Andrey; Uwer, Ulrich; Vagnoni, Vincenzo; Valenti, Giovanni; Vallier, Alexis; Vazquez Gomez, Ricardo; Vazquez Regueiro, Pablo; Vázquez Sierra, Carlos; Vecchi, Stefania; Velthuis, Jaap; Veltri, Michele; Veneziano, Giovanni; Vesterinen, Mika; Viaud, Benoit; Vieira, Daniel; Vieites Diaz, Maria; Vilasis-Cardona, Xavier; Vollhardt, Achim; Volyanskyy, Dmytro; Voong, David; Vorobyev, Alexey; Vorobyev, Vitaly; Voß, Christian; de Vries, Jacco; Waldi, Roland; Wallace, Charlotte; Wallace, Ronan; Walsh, John; Wandernoth, Sebastian; Wang, Jianchun; Ward, David; Watson, Nigel; Websdale, David; Whitehead, Mark; Wicht, Jean; Wiedner, Dirk; Wilkinson, Guy; Williams, Matthew; Williams, Mike; Wilson, Fergus; Wimberley, Jack; Wishahi, Julian; Wislicki, Wojciech; Witek, Mariusz; Wormser, Guy; Wotton, Stephen; Wright, Simon; Wu, Suzhi; Wyllie, Kenneth; Xie, Yuehong; Xing, Zhou; Xu, Zhirui; Yang, Zhenwei; Yuan, Xuhao; Yushchenko, Oleg; Zangoli, Maria; Zavertyaev, Mikhail; Zhang, Liming; Zhang, Wen Chao; Zhang, Yanxi; Zhelezov, Alexey; Zhokhov, Anatoly; Zhong, Liang; Zvyagin, Alexander


    The production of $\\chi_b$ mesons in proton-proton collisions is studied using a data sample collected by the LHCb detector, at centre-of-mass energies of $\\sqrt{s}=7$ and $8$ TeV and corresponding to an integrated luminosity of 3.0 fb$^{-1}$. The $\\chi_b$ mesons are identified through their decays to $\\Upsilon(1S)\\gamma$ and $\\Upsilon(2S)\\gamma$ using photons that converted to $e^+e^-$ pairs in the detector. The $\\chi_b(3P)$ meson mass, and the relative prompt production rate of $\\chi_{b1}(1P)$ and $\\chi_{b2}(1P)$ mesons as a function of the $\\Upsilon(1S)$ transverse momentum in the $\\chi_b$ rapidity range 2.0< $y$<4.5, are measured. Assuming a mass splitting between the $\\chi_{b1}(3P)$ and the $\\chi_{b2}(3P)$ states of 10.5 MeV/$c^2$, the mass of the $\\chi_{b1}(3P)$ meson is \\begin{equation*} m(\\chi_{b1}(3P))= 10515.7^{+2.2}_{-3.9}(stat) ^{+1.5}_{-2.1}(syst) MeV/c^2. \\end{equation*}

  7. Meson factories

    International Nuclear Information System (INIS)

    Dicello, J.F.; Zaider, M.; Bradbury, J.N.


    Technological improvements in accelerator design in the 1960's resulted in the capability to develop medium-energy proton accelerators with beam intensities of almost 1 mA. These beams are able to produce fluxes of secondary particles, including pions, muons, neutrinos, and neutrons, which are as much as 10,000 times as intense as those previously available. Those machines built for optimum meson production are commonly called meson factories. The characteristics of these facilities are reviewed, and the present programs in applied research, and some potential areas of future work are discussed

  8. Tensor meson dominance and e/sup +/e/sup -/-physics

    Energy Technology Data Exchange (ETDEWEB)

    Genz, H [Miami Univ., Coral Gables, FL (USA). Center for Theoretical Studies; Karlsruhe Univ. (T.H.) (Germany, F.R.). Inst. fuer Theoretische Kernphysik); Mallik, S [Karlsruhe Univ. (T.H.) (Germany, F.R.). Inst. fuer Theoretische Kernphysik


    The phenomenological status of tensor meson dominance is reported. Some new results concerning hadronic decays of the 2/sup + +/-meson chi/sub 2/(3.55) and the heavy lepton tau are also included. Considering experimental errors, tensor meson dominance is in agreement with experiment.

  9. Stress Management: Tai Chi (United States)

    ... in constant motion. Tai chi has many different styles. Each style may subtly emphasize various tai chi principles and methods. There are variations within each style. Some styles may focus on health maintenance, while ...

  10. Meson photoproduction (CLAS)

    Energy Technology Data Exchange (ETDEWEB)

    Steffen Strauch


    This is a brief and selective discussion of meson photoproduction measurements with the CEBAF Large Acceptance Spectrometer (CLAS) at Jefferson Lab. Meson photo- production is being used as a tool for various investigations, including the spectroscopy of baryons and mesons and the search for vector-meson medium modifications.

  11. Scalar mesons and radiative vector meson decays

    International Nuclear Information System (INIS)

    Gokalp, A.; Ylmaz, O


    The light scalar mesons with vacuum quantum numbers J p =0 ++ have fundamental importance in understanding low energy QCD phenomenology and the symmetry breaking mechanisms in QCD. The nature and quark substructure of the best known scalar mesons, isoscalar σ(500), f0(980) and isovector a0(980) have been a subject of continuous controversy. The radioactive decay of neutral vector mesons ρ, w and φ into a single photon and a pair of neutral pseudoscalar mesons have been studied in order to obtain information on the nature of these scalar mesons. For such studies, it is essential that a reliable understanding of the mechanisms for these decays should be at hand. In this work, we investigate the particularly interesting mechanism of the exchange of scalar mesons for the radiative vector meson decays by analysing the experimental results such as measured decay rates and invariant mass spectra and compare them with the theoretical prediction of different reaction mechanisms

  12. T'ai Chi (United States)

    ... are different styles of t'ai chi, including: Chen style Hao (or Wu Shi) style Hu Lei ... medical advice, diagnoses, and treatment, consult your doctor. © 1995- The Nemours Foundation. All rights reserved. Images provided ...

  13. Tai Chi research review. (United States)

    Field, Tiffany


    This review briefly summarizes recent Tai Chi research on physical benefits including balance and muscle strength and psychological benefits including attentiveness, sleep and anxiety. Cardiovascular changes following Tai Chi include decreased heart rate and blood pressure, increased vagal activity and decreased cholesterol. Pain syndromes that have been affected include fibromyalgia, osteoarthritis and rheumatoid arthritis. Autoimmune and immune conditions recently researched and reviewed here include osteoporosis, diabetes and HIV. Methodological problems with this research include the variability in forms (series of postures) used across studies as well as the intensity of the Tai Chi schedule. Further, most of the studies are based on within group changes rather than attention control group comparisons. Nonetheless, significant clinical improvements have been noted. Copyright © 2010 Elsevier Ltd. All rights reserved.

  14. Perspective of meson science

    International Nuclear Information System (INIS)

    Yamazaki, T.; Nagamine, K.


    Unstable particles such as mesons and muons are now used in various research domains of physics, chemistry, engineering, and life sciences. This book is aimed at summarizing the present exploratory activities and giving future perspectives from a very broad scope. It contains 27 contributions in a wide range of subjects, such as μSR studies of superconductivities, magnetism, muon beam and μSr methodology, theoretical accounts of muon hyperfine interactions, muon catalyzed fusion processes, metastable exotic atoms, medical diagnostics, strangeness nuclear physics, mesons in nuclei, meson-related nuclear reactions and structure, and exotic decays of mesons

  15. Measurement of the cross-section ratio $\\sigma(\\chi_{c2})/\\sigma(\\chi_{c1})$ for prompt $\\chi_c$ production at $\\sqrt{s}=7$ TeV

    CERN Document Server

    INSPIRE-00258707; Abellan Beteta, C.; Adeva, B.; Adinolfi, M.; Adrover, C.; Affolder, A.; Ajaltouni, Z.; Albrecht, J.; Alessio, F.; Alexander, M.; Alkhazov, G.; Alvarez Cartelle, P.; Alves Jr, A.A.; Amato, S.; Amhis, Y.; Anderson, J.; Appleby, R.B.; Aquines Gutierrez, O.; Archilli, F.; Arrabito, L.; Artamonov, A.; Artuso, M.; Aslanides, E.; Auriemma, G.; Bachmann, S.; Back, J.J.; Bailey, D.S.; Balagura, V.; Baldini, W.; Barlow, R.J.; Barschel, C.; Barsuk, S.; Barter, W.; Bates, A.; Bauer, C.; Bauer, Th.; Bay, A.; Bediaga, I.; Belogurov, S.; Belous, K.; Belyaev, I.; Ben-Haim, E.; Benayoun, M.; Bencivenni, G.; Benson, S.; Benton, J.; Bernet, R.; Bettler, M.O.; van Beuzekom, M.; Bien, A.; Bifani, S.; Bird, T.; Bizzeti, A.; Bjornstad, P.M.; Blake, T.; Blanc, F.; Blanks, C.; Blouw, J.; Blusk, S.; Bobrov, A.; Bocci, V.; Bondar, A.; Bondar, N.; Bonivento, W.; Borghi, S.; Borgia, A.; Bowcock, T.J.V.; Bozzi, C.; Brambach, T.; van den Brand, J.; Bressieux, J.; Brett, D.; Britsch, M.; Britton, T.; Brook, N.H.; Brown, H.; Buchler-Germann, A.; Burducea, I.; Bursche, A.; Buytaert, J.; Cadeddu, S.; Callot, O.; Calvi, M.; Calvo Gomez, M.; Camboni, A.; Campana, P.; Carbone, A.; Carboni, G.; Cardinale, R.; Cardini, A.; Carson, L.; Carvalho Akiba, K.; Casse, G.; Cattaneo, M.; Cauet, Ch.; Charles, M.; Charpentier, Ph.; Chiapolini, N.; Ciba, K.; Cid Vidal, X.; Ciezarek, G.; Clarke, P.E.L.; Clemencic, M.; Cliff, H.V.; Closier, J.; Coca, C.; Coco, V.; Cogan, J.; Collins, P.; Comerma-Montells, A.; Constantin, F.; Conti, G.; Contu, A.; Cook, A.; Coombes, M.; Corti, G.; Cowan, G.A.; Currie, R.; D'Almagne, B.; D'Ambrosio, C.; David, P.; David, P.N.Y.; De Bonis, I.; De Capua, S.; De Cian, M.; De Lorenzi, F.; de Miranda, J.M.; De Paula, L.; De Simone, P.; Decamp, D.; Deckenhoff, M.; Degaudenzi, H.; Deissenroth, M.; Del Buono, L.; Deplano, C.; Derkach, D.; Deschamps, O.; Dettori, F.; Dickens, J.; Dijkstra, H.; Diniz Batista, P.; Bonal, F.Domingo; Donleavy, S.; Dordei, F.; Dosil Suarez, A.; Dossett, D.; Dovbnya, A.; Dupertuis, F.; Dzhelyadin, R.; Dziurda, A.; Easo, S.; Egede, U.; Egorychev, V.; Eidelman, S.; van Eijk, D.; Eisele, F.; Eisenhardt, S.; Ekelhof, R.; Eklund, L.; Elsasser, Ch.; Elsby, D.; Esperante Pereira, D.; Esteve, L.; Falabella, A.; Fanchini, E.; Farber, C.; Fardell, G.; Farinelli, C.; Farry, S.; Fave, V.; Fernandez Albor, V.; Ferro-Luzzi, M.; Filippov, S.; Fitzpatrick, C.; Fontana, M.; Fontanelli, F.; Forty, R.; Frank, M.; Frei, C.; Frosini, M.; Furcas, S.; Gallas Torreira, A.; Galli, D.; Gandelman, M.; Gandini, P.; Gao, Y.; Garnier, J-C.; Garofoli, J.; Garra Tico, J.; Garrido, L.; Gascon, D.; Gaspar, C.; Gauvin, N.; Gersabeck, M.; Gershon, T.; Ghez, Ph.; Gibson, V.; Gligorov, V.V.; Gobel, C.; Golubkov, D.; Golutvin, A.; Gomes, A.; Gordon, H.; Grabalosa Gandara, M.; Graciani Diaz, R.; Granado Cardoso, L.A.; Grauges, E.; Graziani, G.; Grecu, A.; Greening, E.; Gregson, S.; Gui, B.; Gushchin, E.; Guz, Yu.; Gys, T.; Haefeli, G.; Haen, C.; Haines, S.C.; Hampson, T.; Hansmann-Menzemer, S.; Harji, R.; Harnew, N.; Harrison, J.; Harrison, P.F.; He, J.; Heijne, V.; Hennessy, K.; Henrard, P.; Hernando Morata, J.A.; van Herwijnen, E.; Hicks, E.; Holubyev, K.; Hopchev, P.; Hulsbergen, W.; Hunt, P.; Huse, T.; Huston, R.S.; Hutchcroft, D.; Hynds, D.; Iakovenko, V.; Ilten, P.; Imong, J.; Jacobsson, R.; Jaeger, A.; Jahjah Hussein, M.; Jans, E.; Jansen, F.; Jaton, P.; Jean-Marie, B.; Jing, F.; John, M.; Johnson, D.; Jones, C.R.; Jost, B.; Kaballo, M.; Kandybei, S.; Karacson, M.; Karbach, T.M.; Keaveney, J.; Kenyon, I.R.; Kerzel, U.; Ketel, T.; Keune, A.; Khanji, B.; Kim, Y.M.; Knecht, M.; Koppenburg, P.; Kozlinskiy, A.; Kravchuk, L.; Kreplin, K.; Kreps, M.; Krocker, G.; Krokovny, P.; Kruse, F.; Kruzelecki, K.; Kucharczyk, M.; Kvaratskheliya, T.; La Thi, V.N.; Lacarrere, D.; Lafferty, G.; Lai, A.; Lambert, D.; Lambert, R.W.; Lanciotti, E.; Lanfranchi, G.; Langenbruch, C.; Latham, T.; Lazzeroni, C.; Le Gac, R.; van Leerdam, J.; Lees, J.P.; Lefevre, R.; Leflat, A.; Lefrancois, J.; Leroy, O.; Lesiak, T.; Li, L.; Li Gioi, L.; Lieng, M.; Liles, M.; Lindner, R.; Linn, C.; Liu, B.; Liu, G.; Lopes, J.H.; Lopez Asamar, E.; Lopez-March, N.; Lu, H.; Luisier, J.; Raighne, A.Mac; Machefert, F.; Machikhiliyan, I.V.; Maciuc, F.; Maev, O.; Magnin, J.; Malde, S.; Mamunur, R.M.D.; Manca, G.; Mancinelli, G.; Mangiafave, N.; Marconi, U.; Marki, R.; Marks, J.; Martellotti, G.; Martens, A.; Martin, L.; Martin Sanchez, A.; Martinez Santos, D.; Massafferri, A.; Mathe, Z.; Matteuzzi, C.; Matveev, M.; Maurice, E.; Maynard, B.; Mazurov, A.; McGregor, G.; McNulty, R.; Mclean, C.; Meissner, M.; Merk, M.; Merkel, J.; Messi, R.; Miglioranzi, S.; Milanes, D.A.; Minard, M.N.; Molina Rodriguez, J.; Monteil, S.; Moran, D.; Morawski, P.; Mountain, R.; Mous, I.; Muheim, F.; Muller, K.; Muresan, R.; Muryn, B.; Muster, B.; Musy, M.; Mylroie-Smith, J.; Naik, P.; Nakada, T.; Nandakumar, R.; Nasteva, I.; Nedos, M.; Needham, M.; Neufeld, N.; Nguyen-Mau, C.; Nicol, M.; Niess, V.; Nikitin, N.; Nomerotski, A.; Novoselov, A.; Oblakowska-Mucha, A.; Obraztsov, V.; Oggero, S.; Ogilvy, S.; Okhrimenko, O.; Oldeman, R.; Orlandea, M.; Otalora Goicochea, J.M.; Owen, P.; Pal, K.; Palacios, J.; Palano, A.; Palutan, M.; Panman, J.; Papanestis, A.; Pappagallo, M.; Parkes, C.; Parkinson, C.J.; Passaleva, G.; Patel, G.D.; Patel, M.; Paterson, S.K.; Patrick, G.N.; Patrignani, C.; Pavel-Nicorescu, C.; Pazos Alvarez, A.; Pellegrino, A.; Penso, G.; Pepe Altarelli, M.; Perazzini, S.; Perego, D.L.; Perez Trigo, E.; Perez-Calero Yzquierdo, A.; Perret, P.; Perrin-Terrin, M.; Pessina, G.; Petrella, A.; Petrolini, A.; Phan, A.; Picatoste Olloqui, E.; Pie Valls, B.; Pietrzyk, B.; Pilar, T.; Pinci, D.; Plackett, R.; Playfer, S.; Plo Casasus, M.; Polok, G.; Poluektov, A.; Polycarpo, E.; Popov, D.; Popovici, B.; Potterat, C.; Powell, A.; du Pree, T.; Prisciandaro, J.; Pugatch, V.; Puig Navarro, A.; Qian, W.; Rademacker, J.H.; Rakotomiaramanana, B.; Rangel, M.S.; Raniuk, I.; Raven, G.; Redford, S.; Reid, M.M.; dos Reis, A.C.; Ricciardi, S.; Rinnert, K.; Roa Romero, D.A.; Robbe, P.; Rodrigues, E.; Rodrigues, F.; Rodriguez Perez, P.; Rogers, G.J.; Roiser, S.; Romanovsky, V.; Rosello, M.; Rouvinet, J.; Ruf, T.; Ruiz, H.; Sabatino, G.; Saborido Silva, J.J.; Sagidova, N.; Sail, P.; Saitta, B.; Salzmann, C.; Sannino, M.; Santacesaria, R.; Santamarina Rios, C.; Santinelli, R.; Santovetti, E.; Sapunov, M.; Sarti, A.; Satriano, C.; Satta, A.; Savrie, M.; Savrina, D.; Schaack, P.; Schiller, M.; Schleich, S.; Schlupp, M.; Schmelling, M.; Schmidt, B.; Schneider, O.; Schopper, A.; Schune, M.H.; Schwemmer, R.; Sciascia, B.; Sciubba, A.; Seco, M.; Semennikov, A.; Senderowska, K.; Sepp, I.; Serra, N.; Serrano, J.; Seyfert, P.; Shao, B.; Shapkin, M.; Shapoval, I.; Shatalov, P.; Shcheglov, Y.; Shears, T.; Shekhtman, L.; Shevchenko, O.; Shevchenko, V.; Shires, A.; Coutinho, R.Silva; Skwarnicki, T.; Smith, A.C.; Smith, N.A.; Smith, E.; Sobczak, K.; Soler, F.J.P.; Solomin, A.; Soomro, F.; Souza De Paula, B.; Spaan, B.; Sparkes, A.; Spradlin, P.; Stagni, F.; Stahl, S.; Steinkamp, O.; Stoica, S.; Stone, S.; Storaci, B.; Straticiuc, M.; Straumann, U.; Subbiah, V.K.; Swientek, S.; Szczekowski, M.; Szczypka, P.; Szumlak, T.; T'Jampens, S.; Teodorescu, E.; Teubert, F.; Thomas, C.; Thomas, E.; van Tilburg, J.; Tisserand, V.; Tobin, M.; Topp-Joergensen, S.; Torr, N.; Tournefier, E.; Tran, M.T.; Tsaregorodtsev, A.; Tuning, N.; Garcia, M.Ubeda; Ukleja, A.; Urquijo, P.; Uwer, U.; Vagnoni, V.; Valenti, G.; Vazquez Gomez, R.; Vazquez Regueiro, P.; Vecchi, S.; Velthuis, J.J.; Veltri, M.; Viaud, B.; Videau, I.; Vilasis-Cardona, X.; Visniakov, J.; Vollhardt, A.; Volyanskyy, D.; Voong, D.; Vorobyev, A.; Voss, H.; Wandernoth, S.; Wang, J.; Ward, D.R.; Watson, N.K.; Webber, A.D.; Websdale, D.; Whitehead, M.; Wiedner, D.; Wiggers, L.; Wilkinson, G.; Williams, M.P.; Williams, M.; Wilson, F.F.; Wishahi, J.; Witek, M.; Witzeling, W.; Wotton, S.A.; Wyllie, K.; Xie, Y.; Xing, F.; Xing, Z.; Yang, Z.; Young, R.; Yushchenko, O.; Zavertyaev, M.; Zhang, F.; Zhang, L.; Zhang, W.C.; Zhang, Y.; Zhelezov, A.; Zhong, L.; Zverev, E.; Zvyagin, A.


    The prompt production of the charmonium $\\chi_{c1}$ and $\\chi_{c2}$ mesons has been studied in proton-proton collisions at the Large Hadron Collider at a centre-of-mass energy of $\\sqrt{s}=7$~TeV. The $\\chi_c$ mesons are identified through their decays $\\chi_c\\,\\rightarrow\\,J/\\psi\\,\\gamma$ with $J/\\psi\\,\\rightarrow\\,\\mu^+\\,\\mu^-$ using 36~$\\mathrm{pb^{-1}}$ of data collected by the LHCb detector in 2010. The ratio of the prompt production cross-sections for the two $\\chi_c$ spin states, $\\sigma(\\chi_{c2})\\,/\\,\\sigma(\\chi_{c1})$, has been determined as a function of the $J/\\psi$ transverse momentum, $p_{\\mathrm{T}}^{J/\\psi}$, in the range from 2 to 15~GeV/$c$. The results are in agreement with the next-to-leading order non-relativistic QCD model at high $p_{\\mathrm{T}}^{J/\\psi}$ and lie consistently above the pure leading-order colour singlet prediction.

  16. Measurement of the cross-section ratio {sigma}({chi}{sub c2})/{sigma}({chi}{sub c1}) for prompt {chi}{sub c} production at {radical}(s)=7 TeV

    Energy Technology Data Exchange (ETDEWEB)

    Aaij, R. [Nikhef National Institute for Subatomic Physics, Amsterdam (Netherlands); Abellan Beteta, C. [Universitat de Barcelona, Barcelona (Spain); Adeva, B. [Universidad de Santiago de Compostela, Santiago de Compostela (Spain); Adinolfi, M. [H.H. Wills Physics Laboratory, University of Bristol, Bristol (United Kingdom); Adrover, C. [CPPM, Aix-Marseille Universite, CNRS/IN2P3, Marseille (France); Affolder, A. [Oliver Lodge Laboratory, University of Liverpool, Liverpool (United Kingdom); Ajaltouni, Z. [Clermont Universite, Universite Blaise Pascal, CNRS/IN2P3, LPC, Clermont-Ferrand (France); Albrecht, J.; Alessio, F. [European Organization for Nuclear Research (CERN), Geneva (Switzerland); Alexander, M. [School of Physics and Astronomy, University of Glasgow, Glasgow (United Kingdom); Alkhazov, G. [Petersburg Nuclear Physics Institute (PNPI), Gatchina (Russian Federation); Alvarez Cartelle, P. [Universidad de Santiago de Compostela, Santiago de Compostela (Spain); Alves, A.A. [Sezione INFN di Roma La Sapienza, Roma (Italy); Amato, S. [Universidade Federal do Rio de Janeiro (UFRJ), Rio de Janeiro (Brazil); Amhis, Y. [Ecole Polytechnique Federale de Lausanne (EPFL), Lausanne (Switzerland); Anderson, J. [Physik-Institut, Universitaet Zuerich, Zuerich (Switzerland); Appleby, R.B. [School of Physics and Astronomy, University of Manchester, Manchester (United Kingdom); Aquines Gutierrez, O. [Max-Planck-Institut fuer Kernphysik (MPIK), Heidelberg (Germany); Archilli, F. [Laboratori Nazionali dell' INFN di Frascati, Frascati (Italy); European Organization for Nuclear Research (CERN), Geneva (Switzerland); Arrabito, L. [CC-IN2P3, CNRS/IN2P3, Lyon-Villeurbanne (France); and others


    The prompt production of the charmonium {chi}{sub c1} and {chi}{sub c2} mesons has been studied in proton-proton collisions at the Large Hadron Collider at a centre-of-mass energy of {radical}(s)=7 TeV. The {chi}{sub c} mesons are identified through their decays {chi}{sub c}{yields}J/{psi}{gamma} with J/{psi}{yields}{mu}{sup +}{mu}{sup -} using 36 pb{sup -1} of data collected by the LHCb detector in 2010. The ratio of the prompt production cross-sections for the two {chi}{sub c} spin states, {sigma}({chi}{sub c2})/{sigma}({chi}{sub c1}), has been determined as a function of the J/{psi} transverse momentum, p{sub T}{sup J/{psi}}, in the range from 2 to 15 GeV/c. The results are in agreement with the next-to-leading order non-relativistic QCD model at high p{sub T}{sup J/{psi}} and lie consistently above the pure leading-order colour-singlet prediction.

  17. Radiative transitions of new particles and the puzzle of cc-bar pseudoscalar mesons

    International Nuclear Information System (INIS)

    Arafune, J.; Fukugita, M.; Oyanagi, Y.


    Radiative transitions between psi's and chi's are investigated in terms of a nonrelativistic quark model. When the level mixing is taken into account, no difficulties are met in M1 transitions, if the newly discovered chi (3454) is assigned to the ground state of the pseudoscalar meson

  18. Vector-meson dominance revisited

    Directory of Open Access Journals (Sweden)

    Terschlüsen Carla


    Full Text Available The interaction of mesons with electromagnetism is often well described by the concept of vector-meson dominance (VMD. However, there are also examples where VMD fails. A simple chiral Lagrangian for pions, rho and omega mesons is presented which can account for the respective agreement and disagreement between VMD and phenomenology in the sector of light mesons.

  19. Mesonic effects in nuclear physics

    International Nuclear Information System (INIS)

    Johnson, M.


    The relation between mesons and nucleons and the properties of nuclear matter, as presently understood, is considered in these lectures. Feynman diagrams, meson theoretical nucleon-nucleon interactions, mesonic components in nuclear wave functions, direct observation of mesonic components in NN scattering above the pion production threshold, nuclear matter theory, and pion condensation are treated. 120 references

  20. Measurements of psi ' -> (p)over-barK(+)Sigma(0) and chi(cJ) -> (p)over-barK(+) Lambda

    NARCIS (Netherlands)

    Ablikim, M.; Achasov, M. N.; Albayrak, O.; Ambrose, D. J.; An, F. F.; An, Q.; Bai, J. Z.; Ban, Y.; Becker, J.; Bennett, J. V.; Bertani, M.; Bian, J. M.; Boger, E.; Bondarenko, O.; Boyko, I.; Briere, R. A.; Bytev, V.; Cai, X.; Cakir, O.; Calcaterra, A.; Cao, G. F.; Cetin, S. A.; Chang, J. F.; Chelkov, G.; Chen, G.; Chen, H. S.; Chen, J.C.; Chen, M.L.; Chen, S. J.; Chen, X.; Chen, Y.B.; Cheng, H. P.; Chu, Y. P.; Cronin-Hennessy, D.; Dai, H. L.; Dai, J.P.; Dedovich, D.; Deng, Z. Y.; Denig, A.; Denysenko, I.; Destefanis, M.; Ding, W. M.; Ding, Y.; Dong, L. Y.; Dong, M. Y.; Du, S. X.; Fang, J.; Fang, S. S.; Fava, L.; Feng, C. Q.; Ferroli, R. B.; Friedel, P.; Fu, C. D.; Gao, Y.; Geng, C.; Goetzen, K.; Gong, W. X.; Gradl, W.; Greco, M.; Gu, M. H.; Gu, Y. T.; Guan, Y. H.; Guo, Q.; Guo, L. B.; Guo, T.; Guo, Y. P.; Han, Y. L.; Harris, F. A.; He, K. L.; He, M.; He, Z. Y.; Held, T.; Heng, Y. K.; Hou, Z. L.; Hu, C.; Hu, H. M.; Hu, J. F.; Hu, T.; Huang, G. M.; Huang, G. S.; Huang, J.S.; Huang, L.; Huang, X.T.; Huang, Y.; Huang, Y.P.; Hussain, T.; Ji, C. S.; Ji, Q.; Ji, Q. P.; Ji, X. B.; Ji, X. L.; Jiang, L.L.; Jiang, X. S.; Jiao, J. B.; Jiao, Z.; Jin, D. P.; Jin, S.; Jing, F. F.; Kalantar-Nayestanaki, N.; Kavatsyuk, M.; Kopf, B.; Kornicer, M.; Kuehn, W.; Lai, W.; Lange, J.S.; Leyhe, M.; Li, C. H.; Li, Cheng; Li, Cui; Li, D. M.; Li, F.; Li, G.; Li, H.B.; Li, J. C.; Li, K.; Li, Lei; Li, Q. J.; Li, S.L.; Li, W. D.; Li, W. G.; Li, X. L.; Li, X. N.; Li, X. Q.; Li, X. R.; Li, Z. B.; Liang, H.; Liang, Y. F.; Liang, Y.T.; Liao, G.R.; Liao, X. T.; Lin, D.; Liu, B. J.; Liu, Cheng; Liu, C.X.; Liu, F.H.; Liu, Fang; Liu, Feng; Liu, H.; Liu, H. B.; Liu, H. H.; Liu, H. M.; Liu, H. W.; Liu, J. P.; Liu, K.; Liu, K.Y.; Liu, Kai; Liu, P. L.; Liu, Q.; Liu, S. B.; Liu, X.; Liu, Y. B.; Liu, Z. A.; Liu, Zhiqiang; Liu, Zhiqing; Loehner, H.; Lu, G. R.; Lu, H. J.; Lu, J.G.; Lu, Q. W.; Lu, X. R.; Lu, Y. P.; Luo, C. L.; Luo, M. X.; Luo, T.; Luo, X.L.; Lv, M.; Ma, C.L.; Ma, F. C.; Ma, H. L.; Ma, Q. M.; Ma, S.; Ma, T.; Ma, X. Y.; Maas, F.E.; Maggiora, M.; Malik, Q. A.; Mao, Y. J.; Mao, Z. P.; Messchendorp, J. G.; Min, J.; Min, T. J.; Mitchell, R. E.; Mo, X. H.; Morales, C. Morales; Moriya, K.; Muchnoi, N. Yu.; Muramatsu, H.; Nefedov, Y.; Nicholson, C.; Nikolaev, I. B.; Ning, Z.; Olsen, S. L.; Ouyang, Q.; Pacetti, S.; Park, J.W.; Pelizaeus, M.; Peng, H. P.; Peters, K.; Ping, J. L.; Ping, R. G.; Poling, R.; Prencipe, E.; Qi, M.; Qian, S.; Qiao, C. F.; Qin, L. Q.; Qin, X. S.; Qin, Y.; Qin, Z. H.; Qiu, J. F.; Rashid, K. H.; Rong, G.; Ruan, X. D.; Sarantsev, A.; Schaefer, B. D.; Shao, M.; Shen, C. P.; Shen, X. Y.; Sheng, H. Y.; Shepherd, M. R.; Song, X. Y.; Spataro, S.; Spruck, B.; Sun, D. H.; Sun, G. X.; Sun, J.F.; Sun, S. S.; Sun, Y.J.; Sun, Y.Z.; Sun, Z.J.; Sun, Z.T.; Tang, C.J.; Tang, X.; Tapan, I.; Thorndike, E. H.; Toth, D.; Ullrich, M.; Varner, G. S.; Wang, B.Q.; Wang, D.; Wang, D.Y.; Wang, K.; Wang, L. L.; Wang, L. S.; Wang, M.; Wang, P.; Wang, P. L.; Wang, Q. J.; Wang, S. G.; Wang, X. F.; Wang, X. L.; Wang, Y. F.; Wang, Z.; Wang, Z. G.; Wang, Z.Y.; Wei, D. H.; Wei, J.B.; Weidenkaff, P.; Wen, Q. G.; Wen, S. P.; Wiedner, U.; Wu, L.H.; Wu, N.; Wu, S.X.; Wu, W.; Wu, Z.; Xia, L. G.; Xia, Y. X.; Xiao, Z. J.; Xie, Y. G.; Xiu, Q. L.; Xu, G. F.; Xu, G. M.; Xu, Q.J.; Xu, Q.N.; Xu, X. P.; Xu, Z. R.; Xue, F.; Xue, Z.; Yan, L.; Yan, W. B.; Yan, Y. H.; Yang, H. X.; Yang, Y.; Yang, Y. X.; Ye, H.; Ye, M.; Ye, M. H.; Yu, B. X.; Yu, C. X.; Yu, H. W.; Yu, J. S.; Yu, S. P.; Yuan, C. Z.; Yuan, Y.; Zafar, A. A.; Zallo, A.; Zeng, Y.; Zhang, B. X.; Zhang, B. Y.; Zhang, C.; Zhang, C. C.; Zhang, D. H.; Zhang, H. H.; Zhang, H. Y.; Zhang, J. Q.; Zhang, J. W.; Zhang, J. Y.; Zhang, J. Z.; Zhang, LiLi; Zhang, R.; Zhang, S. H.; Zhang, X. J.; Zhang, X. Y.; Zhang, Y.; Zhang, Y. H.; Zhang, Z. P.; Zhang, Z. Y.; Zhang, Zhenghao; Zhao, G.; Zhao, H. S.; Zhao, J.W.; Zhao, K. X.; Zhao, Lei; Zhao, Ling; Zhao, M. G.; Zhao, Q.; Zhao, Q. Z.; Zhao, S.J.; Zhao, T.C.; Zhao, Y. B.; Zhao, Z. G.; Zhemchugov, A.; Zheng, B.; Zheng, Y. H.; Zhong, B.; Zhong, Z.; Zhou, L.; Zhou, X. K.; Zhou, X.R.; Zhu, C.; Zhu, K.; Zhu, K. J.; Zhu, S.H.; Zhu, Stuart; Zhu, Y.C.; Zhu, Y.M.; Zhu, Y.S.; Zhu, Z. A.; Zhuang, J.; Zou, B. S.; Zou, J. H.; Werner, M.J.; Zheng, J.P.


    Using a sample of 1.06 x 10(8) psi' mesons collectedwith the BESIII detector at the BEPCII e(+)e(-) collider and chi(cJ) mesons produced via radiative transitions from the psi', we report the first observation for psi' -> (p) over barK(+)Sigma(0) + c.c. (charge conjugate), as well as improved

  1. Towers of hybrid mesons

    International Nuclear Information System (INIS)

    Semay, Claude; Buisseret, Fabien; Silvestre-Brac, Bernard


    A hybrid meson is a quark-antiquark pair in which, contrary to ordinary mesons, the gluon field is in an excited state. In the framework of constituent models, the interaction potential is assumed to be the energy of an excited string. An approximate, but accurate, analytical solution of the Schroedinger equation with such a potential is presented. When applied to hybrid charmonia and bottomonia, towers of states are predicted in which the masses are a linear function of a harmonic oscillator band number for the quark-antiquark pair. Such a formula could be a reliable guide for the experimental detection of heavy hybrid mesons.

  2. Excited charmed mesons

    International Nuclear Information System (INIS)

    Butler, J.N.; Shukla, S.


    The experimental status of excited charmed mesons is reviewed and is compared to theoretical expectations. Six states have been observed and their properties are consistent with those predicted for excited charmed states with orbital angular momentum equal to one

  3. Tai chi and chronic pain. (United States)

    Peng, Philip W H


    In the last 2 decades, a growing body of research aimed at investigating the health benefits of Tai Chi in various chronic health conditions has been recognized in the literature. This article reviewed the history, the philosophy, and the evidence for the role of Tai Chi in a few selected chronic pain conditions. The ancient health art of Tai Chi contributes to chronic pain management in 3 major areas: adaptive exercise, mind-body interaction, and meditation. Trials examining the health benefit of Tai Chi in chronic pain conditions are mostly low quality. Only 5 pain conditions were reviewed: osteoarthritis, fibromyalgia, rheumatoid arthritis, low back pain, and headache. Of these, Tai Chi seems to be an effective intervention in osteoarthritis, low back pain, and fibromyalgia. The limitations of the Tai Chi study design and suggestions for the direction of future research are also discussed.

  4. Tai chi and rheumatic diseases. (United States)

    Wang, Chenchen


    Tai chi is a complex multicomponent mind-body exercise. Many studies have provided evidence that tai chi benefits patients with a variety of chronic disorders. This form of mind-body exercise enhances cardiovascular fitness, muscular strength, balance, and physical function and seems to be associated with reduced stress, anxiety, and depression and improved quality of life. Thus, despite certain limitations in the evidence, tai chi can be recommended to patients with osteoarthritis, rheumatoid arthritis, and fibromyalgia as a complementary and alternative medical approach. This article overviews the current knowledge about tai chi to better inform clinical decision making for rheumatic patients. Copyright © 2011 Elsevier Inc. All rights reserved.

  5. Observation of B0 -> chi_c0 K*0 and Evidence of B+ -> chi_c0 K*+

    Energy Technology Data Exchange (ETDEWEB)

    Aubert, : B.


    The authors present the observation of the decay B{sup 0} {yields} {chi}{sub c0}K*{sup 0} as well as evidence of B{sup +} {yields} {chi}{sub c0}K*{sup +}, with an 8.9 and a 3.6 standard deviation significance, respectively, using a data sample of 454 million {Upsilon}(4S) {yields} B{bar B} decays collected with the BABAR detector at the PEP-II B meson factory located at the Standard Linear Accelerator Center (SLAC). The measured branching fractions are: {Beta}(B{sup 0} {yields} {chi}{sub c0}K*{sup 0}) = (1.7 {+-} 0.3 {+-} 0.2) x 10{sup -4} and {Beta}(B{sup +} {yields} {chi}{sub c0}K*{sup +}) = (1.4 {+-} 0.5 {+-} 0.2) x 10{sup -4}, where the first quoted errors are statistical and the second are systematic. They obtain a branching fraction upper limit of {Beta}(B{sup +} {yields} {chi}{sub c0}K*{sup +}) < 2.1 x 10{sup -4} at the 90% confidence level.

  6. Mesons above the deconfining transition

    International Nuclear Information System (INIS)

    De Forcrand, P.; Garcia Perez, M.; Hashimoto, T.


    We analyze temporal and spatial meson correlators in quenched lattice QCD at T > 0. Above T c we find different masses and (spatial) 'screening masses', signals of plasma formation, and indication of persisting 'mesonic' excitations. (author)

  7. Meson production in two-photon interactions at LHC energies

    Energy Technology Data Exchange (ETDEWEB)

    Da Silva, D. T.; Goncalves, V. P.; Sauter, W. K. [Instituto de Fisica e Matematica, Universidade Federal de Pelotas, Campus Universitario UFPel, CP 354, 96010-900, Capao do Leao-RS (Brazil)


    The LHC opens a new kinematical regime at high energy, where several questions related to the description of the high-energy regime of the Quantum Chromodynamics (QCD) remain without satisfactory answers. Some open questions are the search for non-q-bar q resonances, the determination of the spectrum of q-bar q states and the identification of states with anomalous {gamma}{gamma} couplings. A possible way to study these problems is the study of meson production in two-photon interactions. In this contribution we calculate the meson production in two-photon interactions at LHC energies considering proton - proton collisions and estimate the total cross section for the production of the mesons {pi}, a, f, {eta} and {chi}.

  8. Charge parity exotic mesons

    International Nuclear Information System (INIS)

    Burden, C.J.


    Full text: Evidence for a meson with exotic quantum numbers J PC 1 -+ , the ρ(1405), has been observed at the AGS at Brookhaven and Crystal Barrel at CERN. This meson is exotic to the extent that its quantum numbers are not consistent with the generalised Pauli exclusion principle applied to the naive constituent quark model. In a fully relativistic field theoretic treatment, however, there is nothing in principle to preclude the existence of charge parity exotics. Using our earlier covariant Bethe-Salpeter model of light-quark mesons with no new parameter fitting we demonstrate the existence of a q - q-bar bound state with the quantum numbers of the ρ

  9. Search for scalar mesons

    International Nuclear Information System (INIS)

    Pennington, M.R.


    The search for I = 0 0 ++ mesons is described. The crucial role played by the states in the 1 GeV region is highlighted. An analysis program that with unimpeachable data would produce definitive results on these is outlined and shown with present data to provide prima facie evidence for dynamics beyond that of the quark model. The authors briefly speculate on the current status of the lowest mass scalar mesons and discuss how experiment can resolve the unanswered issues. 30 references, 6 figures, 1 table

  10. Tai Chi and Qi Gong (United States)

    ... of Grants and Contracts General Award Mechanisms Small Business Research Grant Program (SBIR) Funding for: Natural Product Research ... tai chi and qigong in older adults. Western Journal of Nursing Research. 2009;31(2):245–279. Saeed SA, Antonacci ...

  11. Tai Chi and Rheumatic Diseases


    Wang, Chenchen


    Many patients with chronic rheumatic diseases such as osteoarthritis, rheumatoid arthritis and fibromyalgia experience high levels of pain, psychological distress and negative emotions and have limited therapeutic options. Tai Chi is a complex multi-component mind-body exercise that increasing numbers of Americans are practicing, particularly those with musculoskeletal conditions. Clinical trials and observational studies have provided encouraging evidence that Tai Chi, both short and long-te...

  12. Understanding the branching ratios of \\chi_{c1}\\to\\phi\\phi, \\omega\\omega, \\omega\\phi observed at BES-III


    Chen, Dian-Yong; He, Jun; Li, Xue-Qian; Liu, Xiang


    In this work, we discuss the contribution of the mesonic loops to the decay rates of $\\chi_{c1}\\to \\phi\\phi,\\,\\omega\\omega$ which are suppressed by the helicity selection rules and $\\chi_{c1}\\to \\phi\\omega$ which is a double-OZI forbidden process. We find that the mesonic loop effects naturally explain the clear signals of $\\chi_{c1}\\to \\phi\\phi,\\,\\omega\\omega$ decay modes observed by the BES collaboration. Moreover, we investigate the effects of the $\\omega-\\phi$ mixing which may result in t...


    Energy Technology Data Exchange (ETDEWEB)

    Shafer, J. B.; Murray, J. J.; Ferro-Luzzi, M.; Huwe, D. O.


    Properties of the omega meson were studied from the reaction K/sup -/ + p yields LAMBDA + omega in a 72-in. hydrogen bubble chamber. The momentum of the K/sup -/ mesons was 1.2 to 1.75 Bev/c. The mass of the omega meson is found to be 782 Mev with a width, predominated by three-meson( pi ) decay mode, estimated to be less than 4 Mev. Branching ratios for omega -meson decay into pi /sup +/ pi /sup -/ pi /sup o/, pi /sup o/ gamma , pi /sup +/ i/ sup -/, and e/sup +/e/sup -o/ were determined. (R.E.U.)

  14. Glueball-meson mixing

    Energy Technology Data Exchange (ETDEWEB)

    Vento, Vicente [Consejo Superior de Investigaciones Cientificas, Departamento de Fisica Teorica y Instituto de Fisica Corpuscular, Universidad de Valencia, Burjassot (Spain)


    Calculations in unquenched QCD for the scalar glueball spectrum have confirmed previous results of Gluodynamics finding a glueball at ∝1750 MeV. I analyze the implications of this discovery from the point of view of glueball-meson mixing in light of the experimental scalar spectrum. (orig.)

  15. Mesonic Form Factors

    Energy Technology Data Exchange (ETDEWEB)

    Frederic D. R. Bonnet; Robert G. Edwards; George T. Fleming; Randal Lewis; David Richards


    We have started a program to compute the electromagnetic form factors of mesons. We discuss the techniques used to compute the pion form factor and present preliminary results computed with domain wall valence fermions on MILC asqtad lattices, as well as Wilson fermions on quenched lattices. These methods can easily be extended to rho-to-gamma-pi transition form factors.

  16. Techniques in meson spectroscopy

    International Nuclear Information System (INIS)

    Longacre, R.S.


    This report contains lectures on the following topics: the quark model and beyond using quantum chromodynamics; analysis of formation reactions; energy dependence of the partial wave amplitudes; where the data for the t-matrix analysis comes from; and coupled channel analysis of isoscalar mesons

  17. The CHI 2013 interactive schedule

    DEFF Research Database (Denmark)

    Satyanarayan, Arvind; Strazzulla, Daniel; Klokmose, Clemens Nylandsted


    CHI 2013 offers over 500 separate events including paper presentations, panels, courses, case studies and special interest groups. Given the size of the conference, it is no longer practical to host live summaries of these events. Instead, a 30-second Video Preview summary of each event is availa......CHI 2013 offers over 500 separate events including paper presentations, panels, courses, case studies and special interest groups. Given the size of the conference, it is no longer practical to host live summaries of these events. Instead, a 30-second Video Preview summary of each event...... is available. The CHI'13 Interactive Schedule helps attendees navigate this wealth of video content in order to identify events they would like to attend. It consists of a number of large display screens throughout the conference venue which cycle through a video playlist of events. Attendees can interact...

  18. Discovery of omega meson, first neutral vector meson

    International Nuclear Information System (INIS)



    A personal account of the discovery of the ω meson is given by researcher B. Maglich. His account includes such topics as early and unsuccessful searches for a neutral vector meson (by himself and others), eventual discovery of the rho meson, the Goldhaber effect, and the observation and characterization of the ω meson. Explanatory physics notes on electromagnetic structure experiments and the determination of the quantum numbers of the ω meson are provided for nonspecialists. Also included are an outline of the relation between vector mesons and nuclear forces, a reprint of the Physical Review Letter on Evidence for a T = 0 three-pion resonance, and a scientific autobiography of the researcher. 14 figures, 1 table

  19. Off-shell CHY amplitudes

    Energy Technology Data Exchange (ETDEWEB)

    Lam, C.S., E-mail: [Department of Physics, McGill University, Montreal, Q.C., H3A 2T8 (Canada); Department of Physics and Astronomy, University of British Columbia, Vancouver, BC, V6T 1Z1 (Canada); Yao, York-Peng, E-mail: [Department of Physics, The University of Michigan Ann Arbor, MI 48109 (United States)


    The Cachazo–He–Yuan (CHY) formula for on-shell scattering amplitudes is extended off-shell. The off-shell amplitudes (amputated Green's functions) are Möbius invariant, and have the same momentum poles as the on-shell amplitudes. The working principles which drive the modifications to the scattering equations are mainly Möbius covariance and energy momentum conservation in off-shell kinematics. The same technique is also used to obtain off-shell massive scalars. A simple off-shell extension of the CHY gauge formula which is Möbius invariant is proposed, but its true nature awaits further study.

  20. Meson-meson scattering in lattice QED2+1

    International Nuclear Information System (INIS)

    Fiebig, H.R.; Woloshyn, R.M.


    Scattering phase shifts of a meson-meson system in staggered 3-dimensional lattice QED are computed. The main task of the simulation is to obtain a discrete set of two-body energy levels. These are extracted from a 4-point time correlation matrix and then used to obtain scattering phase shifts. The results for the l = 0 and l = 2 partial waves are consistent with short-range repulsion and intermediate-range attraction of the residual meson-meson interaction. (orig.)

  1. Light Meson Distribution Amplitudes

    CERN Document Server

    Arthur, R.; Brommel, D.; Donnellan, M.A.; Flynn, J.M.; Juttner, A.; de Lima, H.Pedroso; Rae, T.D.; Sachrajda, C.T.; Samways, B.


    We calculated the first two moments of the light-cone distribution amplitudes for the pseudoscalar mesons ($\\pi$ and $K$) and the longitudinally polarised vector mesons ($\\rho$, $K^*$ and $\\phi$) as part of the UKQCD and RBC collaborations' $N_f=2+1$ domain-wall fermion phenomenology programme. These quantities were obtained with a good precision and, in particular, the expected effects of $SU(3)$-flavour symmetry breaking were observed. Operators were renormalised non-perturbatively and extrapolations to the physical point were made, guided by leading order chiral perturbation theory. The main results presented are for two volumes, $16^3\\times 32$ and $24^3\\times 64$, with a common lattice spacing. Preliminary results for a lattice with a finer lattice spacing, $32^3\\times64$, are discussed and a first look is taken at the use of twisted boundary conditions to extract distribution amplitudes.

  2. A theory of scalar mesons

    International Nuclear Information System (INIS)

    Hooft, G. t'; Isidori, G.; Maiani, L.; Polosa, A.D.; Riquer, V.


    We discuss the effect of the instanton induced, six-fermion effective Lagrangian on the decays of the lightest scalar mesons in the diquark-antidiquark picture. This addition allows for a remarkably good description of light scalar meson decays. The same effective Lagrangian produces a mixing of the lightest scalars with the positive parity qq-bar states. Comparing with previous work where the qq-bar mesons are identified with the nonet at 1200-1700 MeV, we find that the mixing required to fit the mass spectrum is in good agreement with the instanton coupling obtained from light scalar decays. A coherent picture of scalar mesons as a mixture of tetraquark states (dominating in the lightest mesons) and heavy qq-bar states (dominating in the heavier mesons) emerges

  3. The size of chi = arg (-Vts Vtb* Vcs* Vcb) and physics beyond the Standard Model

    CERN Document Server

    Aguilar-Saavedra, J A; Branco, Gustavo Castello; Nebot, M


    We analyse the allowed range of values of chi, both in the Standard Model and in models with New Physics, pointing out that a relatively large value of chi, e.g. of order lambda, is only possible in models where the unitarity of the 3x3 Cabibbo-Kobayashi-Maskawa matrix is violated through the introduction of extra Q=2/3 quarks. We study the interesting case where the extra quark is an isosinglet, determining the allowed range for chi and the effect of a large chi on various low-energy observables, such as CP asymmetries in B meson decays. We also discuss the correlated effects which would be observable at high energy colliders, like decays t -> cZ, modifications of the cross section and forward-backward asymmetry in e+ e- -> ttbar and the direct production of a new quark.

  4. Mesons and quarks in nuclei

    International Nuclear Information System (INIS)

    Oset, E.


    A short review of the topic of mesons in nuclei is exposed paying particular attention to the relationship between several mesonic processes. Special emphasis is put into the microscopic pictures that can ultimately relate all these processes with the elementary coupling of mesons to the nuclear hadronic components. The importance of the short range part of the nuclear interaction opens the doors to a more basic understanding in terms of the quark components of nucleons and isobars. (orig.)

  5. Central exclusive $J/\\psi$ and $\\chi_c$ production at LHCb

    CERN Document Server

    Stevenson, S


    Central exclusive $J/\\psi$ and $\\chi_c$ meson production has been measured in decays to dimuons with the LHCb detector, in data corresponding to 36 pb$^{-1}$ of integrated luminosity from $\\sqrt{s}$= 7 TeV proton-proton collisions. Cross-section measurements for $J/\\psi$, $\\psi$ (2S) and $\\chi_{c0,c1,c2}$ production are presented, and the $J/\\psi$ photoproduction cross-section is measured as a function of the photon-proton centre-of-mass energy and compared to measurements made at HERA.

  6. Rare B Meson Decays With Omega Mesons

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Lei; /Colorado U.


    Rare charmless hadronic B decays are particularly interesting because of their importance in understanding the CP violation, which is essential to explain the matter-antimatter asymmetry in our universe, and of their roles in testing the ''effective'' theory of B physics. The study has been done with the BABAR experiment, which is mainly designed for the study of CP violation in the decays of neutral B mesons, and secondarily for rare processes that become accessible with the high luminosity of the PEP-II B Factory. In a sample of 89 million produced B{bar B} pairs on the BABAR experiment, we observed the decays B{sup 0} {yields} {omega}K{sup 0} and B{sup +} {yields} {omega}{rho}{sup +} for the first time, made more precise measurements for B{sup +} {yields} {omega}h{sup +} and reported tighter upper limits for B {yields} {omega}K* and B{sup 0} {yields} {omega}{rho}{sup 0}.

  7. MesonNet Workshop on Meson Transition Form Factors

    CERN Document Server

    Eidelman, S; Hanhart, C; Kubis, B; Kupsc, A; Leupold, S; Moskal, P; Schadmand, S


    The mini-proceedings of the Workshop on Meson Transition Form Factors held in Cracow from May 29th to 30th, 2012 introduce the meson transition form factor project with special emphasis on the interrelations between the various form factors (on-shell, single off-shell, double off-shell). Short summaries of the talks presented at the workshop follow.

  8. Exotic meson spectroscopy with CLAS

    Energy Technology Data Exchange (ETDEWEB)

    Adams, G.; Napolitano, J. [Rensselaer Polytechnic Inst., Troy, NY (United States)


    The identification and study of mesons with explicit gluonic degrees of freedom will provide major constraints on nonperturbative QCD and models thereof. CLAS will provide a unique opportunity for studying these resonances by measuring photoproduction of multi-meson final states.

  9. Strange mesonic transition form factor

    International Nuclear Information System (INIS)

    Goity, J.L.; Musolf, M.J.


    The strange-quark vector current ρ-to-π meson transition form factor is computed at one-loop order using strange meson intermediate states. A comparison is made with a φ-meson dominance model estimate. We find that one-loop contributions are comparable in magnitude to those predicted by φ-meson dominance. It is possible that the one-loop contribution can make the matrix element as large as those of the electromagnetic current mediating vector meson radiative decays. However, due to the quadratic dependence of the one-loop results on the hadronic form factor cutoff mass, a large uncertainty in the estimate of the loops is unavoidable. These results indicate that non-nucleonic strange quarks could contribute appreciable in moderate-parallel Q 2 parallel parity-violating electron-nucleus scattering measurements aimed at probing the strange-quark content of the nucleon. copyright 1996 The American Physical Society

  10. Meson Spectroscopy at COMPASS

    CERN Document Server

    Grube, Boris


    The COmmon Muon and Proton Apparatus for Structure and Spectroscopy (COMPASS) is a multi-purpose fixed-target experiment at the CERN Super Proton Synchrotron (SPS) aimed at studying the structure and spectrum of hadrons. The two-stage spectrometer has a good acceptance for charged as well as neutral particles over a wide kinematic range and thus allows to access a wide range of reactions. Light mesons are studied with negative (mostly $\\pi^-$) and positive ($p$, $\\pi^+$) hadron beams with a momentum of 190 GeV/$c$. The spectrum of light mesons is investigated in various final states produced in diffractive dissociation reactions at squared four-momentum transfers to the target between 0.1 and 1.0 $(\\text{GeV}/c)^2$. The flagship channel is the $\\pi^-\\pi^+\\pi^-$ final state, for which COMPASS has recorded the currently largest data sample. These data not only allow to measure the properties of known resonances with high precision, but also to search for new states. Among these is a new resonance-like signal, t...

  11. Meson radiobiology and therapy

    International Nuclear Information System (INIS)

    Kilgerman, M.M.


    High-linear energy transfer radiation (neutrons, heavy ions, and pions) have a greater relative biological effectiveness than low-linear energy transfer radiation by depositing a high density of ionization in irradiated cells. This overcomes the protective effect of oxygen; decreases the variation in sensitivity among the several stages of the cell cycles; and, inhibits the repair of sublethal damage as compared to x-rays, gamma rays, electrons and protons. Negative pi mesons (pions), appear particularly suited for radiation therapy as their penetration and depth-dose profiles lend themselves to shaping the high dose area to the tumor size and location. Preliminary biological experiments with pions produced at the Los Alamos Meson Physics Facility studied cell survival at various radiation depths and cell cycle sensitivity. Histologic study of data from the first human experiments indicated severe tumor cell destruction by pions as compared to x-rays in treating malignant melanoma skin nodules, without increased effects on dermal elements. (U.S.)

  12. [Medium energy meson research

    International Nuclear Information System (INIS)

    Crowe, K.M.


    The activities of this group are primarily concerned with experiments using the Crystal Barrel Detector. This detector is installed and operating at the Low Energy Antiproton Ring (LEAR) at CERN. QCD, the modem theory of the strong interaction, is reasonably well understood at high energies, but unfortunately, low-energy QCD is still not well understood, and is far from being adequately tested. The Crystal Barrel experiments are designed to provide some of the tests. The basic line of research involves meson spectroscopy, analyses bearing on the quark and/or gluon content of nuclear states, and the exploration of mechanisms and rules which govern p bar p annihilation dynamics. The Crystal Barrel Detector detects and identifies charged and neutral particles with a geometric acceptance close to 100%. The principal component of the detector is an array of 1,380 CsI(TI) crystals. These crystals surround a Jet Drift Chamber (JDC), located in a 1.5 Tesla magnetic field, which measures the momentum and dE/dx of charged particles. One of the very interesting physics goals of the detector is a search for exotic mesonic states -- glueballs and hybrids. Annihilation at rest will be studied with both liquid and gaseous hydrogen targets. The gaseous target offers the possibility of triggering on atomic L-shell X rays so that specific initial angular momentum states can be studied.These topics as well as other related topics are discussed in this report

  13. Meson Spectroscopy at COMPASS

    CERN Document Server

    Grube, Boris


    The goal of the COMPASS experiment at CERN is to study the structure and dynamics of hadrons. The two-stage spectrometer used by the experiment has large acceptance and covers a wide kinematic range for charged as well as neutral particles and can therefore measure a wide range of reactions. The spectroscopy of light mesons is performed with negative (mostly $\\pi^-$) and positive ($p$, $\\pi^+$) hadron beams with a momentum of 190 GeV/$c$. The light-meson spectrum is measured in different final states produced in diffractive dissociation reactions with squared four-momentum transfer $t$ to the target between 0.1 and 1.0 $(\\text{GeV}/c)^2$. The flagship channel is the $\\pi^-\\pi^-\\pi^+$ final state, for which COMPASS has recorded the currently world's largest data sample. These data not only allow to measure the properties of known resonances with high precision, but also to observe new states. Among these is a new axial-vector signal, the $a_1(1420)$, with unusual properties. Novel analysis techniques have been...

  14. Physics with ETA mesons

    International Nuclear Information System (INIS)

    Liu, Lon-chang.


    Since the advent of pion factories, an impressive amount of information about the nuclear dynamics of the Δ(1232) pion- nucleon resonance has been obtained. The study of this isospin-3/2 resonance has greatly benefited from the fact that π/sup /minus//n and π + p systems are pure I = 3/2 states, which couple only to the Δ in the resonance region. Such isospin selectivity of the pion does not exist, however, for the I = 1/2 N* resonances because it is not possible to form a pure I = 1/2 state with a pion and a nucleon. Eta mesons have zero isospin. Consequently, the /eta/N systems are in a pure I = 1/2 state, and /eta/ can be used to tag those N* resonances to which it strongly couples. We will briefly review the πN interaction from the threshold region to c.m. energy √s ≅1600 MeV. We shall see how improved πN data can help the study of πN interactions. I shall discuss what new information about the hadronic interaction can be learned from the study of eta production in pp collisions. The behavior of eta meson in nuclei will be discussed. The interesting question of the quark structure of /eta/(549) and /eta/'(958) will also be discussed within the framework of a simple model. 19 refs., 13 figs

  15. Charmed meson production at LHCb

    International Nuclear Information System (INIS)

    Müller, Dominik


    Measurements of charm meson production are important tests for QCD predictions and LHCb is uniquely suited to perform these measurements in the forward region. This paper summarises recent charm meson production measurements performed by LHCb of J/ψ and open charm mesons and the associated production of ϒ and open charm mesons. The J/ψ and open charm meson measurements are performed with data recorded in Run 2 of the Large Hadron Collider. With proton-proton collisions at √s = 13 TeV, these open a new regime in which QCD predictions for charm meson production may be precisely tested. Furthermore, ratios of cross-sections at different centre-of-mass energies benefit of cancellation of both experimental and theoretical uncertainties, providing a new sensitive test of the QCD calculations. Measurements of ϒ and open charm meson associated production are performed using √s = 7 TeV and √s = 8 TeV data and constitute the first observation of this production channel.

  16. Meson 2000 Conference Summary lite

    International Nuclear Information System (INIS)

    Barnes, T.


    This short contribution is a late MESON2000 conference summary. As appropriate for the 600th anniversary of the Jagiellonian University, it begins with a brief summary of the last 600 years of European history and its place in hadron physics. Next a ''physicist chirality'' order parameter PC is introduced. When applied to MESON2000 plenary speakers this order parameter illustrates the separation of hadron physicists into disjoint communities. The individual plenary talks in MESON2000 are next sorted according to the subconference associated with each of the 36 plenary speakers. Finally, I conclude with a previously unreported Feynman story regarding the use of models in hadron physics. (author)

  17. Hard electroproduction of hybrid mesons

    International Nuclear Information System (INIS)

    Anikin, I.V.; LPT Universite Paris-Sud, Orsay; Szymanowski, L.; Teryaev, O.V.; ); Wallon, S.


    We estimate the sizeable cross section for deep exclusive electroproduction of an exotic J PC = 1 -+ hybrid meson in the Bjorken regime. The production amplitude scales like the one for usual meson electroproduction, i.e. as 1/Q 2 . This is due to the non-vanishing leading twist distribution amplitude for the hybrid meson, which may be normalized thanks to its relation to the energy momentum tensor and to the QCD sum rules technique. The hard amplitude is considered up to next-to-leading order in as and we explore the consequences of fixing the renormalization scale ambiguity through the BLM procedure. (author)

  18. Biomedical wellness by tai chi and sports (United States)

    Chin, Daniel C.; Chin, Amita G.


    Tai-chi chuan is popular worldwide especially in China. People practice tai-chi chuan daily with faith believing that they will be rewarded with health and varieties of other rewords. The Tai Chi Chuan Theory by Master Chang and the Tai Chi Chuan Theory by Master Wang are translated to be the baseline of the tai-chi chuan. The theory described in these two papers clearly shows that the tai-chi power source is the combination of the two antigravity forces distinction by each foot. The ying, yang and hollowed, solid discussed in the papers are the properties and body relationship of the two antigravity forces. The antigravity forces presented inside of body are as air to the balloon termed chi. However chi could be generated by any muscle pressing; only the antigravity forces from feet are called nature chi that has the maximum strength of the person. When a person is soft, as an infant the nature chi will fulfill entire body with no time and effort. The sequence forms were designed for deploying the nature chi in speed and power. The combination of chi and tai-chi form make tai chi chuan supreme than other kinds of martial art. In the training process chi massages whole body many time for a sequence form practice that stimulate all organs and could lead to cure body diseases, lose weight, postpone aging process, and remove the aging symptoms. For the people practicing in the park daily with proper guidance they will fulfill their wishes. Tai chi exercise could also apply to other sports as in dancing and golfing they are discussed at the end of the paper.

  19. Meson Spectroscopy at COMPASS

    International Nuclear Information System (INIS)

    Haas, F.


    In addition to constituent q q(bar) pair configurations, four quark states or gluonic excitations like hybrids or glueballs are also expected to contribute to the mesonic spectrum. The most promising way to identify such states allowed by QCD is the search for J PC quantum number combinations which are forbidden in the constituent quark model. The fixed target COMPASS experiment at CERN offers the opportunity to search for such states in the light quark sector with an unprecedented statistics. First studies of diffractive reactions of 190 GeV/c ions were carried out by COMPASS during a pilot run in 2004. In a first analysis, the three charged pion final state was studied. A Partial Wave Analysis (PWA) with 42 waves including acceptance corrections through a phase-space Monte Carlo simulation of the spectrometer was performed. The exotic π1 (1600) meson with quantum numbers J PC 1 -+ has been clearly established in the ρ-π decay channel with a mass of 1660 ± 0.010(stat) MeV and a width of 0.269 ± 0.021(stat) MeV. The final state with 5 charged pions was also investigated. Results from that study will also be presented. The improved detectors performance in 2008 allows us to study besides these channels further diffractively and centrally produced resonances, neutral ones as well as charged ones. First results of the ongoing analysis of the 2008 data taking period, using a 190 GeV/c pion beam on a hydrogen target will be given. (author)

  20. Brookhaven: Hunting for unusual mesons

    Energy Technology Data Exchange (ETDEWEB)

    Dzierba, Alex R.


    After the overwhelming experimental evidence for the quark model came the notions of colour and confinement which explained why quarks should prefer to bind in 'colourless' systems - quark-antiquark (mesons) and three quarks (baryons)

  1. Brookhaven: Hunting for unusual mesons

    International Nuclear Information System (INIS)

    Dzierba, Alex R.


    After the overwhelming experimental evidence for the quark model came the notions of colour and confinement which explained why quarks should prefer to bind in 'colourless' systems - quark-antiquark (mesons) and three quarks (baryons)

  2. SACLAY: Eta mesons at Saturne

    Energy Technology Data Exchange (ETDEWEB)



    Using a nuclear reaction, the new tagged eta meson facility now operating at the French Saturne National Laboratory in Saclay produces eta mesons (together with recoil helium-3 nuclei) by proton bombardment of a deuterium target. The proton beam is extracted from the Saturne synchrotron at 893 MeV, stabilized to 80 keV. This is a scant 1.5 MeV above the reaction threshold and close to the energy where eta production peaks.

  3. SACLAY: Eta mesons at Saturne

    International Nuclear Information System (INIS)



    Using a nuclear reaction, the new tagged eta meson facility now operating at the French Saturne National Laboratory in Saclay produces eta mesons (together with recoil helium-3 nuclei) by proton bombardment of a deuterium target. The proton beam is extracted from the Saturne synchrotron at 893 MeV, stabilized to 80 keV. This is a scant 1.5 MeV above the reaction threshold and close to the energy where eta production peaks

  4. Tai Chi and balance control. (United States)

    Wong, Alice M K; Lan, Ching


    Balance function begins to decline from middle age on, and poor balance function increases the risk of fall and injury. Suitable exercise training may improve balance function and prevent accidental falls. The coordination of visual, proprioceptive, vestibular and musculoskeletal system is important to maintain balance. Balance function can be evaluated by functional balance testing and sensory organization testing. Tai Chi Chuan (TC) is a popular conditioning exercise in the Chinese community, and recent studies substantiate that TC is effective in balance function enhancement and falls prevention. In studies utilizing functional balance testing, TC may increase the duration of one-leg standing and the distance of functional reach. In studies utilizing sensory organization testing, TC improves static and dynamic balance, especially in more challenging sensory perturbed condition. Therefore, TC may be prescribed as an alternative exercise program for elderly subjects or balance-impaired patients. Participants can choose to perform a complete set of TC or selected movements according to their needs. In conclusion, TC may improve balance function and is appropriate for implementation in the community.

  5. Unified Chiral models of mesons and baryons

    International Nuclear Information System (INIS)

    Mendez-Galain, R.; Ripka, G.


    Unified Chiral models of mesons and baryons are presented. Emphasis is placed on the underlying quark structure of hadrons including the Skyrmion. The Nambu Jona-Lasinio model with vector mesons is discussed

  6. Search for rare B meson decays into Ds+ mesons

    International Nuclear Information System (INIS)

    Albrecht, H.; Ehrlichmann, H.; Hamacher, T.; Hofmann, R.P.; Kirchhoff, T.; Nau, A.; Nowak, S.; Schroeder, H.; Schulz, H.D.; Walter, M.; Wurth, R.; Appuhn, R.D.; Hast, C.; Kolanoski, H.; Lange, A.; Lindner, A.; Mankel, R.; Schieber, M.; Siegmund, T.; Spaan, B.; Thurn, H.; Toepfer, D.; Walther, A.; Wegener, D.; Britton, D.I.; Charlesworth, C.E.K.; Edwards, K.W.; Hyatt, E.R.F.; Kapitza, H.; Krieger, P.; MacFarlane, D.B.; Patel, P.M.; Prentice, J.D.; Saull, P.R.B.; Tzamariudaki, K.; Van de Water, R.G.; Yoon, T.S.; Ressing, D.; Schmidtler, M.; Schneider, M.; Schubert, K.R.; Strahl, K.; Waldi, R.; Weseler, S.; Balagura, V.; Belyaev, I.; Chechelnitsky, S.; Danilov, M.; Droutskoy, A.; Gershtein, Yu.; Golutvin, A.; Gorelov, I.; Kostina, G.; Lubimov, V.; Pakhlov, P.; Ratnikov, F.; Semenov, S.; Shibaev, V.; Soloshenko, V.; Tichomirov, I.; Zaitsev, Yu.


    A search has been performed for rare B meson decays into D s + mesons arising from b→u transitions, W exchange modes, B + annihilation processes, and decays where the D s + is not produced via a W→c anti s quark pair coupling, using the ARGUS detector operating on the Y(4S) resonance at the e + e - storage ring DORIS II. Upper limits for individual decay modes are obtained. In addition, from a study of D s + l - correlations an upper limit of BR(B→D s + l - X)<1.2%(90% CL) is determined. (orig.)

  7. Deep electroproduction of exotic hybrid mesons

    International Nuclear Information System (INIS)

    Anikin, I.V.; Pire, B.; Szymanowski, L.; Teryaev, O.V.; Wallon, S.


    We evaluate the leading order amplitude for the deep exclusive electroproduction of an exotic hybrid meson in the Bjorken regime. We show that, contrarily to naive expectation, this amplitude factorizes at the twist 2 level and thus scales like usual meson electroproduction when the virtual photon and the hybrid meson are longitudinally polarized. Exotic hybrid mesons may thus be studied in electroproduction experiments at JLAB, HERA (HERMES) or CERN (Compass)

  8. Nature of the light scalar mesons

    International Nuclear Information System (INIS)

    Vijande, J.; Valcarce, A.; Fernandez, F.; Silvestre-Brac, B.


    Despite the apparent simplicity of meson spectroscopy, light scalar mesons cannot be accommodated in the usual qq structure. We study the description of the scalar mesons below 2 GeV in terms of the mixing of a chiral nonet of tetraquarks with conventional qq states. A strong diquark-antidiquark component is found for several states. The consideration of a glueball as dictated by quenched lattice QCD drives a coherent picture of the isoscalar mesons

  9. Meson Correlators in Finite Temperature Lattice QCD

    CERN Document Server

    De Forcrand, Philippe; Hashimoto, T; Hioki, S; Matsufuru, H; Miyamura, O; Nakamura, A; Takaishi, T; Umeda, T; Stamatescu, I O; CERN. Geneva; Forcrand, Ph. de


    We analyze temporal and spatial meson correlators in quenched lattice QCD at T>0. Below T_c we observe little change in the meson properties as compared with T=0. Above T_c we observe new features: chiral symmetry restoration and signals of plasma formation, but also indication of persisting mesonic (metastable) states and different temporal and spatial masses in the mesonic channels. This suggests a complex picture of QGP in the region 1 - 1.5 T_c.

  10. Production of excited charmed mesons at LEP

    CERN Document Server

    Abbaneo, D


    Studies od the production of orbitally excited charmed and charmed strange mesons in e+e- collisions, performed by the LEP collaborations are reviewed. Measurements of the production rates of orbitally excited charmed mesons in semileptonic b decays are presented. Searches for charmed meson radial excitations are also briefly discussed.

  11. The search for scalar mesons

    International Nuclear Information System (INIS)

    Pennington, M.R.


    The search of I = 0 0 ++ mesons is described. We highlight the crucial role played by the states in the 1 GeV region. An analysis program that with unimpeachable data would produce definitive results on these is outlined and shown with present data to provide prima facie evidence for dynamics beyond that of the quark model. We briefly speculate on the current status of the lowest mass scalar mesons and discuss how experiment can resolve the unanswered issues. 30 refs., 6 figs., 1 tab

  12. A search for unconventional mesons

    International Nuclear Information System (INIS)

    Turnau, J.


    Selected problems of the fixed target meson spectroscopy connected with the issue of unconventional states glueballs, hybrides and four-quarks are discussed. The experimental basis of the dissertation consists of some results of the WA3 experiment performed by ACCMOR collaboration (Π - p→(3Π) - p, K - p→K - Π + Π - p, Π - p→K s o K s o n) and of the S136 experiment performed by CCM collaborations (Π - p↑→Π + Π - n, Π - p↑→K + K - n). Mesons with spin parities J PC = 0 -+ , 0 ++ , 1 ++ and 2 ++ are discussed from the point of view of the phenomenology of unconventional states. (author)

  13. Observation of CP Violation in the Neutral B Meson System

    Energy Technology Data Exchange (ETDEWEB)

    Levy, S


    This dissertation presents a measurement of time-dependent CP-violating asymmetries in neutral B meson decays collected with the BABAR detector at the PEP-II asymmetric-energy B Factory at the Stanford Linear Accelerator Center. The data sample consists of about 88 million {Upsilon}(4S) {yields} B{bar B} decays collected between 1999 and 2002. We study events in which one neutral B meson decay to the CP-eigenstates J/{psi} K{sub S}{sup 0}, {psi}(2S)K{sub S}{sup 0}, {chi}{sub c1}K{sub S}{sup 0}, and {eta}{sub c}K{sub S}{sup 0}, or to flavor-eigenstates involving D{sup (*)}{pi}/{rho}/a{sub 1} and J/{psi}K*{sup 0}(K*{sup 0} {yields} K{sup +} {pi}{sup -}), is fully reconstructed. The flavor of the other neutral B meson is tagged at the time of its decay, mainly using the charge of identified leptons and kaons. The proper time elapsed between the meson decays is determined by measuring the distance between the decay vertices. The amplitude of the CP-violating asymmetry, which in the Standard Model is proportional to sin2{beta}, is determined from a simultaneous maximum-likelihood fit to the time-difference distribution of the flavor- and CP-eigenstate samples. We measure sin2{beta} = 0.755 {+-} 0.074 (stat) {+-} 0.030 (syst).

  14. Exclusive production of meson pairs and resonances in proton-proton collisions

    Energy Technology Data Exchange (ETDEWEB)

    Lebiedowicz, Piotr [Institute of Nuclear Physics PAN, PL-31-342 Cracow (Poland); Szczurek, Antoni [Institute of Nuclear Physics PAN, PL-31-342 Cracow, Poland and University of Rzeszow, PL-35-959 Rzeszow (Poland)


    We report a study of the central exclusive production of {pi}{sup +}{pi}{sup -} and K{sup +}K{sup -} pairs in high energy hadron-hadron collisions. The amplitude is calculated in the Regge approach including both pomeron and secondary reggeon exchanges and absorption effects due to proton-proton interaction and {pi}{pi} (KK) rescattering. We discuss a measurement of exclusive production of a scalar {chi}{sub c0} meson via {chi}{sub c0}{yields}{pi}{sup +}{pi}{sup -}, K{sup +}K{sup -} decay. We find that the relative contribution of resonance states and the {pi}{pi} (KK) continuum strongly depend on the cut on pion (kaon) transverse momentum. We compare the results with the existing experimental data and present predictions for the RHIC, Tevatron and LHC colliders. We discuss also the f{sub 2} (1270) meson production mediated by an effective tensor pomeron exchanges.

  15. Deriving simulators for hybrid Chi models

    NARCIS (Netherlands)

    Beek, van D.A.; Man, K.L.; Reniers, M.A.; Rooda, J.E.; Schiffelers, R.R.H.


    The hybrid Chi language is formalism for modeling, simulation and verification of hybrid systems. The formal semantics of hybrid Chi allows the definition of provably correct implementations for simulation, verification and realtime control. This paper discusses the principles of deriving an

  16. CHI: A General Agent Communication Framework

    Energy Technology Data Exchange (ETDEWEB)

    Goldsmith, S.Y.; Phillips, L.R.; Spires, S.V.


    We have completed and exercised a communication framework called CHI (CLOS to HTML Interface) by which agents can communicate with humans. CHI follows HTTP (HyperText Transfer Protocol) and produces HTML (HyperText Markup Language) for use by WWW (World-Wide Web) browsers. CHI enables the rapid and dynamic construction of interface mechanisms. The essence of CHI is automatic registration of dynamically generated interface elements to named objects in the agent's internal environment. The agent can access information in these objects at will. State is preserved, so an agent can pursue branching interaction sequences, activate failure recovery behaviors, and otherwise act opportunistically to maintain a conversation. The CHI mechanism remains transparent in multi-agent, multi-user environments because of automatically generated unique identifiers built into the CHI mechanism. In this paper we discuss design, language, implementation, and extension issues, and, by way of illustration, examine the use of the general CHI/HCHI mechanism in a specific international electronic commerce system. We conclude that the CHI mechanism is an effective, efficient, and extensible means of the agent/human communication.

  17. In Defense of Chi's Ontological Incompatibility Hypothesis (United States)

    Slotta, James D.


    This article responds to an article by A. Gupta, D. Hammer, and E. F. Redish (2010) that asserts that M. T. H. Chi's (1992, 2005) hypothesis of an "ontological commitment" in conceptual development is fundamentally flawed. In this article, I argue that Chi's theoretical perspective is still very much intact and that the critique offered by Gupta…

  18. A Journey to Wholeness Through Tai Chi (United States)

    Al-Turki, Faiza

    Healing is a multifaceted venture. Whereas many traditional cultures see healing as a journey that, by necessity, combines body, mind, and spirit, today's Western society frequently divides healing, relegating its parts to various experts--body to physicians, mind to psychologists, spirit to religions. Employing heuristic and alchemical hermeneutic methodologies, this thesis explores tai chi as a healing tool that bridges that division, exploring the following question: is it possible that the connection of body, mind, and spirit offered by tai chi is the very mechanism by which it facilitates healing? The cultural and historical context of tai chi is introduced, as well as research showing various Western views. A heuristic approach offers personal examples of the use of tai chi as a process partner, while a depth psychological lens informs the use of tai chi principles to guide moments of self-exploration and transformation in a therapeutic way.

  19. Production of mesons with new flavor in e+e- collisions

    International Nuclear Information System (INIS)

    Maharana, J.; Singh, L.P.


    Cross sections for production of BB-bar, B-barB*+B-bar*B, and B*B-bar* mesons (carrying b-quark quantum numbers) in e + e - annihilation are estimated and differential cross sections are evaluated. The cross sections for e + e - → e + e - eta/sub b/, e + e - → e + e - chi/sub b/, and e + e - → e + e - BB-bar are computed in the equivalent-photon approximation

  20. A thermodynamical analysis of the π and K meson valence structure functions

    International Nuclear Information System (INIS)

    Angelini, C.; Pazzi, R.


    The π and K meson valance structure functions are analysed in the framework of a thermodynamical model already applied to the nucleon. We obtain a simple expression which reproduces quite well the data for chi > 0.3. The effective temperatures are found to be of the order of 20 MeV for the pion and 65 MeV for the kaon. (orig.)

  1. QCD bosonization and the meson effective action

    International Nuclear Information System (INIS)

    Praschifka, J.; Roberts, C.D.; Cahill, R.T.


    A bosonization of quantum chromodynamics (QCD) is employed to derive a meson effective action, thus providing a direct link between QCD and meson phenomenology. As an example of this approach expressions are obtained for the meson parameters associated with the analysis of ω→3π decay. The bosonization also directly motivates a divergence-free, global color-symmetry model for mesons, which is seen to be a generalization of various phenomenological models. Good estimates are obtained for the values of several of the meson parameters

  2. Spin-zero mesons and current algebras

    International Nuclear Information System (INIS)

    Wellner, M.


    Large chiral algebras, using the f and d coefficients of SU(3) can be constructed with spin-1/2 baryons. Such algebras have been found useful in some previous investigations. This article examines under what conditions similar or identical current algebras may be realized with spin-0 mesons. A curious lack of analogy emerges between meson and baryon currents. Second-class currents, made of mesons, are required in some algebras. If meson and baryon currents are to satisfy the same extended SU(3) algebra, four meson nonets are needed, in terms of which we give an explicit construction for the currents

  3. Mesons in the nuclear Medium

    CERN Document Server

    Kotulla, M


    We discuss recent experimental results on the modification of hadron properties in a nuclear medium. Particular emphasis is placed on an $\\omega$ production experiment performed by the CBELSA/TAPS collaboration at the ELSA accelerator. The data shows a smaller $\\omega$ meson mass together with a significant increase of its width in the nuclear medium.

  4. Decay of the Bottom mesons

    International Nuclear Information System (INIS)

    Duong Van Phi; Duong Anh Duc


    The channels of the decay of Bottom mesons are deduced from a selection rule and the Lagrangians which are formed on the LxO(4) invariance and the principle of minimal structure. The estimation of the corresponding decay probabilities are considered. (author). 21 refs

  5. Exclusive meson production at COMPASS

    CERN Document Server

    Pochodzalla, Josef; Moinester, Murray; Piller, Gunther; Sandacz, Andrzej; Vanderhaeghen, Marc; Pochodzalla, Josef; Mankiewicz, Lech; Moinester, Murray; Piller, Gunther; Sandacz, Andrzej; Vanderhaeghen, Marc


    We explore the feasibility to study exclusive meson production (EMP) in hard muon-proton scattering at the COMPASS experiment. These measurements constrain the off-forward parton distributions (OFPD's) of the proton, which are related to the quark orbital contribution to the proton spin.

  6. Distribution amplitudes of vector mesons

    Energy Technology Data Exchange (ETDEWEB)

    Braun, V.M. [Regensburg Univ. (Germany). Inst. fuer Theoretische Physik; Broemmel, D. [Deutsches Elektronen-Synchrotron, Hamburg (Germany); Goeckeler, M. [Regensburg Univ. (DE). Inst. fuer Theoretische Physik] (and others)


    Results are presented for the lowest moment of the distribution amplitude for the K{sup *} vector meson. Both longitudinal and transverse moments are investigated. We use two flavours of O(a) improved Wilson fermions, together with a non-perturbative renormalisation of the matrix element. (orig.)

  7. A light meson translatable template

    International Nuclear Information System (INIS)

    Allgower, C.E.; Peaslee, D.C.


    Recently surveyed (mass)2 values for I = 0, JPC = 2++ light mesons can be assembled into repeating patterns of 4 states, dubbed 'templates'. Within error, both internal and external template spacings approximate simple multiples of Δm2 ≅ 0.35 GeV2. Hopefully, this feature will be useful in predicting the positions of higher isoscalar 2++ states

  8. Chi-Nu Level 2 Review

    Energy Technology Data Exchange (ETDEWEB)

    Haight, Robert Cameron [Los Alamos National Laboratory; Lee, Hye Young [Los Alamos National Laboratory; Mosby, Shea Morgan [Los Alamos National Laboratory; O' Donnell, John M. [Los Alamos National Laboratory; Solomon, Clell Jeffrey Jr. [Los Alamos National Laboratory; Taddeucci, Terry Nicholas [Los Alamos National Laboratory; Fotiadis, Nikolaos [Los Alamos National Laboratory; Devlin, Matthew James [Los Alamos National Laboratory; Ullmann, John Leonard [Los Alamos National Laboratory; Bredeweg, Todd Allen [Los Alamos National Laboratory; Jandel, Marian [Los Alamos National Laboratory; Nelson, Ronald Owen [Los Alamos National Laboratory; Wender, Stephen Arthur [Los Alamos National Laboratory; Neudecker, Denise [Los Alamos National Laboratory; Rising, Michael Evan [Los Alamos National Laboratory; White, Morgan Curtis [Los Alamos National Laboratory; Wu, Ching-Yen [Los Alamos National Laboratory; Bucher, Brian Michael [Los Alamos National Laboratory; Buckner, Matthew Quinn [Los Alamos National Laboratory; Henderson, Roger Alan [Los Alamos National Laboratory


    This series of slides presents information on Chi-Nu measurements and analysis of prompt fission neutron spectra (PFNS) for neutron energy below 1 MeV for 235U. A key focus of the Chi-Nu measurement is to address the energy dependence of the low-energy emissions. The 235U PFNS evaluation is in progress. Chi-Nu delivered preliminary experimental data and input for part of the old experimental data base. The 239Pu PFNS evaluation is finalized and submitted for testing. Data from 252Cf spontaneous fission will also be obtained.

  9. CHY loop integrands from holomorphic forms

    Energy Technology Data Exchange (ETDEWEB)

    Gomez, Humberto [Facultad de Ciencias Basicas, Universidad Santiago de Cali,Calle 5 62-00 Barrio Pampalinda, Cali, Valle (Colombia); Perimeter Institute for Theoretical Physics,31 Caroline Street N, Waterloo, ON N2L 2Y5 (Canada); Mizera, Sebastian; Zhang, Guojun [Perimeter Institute for Theoretical Physics,31 Caroline Street N, Waterloo, ON N2L 2Y5 (Canada); Department of Physics & Astronomy, University of Waterloo,Waterloo, ON N2L 3G1 (Canada)


    Recently, the Cachazo-He-Yuan (CHY) approach for calculating scattering amplitudes has been extended beyond tree level. In this paper, we introduce a way of constructing CHY integrands for Φ{sup 3} theory up to two loops from holomorphic forms on Riemann surfaces. We give simple rules for translating Feynman diagrams into the corresponding CHY integrands. As a complementary result, we extend the L-algorithm, originally introduced in, to two loops. Using this approach, we are able to analytically verify our prescription for the CHY integrands up to seven external particles at two loops. In addition, it gives a natural way of extending to higher-loop orders.

  10. Meson-Meson molecules and compact four-quark states

    International Nuclear Information System (INIS)

    Vijande, J.; Valcarce, A.


    The physics of charm has become one of the best laboratories exposing the limitations of the naive constituent quark model and also giving hints into a more mature description of meson spectroscopy, beyond the simple quark-antiquark configurations. In this talk we review some recent studies of multiquark components in the charm sector and discuss in particular exotic and non-exotic four-quark systems.

  11. Inclusive decays of {ital B} mesons to charmonium

    Energy Technology Data Exchange (ETDEWEB)

    Balest, R.; Cho, K.; Ford, W.T.; Johnson, D.R.; Lingel, K.; Lohner, M.; Rankin, P.; Smith, J.G.; Alexander, J.P.; Bebek, C.; Berkelman, K.; Bloom, K.; Browder, T.E.; Cassel, D.G.; Cho, H.A.; Coffman, D.M.; Crowcroft, D.S.; Drell, P.S.; Dumas, D.J.; Ehrlich, R.; Gaidarev, P.; Garcia-Sciveres, M.; Geiser, B.; Gittelman, B.; Gray, S.W.; Hartill, D.L.; Heltsley, B.K.; Henderson, S.; Jones, C.D.; Jones, S.L.; Kandaswamy, J.; Katayama, N.; Kim, P.C.; Kreinick, D.L.; Ludwig, G.S.; Masui, J.; Mevissen, J.; Mistry, N.B.; Ng, C.R.; Nordberg, E.; Patterson, J.R.; Peterson, D.; Riley, D.; Salman, S.; Sapper, M.; Wuerthwein, F.; Avery, P.; Freyberger, A.; Rodriguez, J.; Yang, S.; Yelton, J.; Cinabro, D.; Liu, T.; Saulnier, M.; Wilson, R.; Yamamoto, H.; Bergfeld, T.; Eisenstein, B.I.; Gollin, G.; Ong, B.; Palmer, M.; Selen, M.; Thaler, J.J.; Edwards, K.W.; Ogg, M.; Bellerive, A.; Britton, D.I.; Hyatt, E.R.F.; MacFarlane, D.B.; Patel, P.M.; Spaan, B.; Sadoff, A.J.; Ammar, R.; Baringer, P.; Bean, A.; Besson, D.; Coppage, D.; Copty, N.; Davis, R.; Hancock, N.; Kelly, M.; Kotov, S.; Kravchenko, I.; Kwak, N.; Lam, H.; Kubota, Y.; Lattery, M.; Momayezi, M.; Nelson, J.K.; Patton, S.; Poling, R.; Savinov, V.; Schrenk, S.; Wang, R.; Alam, M.S.; Kim, I.J.; Ling, Z.; Mahmood, A.H.; O`Neill, J.J.; Severini, H.; Sun, C.R.; Wappler, F.; Crawford, G.; Daubenmier, C.M.; Fulton, R.; Fujino, D.; Gan, K.K.; Honscheid, K.; Kagan, H.; Kass, R.; Lee, J.; Sung, M.; White, C.; Wolf, A.; Zoeller, M.M.; Butler, F.; Fu, X.; Nemati, B.; Ross, W.R.; Skubic, P.; Wood, M.; Bishai, M.; Fast, J.; Gerndt, E.; Hinson, J.W.; McIlwain, R.L.; Miao, T.; Miller, D.H.; Modesitt, M.; Payne, D.; Shibata, E.I.; Shipsey, I.P.J.; Wang, P.N.; Battle, M.; Ernst, J.; Gibbons, L.; Kwon, Y.; Roberts, S.; Thorndike, E.H.; Wang, C.H.; Dominick, J.; Lambrecht, M.; Sanghera, S.; Shelkov, V.; Skwarnicki, T.; Stroynowski, R.; Volobouev, I.; Wei, G.; Artuso, M.; Gao, M.; Goldberg, M.; He, D.; Horwitz, N.; Moneti, G.C.; (CLEO Collabor...


    We have used the CLEO-II detector at the Cornell Electron Storage Ringe (CESR) to study the inclusive production of charmonium mesons in a sample of 2.15 million {ital B{bar B}} events. We find inclusive branching fractions of (1.12{plus_minus}0.04{plus_minus}0.06)% for {ital B}{r_arrow}{ital J}/{psi}{ital X}, (0.34{plus_minus}0.04{plus_minus}0.03)% for {ital B}{r_arrow}{psi}{prime}{ital X}, and (0.40{plus_minus}0.06{plus_minus}0.04)% for {ital B}{r_arrow}{chi}{sub {ital c}1}{ital X}. We also find some evidence for the inclusive production of {chi}{sub {ital c}2}, and set an upper limit for the branching fraction of the inclusive decay {ital B}{r_arrow}{eta}{sub {ital c}}{ital X} of 0.9% at 90% confidence level. Momentum spectra for inclusive {ital J}/{psi}, {psi}{prime}, and {chi}{sub {ital c}1} production are presented. These measurements are compared to theoretical calculations.

  12. Observation of the $ \\chi_{\\mathrm{b}1}(\\text{3P}) $ and $ \\chi_{\\mathrm{b}2}(\\text{3P}) $ and measurement of their masses

    CERN Document Server

    Sirunyan, Albert M; CMS Collaboration; Adam, Wolfgang; Ambrogi, Federico; Asilar, Ece; Bergauer, Thomas; Brandstetter, Johannes; Dragicevic, Marko; Erö, Janos; Escalante Del Valle, Alberto; Flechl, Martin; Fruehwirth, Rudolf; Ghete, Vasile Mihai; Hrubec, Josef; Jeitler, Manfred; Krammer, Natascha; Krätschmer, Ilse; Liko, Dietrich; Madlener, Thomas; Mikulec, Ivan; Rad, Navid; Rohringer, Herbert; Schieck, Jochen; Schöfbeck, Robert; Spanring, Markus; Spitzbart, Daniel; Taurok, Anton; Waltenberger, Wolfgang; Wittmann, Johannes; Wulz, Claudia-Elisabeth; Zarucki, Mateusz; Chekhovsky, Vladimir; Mossolov, Vladimir; Suarez Gonzalez, Juan; De Wolf, Eddi A; Di Croce, Davide; Janssen, Xavier; Lauwers, Jasper; Pieters, Maxim; Van De Klundert, Merijn; Van Haevermaet, Hans; Van Mechelen, Pierre; Van Remortel, Nick; Abu Zeid, Shimaa; Blekman, Freya; D'Hondt, Jorgen; De Bruyn, Isabelle; De Clercq, Jarne; Deroover, Kevin; Flouris, Giannis; Lontkovskyi, Denys; Lowette, Steven; Marchesini, Ivan; Moortgat, Seth; Moreels, Lieselotte; Python, Quentin; Skovpen, Kirill; Tavernier, Stefaan; Van Doninck, Walter; Van Mulders, Petra; Van Parijs, Isis; Beghin, Diego; Bilin, Bugra; Brun, Hugues; Clerbaux, Barbara; De Lentdecker, Gilles; Delannoy, Hugo; Dorney, Brian; Fasanella, Giuseppe; Favart, Laurent; Goldouzian, Reza; Grebenyuk, Anastasia; Kalsi, Amandeep Kaur; Lenzi, Thomas; Luetic, Jelena; Postiau, Nicolas; Starling, Elizabeth; Thomas, Laurent; Vander Velde, Catherine; Vanlaer, Pascal; Vannerom, David; Wang, Qun; Cornelis, Tom; Dobur, Didar; Fagot, Alexis; Gul, Muhammad; Khvastunov, Illia; Poyraz, Deniz; Roskas, Christos; Trocino, Daniele; Tytgat, Michael; Verbeke, Willem; Vermassen, Basile; Vit, Martina; Zaganidis, Nicolas; Bakhshiansohi, Hamed; Bondu, Olivier; Brochet, Sébastien; Bruno, Giacomo; Caputo, Claudio; David, Pieter; Delaere, Christophe; Delcourt, Martin; Francois, Brieuc; Giammanco, Andrea; Krintiras, Georgios; Lemaitre, Vincent; Magitteri, Alessio; Mertens, Alexandre; Musich, Marco; Piotrzkowski, Krzysztof; Saggio, Alessia; Vidal Marono, Miguel; Wertz, Sébastien; Zobec, Joze; Alves, Fábio Lúcio; Alves, Gilvan; Correa Martins Junior, Marcos; Correia Silva, Gilson; Hensel, Carsten; Moraes, Arthur; Pol, Maria Elena; Rebello Teles, Patricia; Belchior Batista Das Chagas, Ewerton; Carvalho, Wagner; Chinellato, Jose; Coelho, Eduardo; Melo Da Costa, Eliza; Da Silveira, Gustavo Gil; De Jesus Damiao, Dilson; De Oliveira Martins, Carley; Fonseca De Souza, Sandro; Malbouisson, Helena; Matos Figueiredo, Diego; Melo De Almeida, Miqueias; Mora Herrera, Clemencia; Mundim, Luiz; Nogima, Helio; Prado Da Silva, Wanda Lucia; Sanchez Rosas, Luis Junior; Santoro, Alberto; Sznajder, Andre; Thiel, Mauricio; Tonelli Manganote, Edmilson José; Torres Da Silva De Araujo, Felipe; Vilela Pereira, Antonio; Ahuja, Sudha; Bernardes, Cesar Augusto; Calligaris, Luigi; Tomei, Thiago; De Moraes Gregores, Eduardo; Mercadante, Pedro G; Novaes, Sergio F; Padula, Sandra; Aleksandrov, Aleksandar; Hadjiiska, Roumyana; Iaydjiev, Plamen; Marinov, Andrey; Misheva, Milena; Rodozov, Mircho; Shopova, Mariana; Sultanov, Georgi; Dimitrov, Anton; Litov, Leander; Pavlov, Borislav; Petkov, Peicho; Fang, Wenxing; Gao, Xuyang; Yuan, Li; Ahmad, Muhammad; Bian, Jian-Guo; Chen, Guo-Ming; Chen, He-Sheng; Chen, Mingshui; Chen, Ye; Jiang, Chun-Hua; Leggat, Duncan; Liao, Hongbo; Liu, Zhenan; Romeo, Francesco; Shaheen, Sarmad Masood; Spiezia, Aniello; Tao, Junquan; Wang, Chunjie; Wang, Zheng; Yazgan, Efe; Zhang, Huaqiao; Zhang, Sijing; Zhao, Jingzhou; Ban, Yong; Chen, Geng; Levin, Andrew; Li, Jing; Li, Linwei; Li, Qiang; Mao, Yajun; Qian, Si-Jin; Wang, Dayong; Xu, Zijun; Wang, Yi; Avila, Carlos; Cabrera, Andrés; Carrillo Montoya, Camilo Andres; Chaparro Sierra, Luisa Fernanda; Florez, Carlos; González Hernández, Carlos Felipe; Segura Delgado, Manuel Alejandro; Courbon, Benoit; Godinovic, Nikola; Lelas, Damir; Puljak, Ivica; Sculac, Toni; Antunovic, Zeljko; Kovac, Marko; Brigljevic, Vuko; Ferencek, Dinko; Kadija, Kreso; Mesic, Benjamin; Starodumov, Andrei; Susa, Tatjana; Ather, Mohsan Waseem; Attikis, Alexandros; Kolosova, Marina; Mavromanolakis, Georgios; Mousa, Jehad; Nicolaou, Charalambos; Ptochos, Fotios; Razis, Panos A; Rykaczewski, Hans; Finger, Miroslav; Finger Jr, Michael; Ayala, Edy; Carrera Jarrin, Edgar; Abdalla, Hassan; Abdelalim, Ahmed Ali; Mahmoud, Mohammed; Bhowmik, Sandeep; Carvalho Antunes De Oliveira, Alexandra; Dewanjee, Ram Krishna; Ehataht, Karl; Kadastik, Mario; Raidal, Martti; Veelken, Christian; Eerola, Paula; Kirschenmann, Henning; Pekkanen, Juska; Voutilainen, Mikko; Havukainen, Joona; Heikkilä, Jaana Kristiina; Jarvinen, Terhi; Karimäki, Veikko; Kinnunen, Ritva; Lampén, Tapio; Lassila-Perini, Kati; Laurila, Santeri; Lehti, Sami; Lindén, Tomas; Luukka, Panja-Riina; Mäenpää, Teppo; Siikonen, Hannu; Tuominen, Eija; Tuominiemi, Jorma; Tuuva, Tuure; Besancon, Marc; Couderc, Fabrice; Dejardin, Marc; Denegri, Daniel; Faure, Jean-Louis; Ferri, Federico; Ganjour, Serguei; Givernaud, Alain; Gras, Philippe; Hamel de Monchenault, Gautier; Jarry, Patrick; Leloup, Clément; Locci, Elizabeth; Malcles, Julie; Negro, Giulia; Rander, John; Rosowsky, André; Sahin, Mehmet Özgür; Titov, Maksym; Abdulsalam, Abdulla; Amendola, Chiara; Antropov, Iurii; Beaudette, Florian; Busson, Philippe; Charlot, Claude; Granier de Cassagnac, Raphael; Kucher, Inna; Lobanov, Artur; Martin Blanco, Javier; Nguyen, Matthew; Ochando, Christophe; Ortona, Giacomo; Pigard, Philipp; Salerno, Roberto; Sauvan, Jean-Baptiste; Sirois, Yves; Stahl Leiton, Andre Govinda; Zabi, Alexandre; Zghiche, Amina; Agram, Jean-Laurent; Andrea, Jeremy; Bloch, Daniel; Brom, Jean-Marie; Chabert, Eric Christian; Cherepanov, Vladimir; Collard, Caroline; Conte, Eric; Fontaine, Jean-Charles; Gelé, Denis; Goerlach, Ulrich; Jansová, Markéta; Le Bihan, Anne-Catherine; Tonon, Nicolas; Van Hove, Pierre; Gadrat, Sébastien; Beauceron, Stephanie; Bernet, Colin; Boudoul, Gaelle; Chanon, Nicolas; Chierici, Roberto; Contardo, Didier; Depasse, Pierre; El Mamouni, Houmani; Fay, Jean; Finco, Linda; Gascon, Susan; Gouzevitch, Maxime; Grenier, Gérald; Ille, Bernard; Lagarde, Francois; Laktineh, Imad Baptiste; Lattaud, Hugues; Lethuillier, Morgan; Mirabito, Laurent; Pequegnot, Anne-Laure; Perries, Stephane; Popov, Andrey; Sordini, Viola; Vander Donckt, Muriel; Viret, Sébastien; Toriashvili, Tengizi; Tsamalaidze, Zviad; Autermann, Christian; Feld, Lutz; Kiesel, Maximilian Knut; Klein, Katja; Lipinski, Martin; Preuten, Marius; Rauch, Max Philip; Schomakers, Christian; Schulz, Johannes; Teroerde, Marius; Wittmer, Bruno; Zhukov, Valery; Albert, Andreas; Duchardt, Deborah; Endres, Matthias; Erdmann, Martin; Esch, Thomas; Ghosh, Saranya; Güth, Andreas; Hebbeker, Thomas; Heidemann, Carsten; Hoepfner, Kerstin; Keller, Henning; Knutzen, Simon; Mastrolorenzo, Luca; Merschmeyer, Markus; Meyer, Arnd; Millet, Philipp; Mukherjee, Swagata; Pook, Tobias; Radziej, Markus; Reithler, Hans; Rieger, Marcel; Schmidt, Alexander; Teyssier, Daniel; Flügge, Günter; Hlushchenko, Olena; Kress, Thomas; Künsken, Andreas; Müller, Thomas; Nehrkorn, Alexander; Nowack, Andreas; Pistone, Claudia; Pooth, Oliver; Roy, Dennis; Sert, Hale; Stahl, Achim; Aldaya Martin, Maria; Arndt, Till; Asawatangtrakuldee, Chayanit; Babounikau, Illia; Beernaert, Kelly; Behnke, Olaf; Behrens, Ulf; Bermúdez Martínez, Armando; Bertsche, David; Bin Anuar, Afiq Aizuddin; Borras, Kerstin; Botta, Valeria; Campbell, Alan; Connor, Patrick; Contreras-Campana, Christian; Costanza, Francesco; Danilov, Vladyslav; De Wit, Adinda; Defranchis, Matteo Maria; Diez Pardos, Carmen; Domínguez Damiani, Daniela; Eckerlin, Guenter; Eichhorn, Thomas; Elwood, Adam; Eren, Engin; Gallo, Elisabetta; Geiser, Achim; Grados Luyando, Juan Manuel; Grohsjean, Alexander; Gunnellini, Paolo; Guthoff, Moritz; Haranko, Mykyta; Harb, Ali; Hauk, Johannes; Jung, Hannes; Kasemann, Matthias; Keaveney, James; Kleinwort, Claus; Knolle, Joscha; Krücker, Dirk; Lange, Wolfgang; Lelek, Aleksandra; Lenz, Teresa; Lipka, Katerina; Lohmann, Wolfgang; Mankel, Rainer; Melzer-Pellmann, Isabell-Alissandra; Meyer, Andreas Bernhard; Meyer, Mareike; Missiroli, Marino; Mittag, Gregor; Mnich, Joachim; Myronenko, Volodymyr; Pflitsch, Svenja Karen; Pitzl, Daniel; Raspereza, Alexei; Savitskyi, Mykola; Saxena, Pooja; Schütze, Paul; Schwanenberger, Christian; Shevchenko, Rostyslav; Singh, Akshansh; Tholen, Heiner; Turkot, Oleksii; Vagnerini, Antonio; Van Onsem, Gerrit Patrick; Walsh, Roberval; Wen, Yiwen; Wichmann, Katarzyna; Wissing, Christoph; Zenaiev, Oleksandr; Aggleton, Robin; Bein, Samuel; Benato, Lisa; Benecke, Anna; Blobel, Volker; Centis Vignali, Matteo; Dreyer, Torben; Garutti, Erika; Gonzalez, Daniel; Haller, Johannes; Hinzmann, Andreas; Karavdina, Anastasia; Kasieczka, Gregor; Klanner, Robert; Kogler, Roman; Kovalchuk, Nataliia; Kurz, Simon; Kutzner, Viktor; Lange, Johannes; Marconi, Daniele; Multhaup, Jens; Niedziela, Marek; Nowatschin, Dominik; Perieanu, Adrian; Reimers, Arne; Rieger, Oliver; Scharf, Christian; Schleper, Peter; Schumann, Svenja; Schwandt, Joern; Sonneveld, Jory; Stadie, Hartmut; Steinbrück, Georg; Stober, Fred-Markus Helmut; Stöver, Marc; Troendle, Daniel; Vanhoefer, Annika; Vormwald, Benedikt; Akbiyik, Melike; Barth, Christian; Baselga, Marta; Baur, Sebastian; Butz, Erik; Caspart, René; Chwalek, Thorsten; Colombo, Fabio; De Boer, Wim; Dierlamm, Alexander; El Morabit, Karim; Faltermann, Nils; Freund, Benedikt; Giffels, Manuel; Harrendorf, Marco Alexander; Hartmann, Frank; Heindl, Stefan Michael; Husemann, Ulrich; Kassel, Florian; Katkov, Igor; Kudella, Simon; Mildner, Hannes; Mitra, Soureek; Mozer, Matthias Ulrich; Müller, Thomas; Plagge, Michael; Quast, Gunter; Rabbertz, Klaus; Schröder, Matthias; Shvetsov, Ivan; Sieber, Georg; Simonis, Hans-Jürgen; Ulrich, Ralf; Wayand, Stefan; Weber, Marc; Weiler, Thomas; Williamson, Shawn; Wöhrmann, Clemens; Wolf, Roger; Anagnostou, Georgios; Daskalakis, Georgios; Geralis, Theodoros; Kyriakis, Aristotelis; Loukas, Demetrios; Paspalaki, Garyfallia; Topsis-Giotis, Iasonas; Karathanasis, George; Kesisoglou, Stilianos; Kontaxakis, Pantelis; Panagiotou, Apostolos; Papavergou, Ioanna; Saoulidou, Niki; Tziaferi, Eirini; Vellidis, Konstantinos; Kousouris, Konstantinos; Papakrivopoulos, Ioannis; Tsipolitis, Georgios; Evangelou, Ioannis; Foudas, Costas; Gianneios, Paraskevas; Katsoulis, Panagiotis; Kokkas, Panagiotis; Mallios, Stavros; Manthos, Nikolaos; Papadopoulos, Ioannis; Paradas, Evangelos; Strologas, John; Triantis, Frixos A; Tsitsonis, Dimitrios; Bartók, Márton; Csanad, Mate; Filipovic, Nicolas; Major, Péter; Nagy, Marton Imre; Pasztor, Gabriella; Surányi, Olivér; Veres, Gabor Istvan; Bencze, Gyorgy; Hajdu, Csaba; Horvath, Dezso; Hunyadi, Ádám; Sikler, Ferenc; Vámi, Tamás Álmos; Veszpremi, Viktor; Vesztergombi, Gyorgy; Beni, Noemi; Czellar, Sandor; Karancsi, János; Makovec, Alajos; Molnar, Jozsef; Szillasi, Zoltan; Raics, Peter; Trocsanyi, Zoltan Laszlo; Ujvari, Balazs; Choudhury, Somnath; Komaragiri, Jyothsna Rani; Tiwari, Praveen Chandra; Bahinipati, Seema; Kar, Chandiprasad; Mal, Prolay; Mandal, Koushik; Nayak, Aruna; Sahoo, Deepak Kumar; Swain, Sanjay Kumar; Bansal, Sunil; Beri, Suman Bala; Bhatnagar, Vipin; Chauhan, Sushil; Chawla, Ridhi; Dhingra, Nitish; Gupta, Rajat; Kaur, Anterpreet; Kaur, Amandeep; Kaur, Manjit; Kaur, Sandeep; Kumar, Ramandeep; Kumari, Priyanka; Lohan, Manisha; Mehta, Ankita; Sandeep, Kaur; Sharma, Sandeep; Singh, Jasbir; Walia, Genius; Bhardwaj, Ashutosh; Choudhary, Brajesh C; Garg, Rocky Bala; Gola, Mohit; Keshri, Sumit; Kumar, Ashok; Malhotra, Shivali; Naimuddin, Md; Priyanka, Priyanka; Ranjan, Kirti; Shah, Aashaq; Sharma, Ramkrishna; Bhardwaj, Rishika; Bharti, Monika; Bhattacharya, Rajarshi; Bhattacharya, Satyaki; Bhawandeep, Bhawandeep; Bhowmik, Debabrata; Dey, Sourav; Dutt, Suneel; Dutta, Suchandra; Ghosh, Shamik; Mondal, Kuntal; Nandan, Saswati; Purohit, Arnab; Rout, Prasant Kumar; Roy, Ashim; Roy Chowdhury, Suvankar; Saha, Gourab; Sarkar, Subir; Sharan, Manoj; Singh, Bipen; Thakur, Shalini; Behera, Prafulla Kumar; Chudasama, Ruchi; Dutta, Dipanwita; Jha, Vishwajeet; Kumar, Vineet; Netrakanti, Pawan Kumar; Pant, Lalit Mohan; Shukla, Prashant; Aziz, Tariq; Bhat, Muzamil Ahmad; Dugad, Shashikant; Mohanty, Gagan Bihari; Sur, Nairit; Sutar, Bajrang; Ravindra Kumar Verma, Ravindra; Banerjee, Sudeshna; Bhattacharya, Soham; Chatterjee, Suman; Das, Pallabi; Guchait, Monoranjan; Jain, Sandhya; Karmakar, Saikat; Kumar, Sanjeev; Maity, Manas; Majumder, Gobinda; Mazumdar, Kajari; Sahoo, Niladribihari; Sarkar, Tanmay; Chauhan, Shubhanshu; Dube, Sourabh; Hegde, Vinay; Kapoor, Anshul; Kothekar, Kunal; Pandey, Shubham; Rane, Aditee; Sharma, Seema; Chenarani, Shirin; Eskandari Tadavani, Esmaeel; Etesami, Seyed Mohsen; Khakzad, Mohsen; Mohammadi Najafabadi, Mojtaba; Naseri, Mohsen; Rezaei Hosseinabadi, Ferdos; Safarzadeh, Batool; Zeinali, Maryam; Felcini, Marta; Grunewald, Martin; Abbrescia, Marcello; Calabria, Cesare; Colaleo, Anna; Creanza, Donato; Cristella, Leonardo; De Filippis, Nicola; De Palma, Mauro; Di Florio, Adriano; Errico, Filippo; Fiore, Luigi; Gelmi, Andrea; Iaselli, Giuseppe; Ince, Merve; Lezki, Samet; Maggi, Giorgio; Maggi, Marcello; Miniello, Giorgia; My, Salvatore; Nuzzo, Salvatore; Pompili, Alexis; Pugliese, Gabriella; Radogna, Raffaella; Ranieri, Antonio; Selvaggi, Giovanna; Sharma, Archana; Silvestris, Lucia; Venditti, Rosamaria; Verwilligen, Piet; Zito, Giuseppe; Abbiendi, Giovanni; Battilana, Carlo; Bonacorsi, Daniele; Borgonovi, Lisa; Braibant-Giacomelli, Sylvie; Campanini, Renato; Capiluppi, Paolo; Castro, Andrea; Cavallo, Francesca Romana; Chhibra, Simranjit Singh; Ciocca, Claudia; Codispoti, Giuseppe; Cuffiani, Marco; Dallavalle, Gaetano-Marco; Fabbri, Fabrizio; Fanfani, Alessandra; Giacomelli, Paolo; Grandi, Claudio; Guiducci, Luigi; Iemmi, Fabio; Marcellini, Stefano; Masetti, Gianni; Montanari, Alessandro; Navarria, Francesco; Perrotta, Andrea; Primavera, Federica; Rossi, Antonio; Rovelli, Tiziano; Siroli, Gian Piero; Tosi, Nicolò; Albergo, Sebastiano; Di Mattia, Alessandro; Potenza, Renato; Tricomi, Alessia; Tuve, Cristina; Barbagli, Giuseppe; Chatterjee, Kalyanmoy; Ciulli, Vitaliano; Civinini, Carlo; D'Alessandro, Raffaello; Focardi, Ettore; Latino, Giuseppe; Lenzi, Piergiulio; Meschini, Marco; Paoletti, Simone; Russo, Lorenzo; Sguazzoni, Giacomo; Strom, Derek; Viliani, Lorenzo; Benussi, Luigi; Bianco, Stefano; Fabbri, Franco; Piccolo, Davide; Ferro, Fabrizio; Ravera, Fabio; Robutti, Enrico; Tosi, Silvano; Benaglia, Andrea; Beschi, Andrea; Brianza, Luca; Brivio, Francesco; Ciriolo, Vincenzo; Di Guida, Salvatore; Dinardo, Mauro Emanuele; Fiorendi, Sara; Gennai, Simone; Ghezzi, Alessio; Govoni, Pietro; Malberti, Martina; Malvezzi, Sandra; Massironi, Andrea; Menasce, Dario; Moroni, Luigi; Paganoni, Marco; Pedrini, Daniele; Ragazzi, Stefano; Tabarelli de Fatis, Tommaso; Zuolo, Davide; Buontempo, Salvatore; Cavallo, Nicola; Di Crescenzo, Antonia; Fabozzi, Francesco; Fienga, Francesco; Galati, Giuliana; Iorio, Alberto Orso Maria; Khan, Wajid Ali; Lista, Luca; Meola, Sabino; Paolucci, Pierluigi; Sciacca, Crisostomo; Voevodina, Elena; Azzi, Patrizia; Bacchetta, Nicola; Bisello, Dario; Boletti, Alessio; Bragagnolo, Alberto; Carlin, Roberto; Checchia, Paolo; Dall'Osso, Martino; De Castro Manzano, Pablo; Dorigo, Tommaso; Dosselli, Umberto; Gasparini, Fabrizio; Gasparini, Ugo; Gozzelino, Andrea; Hoh, Siew Yan; Lacaprara, Stefano; Lujan, Paul; Margoni, Martino; Meneguzzo, Anna Teresa; Pazzini, Jacopo; Ronchese, Paolo; Rossin, Roberto; Simonetto, Franco; Tiko, Andres; Torassa, Ezio; Zanetti, Marco; Zotto, Pierluigi; Zumerle, Gianni; Braghieri, Alessandro; Magnani, Alice; Montagna, Paolo; Ratti, Sergio P; Re, Valerio; Ressegotti, Martina; Riccardi, Cristina; Salvini, Paola; Vai, Ilaria; Vitulo, Paolo; Biasini, Maurizio; Bilei, Gian Mario; Cecchi, Claudia; Ciangottini, Diego; Fanò, Livio; Lariccia, Paolo; Leonardi, Roberto; Manoni, Elisa; Mantovani, Giancarlo; Mariani, Valentina; Menichelli, Mauro; Rossi, Alessandro; Santocchia, Attilio; Spiga, Daniele; Androsov, Konstantin; Azzurri, Paolo; Bagliesi, Giuseppe; Bianchini, Lorenzo; Boccali, Tommaso; Borrello, Laura; Castaldi, Rino; Ciocci, Maria Agnese; Dell'Orso, Roberto; Fedi, Giacomo; Fiori, Francesco; Giannini, Leonardo; Giassi, Alessandro; Grippo, Maria Teresa; Ligabue, Franco; Manca, Elisabetta; Mandorli, Giulio; Messineo, Alberto; Palla, Fabrizio; Rizzi, Andrea; Spagnolo, Paolo; Tenchini, Roberto; Tonelli, Guido; Venturi, Andrea; Verdini, Piero Giorgio; Barone, Luciano; Cavallari, Francesca; Cipriani, Marco; Daci, Nadir; Del Re, Daniele; Di Marco, Emanuele; Diemoz, Marcella; Gelli, Simone; Longo, Egidio; Marzocchi, Badder; Meridiani, Paolo; Organtini, Giovanni; Pandolfi, Francesco; Paramatti, Riccardo; Preiato, Federico; Rahatlou, Shahram; Rovelli, Chiara; Santanastasio, Francesco; Amapane, Nicola; Arcidiacono, Roberta; Argiro, Stefano; Arneodo, Michele; Bartosik, Nazar; Bellan, Riccardo; Biino, Cristina; Cartiglia, Nicolo; Cenna, Francesca; Cometti, Simona; Costa, Marco; Covarelli, Roberto; Demaria, Natale; Kiani, Bilal; Mariotti, Chiara; Maselli, Silvia; Migliore, Ernesto; Monaco, Vincenzo; Monteil, Ennio; Monteno, Marco; Obertino, Maria Margherita; Pacher, Luca; Pastrone, Nadia; Pelliccioni, Mario; Pinna Angioni, Gian Luca; Romero, Alessandra; Ruspa, Marta; Sacchi, Roberto; Shchelina, Ksenia; Sola, Valentina; Solano, Ada; Soldi, Dario; Staiano, Amedeo; Belforte, Stefano; Candelise, Vieri; Casarsa, Massimo; Cossutti, Fabio; Da Rold, Alessandro; Della Ricca, Giuseppe; Vazzoler, Federico; Zanetti, Anna; Kim, Dong Hee; Kim, Gui Nyun; Kim, Min Suk; Lee, Jeongeun; Lee, Sangeun; Lee, Seh Wook; Moon, Chang-Seong; Oh, Young Do; Sekmen, Sezen; Son, Dong-Chul; Yang, Yu Chul; Kim, Hyunchul; Moon, Dong Ho; Oh, Geonhee; Goh, Junghwan; Kim, Tae Jeong; Cho, Sungwoong; Choi, Suyong; Go, Yeonju; Gyun, Dooyeon; Ha, Seungkyu; Hong, Byung-Sik; Jo, Youngkwon; Lee, Kisoo; Lee, Kyong Sei; Lee, Songkyo; Lim, Jaehoon; Park, Sung Keun; Roh, Youn; Kim, Hyunsoo; Almond, John; Kim, Junho; Kim, Jae Sung; Lee, Haneol; Lee, Kyeongpil; Nam, Kyungwook; Oh, Sung Bin; Radburn-Smith, Benjamin Charles; Seo, Seon-hee; Yang, Unki; Yoo, Hwi Dong; Yu, Geum Bong; Jeon, Dajeong; Kim, Hyunyong; Kim, Ji Hyun; Lee, Jason Sang Hun; Park, Inkyu; Choi, Young-Il; Hwang, Chanwook; Lee, Jongseok; Yu, Intae; Dudenas, Vytautas; Juodagalvis, Andrius; Vaitkus, Juozas; Ahmed, Ijaz; Ibrahim, Zainol Abidin; Md Ali, Mohd Adli Bin; Mohamad Idris, Faridah; Wan Abdullah, Wan Ahmad Tajuddin; Yusli, Mohd Nizam; Zolkapli, Zukhaimira; Benitez, Jose F; Castaneda Hernandez, Alfredo; Murillo Quijada, Javier Alberto; Duran-Osuna, Cecilia; Castilla-Valdez, Heriberto; De La Cruz-Burelo, Eduard; Ramirez-Sanchez, Gabriel; Heredia-De La Cruz, Ivan; Rabadán-Trejo, Raúl Iraq; Lopez-Fernandez, Ricardo; Mejia Guisao, Jhovanny; Reyes-Almanza, Rogelio; Ramírez García, Mateo; Sánchez Hernández, Alberto; Carrillo Moreno, Salvador; Oropeza Barrera, Cristina; Vazquez Valencia, Fabiola; Eysermans, Jan; Pedraza, Isabel; Salazar Ibarguen, Humberto Antonio; Uribe Estrada, Cecilia; Morelos Pineda, Antonio; Krofcheck, David; Bheesette, Srinidhi; Butler, Philip H; Ahmad, Ashfaq; Ahmad, Muhammad; Asghar, Muhammad Irfan; Hassan, Qamar; Hoorani, Hafeez R; Saddique, Asif; Shah, Mehar Ali; Shoaib, Muhammad; Waqas, Muhammad; Bialkowska, Helena; Bluj, Michal; Boimska, Bozena; Frueboes, Tomasz; Górski, Maciej; Kazana, Malgorzata; Nawrocki, Krzysztof; Szleper, Michal; Traczyk, Piotr; Zalewski, Piotr; Bunkowski, Karol; Byszuk, Adrian; Doroba, Krzysztof; Kalinowski, Artur; Konecki, Marcin; Krolikowski, Jan; Misiura, Maciej; Olszewski, Michal; Pyskir, Andrzej; Walczak, Marek; Araujo, Mariana; Bargassa, Pedrame; Beirão Da Cruz E Silva, Cristóvão; Di Francesco, Agostino; Faccioli, Pietro; Galinhas, Bruno; Gallinaro, Michele; Hollar, Jonathan; Leonardo, Nuno; Nemallapudi, Mythra Varun; Seixas, Joao; Strong, Giles; Toldaiev, Oleksii; Vadruccio, Daniele; Varela, Joao; Afanasiev, Serguei; Bunin, Pavel; Gavrilenko, Mikhail; Golutvin, Igor; Gorbunov, Ilya; Kamenev, Alexey; Karjavine, Vladimir; Lanev, Alexander; Malakhov, Alexander; Matveev, Viktor; Moisenz, Petr; Palichik, Vladimir; Perelygin, Victor; Shmatov, Sergey; Shulha, Siarhei; Skatchkov, Nikolai; Smirnov, Vitaly; Voytishin, Nikolay; Zarubin, Anatoli; Golovtsov, Victor; Ivanov, Yury; Kim, Victor; Kuznetsova, Ekaterina; Levchenko, Petr; Murzin, Victor; Oreshkin, Vadim; Smirnov, Igor; Sosnov, Dmitry; Sulimov, Valentin; Uvarov, Lev; Vavilov, Sergey; Vorobyev, Alexey; Andreev, Yuri; Dermenev, Alexander; Gninenko, Sergei; Golubev, Nikolai; Karneyeu, Anton; Kirsanov, Mikhail; Krasnikov, Nikolai; Pashenkov, Anatoli; Tlisov, Danila; Toropin, Alexander; Epshteyn, Vladimir; Gavrilov, Vladimir; Lychkovskaya, Natalia; Popov, Vladimir; Pozdnyakov, Ivan; Safronov, Grigory; Spiridonov, Alexander; Stepennov, Anton; Stolin, Viatcheslav; Toms, Maria; Vlasov, Evgueni; Zhokin, Alexander; Aushev, Tagir; Chistov, Ruslan; Danilov, Mikhail; Parygin, Pavel; Philippov, Dmitry; Polikarpov, Sergey; Tarkovskii, Evgenii; Andreev, Vladimir; Azarkin, Maksim; Dremin, Igor; Kirakosyan, Martin; Rusakov, Sergey V; Terkulov, Adel; Baskakov, Alexey; Belyaev, Andrey; Boos, Edouard; Dubinin, Mikhail; Dudko, Lev; Ershov, Alexander; Gribushin, Andrey; Klyukhin, Vyacheslav; Kodolova, Olga; Lokhtin, Igor; Miagkov, Igor; Obraztsov, Stepan; Petrushanko, Sergey; Savrin, Viktor; Snigirev, Alexander; Barnyakov, Alexander; Blinov, Vladimir; Dimova, Tatyana; Kardapoltsev, Leonid; Skovpen, Yuri; Azhgirey, Igor; Bayshev, Igor; Bitioukov, Sergei; Elumakhov, Dmitry; Godizov, Anton; Kachanov, Vassili; Kalinin, Alexey; Konstantinov, Dmitri; Mandrik, Petr; Petrov, Vladimir; Ryutin, Roman; Slabospitskii, Sergei; Sobol, Andrei; Troshin, Sergey; Tyurin, Nikolay; Uzunian, Andrey; Volkov, Alexey; Babaev, Anton; Baidali, Sergei; Okhotnikov, Vitalii; Adzic, Petar; Cirkovic, Predrag; Devetak, Damir; Dordevic, Milos; Milosevic, Jovan; Alcaraz Maestre, Juan; Álvarez Fernández, Adrian; Bachiller, Irene; Barrio Luna, Mar; Brochero Cifuentes, Javier Andres; Cerrada, Marcos; Colino, Nicanor; De La Cruz, Begona; Delgado Peris, Antonio; Fernandez Bedoya, Cristina; Fernández Ramos, Juan Pablo; Flix, Jose; Fouz, Maria Cruz; Gonzalez Lopez, Oscar; Goy Lopez, Silvia; Hernandez, Jose M; Josa, Maria Isabel; Moran, Dermot; Pérez-Calero Yzquierdo, Antonio María; Puerta Pelayo, Jesus; Redondo, Ignacio; Romero, Luciano; Senghi Soares, Mara; Triossi, Andrea; Albajar, Carmen; de Trocóniz, Jorge F; Cuevas, Javier; Erice, Carlos; Fernandez Menendez, Javier; Folgueras, Santiago; Gonzalez Caballero, Isidro; González Fernández, Juan Rodrigo; Palencia Cortezon, Enrique; Rodríguez Bouza, Víctor; Sanchez Cruz, Sergio; Vischia, Pietro; Vizan Garcia, Jesus Manuel; Cabrillo, Iban Jose; Calderon, Alicia; Chazin Quero, Barbara; Duarte Campderros, Jordi; Fernandez, Marcos; Fernández Manteca, Pedro José; García Alonso, Andrea; Garcia-Ferrero, Juan; Gomez, Gervasio; Lopez Virto, Amparo; Marco, Jesus; Martinez Rivero, Celso; Martinez Ruiz del Arbol, Pablo; Matorras, Francisco; Piedra Gomez, Jonatan; Prieels, Cédric; Rodrigo, Teresa; Ruiz-Jimeno, Alberto; Scodellaro, Luca; Trevisani, Nicolò; Vila, Ivan; Vilar Cortabitarte, Rocio; Wickramage, Nadeesha; Abbaneo, Duccio; Akgun, Bora; Auffray, Etiennette; Auzinger, Georg; Baillon, Paul; Ball, Austin; Barney, David; Bendavid, Joshua; Bianco, Michele; Bocci, Andrea; Botta, Cristina; Brondolin, Erica; Camporesi, Tiziano; Cepeda, Maria; Cerminara, Gianluca; Chapon, Emilien; Chen, Yi; Cucciati, Giacomo; D'Enterria, David; Dabrowski, Anne; Daponte, Vincenzo; David Tinoco Mendes, Andre; De Roeck, Albert; Deelen, Nikkie; Dobson, Marc; Dünser, Marc; Dupont, Niels; Elliott-Peisert, Anna; Everaerts, Pieter; Fallavollita, Francesco; Fasanella, Daniele; Franzoni, Giovanni; Fulcher, Jonathan; Funk, Wolfgang; Gigi, Dominique; Gilbert, Andrew; Gill, Karl; Glege, Frank; Guilbaud, Maxime; Gulhan, Doga; Hegeman, Jeroen; Innocente, Vincenzo; Jafari, Abideh; Janot, Patrick; Karacheban, Olena; Kieseler, Jan; Kornmayer, Andreas; Krammer, Manfred; Lange, Clemens; Lecoq, Paul; Lourenco, Carlos; Malgeri, Luca; Mannelli, Marcello; Meijers, Frans; Merlin, Jeremie Alexandre; Mersi, Stefano; Meschi, Emilio; Milenovic, Predrag; Moortgat, Filip; Mulders, Martijn; Ngadiuba, Jennifer; Nourbakhsh, Shervin; Orfanelli, Styliani; Orsini, Luciano; Pantaleo, Felice; Pape, Luc; Perez, Emmanuel; Peruzzi, Marco; Petrilli, Achille; Petrucciani, Giovanni; Pfeiffer, Andreas; Pierini, Maurizio; Pitters, Florian Michael; Rabady, Dinyar; Racz, Attila; Reis, Thomas; Rolandi, Gigi; Rovere, Marco; Sakulin, Hannes; Schäfer, Christoph; Schwick, Christoph; Seidel, Markus; Selvaggi, Michele; Sharma, Archana; Silva, Pedro; Sphicas, Paraskevas; Stakia, Anna; Steggemann, Jan; Tosi, Mia; Treille, Daniel; Tsirou, Andromachi; Veckalns, Viesturs; Zeuner, Wolfram Dietrich; Caminada, Lea; Deiters, Konrad; Erdmann, Wolfram; Horisberger, Roland; Ingram, Quentin; Kaestli, Hans-Christian; Kotlinski, Danek; Langenegger, Urs; Rohe, Tilman; Wiederkehr, Stephan Albert; Backhaus, Malte; Bäni, Lukas; Berger, Pirmin; Chernyavskaya, Nadezda; Dissertori, Günther; Dittmar, Michael; Donegà, Mauro; Dorfer, Christian; Grab, Christoph; Heidegger, Constantin; Hits, Dmitry; Hoss, Jan; Klijnsma, Thomas; Lustermann, Werner; Manzoni, Riccardo Andrea; Marionneau, Matthieu; Meinhard, Maren Tabea; Micheli, Francesco; Musella, Pasquale; Nessi-Tedaldi, Francesca; Pata, Joosep; Pauss, Felicitas; Perrin, Gaël; Perrozzi, Luca; Pigazzini, Simone; Quittnat, Milena; Ruini, Daniele; Sanz Becerra, Diego Alejandro; Schönenberger, Myriam; Shchutska, Lesya; Tavolaro, Vittorio Raoul; Theofilatos, Konstantinos; Vesterbacka Olsson, Minna Leonora; Wallny, Rainer; Zhu, De Hua; Aarrestad, Thea Klaeboe; Amsler, Claude; Brzhechko, Danyyl; Canelli, Maria Florencia; De Cosa, Annapaola; Del Burgo, Riccardo; Donato, Silvio; Galloni, Camilla; Hreus, Tomas; Kilminster, Benjamin; Leontsinis, Stefanos; Neutelings, Izaak; Pinna, Deborah; Rauco, Giorgia; Robmann, Peter; Salerno, Daniel; Schweiger, Korbinian; Seitz, Claudia; Takahashi, Yuta; Zucchetta, Alberto; Chang, Yu-Hsiang; Cheng, Kai-yu; Doan, Thi Hien; Jain, Shilpi; Khurana, Raman; Kuo, Chia-Ming; Lin, Willis; Pozdnyakov, Andrey; Yu, Shin-Shan; Chang, Paoti; Chao, Yuan; Chen, Kai-Feng; Chen, Po-Hsun; Hou, George Wei-Shu; Kumar, Arun; Li, You-ying; Liu, Yueh-Feng; Lu, Rong-Shyang; Paganis, Efstathios; Psallidas, Andreas; Steen, Arnaud; Asavapibhop, Burin; Srimanobhas, Norraphat; Suwonjandee, Narumon; Bat, Ayse; Boran, Fatma; Cerci, Salim; Damarseckin, Serdal; Demiroglu, Zuhal Seyma; Dolek, Furkan; Dozen, Candan; Dumanoglu, Isa; Girgis, Semiray; Gokbulut, Gul; Guler, Yalcin; Gurpinar, Emine; Hos, Ilknur; Isik, Candan; Kangal, Evrim Ersin; Kara, Ozgun; Kayis Topaksu, Aysel; Kiminsu, Ugur; Oglakci, Mehmet; Onengut, Gulsen; Ozdemir, Kadri; Ozturk, Sertac; Sunar Cerci, Deniz; Tali, Bayram; Tok, Ufuk Guney; Turkcapar, Semra; Zorbakir, Ibrahim Soner; Zorbilmez, Caglar; Isildak, Bora; Karapinar, Guler; Yalvac, Metin; Zeyrek, Mehmet; Atakisi, Ismail Okan; Gülmez, Erhan; Kaya, Mithat; Kaya, Ozlem; Tekten, Sevgi; Yetkin, Elif Asli; Agaras, Merve Nazlim; Atay, Serhat; Cakir, Altan; Cankocak, Kerem; Komurcu, Yildiray; Sen, Sercan; Grynyov, Boris; Levchuk, Leonid; Ball, Fionn; Beck, Lana; Brooke, James John; Burns, Douglas; Clement, Emyr; Cussans, David; Davignon, Olivier; Flacher, Henning; Goldstein, Joel; Heath, Greg P; Heath, Helen F; Kreczko, Lukasz; Newbold, Dave M; Paramesvaran, Sudarshan; Penning, Bjoern; Sakuma, Tai; Smith, Dominic; Smith, Vincent J; Taylor, Joseph; Titterton, Alexander; Bell, Ken W; Belyaev, Alexander; Brew, Christopher; Brown, Robert M; Cieri, Davide; Cockerill, David JA; Coughlan, John A; Harder, Kristian; Harper, Sam; Linacre, Jacob; Olaiya, Emmanuel; Petyt, David; Shepherd-Themistocleous, Claire; Thea, Alessandro; Tomalin, Ian R; Williams, Thomas; Womersley, William John; Bainbridge, Robert; Bloch, Philippe; Borg, Johan; Breeze, Shane; Buchmuller, Oliver; Bundock, Aaron; Casasso, Stefano; Colling, David; Corpe, Louie; Dauncey, Paul; Davies, Gavin; Della Negra, Michel; Di Maria, Riccardo; Haddad, Yacine; Hall, Geoffrey; Iles, Gregory; James, Thomas; Komm, Matthias; Laner, Christian; Lyons, Louis; Magnan, Anne-Marie; Malik, Sarah; Martelli, Arabella; Nash, Jordan; Nikitenko, Alexander; Palladino, Vito; Pesaresi, Mark; Richards, Alexander; Rose, Andrew; Scott, Edward; Seez, Christopher; Shtipliyski, Antoni; Singh, Gurpreet; Stoye, Markus; Strebler, Thomas; Summers, Sioni; Tapper, Alexander; Uchida, Kirika; Virdee, Tejinder; Wardle, Nicholas; Winterbottom, Daniel; Wright, Jack; Zenz, Seth Conrad; Cole, Joanne; Hobson, Peter R; Khan, Akram; Kyberd, Paul; Mackay, Catherine Kirsty; Morton, Alexander; Reid, Ivan; Teodorescu, Liliana; Zahid, Sema; Call, Kenneth; Dittmann, Jay; Hatakeyama, Kenichi; Liu, Hongxuan; Madrid, Christopher; Mcmaster, Brooks; Pastika, Nathaniel; Smith, Caleb; Bartek, Rachel; Dominguez, Aaron; Buccilli, Andrew; Cooper, Seth; Henderson, Conor; Rumerio, Paolo; West, Christopher; Arcaro, Daniel; Bose, Tulika; Gastler, Daniel; Rankin, Dylan; Richardson, Clint; Rohlf, James; Sulak, Lawrence; Zou, David; Benelli, Gabriele; Coubez, Xavier; Cutts, David; Hadley, Mary; Hakala, John; Heintz, Ulrich; Hogan, Julie Managan; Kwok, Ka Hei Martin; Laird, Edward; Landsberg, Greg; Lee, Jangbae; Mao, Zaixing; Narain, Meenakshi; Piperov, Stefan; Sagir, Sinan; Syarif, Rizki; Usai, Emanuele; Yu, David; Band, Reyer; Brainerd, Christopher; Breedon, Richard; Burns, Dustin; Calderon De La Barca Sanchez, Manuel; Chertok, Maxwell; Conway, John; Conway, Rylan; Cox, Peter Timothy; Erbacher, Robin; Flores, Chad; Funk, Garrett; Ko, Winston; Kukral, Ota; Lander, Richard; Mulhearn, Michael; Pellett, Dave; Pilot, Justin; Shalhout, Shalhout; Shi, Mengyao; Stolp, Dustin; Taylor, Devin; Tos, Kyle; Tripathi, Mani; Wang, Zhangqier; Zhang, Fengwangdong; Bachtis, Michail; Bravo, Cameron; Cousins, Robert; Dasgupta, Abhigyan; Florent, Alice; Hauser, Jay; Ignatenko, Mikhail; Mccoll, Nickolas; Regnard, Simon; Saltzberg, David; Schnaible, Christian; Valuev, Vyacheslav; Bouvier, Elvire; Burt, Kira; Clare, Robert; Gary, J William; Ghiasi Shirazi, Seyyed Mohammad Amin; Hanson, Gail; Karapostoli, Georgia; Kennedy, Elizabeth; Lacroix, Florent; Long, Owen Rosser; Olmedo Negrete, Manuel; Paneva, Mirena Ivova; Si, Weinan; Wang, Long; Wei, Hua; Wimpenny, Stephen; Yates, Brent; Branson, James G; Cittolin, Sergio; Derdzinski, Mark; Gerosa, Raffaele; Gilbert, Dylan; Hashemi, Bobak; Holzner, André; Klein, Daniel; Kole, Gouranga; Krutelyov, Vyacheslav; Letts, James; Masciovecchio, Mario; Olivito, Dominick; Padhi, Sanjay; Pieri, Marco; Sani, Matteo; Sharma, Vivek; Simon, Sean; Tadel, Matevz; Vartak, Adish; Wasserbaech, Steven; Wood, John; Würthwein, Frank; Yagil, Avraham; Zevi Della Porta, Giovanni; Amin, Nick; Bhandari, Rohan; Bradmiller-Feld, John; Campagnari, Claudio; Citron, Matthew; Dishaw, Adam; Dutta, Valentina; Franco Sevilla, Manuel; Gouskos, Loukas; Heller, Ryan; Incandela, Joe; Ovcharova, Ana; Qu, Huilin; Richman, Jeffrey; Stuart, David; Suarez, Indara; Wang, Sicheng; Yoo, Jaehyeok; Anderson, Dustin; Bornheim, Adolf; Lawhorn, Jay Mathew; Newman, Harvey B; Nguyen, Thong; Spiropulu, Maria; Vlimant, Jean-Roch; Wilkinson, Richard; Xie, Si; Zhang, Zhicai; Zhu, Ren-Yuan; Andrews, Michael Benjamin; Ferguson, Thomas; Mudholkar, Tanmay; Paulini, Manfred; Sun, Menglei; Vorobiev, Igor; Weinberg, Marc; Cumalat, John Perry; Ford, William T; Jensen, Frank; Johnson, Andrew; Krohn, Michael; MacDonald, Emily; Mulholland, Troy; Stenson, Kevin; Ulmer, Keith; Wagner, Stephen Robert; Alexander, James; Chaves, Jorge; Cheng, Yangyang; Chu, Jennifer; Datta, Abhisek; Mcdermott, Kevin; Mirman, Nathan; Patterson, Juliet Ritchie; Quach, Dan; Rinkevicius, Aurelijus; Ryd, Anders; Skinnari, Louise; Soffi, Livia; Tan, Shao Min; Tao, Zhengcheng; Thom, Julia; Tucker, Jordan; Wittich, Peter; Zientek, Margaret; Abdullin, Salavat; Albrow, Michael; Alyari, Maral; Apollinari, Giorgio; Apresyan, Artur; Apyan, Aram; Banerjee, Sunanda; Bauerdick, Lothar AT; Beretvas, Andrew; Berryhill, Jeffrey; Bhat, Pushpalatha C; Bolla, Gino; Burkett, Kevin; Butler, Joel Nathan; Canepa, Anadi; Cerati, Giuseppe Benedetto; Cheung, Harry; Chlebana, Frank; Cremonesi, Matteo; Duarte, Javier; Elvira, Victor Daniel; Freeman, Jim; Gecse, Zoltan; Gottschalk, Erik; Gray, Lindsey; Green, Dan; Grünendahl, Stefan; Gutsche, Oliver; Hanlon, Jim; Harris, Robert M; Hasegawa, Satoshi; Hirschauer, James; Hu, Zhen; Jayatilaka, Bodhitha; Jindariani, Sergo; Johnson, Marvin; Joshi, Umesh; Klima, Boaz; Kortelainen, Matti J; Kreis, Benjamin; Lammel, Stephan; Lincoln, Don; Lipton, Ron; Liu, Miaoyuan; Liu, Tiehui; Lykken, Joseph; Maeshima, Kaori; Marraffino, John Michael; Mason, David; McBride, Patricia; Merkel, Petra; Mrenna, Stephen; Nahn, Steve; O'Dell, Vivian; Pedro, Kevin; Pena, Cristian; Prokofyev, Oleg; Rakness, Gregory; Ristori, Luciano; Savoy-Navarro, Aurore; Schneider, Basil; Sexton-Kennedy, Elizabeth; Soha, Aron; Spalding, William J; Spiegel, Leonard; Stoynev, Stoyan; Strait, James; Strobbe, Nadja; Taylor, Lucas; Tkaczyk, Slawek; Tran, Nhan Viet; Uplegger, Lorenzo; Vaandering, Eric Wayne; Vernieri, Caterina; Verzocchi, Marco; Vidal, Richard; Wang, Michael; Weber, Hannsjoerg Artur; Whitbeck, Andrew; Acosta, Darin; Avery, Paul; Bortignon, Pierluigi; Bourilkov, Dimitri; Brinkerhoff, Andrew; Cadamuro, Luca; Carnes, Andrew; Carver, Matthew; Curry, David; Field, Richard D; Gleyzer, Sergei V; Joshi, Bhargav Madhusudan; Konigsberg, Jacobo; Korytov, Andrey; Ma, Peisen; Matchev, Konstantin; Mei, Hualin; Mitselmakher, Guenakh; Shi, Kun; Sperka, David; Wang, Jian; Wang, Sean-Jiun; Joshi, Yagya Raj; Linn, Stephan; Ackert, Andrew; Adams, Todd; Askew, Andrew; Hagopian, Sharon; Hagopian, Vasken; Johnson, Kurtis F; Kolberg, Ted; Martinez, German; Perry, Thomas; Prosper, Harrison; Saha, Anirban; Schiber, Catherine; Sharma, Varun; Yohay, Rachel; Baarmand, Marc M; Bhopatkar, Vallary; Colafranceschi, Stefano; Hohlmann, Marcus; Noonan, Daniel; Rahmani, Mehdi; Roy, Titas; Yumiceva, Francisco; Adams, Mark Raymond; Apanasevich, Leonard; Berry, Douglas; Betts, Russell Richard; Cavanaugh, Richard; Chen, Xuan; Dittmer, Susan; Evdokimov, Olga; Gerber, Cecilia Elena; Hangal, Dhanush Anil; Hofman, David Jonathan; Jung, Kurt; Kamin, Jason; Mills, Corrinne; Sandoval Gonzalez, Irving Daniel; Tonjes, Marguerite; Varelas, Nikos; Wang, Hui; Wang, Xiao; Wu, Zhenbin; Zhang, Jingyu; Alhusseini, Mohammad; Bilki, Burak; Clarida, Warren; Dilsiz, Kamuran; Durgut, Süleyman; Gandrajula, Reddy Pratap; Haytmyradov, Maksat; Khristenko, Viktor; Merlo, Jean-Pierre; Mestvirishvili, Alexi; Moeller, Anthony; Nachtman, Jane; Ogul, Hasan; Onel, Yasar; Ozok, Ferhat; Penzo, Aldo; Snyder, Christina; Tiras, Emrah; Wetzel, James; Blumenfeld, Barry; Cocoros, Alice; Eminizer, Nicholas; Fehling, David; Feng, Lei; Gritsan, Andrei; Hung, Wai Ting; Maksimovic, Petar; Roskes, Jeffrey; Sarica, Ulascan; Swartz, Morris; Xiao, Meng; You, Can; Al-bataineh, Ayman; Baringer, Philip; Bean, Alice; Boren, Samuel; Bowen, James; Bylinkin, Alexander; Castle, James; Khalil, Sadia; Kropivnitskaya, Anna; Majumder, Devdatta; Mcbrayer, William; Murray, Michael; Rogan, Christopher; Sanders, Stephen; Schmitz, Erich; Tapia Takaki, Daniel; Wang, Quan; Duric, Senka; Ivanov, Andrew; Kaadze, Ketino; Kim, Doyeong; Maravin, Yurii; Mendis, Dalath Rachitha; Mitchell, Tyler; Modak, Atanu; Mohammadi, Abdollah; Saini, Lovedeep Kaur; Skhirtladze, Nikoloz; Rebassoo, Finn; Wright, Douglas; Baden, Drew; Baron, Owen; Belloni, Alberto; Eno, Sarah Catherine; Feng, Yongbin; Ferraioli, Charles; Hadley, Nicholas John; Jabeen, Shabnam; Jeng, Geng-Yuan; Kellogg, Richard G; Kunkle, Joshua; Mignerey, Alice; Ricci-Tam, Francesca; Shin, Young Ho; Skuja, Andris; Tonwar, Suresh C; Wong, Kak; Abercrombie, Daniel; Allen, Brandon; Azzolini, Virginia; Baty, Austin; Bauer, Gerry; Bi, Ran; Brandt, Stephanie; Busza, Wit; Cali, Ivan Amos; D'Alfonso, Mariarosaria; Demiragli, Zeynep; Gomez Ceballos, Guillelmo; Goncharov, Maxim; Harris, Philip; Hsu, Dylan; Hu, Miao; Iiyama, Yutaro; Innocenti, Gian Michele; Klute, Markus; Kovalskyi, Dmytro; Lee, Yen-Jie; Luckey, Paul David; Maier, Benedikt; Marini, Andrea Carlo; Mcginn, Christopher; Mironov, Camelia; Narayanan, Siddharth; Niu, Xinmei; Paus, Christoph; Roland, Christof; Roland, Gunther; Stephans, George; Sumorok, Konstanty; Tatar, Kaya; Velicanu, Dragos; Wang, Jing; Wang, Ta-Wei; Wyslouch, Bolek; Zhaozhong, Shi; Benvenuti, Alberto; Chatterjee, Rajdeep Mohan; Evans, Andrew; Hansen, Peter; Kalafut, Sean; Kubota, Yuichi; Lesko, Zachary; Mans, Jeremy; Ruckstuhl, Nicole; Rusack, Roger; Turkewitz, Jared; Wadud, Mohammad Abrar; Acosta, John Gabriel; Oliveros, Sandra; Avdeeva, Ekaterina; Bloom, Kenneth; Claes, Daniel R; Fangmeier, Caleb; Golf, Frank; Gonzalez Suarez, Rebeca; Kamalieddin, Rami; Kravchenko, Ilya; Monroy, Jose; Siado, Joaquin Emilo; Snow, Gregory R; Stieger, Benjamin; Godshalk, Andrew; Harrington, Charles; Iashvili, Ia; Kharchilava, Avto; Mclean, Christine; Nguyen, Duong; Parker, Ashley; Rappoccio, Salvatore; Roozbahani, Bahareh; Alverson, George; Barberis, Emanuela; Freer, Chad; Hortiangtham, Apichart; Morse, David Michael; Orimoto, Toyoko; Teixeira De Lima, Rafael; Wamorkar, Tanvi; Wang, Bingran; Wisecarver, Andrew; Wood, Darien; Bhattacharya, Saptaparna; Charaf, Otman; Hahn, Kristan Allan; Mucia, Nicholas; Odell, Nathaniel; Schmitt, Michael Henry; Sung, Kevin; Trovato, Marco; Velasco, Mayda; Bucci, Rachael; Dev, Nabarun; Hildreth, Michael; Hurtado Anampa, Kenyi; Jessop, Colin; Karmgard, Daniel John; Kellams, Nathan; Lannon, Kevin; Li, Wenzhao; Loukas, Nikitas; Marinelli, Nancy; Meng, Fanbo; Mueller, Charles; Musienko, Yuri; Planer, Michael; Reinsvold, Allison; Ruchti, Randy; Siddireddy, Prasanna; Smith, Geoffrey; Taroni, Silvia; Wayne, Mitchell; Wightman, Andrew; Wolf, Matthias; Woodard, Anna; Alimena, Juliette; Antonelli, Louis; Bylsma, Ben; Durkin, Lloyd Stanley; Flowers, Sean; Francis, Brian; Hart, Andrew; Hill, Christopher; Ji, Weifeng; Ling, Ta-Yung; Luo, Wuming; Winer, Brian L; Wulsin, Howard Wells; Cooperstein, Stephane; Elmer, Peter; Hardenbrook, Joshua; Higginbotham, Samuel; Kalogeropoulos, Alexis; Lange, David; Lucchini, Marco Toliman; Luo, Jingyu; Marlow, Daniel; Mei, Kelvin; Ojalvo, Isabel; Olsen, James; Palmer, Christopher; Piroué, Pierre; Salfeld-Nebgen, Jakob; Stickland, David; Tully, Christopher; Malik, Sudhir; Norberg, Scarlet; Barker, Anthony; Barnes, Virgil E; Das, Souvik; Gutay, Laszlo; Jones, Matthew; Jung, Andreas Werner; Khatiwada, Ajeeta; Mahakud, Bibhuprasad; Miller, David Harry; Neumeister, Norbert; Peng, Cheng-Chieh; Qiu, Hao; Schulte, Jan-Frederik; Sun, Jian; Wang, Fuqiang; Xiao, Rui; Xie, Wei; Cheng, Tongguang; Dolen, James; Parashar, Neeti; Chen, Zhenyu; Ecklund, Karl Matthew; Freed, Sarah; Geurts, Frank JM; Kilpatrick, Matthew; Li, Wei; Michlin, Benjamin; Padley, Brian Paul; Roberts, Jay; Rorie, Jamal; Shi, Wei; Tu, Zhoudunming; Zabel, James; Zhang, Aobo; Bodek, Arie; de Barbaro, Pawel; Demina, Regina; Duh, Yi-ting; Dulemba, Joseph Lynn; Fallon, Colin; Ferbel, Thomas; Galanti, Mario; Garcia-Bellido, Aran; Han, Jiyeon; Hindrichs, Otto; Khukhunaishvili, Aleko; Lo, Kin Ho; Tan, Ping; Taus, Rhys; Verzetti, Mauro; Agapitos, Antonis; Chou, John Paul; Gershtein, Yuri; Gómez Espinosa, Tirso Alejandro; Halkiadakis, Eva; Heindl, Maximilian; Hughes, Elliot; Kaplan, Steven; Kunnawalkam Elayavalli, Raghav; Kyriacou, Savvas; Lath, Amitabh; Montalvo, Roy; Nash, Kevin; Osherson, Marc; Saka, Halil; Salur, Sevil; Schnetzer, Steve; Sheffield, David; Somalwar, Sunil; Stone, Robert; Thomas, Scott; Thomassen, Peter; Walker, Matthew; Delannoy, Andrés G; Heideman, Joseph; Riley, Grant; Spanier, Stefan; Thapa, Krishna; Bouhali, Othmane; Celik, Ali; Dalchenko, Mykhailo; De Mattia, Marco; Delgado, Andrea; Dildick, Sven; Eusebi, Ricardo; Gilmore, Jason; Huang, Tao; Kamon, Teruki; Luo, Sifu; Mueller, Ryan; Patel, Rishi; Perloff, Alexx; Perniè, Luca; Rathjens, Denis; Safonov, Alexei; Akchurin, Nural; Damgov, Jordan; De Guio, Federico; Dudero, Phillip Russell; Kunori, Shuichi; Lamichhane, Kamal; Lee, Sung Won; Mengke, Tielige; Muthumuni, Samila; Peltola, Timo; Undleeb, Sonaina; Volobouev, Igor; Wang, Zhixing; Greene, Senta; Gurrola, Alfredo; Janjam, Ravi; Johns, Willard; Maguire, Charles; Melo, Andrew; Ni, Hong; Padeken, Klaas; Ruiz Alvarez, José David; Sheldon, Paul; Tuo, Shengquan; Velkovska, Julia; Verweij, Marta; Xu, Qiao; Arenton, Michael Wayne; Barria, Patrizia; Cox, Bradley; Hirosky, Robert; Joyce, Matthew; Ledovskoy, Alexander; Li, Hengne; Neu, Christopher; Sinthuprasith, Tutanon; Wang, Yanchu; Wolfe, Evan; Xia, Fan; Harr, Robert; Karchin, Paul Edmund; Poudyal, Nabin; Sturdy, Jared; Thapa, Prakash; Zaleski, Shawn; Brodski, Michael; Buchanan, James; Caillol, Cécile; Carlsmith, Duncan; Dasu, Sridhara; Dodd, Laura; Gomber, Bhawna; Grothe, Monika; Herndon, Matthew; Hervé, Alain; Hussain, Usama; Klabbers, Pamela; Lanaro, Armando; Long, Kenneth; Loveless, Richard; Ruggles, Tyler; Savin, Alexander; Smith, Nicholas; Smith, Wesley H; Woods, Nathaniel


    The $ \\chi_{\\mathrm{b}1}(\\text{3P}) $ and $ \\chi_{\\mathrm{b}2}(\\text{3P}) $ states are observed through their $ \\Upsilon(\\text{3S}) \\gamma$ decays, using an event sample of proton-proton collisions collected by the CMS experiment at the CERN LHC. The data were collected at a center-of-mass energy of 13 TeV and correspond to an integrated luminosity of 80.0 fb$^{-1}$. The $ \\Upsilon(\\text{3S}) $ mesons are identified through their dimuon decay channel, while the low-energy photons are detected after converting to $ \\mathrm{ e^{+}e^{-} } $ pairs in the silicon tracker, leading to a $ \\chi_{\\mathrm{b}}(\\text{3P}) $ mass resolution of 2.2 MeV. This is the first time that the $J = $ 1 and 2 states are well resolved and their masses individually measured: 10 513.42 $\\pm$ 0.41 (stat) $\\pm$ 0.18 (syst) MeV and 10 524.02 $\\pm$ 0.57 (stat) $\\pm$ 0.18 (syst) MeV; they are determined with respect to the world-average value of the $ \\Upsilon(\\text{3S}) $ mass, which has an uncertainty of 0.5 MeV. The mass splitting is me...

  13. CHI Research on NSTX-U (United States)

    Lay, W.-S.; Raman, R.; Jarboe, T. R.; Nelson, B. A.; Mueller, D.; Ebrahimi, F.; Ono, M.; Jardin, S. C.; Taylor, G.


    At present about 20% of the total plasma current required for sustained operation has been generated by transient CHI. The present understanding suggests that it may be possible to generate all of the needed current in a ST / tokamak using transient CHI. In such a scenario, one could transition directly from a CHI produced plasma to a non-inductively sustained plasma, without the difficult intermediate step that involves non-inductive current ramp-up. STs based on this new configuration would take advantage of evolving developments in high-temperature superconductor technology to develop a simpler design ST that relies primarily on CHI for plasma current generation. Motivated by the very good results from NSTX and HIT-II, we are examining the potential application of transient CHI for reactor configurations through these studies. (1) Study of the maximum levels of start-up currents that could be generated on NSTX-U, (2) application of a single biased electrode configuration on QUEST to protect the insulator from neutron damage in a CHI reactor installation, and (3) QUEST-like, but a double biased electrode configuration for PEGASUS and NSTX-U. Results from these on-going studies will be described. This work is supported by U.S. DOE Contracts: DE-AC02-09CH11466, DE-FG02-99ER54519 AM08, and DE-SC0006757.

  14. Measurement of Charm Meson Lifetimes

    International Nuclear Information System (INIS)

    Bonvicini, G.; Cinabro, D.; Greene, R.; Perera, L.P.; Zhou, G.J.; Chan, S.; Eigen, G.; Lipeles, E.; Schmidtler, M.; Shapiro, A.; Sun, W.M.; Urheim, J.; Weinstein, A.J.; Wuerthwein, F.; Jaffe, D.E.; Masek, G.; Paar, H.P.; Potter, E.M.; Prell, S.; Sharma, V.; Asner, D.M.; Eppich, A.; Gronberg, J.; Hill, T.S.; Korte, C.M.; Lange, D.J.; Morrison, R.J.; Nelson, H.N.; Nelson, T.K.; Roberts, D.; Tajima, H.; Behrens, B.H.; Ford, W.T.; Gritsan, A.; Krieg, H.; Roy, J.; Smith, J.G.; Alexander, J.P.; Baker, R.; Bebek, C.; Berger, B.E.; Berkelman, K.; Boisvert, V.; Cassel, D.G.; Crowcroft, D.S.; Dickson, M.; Dombrowski, S. von; Drell, P.S.; Dumas, D.J.; Ecklund, K.M.; Ehrlich, R.; Foland, A.D.; Gaidarev, P.; Gibbons, L.; Gittelman, B.; Gray, S.W.; Hartill, D.L.; Heltsley, B.K.; Henderson, S.; Hopman, P.I.; Katayama, N.; Kreinick, D.L.; Lee, T.; Liu, Y.; Meyer, T.O.; Mistry, N.B.; Ng, C.R.; Nordberg, E.; Ogg, M.; Patterson, J.R.; Peterson, D.; Riley, D.; Soffer, A.; Thayer, J.G.; Thies, P.G.; Valant-Spaight, B.; Warburton, A.; Ward, C.; Athanas, M.; Avery, P.; Jones, C.D.; Lohner, M.; Prescott, C.; Rubiera, A.I.; Yelton, J.; Zheng, J.; Brandenburg, G.; Briere, R.A.; Ershov, A.; Gao, Y.S.; Kim, D.Y.; Wilson, R.; Browder, T.E.; Li, Y.; Rodriguez, J.L.; Yamamoto, H.; Bergfeld, T.; Eisenstein, B.I.; Ernst, J.; Gladding, G.E.; Gollin, G.D


    We report measurements of the D 0 , D + , and D + s meson lifetimes using 3.7 fb -1 of e + e - annihilation data collected near the Υ(4S) resonance with the CLEO detector. The measured lifetimes of the D 0 , D + , and D + s mesons are 408.5±4.1 +3.5 -3.4 fs , 1033.6±22.1 +9.9 -12.7 fs , and 486.3±15.0 +4.9 -5.1 fs . The precision of these lifetimes are comparable to those of the best previous measurements, and the systematic errors are very different. In a single experiment we find that the ratio of the D + s and D 0 lifetimes is 1.19±0.04 . copyright 1999 The American Physical Society

  15. Summary of Meson'98 Workshop

    International Nuclear Information System (INIS)

    Henley, E.M.


    One never quite knows what to say in a summary. If you were at the sessions, you heard the same talks I did. Perhaps the purpose is to summarize the parallel sessions, but like you, I can only attend one of these sessions. In addition, the time is short, so that this cannot be a real summary. What I will present are impressions of the past two days, and these will certainly be colored by my own views. Thus at the outset, let me apologize for any and all omissions and distortions. I will cover primarily the plenary session talks, but will organize this summary along the following lines: 1. vector (V) mesons; 2. pseudoscalar mesons, and 3. other subjects, notably with electrons. This afternoon's talks are so close in time to this summary that I shall omit them. (author)

  16. Pseudoscalar Meson Electroproduction and Transversity

    International Nuclear Information System (INIS)

    Goldstein, G.; Liuti, S.


    Exclusive meson leptoproduction from nucleons in the deeply virtual exchanged boson limit can be described by generalized parton distributions (GPDs). Including spin dependence in the description requires 8 independent quark-parton and gluon-parton functions. The chiral even subset of 4 quark-nucleon GPDs are related to nucleon form factors and to parton distribution functions. The chiral odd set of 4 quark-nucleon GPDs are related to transversity, the tensor charge, and other quantities related to transversity. Different meson or photon production processes access different combinations of GPDs. This is analyzed in terms of t-channel exchange quantum numbers, J PC and it is shown that pseudoscalar production can isolate chiral odd GPDs. There is a sensitive dependence in various cross sections and asymmetries on the tensor charge of the nucleon and other transversity parameters. In a second section, analyticity and completeness are shown to limit the partonic interpret ation of the GPDs in the ERBL region.

  17. Quarks and mesons in nuclei

    International Nuclear Information System (INIS)

    Rho, M.


    Quantum chromodynamics is believed to be candidate theory for the strong interactions and contains as its ingredients spinor quark fields and vector gluons, none of which can perhaps be ever liberated and detected in laboratories. A nucleus consists of nucleons bound by nuclear force which are however separately observable and which seem to preserve their identities even under extreme conditions. An intriguing question is: when compressed to high densities or heated to high temperature, at what point does a nuclear matter cease to be describable in terms of nucleon and meson degrees of freedom, but become a plasma of quarks and gluons; and how does this transition occur. This is not an idle question. If quarks and gluons are never to be observed isolated, then it may be that at low energies (or at low densities) they are not the right variables to do physics with. Instead hadrons must be. On the other hand, asymptotic freedom - the unique property of non-abelian gauge theories to which QCD belongs that quark-gluon and gluon-gluon interactions get weaker at short distances - tells us that at some large matter density the matter must necessarily be in the form of quark gas interacting only weakly. This means that a change in degrees of freedom must take place. We would like to know where this occurs and how. In this talk, I would like to address to this question by discussing first the large success we have had in understanding the role that mesons play in finite nuclei and nuclear matter and then attempting to correlate nucleon and meson degrees of freedom to quark-gluon degrees of freedom. In my opinion we are now at a stage where we feel fairly confident in our understanding of nucleon-meson structure of nuclei and nuclear matter and any further progress in deeper understanding of nuclear dynamics - and strong interactions - must come from QCD or its effective version, bags or strings. (orig.)

  18. Properties of the D mesons

    International Nuclear Information System (INIS)

    Feldman, G.J.


    A review is given of the nonleptonic decays of D mesons. Included are measurements of the psi(3772), the accurate determination of D masses and their consequences, and inclusive measurements and tagged events. It is noted that the distinction between the above designated events is that in the former one detects a D decay and ignores the remainder of the event, while in the tagged events a D decay is detected and also the remainder of the event is studied. 39 references

  19. Hybrid mesons with auxiliary fields

    International Nuclear Information System (INIS)

    Buisseret, F.; Mathieu, V.


    Hybrid mesons are exotic mesons in which the color field is not in the ground state. Their understanding deserves interest from a theoretical point of view, because it is intimately related to nonperturbative aspects of QCD. Moreover, it seems that some recently detected particles, such as the π 1 (1600) and the Y(4260), are serious hybrid candidates. In this work, we investigate the description of such exotic hadrons by applying the auxiliary fields technique (also known as the einbein field method) to the widely used spinless Salpeter Hamiltonian with appropriate linear confinement. Instead of the usual numerical resolution, this technique allows to find simplified analytical mass spectra and wave functions of the Hamiltonian, which still lead to reliable qualitative predictions. We analyse and compare two different descriptions of hybrid mesons, namely a two-body q system with an excited flux tube, or a three-body qg system. We also compute the masses of the 1 -+ hybrids. Our results are shown to be in satisfactory agreement with lattice QCD and other effective models. (orig.)

  20. Old tensor mesons in QCD sum rules

    International Nuclear Information System (INIS)

    Aliev, T.M.; Shifman, M.A.


    Tensor mesons f, A 2 and A 3 are analyzed within the framework of QCD sum rules. The effects of gluon and quark condensate is accounted for phenomenologically. Accurate estimates of meson masses and coupling constants of the lowest-lying states are obtained. It is shown that the masses are reproduced within theoretical uncertainty of about 80 MeV. The coupling of f meson to the corresponding quark current is determined. The results are in good aqreement with experimental data [ru

  1. Single spin asymmetry for charm mesons

    Energy Technology Data Exchange (ETDEWEB)

    Dominguez Zacarias, G. [PIMAyC, Eje Central Lazaro Cardenas No. 152, Apdo. Postal 14-805, D.F. (Mexico); Herrera, G.; Mercado, J. [Centro de Investigacion y de Estudios Avanzados, Apdo. Postal 14-740, D.F. (Mexico)


    We study single spin asymmetries of D{sup 0} and D{sup -} mesons in polarized proton-proton collisions. A two component model is used to describe charm meson production. The production of D mesons occurs by recombination of the constituents present in the initial state as well as by fragmentation of quarks in the final state. This model has proved to describe the production of charm. The recombination component involves a mechanism of spin alignment that ends up in a single spin asymmetry. Experimental measurements of single spin asymmetry for pions at RHIC are compared with the model. Predictions for the asymmetry in D mesons are presented. (orig.)

  2. Single spin asymmetry for charm mesons

    International Nuclear Information System (INIS)

    Dominguez Zacarias, G.; Herrera, G.; Mercado, J.


    We study single spin asymmetries of D 0 and D - mesons in polarized proton-proton collisions. A two component model is used to describe charm meson production. The production of D mesons occurs by recombination of the constituents present in the initial state as well as by fragmentation of quarks in the final state. This model has proved to describe the production of charm. The recombination component involves a mechanism of spin alignment that ends up in a single spin asymmetry. Experimental measurements of single spin asymmetry for pions at RHIC are compared with the model. Predictions for the asymmetry in D mesons are presented. (orig.)

  3. Building Bridges: Psi Chi and International Psychology

    Directory of Open Access Journals (Sweden)

    Mercedes A McCormick


    Full Text Available “How can Psi Chi best partner with international psychologists to expand the honor society world-wide?” This has been an important question since 2009, when the 1,100 chapters of Psi Chi in the United States voted to become “The International Honor Society in Psychology”. This report updates and expands on a unique symposium offered at the 120th meeting of the American Psychological Association in Orlando, Florida, in August of 2012 - the first symposium on the Presidential theme of “Building Bridges” between Psi Chi and international psychology [8]. Here, seven leaders in international psychology in North and South America join to address different aspects of this timely question--with many suggestions on how to “build bridges” to expand Psi Chi globally. It was in part due to this historic symposium that in 2013 Guatemala became the first nation in Latin America, and Russia the first nation in mainland Europe to launch a chapter of Psi Chi.

  4. Measurement of inclusive production of charmonium states in B meson decays

    Energy Technology Data Exchange (ETDEWEB)

    Barrera, Barbara


    The authors reconstruct the charmonium mesons J/{psi}, {psi}(2S) and {chi}{sub c} using a sample of 8.46 x 10{sup 6} B{bar B} events collected by the BABAR detector operating at e{sup +}e{sup -} center of mass energies near the {Lambda}(4S) resonance. by measuring rates relative to the branching fraction of the J/{psi}, they obtain preliminary inclusive B branching fractions of (0.25 {+-} 0.02 {+-} 0.02)% to the {psi}(2S) and (0.39 {+-} 0.04 {+-} 0.04)% to the {chi}{sub c1}, and set a 90% confidence level limit of 0.24% on decays through the {chi}{sub c2}.

  5. Structure of exotic nuclei and superheavy elements in meson field theory

    International Nuclear Information System (INIS)

    Linn, Khin Nyan


    In this work the nuclear structure of exotic nuclei and superheavy nuclei is studied in a relativistic framework. In the relativistic mean-field (RMF) approximation, the nucleons interact with each other through the exchange of various effective mesons (scalar, vector, isovector-vector). Ground state properties of exotic nuclei and superheavy nuclei are studied in the RMF theory with the three different parameter sets (ChiM,NL3,NL-Z2). Axial deformation of nuclei within two drip lines are performed with the parameter set (ChiM). The position of drip lines are investigated with three different parameter sets (ChiM,NL3,NL-Z2) and compared with the experimental drip line nuclei. In addition, the structure of hypernuclei are studied and for a certain isotope, hyperon halo nucleus is predicted. (orig.)

  6. Structure of exotic nuclei and superheavy elements in meson field theory

    Energy Technology Data Exchange (ETDEWEB)

    Linn, Khin Nyan


    In this work the nuclear structure of exotic nuclei and superheavy nuclei is studied in a relativistic framework. In the relativistic mean-field (RMF) approximation, the nucleons interact with each other through the exchange of various effective mesons (scalar, vector, isovector-vector). Ground state properties of exotic nuclei and superheavy nuclei are studied in the RMF theory with the three different parameter sets (ChiM,NL3,NL-Z2). Axial deformation of nuclei within two drip lines are performed with the parameter set (ChiM). The position of drip lines are investigated with three different parameter sets (ChiM,NL3,NL-Z2) and compared with the experimental drip line nuclei. In addition, the structure of hypernuclei are studied and for a certain isotope, hyperon halo nucleus is predicted. (orig.)

  7. Obituary: Chi Yuan (1937-2008) (United States)

    Ho, Paul


    Chi Yuan graduated from the National Taiwan University in1959, and received his Masters of Science degree from the University of Florida in 1962, and his Doctor of Philosophy from the University of Michigan in 1966. He was a postdoctoral fellow with Professor C.C. Lin at MIT for three years, before taking his faculty post at the City College of New York in 1969. He attained full professorship at CCNY in 1981. From 1994-1996, Chi returned to Taiwan as Director of the newly found Academia Sinica Institute of Astronomy and Astrophysics (ASIAA). From 1997-2002, he was the recipient of an Outstanding Scholar Award, reserved for the most distinguished scientists employed in Taiwan. Chi retired from ASIAA in 2007, but continued to be active in his research during his two-year fight with brain cancer. Chi Yuan made his greatest impact with his work on the density-wave theory for spiral arm structures in galaxies, with C.C. Lin and Frank Shu. His early work elucidated the observational tests of density-wave theory, and the effects of magnetic fields in galactic shocks. In the 1980s, Chi Yuan worked on spiral density waves in Saturn's rings. In the past two decades, Chi Yuan concentrated on the problem of barred and spiral structures in the nuclei of galaxies, with their implications for fueling the central supermassive black holes. He also worked on the problem of the migration of giant extrasolar planets in their solar disks. These studies were made possible by his establishment of a program on computational fluid dynamics, which became one of the key initiatives in theory at the ASIAA. Among his academic records, two contributions are particularly notable. First, with Typhoon Lee, Fred Lo, and Frank Shu, Chi Yuan founded the ASIAA in order to stimulate the growth of astronomy in Taiwan. Second, and perhaps his greatest influence, has been his training and mentoring of a great number of students in astrophysics, especially for the last 20 years in Taiwan. Today, astronomy

  8. Exotic hybrid mesons in hard electroproduction

    International Nuclear Information System (INIS)

    Anikin, I.V.; Pire, B.; Szymanowski, L.; Teryaev, O.V.; Wallon, S.


    We estimate the sizeable cross section for deep exclusive electroproduction of an exotic J PC =1 -+ hybrid meson in the Bjorken regime. The production amplitude scales like the one for usual meson electroproduction, i.e., as 1/Q 2 . This is due to the nonvanishing leading twist distribution amplitude for the hybrid meson, which may be normalized thanks to its relation to the energy-momentum tensor and to the QCD sum rules technique. The hard amplitude is considered up to next-to-leading order in α S and we explore the consequences of fixing the renormalization scale ambiguity through the Brodsky-Lepage-Mackenzie (BLM) procedure. We study the particular case where the hybrid meson decays through a πη meson pair. We discuss the πη generalized distribution amplitude and then calculate the production amplitude for this process. We propose a forward-backward asymmetry in the production of π and η mesons as a signal for the hybrid meson production. We briefly comment on hybrid electroproduction at very high energy, in the diffractive limit where a QCD Odderon exchange mechanism should dominate. The conclusion of our study is that hard electroproduction is a promising way to study exotic hybrid mesons, in particular, at JLAB, HERA (HERMES), or CERN (Compass)

  9. Experimental evidence for hadroproduction of exotic mesons

    International Nuclear Information System (INIS)

    G. S. Adams; T. Adams; Z. Bar-Yam; J. M. Bishop; V. A. Bodyagin; B. B. Brabson; D. S. Brown; N. M. Cason; S. U. Chung; R. R. Crittenden; J. P. Cummings; K. Danyo; S. Denisov; V. Dorofeev; J. P. Dowd; A. R. Dzierba; P. Eugenio; J. Gunter; R. W. Hackenburg; M. Hayek; E. I. Ivanov; I. Kachaev; W. Kern; E. King; O. L. Kodolova; V. L. Korotkikh; M. A. Kostin; J. Kuhn; R. Lindenbusch; V. Lipaev; J. M. LoSecco; J. J. Manak; J. Napolitano; M. Nozar; C. Olchanski; A. I. Ostrovidov; T. K. Pedlar; A. Popov; D. R. Rust; D. Ryabchikov; A. H. Sanjari; L. I. Sarycheva; E. Scott; K. K. Seth; N. Shenhav; W. D. Shephard; N. B. Sinev; J. A. Smith; P. T. Smith; D. L. Stienike; T. Sulanke; S. A. Taegar; S. Teige; D. R. Thompson; I. N. Vardanyan; D. P. Weygand; D. White; H. J. Willutzki; J. Wise; M. Witkowski; A. A. Yershov; D. Zhao


    New measurements of peripheral meson production are presented. The data confirm the existence of exotic mesons at 1.4 and 1.6 GeV/c2. The latter state dominates the eta'pi- decay spectrum. The data on eta pi+pi-pi- decay show large strength in several exotic (Jpc = 1- +) waves as well

  10. Meson phase space density from interferometry

    International Nuclear Information System (INIS)

    Bertsch, G.F.


    The interferometric analysis of meson correlations a measure of the average phase space density of the mesons in the final state. The quantity is a useful indicator of the statistical properties of the systems, and it can be extracted with a minimum of model assumptions. Values obtained from recent measurements are consistent with the thermal value, but do not rule out superradiance effects

  11. Sigma meson in heavy ion collision

    International Nuclear Information System (INIS)

    Cristian, Ivan; Fuchs, Christian


    We want to present a short theoretical prediction of the behaviour of the sigma meson in heavy ion collisions. It is considered that the sigma meson is a pion-pion correlation, resulting from the decay of the N*(1440) resonance. There will be presented some QMD simulations. (authors)

  12. Experiments on eta-meson production

    International Nuclear Information System (INIS)

    Peng, J.C.


    Following a review of some highlights of eta-meson characteristics, the status of eta-meson production experiments is reviewed. The physics motivations and first results of two LAMPF experiments on (π,eta) reactions are discussed. Possible future experiments are also discussed. 42 refs., 12 figs., 4 tabs

  13. Review of meson resonance radiative decays

    International Nuclear Information System (INIS)

    Thorndike, E.H.


    The radiative decays of meson resonances can be studied by three different approaches, it is noted. These are the meson-exchange, Primakoff effect, and the production of the desired resonance and subsequent observation of its decay. These approaches are criticized and examples of them are reviewed. Mass distributions are shown and branching ratios discussed. 21 references

  14. Meson-nucleus potentials and the search for meson-nucleus bound states (United States)

    Metag, V.; Nanova, M.; Paryev, E. Ya.


    Recent experiments studying the meson-nucleus interaction to extract meson-nucleus potentials are reviewed. The real part of the potentials quantifies whether the interaction is attractive or repulsive while the imaginary part describes the meson absorption in nuclei. The review is focused on mesons which are sufficiently long-lived to potentially form meson-nucleus quasi-bound states. The presentation is confined to meson production off nuclei in photon-, pion-, proton-, and light-ion induced reactions and heavy-ion collisions at energies near the production threshold. Tools to extract the potential parameters are presented. In most cases, the real part of the potential is determined by comparing measured meson momentum distributions or excitation functions with collision model or transport model calculations. The imaginary part is extracted from transparency ratio measurements. Results on K+ ,K0 ,K- , η ,η‧ , ω, and ϕ mesons are presented and compared with theoretical predictions. The interaction of K+ and K0 mesons with nuclei is found to be weakly repulsive, while the K- , η ,η‧ , ω and ϕ meson-nucleus potentials are attractive, however, with widely different strengths. Because of meson absorption in the nuclear medium the imaginary parts of the meson-nucleus potentials are all negative, again with a large spread. An outlook on planned experiments in the charm sector is given. In view of the determined potential parameters, the criteria and chances for experimentally observing meson-nucleus quasi-bound states are discussed. The most promising candidates appear to be the η and η‧ mesons.

  15. Gain Shift Corrections at Chi-Nu

    Energy Technology Data Exchange (ETDEWEB)

    Brown, Tristan Brooks [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Univ. of Massachusetts, Lowell, MA (United States). Dept. of Physics and Applied Physics; Devlin, Matthew James [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)


    Ambient conditions have the potential to cause changes in liquid scintillator detector gain that vary with time and temperature. These gain shifts can lead to poor resolution in both energy as well as pulse shape discrimination. In order to correct for these shifts in the Chi-Nu high energy array, a laser system has been developed for calibration of the pulse height signals.

  16. Saigon-Ho Chi Minh City

    NARCIS (Netherlands)

    Nguyen, T.B.; Samsura, D.A.A.; Krabben, E. van der; Le, A.D.; Le, A.-D.


    Ho Chi Minh City (HCMC) has existed for over three centuries and has developed into the financial capital and most important economic hub of Vietnam. This profile outlines the history of HCMC's development and its impact on current conditions and physical structure of the city. The paper analyzes

  17. Studies of Excited $D$ mesons in $B$ meson decays

    CERN Document Server


    This thesis documents the studies of several three-body B + meson decays, each with a charged charmed meson in the final state. All analyses presented use a data sample recorded by the LHCb detector in 2011 and 2012, corresponding to an integrated luminosity of 3.0 $fb^{-1}$ of $pp$ collision data. The $B^{+} \\to D^{-}K^{+}\\pi^{+}$ and $B^{+} \\to D^{+}K^{+}\\pi^{-}$ decay modes are observed for the first time. The branching fraction of the favoured $B^{+} \\to D^{-}K^{+}\\pi^{+}$ decay mode is measured relative to the topologically similar $B^{+} \\to D^{-}\\pi^{+}\\pi^{+}$ decay and the $B^{+} \\to D^{-}K^{+}\\pi^{+}$ final state is used as a normalisation channel for the suppressed $B^{+} \\to D^{+}K^{+}\\pi^{-}$ decay branching fraction measurement. Searches are performed for the quasi-two-body decays $B^{+} \\to D^{+}K^{*}(892)^{0}$ and $B^{+} \\to D_{2}^{*}(2460)^{0}K^{+}$, using the sample of $B^{+} \\to D^{+}K^{+}\\pi^{-}$ candidate decays. No significant signals are observed for either decay mode and upper limits a...

  18. Vector mesons and chiral symmetry

    International Nuclear Information System (INIS)

    Ecker, G.


    The ambiguities in the off-shell behaviour of spin-1 exchange can be resolved to O(p 4 ) in the chiral low-energy expansion if the asymptotic behaviour of QCD is properly incorporated. As a consequence, the chiral version of vector (and axial-vector) meson dominance is model independent. Additional high-energy constraints motivated by QCD determine the V,A resonance couplings uniquely. In particular, QCD in its effective chiral realization sucessfully predicts Γ(ρ→2π). 10 refs. (Author)

  19. Meson theory and nuclear matter

    International Nuclear Information System (INIS)

    Skyrme, T.H.R.


    An attempt is made to justify the use of the concept of a 'mesic fluid' in connection with the structure of nuclear matter. A transformation is made of the usual symmetric pseudo-scalar meson theory to bring into evidence certain saturation properties, which provide a natural basis for the use of a 'self-consistent' field in the discussion of nuclear structure. Fluctuations about this semi-classical saturated state will give rise to residual interparticle forces within the nucleus, and are also briefly considered in relation to electromagnetic interactions. (author). 5 refs

  20. [Meson spectroscopy and particle astrophysics

    International Nuclear Information System (INIS)

    LoSecco, J.M.


    Progress in the design and construction of a light meson spectroscopy experiment is reported. The experiment will run in 1993. Some non- accelerator, activities and plans for the future are also discussed. Results of a Brookhaven beam test with a subset of the final detector are described. The test has been quite promising both in the speed with which results have been obtained and in the quality of the data itself. The status of the CsI veto is reported The target region, in particular the CsI veto experiment is Notre Dame's primary hardware responsibility on this experiment

  1. Temperature, chemical potential and the ρ meson

    International Nuclear Information System (INIS)

    Roberts, C. D.; Schmidt, S. M.


    Models of QCD must confront nonperturbative phenomena such as confinement, dynamical chiral symmetry breaking (DCSB) and the formation of bound states. In addition, a unified approach should describe the deconfinement and chiral symmetry restoring phase transition exhibited by strongly-interacting matter under extreme conditions of temperature and density. Nonperturbative Dyson-Schwinger equation (DSE) models provide insight into a wide range of zero temperature hadronic phenomena; e.g., non-hadronic electroweak interactions of light- and heavy-mesons, and diverse meson-meson and meson-nucleon form factors. This is the foundation for their application at nonzero-(T, μ). Herein the authors describe the calculation of the reconfinement and chiral symmetry restoring phase boundary, and the medium dependence of ρ-meson properties. They also introduce an extension to describe the time-evolution in the plasma of the quark's scalar and vector self energies based on a Vlasov equation

  2. Meson spectroscopy, quark mixing and quantum chromodynamics

    International Nuclear Information System (INIS)

    Filippov, A.T.


    A semiphenomenological theory of mass spectrum for mesons, consisting of a quark-antiquark pair, is presented. Relativistic kinematical effects of the quark mass differences, the SU(3)-symmetry breaking in slopes of the Regge trajectories and in radially excited states are taken into account. The OZI-rule breaking is taken into account by means of the mixing matrix for the quark wave functions, whose form is suggested by the quantum chromodynamics. A simple extrapolation of expression, given by the quantum chromodynamics from the ''asymptotic freedom'' region to the ''infrared slavery'' region is proposed to describe the dependence of the mixing parameters on the meson masses. To calculate masses and mixing angles for pseudoscalar mesons a condition is proposed that the pion mass is minimal. In this situation the eta-meson mass is near the maximal value. The predictions of the theory for masses and mixing angles of the mesons are in good agreement with the experiment

  3. Light Vector Mesons in the Nuclear Medium

    Energy Technology Data Exchange (ETDEWEB)

    Wood, Michael; Nasseripour, Rakhsha; Weygand, Dennis; Djalali, Chaden; Tur, Clarisse; Mosel, Ulrich; Muehlich, Pascal; Adams, Gary; Amaryan, Moscov; Amaryan, Moskov; Ambrozewicz, Pawel; Anghinolfi, Marco; Asryan, Gegham; Avagyan, Harutyun; Baghdasaryan, Hovhannes; Baillie, Nathan; Ball, James; Baltzell, Nathan; Barrow, Steve; Battaglieri, Marco; Bedlinskiy, Ivan; Bektasoglu, Mehmet; Bellis, Matthew; Benmouna, Nawal; Berman, Barry; Biselli, Angela; Blaszczyk, Lukasz; Bouchigny, Sylvain; Boyarinov, Sergey; Bradford, Robert; Branford, Derek; Briscoe, William; Brooks, William; Burkert, Volker; Butuceanu, Cornel; Calarco, John; Careccia, Sharon; Carman, Daniel; Carnahan, Bryan; Casey, Liam; Chen, Shifeng; Cheng, Lu; Cole, Philip; Collins, Patrick; Coltharp, Philip; Crabb, Donald; Crannell, Hall; Crede, Volker; Cummings, John; Dashyan, Natalya; De Vita, Raffaella; De Sanctis, Enzo; Degtiarenko, Pavel; Denizli, Haluk; Dennis, Lawrence; Deur, Alexandre; Dharmawardane, Kahanawita; Dickson, Richard; Dodge, Gail; Doughty, David; Dugger, Michael; Dytman, Steven; Dzyubak, Oleksandr; Egiyan, Hovanes; Egiyan, Kim; Elfassi, Lamiaa; Elouadrhiri, Latifa; Eugenio, Paul; Fedotov, Gleb; Feldman, Gerald; Feuerbach, Robert; Fradi, Ahmed; Funsten, Herbert; Garcon, Michel; Gavalian, Gagik; Gilfoyle, Gerard; Giovanetti, Kevin; Girod, Francois-Xavier; Goetz, John; Gordon, Christopher; Gothe, Ralf; Griffioen, Keith; Guidal, Michel; Guler, Nevzat; Guo, Lei; Gyurjyan, Vardan; Hadjidakis, Cynthia; Hafidi, Kawtar; Hakobyan, Hayk; Hakobyan, Rafael; Hanretty, Charles; Hardie, John; Hassall, Neil; Hersman, F.; Hicks, Kenneth; Hleiqawi, Ishaq; Holtrop, Maurik; Hyde, Charles; Ilieva, Yordanka; Ireland, David; Ishkhanov, Boris; Isupov, Evgeny; Ito, Mark; Jenkins, David; Jo, Hyon-Suk; Johnstone, John; Joo, Kyungseon; Juengst, Henry; Kalantarians, Narbe; Kellie, James; Khandaker, Mahbubul; Khetarpal, Puneet; Kim, Wooyoung; Klein, Andreas; Klein, Franz; Klimenko, Alexei; Kossov, Mikhail; Krahn, Zebulun; Kramer, Laird; Kubarovsky, Valery; Kuhn, Joachim; Kuhn, Sebastian; Kuleshov, Sergey; Lachniet, Jeff; Laget, Jean; Langheinrich, Jorn; Lawrence, David; Li, Ji; Livingston, Kenneth; Lu, Haiyun; MacCormick, Marion; Markov, Nikolai; Mattione, Paul; McAleer, Simeon; McKinnon, Bryan; McNabb, John; Mecking, Bernhard; Mehrabyan, Surik; Melone, Joseph; Mestayer, Mac; Meyer, Curtis; Mibe, Tsutomu; Mikhaylov, Konstantin; Minehart, Ralph; Mirazita, Marco; Miskimen, Rory; Mokeev, Viktor; Moriya, Kei; Morrow, Steven; Moteabbed, Maryam; Mueller, James; Munevar Espitia, Edwin; Mutchler, Gordon; Nadel-Turonski, Pawel; Niccolai, Silvia; Niculescu, Gabriel; Niculescu, Maria-Ioana; Niczyporuk, Bogdan; Niroula, Megh; Niyazov, Rustam; Nozar, Mina; Osipenko, Mikhail; Ostrovidov, Alexander; Park, Kijun; Pasyuk, Evgueni; Paterson, Craig; Pereira, Sergio; Pierce, Joshua; Pivnyuk, Nikolay; Pocanic, Dinko; Pogorelko, Oleg; Pozdnyakov, Sergey; Preedom, Barry; Price, John; Prok, Yelena; Protopopescu, Dan; Raue, Brian; Riccardi, Gregory; Ricco, Giovanni; Ripani, Marco; Ritchie, Barry; Ronchetti, Federico; Rosner, Guenther; Rossi, Patrizia; Sabatie, Franck; Salamanca, Julian; Salgado, Carlos; Santoro, Joseph; Sapunenko, Vladimir; Schumacher, Reinhard; Serov, Vladimir; Sharabian, Youri; Sharov, Dmitri; Shvedunov, Nikolay; Smith, Elton; Smith, Lee; Sober, Daniel; Sokhan, Daria; Stavinsky, Aleksey; Stepanyan, Stepan; Stepanyan, Samuel; Stokes, Burnham; Stoler, Paul; Strakovski, Igor; Strauch, Steffen; Taiuti, Mauro; Tedeschi, David; Tkabladze, Avtandil; Tkachenko, Svyatoslav; Todor, Luminita; Ungaro, Maurizio; Vineyard, Michael; Vlassov, Alexander; Watts, Daniel; Weinstein, Lawrence; Williams, Michael; Wolin, Elliott; Yegneswaran, Amrit; Zana, Lorenzo; Zhang, Bin; Zhang, Jixie; Zhao, Bo; Zhao, Zhiwen


    The light vector mesons ($\\rho$, $\\omega$, and $\\phi$) were produced in deuterium, carbon, titanium, and iron targets in a search for possible in-medium modifications to the properties of the $\\rho$ meson at normal nuclear densities and zero temperature. The vector mesons were detected with the CEBAF Large Acceptance Spectrometer (CLAS) via their decays to $e^{+}e^{-}$. The rare leptonic decay was chosen to reduce final-state interactions. A combinatorial background was subtracted from the invariant mass spectra using a well-established event-mixing technique. The $\\rho$ meson mass spectrum was extracted after the $\\omega$ and $\\phi$ signals were removed in a nearly model-independent way. Comparisons were made between the $\\rho$ mass spectra from the heavy targets ($A > 2$) with the mass spectrum extracted from the deuterium target. With respect to the $\\rho$-meson mass, we obtain a small shift compatible with zero. Also, we measure widths consistent with standard nuclear many-body eff

  4. Parity violating nuclear force by meson mixing

    International Nuclear Information System (INIS)

    Iqbal, M.J.; Niskanen, J.A.


    We study a mechanism for parity violation in the two nucleon meson-exchange interaction by way of the mixing of mesons of opposite parities. This mixing arises from parity violating W ± and Z exchange between the q bar q pair in the meson. Numerically its effect turns out to be as important as vector meson exchange with a weak meson-nucleon vertex and may partly be used to model this vertex. The calculation is performed using both the standard Born approximation adding the amplitude phases by Watson's theorem and also using the exact correlated two-nucleon wave functions. The effect of correlations and form factors is found to be crucially important at intermediate energies

  5. Measurement of the fraction of $\\Upsilon(1S)$ originating from $\\chi_b(1P)$ decays in $pp$ collisions at $\\sqrt{s}$ = 7 TeV

    CERN Document Server

    Aaij, R; Adametz, A; Adeva, B; Adinolfi, M; Adrover, C; Affolder, A; Ajaltouni, Z; Albrecht, J; Alessio, F; Alexander, M; Ali, S; Alkhazov, G; Alvarez Cartelle, P; Alves Jr, A A; Amato, S; Amhis, Y; Anderson, J; Appleby, R B; Aquines Gutierrez, O; Archilli, F; Artamonov, A; Artuso, M; Aslanides, E; Auriemma, G; Bachmann, S; Back, J J; Balagura, V; Baldini, W; Barlow, R J; Barschel, C; Barsuk, S; Barter, W; Bates, A; Bauer, C; Bauer, Th; Bay, A; Beddow, J; Bediaga, I; Belogurov, S; Belous, K; Belyaev, I; Ben-Haim, E; Benayoun, M; Bencivenni, G; Benson, S; Benton, J; Bernet, R; Bettler, M -O; van Beuzekom, M; Bien, A; Bifani, S; Bird, T; Bizzeti, A; Bjørnstad, P M; Blake, T; Blanc, F; Blanks, C; Blouw, J; Blusk, S; Bobrov, A; Bocci, V; Bondar, A; Bondar, N; Bonivento, W; Borghi, S; Borgia, A; Bowcock, T J V; Bozzi, C; Brambach, T; van den Brand, J; Bressieux, J; Brett, D; Britsch, M; Britton, T; Brook, N H; Brown, H; Büchler-Germann, A; Burducea, I; Bursche, A; Buytaert, J; Cadeddu, S; Callot, O; Calvi, M; Calvo Gomez, M; Camboni, A; Campana, P; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carson, L; Carvalho Akiba, K; Casse, G; Cattaneo, M; Cauet, Ch; Charles, M; Charpentier, Ph; Chen, P; Chiapolini, N; Chrzaszcz, M; Ciba, K; Cid Vidal, X; Ciezarek, G; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Coca, C; Coco, V; Cogan, J; Cogneras, E; Collins, P; Comerma-Montells, A; Contu, A; Cook, A; Coombes, M; Corti, G; Couturier, B; Cowan, G A; Craik, D; Currie, R; D'Ambrosio, C; David, P; David, P N Y; De Bonis, I; De Bruyn, K; De Capua, S; De Cian, M; De Miranda, J M; De Paula, L; De Simone, P; Decamp, D; Deckenhoff, M; Degaudenzi, H; Del Buono, L; Deplano, C; Derkach, D; Deschamps, O; Dettori, F; Dickens, J; Dijkstra, H; Diniz Batista, P; Domingo Bonal, F; Donleavy, S; Dordei, F; Dosil Suárez, A; Dossett, D; Dovbnya, A; Dupertuis, F; Dzhelyadin, R; Dziurda, A; Dzyuba, A; Easo, S; Egede, U; Egorychev, V; Eidelman, S; van Eijk, D; Eisele, F; Eisenhardt, S; Ekelhof, R; Eklund, L; El Rifai, I; Elsasser, Ch; Elsby, D; Esperante Pereira, D; Falabella, A; Färber, C; Fardell, G; Farinelli, C; Farry, S; Fave, V; Fernandez Albor, V; Ferreira Rodrigues, F; Ferro-Luzzi, M; Filippov, S; Fitzpatrick, C; Fontana, M; Fontanelli, F; Forty, R; Francisco, O; Frank, M; Frei, C; Frosini, M; Furcas, S; Gallas Torreira, A; Galli, D; Gandelman, M; Gandini, P; Gao, Y; Garnier, J-C; Garofoli, J; Garra Tico, J; Garrido, L; Gascon, D; Gaspar, C; Gauld, R; Gauvin, N; Gersabeck, E; Gersabeck, M; Gershon, T; Ghez, Ph; Gibson, V; Gligorov, V V; Göbel, C; Golubkov, D; Golutvin, A; Gomes, A; Gordon, H; Grabalosa Gándara, M; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graziani, G; Grecu, A; Greening, E; Gregson, S; Grünberg, O; Gui, B; Gushchin, E; Guz, Yu; Gys, T; Hadjivasiliou, C; Haefeli, G; Haen, C; Haines, S C; Hampson, T; Hansmann-Menzemer, S; Harnew, N; Harnew, S T; Harrison, J; Harrison, P F; Hartmann, T; He, J; Heijne, V; Hennessy, K; Henrard, P; Hernando Morata, J A; van Herwijnen, E; Hicks, E; Hoballah, M; Hopchev, P; Hulsbergen, W; Hunt, P; Huse, T; Huston, R S; Hutchcroft, D; Hynds, D; Iakovenko, V; Ilten, P; Imong, J; Jacobsson, R; Jaeger, A; Jahjah Hussein, M; Jans, E; Jansen, F; Jaton, P; Jean-Marie, B; Jing, F; John, M; Johnson, D; Jones, C R; Jost, B; Kaballo, M; Kandybei, S; Karacson, M; Karbach, T M; Keaveney, J; Kenyon, I R; Kerzel, U; Ketel, T; Keune, A; Khanji, B; Kim, Y M; Knecht, M; Kochebina, O; Komarov, I; Koopman, R F; Koppenburg, P; Korolev, M; Kozlinskiy, A; Kravchuk, L; Kreplin, K; Kreps, M; Krocker, G; Krokovny, P; Kruse, F; Kucharczyk, M; Kudryavtsev, V; Kvaratskheliya, T; La Thi, V N; Lacarrere, D; Lafferty, G; Lai, A; Lambert, D; Lambert, R W; Lanciotti, E; Lanfranchi, G; Langenbruch, C; Latham, T; Lazzeroni, C; Le Gac, R; van Leerdam, J; Lees, J -P; Lefèvre, R; Leflat, A; Lefrançois, J; Leroy, O; Lesiak, T; Li, L; Li, Y; Li Gioi, L; Lieng, M; Liles, M; Lindner, R; Linn, C; Liu, B; Liu, G; von Loeben, J; Lopes, J H; Lopez Asamar, E; Lopez-March, N; Lu, H; Luisier, J; Mac Raighne, A; Machefert, F; Machikhiliyan, I V; Maciuc, F; Maev, O; Magnin, J; Malde, S; Mamunur, R M D; Manca, G; Mancinelli, G; Mangiafave, N; Marconi, U; Märki, R; Marks, J; Martellotti, G; Martens, A; Martin, L; Martín Sánchez, A; Martinelli, M; Martinez Santos, D; Massafferri, A; Mathe, Z; Matteuzzi, C; Matveev, M; Maurice, E; Mazurov, A; McCarthy, J; McGregor, G; McNulty, R; Meissner, M; Merk, M; Merkel, J; Milanes, D A; Minard, M -N; Molina Rodriguez, J; Monteil, S; Moran, D; Morawski, P; Mountain, R; Mous, I; Muheim, F; Müller, K; Muresan, R; Muryn, B; Muster, B; Mylroie-Smith, J; Naik, P; Nakada, T; Nandakumar, R; Nasteva, I; Needham, M; Neufeld, N; Nguyen, A D; Nguyen-Mau, C; Nicol, M; Niess, V; Nikitin, N; Nikodem, T; Nomerotski, A; Novoselov, A; Oblakowska-Mucha, A; Obraztsov, V; Oggero, S; Ogilvy, S; Okhrimenko, O; Oldeman, R; Orlandea, M; Otalora Goicochea, J M; Owen, P; Pal, B K; Palano, A; Palutan, M; Panman, J; Papanestis, A; Pappagallo, M; Parkes, C; Parkinson, C J; Passaleva, G; Patel, G D; Patel, M; Patrick, G N; Patrignani, C; Pavel-Nicorescu, C; Pazos Alvarez, A; Pellegrino, A; Penso, G; Pepe Altarelli, M; Perazzini, S; Perego, D L; Perez Trigo, E; Pérez-Calero Yzquierdo, A; Perret, P; Perrin-Terrin, M; Pessina, G; Petrolini, A; Phan, A; Picatoste Olloqui, E; Pie Valls, B; Pietrzyk, B; Pilař, T; Pinci, D; Playfer, S; Plo Casasus, M; Polci, F; Polok, G; Poluektov, A; Polycarpo, E; Popov, D; Popovici, B; Potterat, C; Powell, A; Prisciandaro, J; Pugatch, V; Puig Navarro, A; Qian, W; Rademacker, J H; Rakotomiaramanana, B; Rangel, M S; Raniuk, I; Rauschmayr, N; Raven, G; Redford, S; Reid, M M; dos Reis, A C; Ricciardi, S; Richards, A; Rinnert, K; Roa Romero, D A; Robbe, P; Rodrigues, E; Rodrigues, F; Rodriguez Perez, P; Rogers, G J; Roiser, S; Romanovsky, V; Romero Vidal, A; Rosello, M; Rouvinet, J; Ruf, T; Ruiz, H; Sabatino, G; Saborido Silva, J J; Sagidova, N; Sail, P; Saitta, B; Salzmann, C; Sanmartin Sedes, B; Sannino, M; Santacesaria, R; Santamarina Rios, C; Santinelli, R; Santovetti, E; Sapunov, M; Sarti, A; Satriano, C; Satta, A; Savrie, M; Savrina, D; Schaack, P; Schiller, M; Schindler, H; Schleich, S; Schlupp, M; Schmelling, M; Schmidt, B; Schneider, O; Schopper, A; Schune, M -H; Schwemmer, R; Sciascia, B; Sciubba, A; Seco, M; Semennikov, A; Senderowska, K; Sepp, I; Serra, N; Serrano, J; Seyfert, P; Shapkin, M; Shapoval, I; Shatalov, P; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, O; Shevchenko, V; Shires, A; Silva Coutinho, R; Skwarnicki, T; Smith, N A; Smith, E; Smith, M; Sobczak, K; Soler, F J P; Solomin, A; Soomro, F; Souza, D; Souza De Paula, B; Spaan, B; Sparkes, A; Spradlin, P; Stagni, F; Stahl, S; Steinkamp, O; Stoica, S; Stone, S; Storaci, B; Straticiuc, M; Straumann, U; Subbiah, V K; Swientek, S; Szczekowski, M; Szczypka, P; Szumlak, T; T'Jampens, S; Teklishyn, M; Teodorescu, E; Teubert, F; Thomas, C; Thomas, E; van Tilburg, J; Tisserand, V; Tobin, M; Tolk, S; Topp-Joergensen, S; Torr, N; Tournefier, E; Tourneur, S; Tran, M T; Tsaregorodtsev, A; Tuning, N; Ubeda Garcia, M; Ukleja, A; Uwer, U; Vagnoni, V; Valenti, G; Vazquez Gomez, R; Vazquez Regueiro, P; Vecchi, S; Velthuis, J J; Veltri, M; Veneziano, G; Vesterinen, M; Viaud, B; Videau, I; Vieira, D; Vilasis-Cardona, X; Visniakov, J; Vollhardt, A; Volyanskyy, D; Voong, D; Vorobyev, A; Vorobyev, V; Voß, C; Voss, H; Waldi, R; Wallace, R; Wandernoth, S; Wang, J; Ward, D R; Watson, N K; Webber, A D; Websdale, D; Whitehead, M; Wicht, J; Wiedner, D; Wiggers, L; Wilkinson, G; Williams, M P; Williams, M; Wilson, F F; Wishahi, J; Witek, M; Witzeling, W; Wotton, S A; Wright, S; Wu, S; Wyllie, K; Xie, Y; Xing, F; Xing, Z; Yang, Z; Young, R; Yuan, X; Yushchenko, O; Zangoli, M; Zavertyaev, M; Zhang, F; Zhang, L; Zhang, W C; Zhang, Y; Zhelezov, A; Zhong, L; Zvyagin, A


    The production of $\\chi_b(1P)$ mesons in $pp$ collisions at a centre-of-mass energy of 7 TeV is studied using 32 pb$^{-1}$ of data collected with the LHCb detector. The $\\chi_b(1P)$ mesons are reconstructed in the decay mode $\\chi_b(1P) \\to \\Upsilon(1S)\\gamma \\to \\mu^+\\mu^-\\gamma$. The fraction of $\\Upsilon(1S)$ originating from $\\chi_b(1P)$ decays in the $\\Upsilon(1S)$ transverse momentum range $6 < p_{\\rm T}^{\\Upsilon(1S)} < 15$ Gev/$c$ and rapidity range $2.0 < y^{\\Upsilon(1S)} < 4.5$ is measured to be $(20.7\\pm 5.7\\pm 2.1^{+2.7}_{-5.4})\\%$, where the first uncertainty is statistical, the second is systematic and the last gives the range of the result due to the unknown $\\Upsilon(1S)$ and $\\chi_b(1P)$ polarizations.

  6. Meson spectroscopy at the Serpukhov accelerator

    International Nuclear Information System (INIS)

    Prokoshkin, Yu.D.


    At present meson spectroscopy is a dominating direction of experimental studies at the IHEP accelerator. The main attention is paid to the search and study of exotic meson states. This report presents some new results obtained recently at the IHEP accelerator. First, observation is made of a narrow 1750 MeV meson decays into ηη. Above |t| ∼ 0.2 (GeV-c) 2 (t: a square of 4-momentum transferred to a neutron), a clear narrow peak appears in Mηη mass spectrum at a mass of 1750 MeV. Second, 2.22 GeV narrow meson decaying into η'η is described. At present only premature conclusions have been obtained in this area and the situation with ζ is not clear. Third, a study is made on new exotic tensor meson χ(1810) decaying into 4π deg and ηη channels. The decay M deg → 4π deg is a very promissing instrument in search for exotic mesons. Next, G(1590)-meson as a scalar glueball is discussed. BR(G → 4π deg) has a large value, an independent evidence of the exotic nature of G(1590)-meson. Experimental data obtained on all essential decay channels of G(1590)-meson allows to give a selfconsistent description of its production and decay as the scalar glueball, a particle with the dominating gluon component. The final two parts deal with exotic vector meson C(1480) decaying into ψπ deg and observation of D(1285) → ψγ decay. (Nogami, K.)

  7. Discrete symmetries with neutral mesons (United States)

    Bernabéu, José


    Symmetries, and Symmetry Breakings, in the Laws of Physics play a crucial role in Fundamental Science. Parity and Charge Conjugation Violations prompted the consideration of Chiral Fields in the construction of the Standard Model, whereas CP-Violation needed at least three families of Quarks leading to Flavour Physics. In this Lecture I discuss the Conceptual Basis and the present experimental results for a Direct Evidence of Separate Reversal-in-Time T, CP and CPT Genuine Asymmetries in Decaying Particles like Neutral Meson Transitions, using Quantum Entanglement and the Decay as a Filtering Measurement. The eight transitions associated to the Flavour-CP eigenstate decay products of entangled neutral mesons have demonstrated with impressive significance a separate evidence of TRV and CPV in Bd-physics, whereas a CPTV asymmetry shows a 2σ effect interpreted as an upper limit. Novel CPTV observables are discussed for K physics at KLOE-2, including the difference between the semileptonic asymmetries from KL and KS, the ratios of double decay rate Intensities to Flavour-CP eigenstate decay products and the ω-effect. Their observation would lead to a change of paradigm beyond Quantum Field Theory, however there is nothing in Quantum Mechanics forbidding CPTV.

  8. Dicty_cDB: CHI134 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHI134 (Link to dictyBase) - - - Contig-U11723-1 CHI134P (Link... to Original site) CHI134F 581 CHI134Z 736 CHI134P 1297 - - Show CHI134 Library CH (Link to library) Clone ID CHI134 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11723-1 Original site URL*kta*g*IIMESNKSSSHGDVSTSPSFLNNHHQFNNGGDIIPKKKKNRIMHVG SYEVGKTLGNGTFGKVKLGTNICTK...PVIEAPKTRRMSLDSR MLNGDQQSLVEKNQHMASPRTSKGIFKXSTTTTKSPEKTIIELKRSLEESGLFTKKKGPY LXLCFDEDNSVKFQIEIVKICNLDLTGIQLKRLSGDTWKYKDICT

  9. Meson Form Factors and Deep Exclusive Meson Production Experiments

    Energy Technology Data Exchange (ETDEWEB)

    Horn, Tanja [The Catholic Univ. of America, Washington, DC (United States); Thomas Jefferson National Accelerator Facility (TJNAF), Newport News, VA (United States)


    Pion and kaon electroproduction data play a unique role in Nature and our understanding of them is essential for explaining hadron structure. Precision longitudinaltransverse separated pion and kaon cross sections are of particular interest. They allow for the extraction of meson form factors and validation of understanding of hard exclusive and semi-inclusive reactions (π+, K+, π0, γ) towards 3D hadron imaging and potential future flavor decomposition. We review recent data and present prospects for deep exclusive pion and kaon electroproduction at the 12 GeV Jefferson Lab including the prospects to use projected charged- and neutral pion data to further determine the spin, charge-parity and flavor of GPDs, including the helicity-flip GPDs.

  10. A precursory ULF signature for the Chi-Chi earthquake in Taiwan

    Directory of Open Access Journals (Sweden)

    Y. Akinaga


    Full Text Available ULF emission data at Lunping (epicentral distance, 120 km have been analysed for the Chi-Chi earthquake (with magnitude 7.6 and depth of 11 km in Taiwan which occurred on 21 September 1999. Simple intensity analyses have not yielded any significant results but we have found, based on the analysis of polarization (the ratio of vertical magnetic field component Z to the horizontal component G, that the polarization (Z/G showed a significant enhancement for two months before the earthquake. This kind of temporal evolution of polarization seems to be very similar to previous results, so that it is highly likely that this phenomenon may be associated with the Chi-Chi earthquake. Also, the comparison of the results of polarization analyses, by changing the signal threshold, has given us an approximate intensity of the seismogenic emission of the order of the monthly mean value.

  11. Exclusive φ meson production in HERMES

    International Nuclear Information System (INIS)

    Golembiovskaya, Mayya


    In the present work exclusive φ meson leptoproduction at HERMES experiment in DESY was studied using the data collected at HERA accelerator in the period from 1998 till 2000 and from 2006 till 2007 years. In the analysis unpolarized and longitudinally polarized hydrogen and deuteron targets were used, the beam consisted of longitudinally polarized leptons. Via measurement of the angular and momentum distribution of the φ meson decay products 23 spin density matrix elements (SDMEs) for the φ meson were obtained. The number of SDMEs was defined by the experiment conditions, e.g. by the beam and target polarization directions. For the mentioned time period φ meson SDMEs were defined at HERMES for the first time. The quantities U 1 , U 2 and U 3 which can be used to check presence of unnatural parity exchange (UPE) mechanism in phi meson production were calculated from SDMEs. All the results were obtained in 3 kinematic bins of Q 2 , 4 kinematic bins of t' and for the integrated kinematics. No statistically significant difference between the results for hydrogen and deuteron targets was observed. The UPE quantities were found to be zero within 2 σ for the integrated kinematics, indicating negligible contribution of UPE for the φ meson production which is in agreement with theory predictions. The test of s-channel helicity conservation hypothesis via comparison of corresponding SDME values showed helicity conservation for the φ meson production.

  12. Exotic hybrid mesons in hard electroproduction

    CERN Document Server

    Anikin, I V; Szymanowski, L; Teryaev, O V; Wallon, S


    We estimate the sizeable cross section for deep exclusive electroproduction of an exotic $J^{PC}=1^{-+}$ hybrid meson in the Bjorken regime. The production amplitude scales like the one for usual meson electroproduction, i.e. as $1/Q^2$. This is due to the non-vanishing leading twist distribution amplitude for the hybrid meson, which may be normalized thanks to its relation to the energy momentum tensor and to the QCD sum rules technique. The hard amplitude is considered up to next-to-leading order in $\\alpha_{S}$ and we explore the consequences of fixing the renormalization scale ambiguity through the BLM procedure. We study the particular case where the hybrid meson decays through a $\\pi\\eta $ meson pair. We discuss the $\\pi\\eta$ generalized distribution amplitude and then calculate the production amplitude for this process. We propose a forward-backward asymmetry in the production of $\\pi$ and $\\eta$ mesons as a signal for the hybrid meson production. We briefly comment on hybrid electroproduction at very ...

  13. Exclusive φ meson production in HERMES

    Energy Technology Data Exchange (ETDEWEB)

    Golembiovskaya, Mayya


    In the present work exclusive φ meson leptoproduction at HERMES experiment in DESY was studied using the data collected at HERA accelerator in the period from 1998 till 2000 and from 2006 till 2007 years. In the analysis unpolarized and longitudinally polarized hydrogen and deuteron targets were used, the beam consisted of longitudinally polarized leptons. Via measurement of the angular and momentum distribution of the φ meson decay products 23 spin density matrix elements (SDMEs) for the φ meson were obtained. The number of SDMEs was defined by the experiment conditions, e.g. by the beam and target polarization directions. For the mentioned time period φ meson SDMEs were defined at HERMES for the first time. The quantities U{sub 1}, U{sub 2} and U{sub 3} which can be used to check presence of unnatural parity exchange (UPE) mechanism in phi meson production were calculated from SDMEs. All the results were obtained in 3 kinematic bins of Q{sup 2}, 4 kinematic bins of t' and for the integrated kinematics. No statistically significant difference between the results for hydrogen and deuteron targets was observed. The UPE quantities were found to be zero within 2 σ for the integrated kinematics, indicating negligible contribution of UPE for the φ meson production which is in agreement with theory predictions. The test of s-channel helicity conservation hypothesis via comparison of corresponding SDME values showed helicity conservation for the φ meson production.

  14. Tai Chi Chuan in Medicine and Health Promotion


    Lan, Ching; Chen, Ssu-Yuan; Lai, Jin-Shin; Wong, Alice May-Kuen


    Tai Chi Chuan (Tai Chi) is a Chinese traditional mind-body exercise and recently, it becomes popular worldwide. During the practice of Tai Chi, deep diaphragmatic breathing is integrated into body motions to achieve a harmonious balance between body and mind and to facilitate the flow of internal energy (Qi). Participants can choose to perform a complete set of Tai Chi or selected movements according to their needs. Previous research substantiates that Tai Chi has significant benefits to heal...

  15. Quantum field theory approaches to meson structure

    International Nuclear Information System (INIS)

    Branz, Tanja


    Meson spectroscopy became one of the most interesting topics in particle physics in the last ten years. In particular, the discovery of new unexpected states in the charmonium spectrum which cannot be simply explained by the constituent quark model attracted the interest of many theoretical efforts. In the present thesis we discuss different meson structures ranging from light and heavy quark-antiquark states to bound states of hadrons-hadronic molecules. Here we consider the light scalar mesons f 0 (980) and a 0 (980) and the charmonium-like Y(3940), Y(4140) and Z ± (4430) states. In the discussion of the meson properties like mass spectrum, total and partial decay widths and production rates we introduce three different theoretical methods for the treatment and description of hadronic structure. For the study of bound states of mesons we apply a coupled channel approach which allows for the dynamical generation of meson-meson resonances. The decay properties of meson molecules are further on studied within a second model based on effective Lagrangians describing the interaction of the bound state and its constituents. Besides hadronic molecules the effective Lagrangian approach is also used to study the radiative and strong decay properties of ordinary quark-antiquark (q anti q) states. The AdS/QCD model forms the completion of the three theoretical methods introduced in the present thesis. This holographic model provides a completely different ansatz and is based on extra dimensions and string theory. Within this framework we calculate the mass spectrum of light and heavy mesons and their decay constants.

  16. Meson facility. Powerful new research tool

    International Nuclear Information System (INIS)

    Lobashev, V.M.; Tavkhelidze, A.N.

    A meson facility is being built at the Institute of Nuclear Research, USSR Academy of Sciences, in Troitsk, where the Scientific Center, USSR Academy of Sciences is located. The facility will include a linear accelerator for protons and negative hydrogen ions with 600 MeV energy and 0.5-1 mA beam current. Some fundamental studies that can be studied at a meson facility are described in the areas of elementary particles, neutron physics, solid state physics, and applied research. The characteristics of the linear accelerator are given and the meson facility's experimental complex is described

  17. Radiative decay of light and heavy mesons

    International Nuclear Information System (INIS)

    Barik, N.; Dash, P.C.


    The M1 transition among the vector (V) and pseudoscalar (P) mesons in the light and heavy flavor sectors has been investigated in a potential model of independent quarks. Going beyond the static approximation, to add some momentum dependence due to the recoil effect in a more realistic calculation, we find an improvement in the results for the radiative decay of light flavored mesons. However, our prediction on the decay rates for the mesons (D * and B * ) in the heavy flavor sector remains unaffected and compares well with those of other model calculations

  18. Single meson photoproduction and IR renormalons

    International Nuclear Information System (INIS)

    Agaev, S.S.


    Single pseudoscalar and vector mesons inclusive photoproduction γh → MX via higher twist mechanism is calculated using the QCD running coupling constant method. It is proved that in the context of this method a higher twist contribution to the photoproduction cross section cannot be normalized in terms of the meson electromagnetic form factor. The structure of infrared renormalon singularities of the higher twist subprocess cross section and the resumed expression (the Borel sum) for it are found. Comparisons are made with earlier results, as well as with leading twist cross section. Phenomenological effects of studied contributions for π, K, ρ-meson photoproduction are discussed. (author). 21 refs, 8 figs

  19. Search for radiative B meson decays

    International Nuclear Information System (INIS)

    Lesiak, T.; Muryn, B.; Nowak, G.; Antreasyan, D.; Irion, J.; McBride, P.; Strauch, K.; Bartels, H.W.; Bienlein, J.K.; Brockmueller, K.; Jakubowski, Z.; Karch, K.; Kloiber, T.; Koch, W.; Maschmann, W.; Meyer, H.; Skwarnicki, T.; Trost, H.J.; Voigt, A.; Wachs, K.; Zschorsch, P.; Besset, D.; Cabenda, R.; Cowan, R.; Bieler, C.; Graaf, K.; Heinsius, F.H.; Kiel, T.; Krueger, S.; Lekebusch, R.; Nernst, R.; Sievers, D.; Stock, V.; Strohbusch, U.; Bloom, E.D.; Clare, R.; Cooper, S.; Fairfield, K.; Fridman, A.; Gaiser, J.; Gelphman, D.; Godfrey, G.; Hofstadter, R.; Kirkbride, I.; Lee, R.; Leffler, S.; Litke, A.M.; Lockman, W.; Lowe, S.; Niczyporuk, B.; Pollock, B.; Schwarz, A.; Tompkins, J.; Van Uitert, B.; Wacker, K.; Brock, I.; Engler, A.; Kraemer, R.W.; Marlow, D.; Messing, F.; Prindle, D.; Renger, B.; Rippich, C.; Vogel, H.; Cavalli-Sforza, M.; Coyne, D.; Folger, G.; Glaser, G.; Kobel, M.; Lurz, B.; Schuette, J.; Volland, U.; Wegener, H.; Janssen, H.; Koenig, A.C.; Metzger, W.J.; Reidenbach, M.; Schotanus, J.; Walle, R.T. van de; Walk, W.; Keh, S.; Kilian, H.; Koenigsmann, K.; Scheer, M.; Schmitt, P.; Marsiske, H.; Peck, C.; Porter, F.C.; Ratoff, P.; Williams, D.A.


    The Crystal Ball detector at the ε + ε - storage ring DORIS-II has been used to search for radiative B meson decays, especially of the type b→sγ. No mono-energetic γ-lines have been found in the inclusive photon spectrum from Υ(4S) decays, and upper limits are obtained for radiative decays of B mesons to various strange mesons and to the D*. Integrating the photon spectrum over the corresponding energy range, we find BR(B→γX) -3 at 90% confidence level for the mass range 892 MeV≤M X ≤2045 MeV. (orig.)

  20. Search for radiative B meson decays

    International Nuclear Information System (INIS)

    Lesiak, T.; Muryn, B.; Nowak, G.; Antreasyan, D.; Irion, J.; McBride, P.; Strauch, K.; Bartels, H.W.; Bienlein, J.K.; Brockmueller, K.; Jakubowski, Z.; Karch, K.; Kloiber, T.; Koch, W.; Maschmann, W.; Meyer, H.; Skwarnicki, T.; Trost, H.J.; Voigt, A.; Wachs, K.; Zschorsch, P.; Besset, D.; Cabenda, R.; Cowan, R.; Bieler, C.; Graaf, K.; Heinsius, F.H.; Kiel, T.; Krueger, S.; Lekebusch, R.; Nernst, R.; Sievers, D.; Stock, V.; Strohbusch, U.; Bloom, E.D.; Clare, R.; Cooper, S.; Fairfield, K.; Fridman, A.; Gaiser, J.; Gelphman, D.; Godfrey, G.; Hofstadter, R.; Kirkbride, I.; Lee, R.; Leffler, S.; Litke, A.M.; Lockman, W.; Lowe, S.; Niczyporuk, B.; Pollock, B.; Schwarz, A.; Tompkins, J.; Van Uitert, B.; Wacker, K.; Brock, I.; Engler, A.; Kraemer, R.W.; Marlow, D.; Messing, F.; Prindle, D.; Renger, B.; Rippich, C.; Vogel, H.; Cavalli-Sforza, M.; Coyne, D.; Folger, G.; Glaser, G.; Kobel, M.; Lurz, B.; Schuette, J.; Volland, U.; Wegener, H.; Janssen, H.; Koenig, A.C.; Metzger, W.J.; Reidenbach, M.; Schotanus, J.; Walle, R.T. van de; Walk, W.; Keh, S.; Kilian, H.; Koenigsmann, K.; Scheer, M.; Schmitt, P.; Marsiske, H.; Williams, D.A.


    The Crystal Ball detector at the e + e - storage ring DORIS-II has been used to search for radiative B meson decays, especially of the type b→sγ. No mono-energetic γ-lines have been found in the inclusive photon spectrum from Υ(4S) decays, and upper limits are obtained for radiative decays of B mesons to various strange mesons and to the D*. Integrating the photon spectrum over the corresponding energy range, we find BR(B→γX) -3 , at 90% confidence level for the mass range 892 MeV≤M X ≤2045 MeV. (orig.)

  1. Why do nucleons cling. [Meson theory

    Energy Technology Data Exchange (ETDEWEB)

    Kumar, N [Hindu Coll., Delhi (India)


    The nature of the forces which bind nucleons together within the nucleus of an atom have been discussed in detail. The characteristic properties of the nucleons, such as spin, interaction range etc. and the meson theory of nuclear forces are described. The present researches indicate that the force between two nucleons in a many-nucleon system is not very different from the force between two free nucleons. Researches related to the origin of nuclear forces based on the meson theory are now mainly concerned with the role played by the heavier mesons and the two pion exchanges in the middle region around 0.7 fm. (10/sup -13/ cm).

  2. Fock exchange in meson theories of nuclei

    International Nuclear Information System (INIS)

    Bolsterli, M.


    The Fock exchange term in meson field theories of nuclear systems is shown to arise from a two-loop ground-state self-energy diagram. Evaluation of this diagram gives the relativistic or semirelativistic analog of the Fock exchange energy; it differs from the nucleon-nucleon Fock energy in including retardation effects. In finite meson-field theories of nuclear systems, the variational nature of the meson-field analog of the Hartree-Fock energy functional can be further elucidated. 4 refs

  3. The η' meson from lattice QCD

    International Nuclear Information System (INIS)

    Jansen, K.; Michael, C.; Urbach, C.


    We study the flavour singlet pseudoscalar mesons from first principles using lattice QCD. With N f =2 flavours of light quark, this is the so-called η 2 meson and we discuss the phenomenological status of this. Using maximally twisted-mass lattice QCD, we extract the mass of the η 2 meson at two values of the lattice spacing for lighter quarks than previously discussed in the literature. We are able to estimate the mass value in the limit of light quarks with their physical masses. (orig.)

  4. Discussion of the 3P0 model applied to the decay of mesons into two mesons

    International Nuclear Information System (INIS)

    Bonnaz, R.; Silvestre-Brac, B.


    The 3 P 0 model for the decay of a meson into two mesons is revisited. In particular, the formalism is extended in order to deal with an arbitrary form for the creation vertex and with the exact meson wave functions. A careful analysis of both effects is performed and discussed. The model is then applied to a large class of transitions known experimentally. Two types of quark-antiquark potentials have been tested and compared. (author)

  5. Tetraquarks in the 1/N expansion and meson-meson resonances

    Energy Technology Data Exchange (ETDEWEB)

    Maiani, L. [Dipartimento di Fisica and INFN, ‘Sapienza’ Università di Roma, P.le Aldo Moro 5, I-00185 Roma (Italy); Polosa, A.D. [Dipartimento di Fisica and INFN, ‘Sapienza’ Università di Roma, P.le Aldo Moro 5, I-00185 Roma (Italy); CERN Theory Department, CH-1211 Geneva 23 (Switzerland); Riquer, V. [Dipartimento di Fisica and INFN, ‘Sapienza’ Università di Roma, P.le Aldo Moro 5, I-00185 Roma (Italy)


    Diquarks are found to have the right degrees of freedom to describe the tetraquark poles in hidden-charm to open-charm meson-meson amplitudes. Compact tetraquarks result as intermediate states in non-planar diagrams of the 1/N expansion and the corresponding resonances are narrower than what estimated before. The proximity of tetraquarks to meson-thresholds has an apparent role in this analysis and, in the language of meson molecules, an halving rule in the counting of states is obtained.

  6. Tetraquarks in the 1/N expansion and meson-meson resonances

    International Nuclear Information System (INIS)

    Maiani, L.; Polosa, A.D.; Riquer, V.


    Diquarks are found to have the right degrees of freedom to describe the tetraquark poles in hidden-charm to open-charm meson-meson amplitudes. Compact tetraquarks result as intermediate states in non-planar diagrams of the 1/N expansion and the corresponding resonances are narrower than what estimated before. The proximity of tetraquarks to meson-thresholds has an apparent role in this analysis and, in the language of meson molecules, an halving rule in the counting of states is obtained.

  7. Meson decays in a quark model

    International Nuclear Information System (INIS)

    Roberts, W.; Silvestre-Brac, B.


    A recent model of hadron states is extended to include meson decays. We find that the overall success of the model is quite good. Possible improvements to the model are suggested. copyright 1997 The American Physical Society

  8. Hybrid mesons: old prejudices and new spectroscopy

    International Nuclear Information System (INIS)

    Kalashnikova, Yu.S.


    The models for hybrid mesons are discussed, in which the gluonic excitations manifest themselves as the vibrations of the quark-antiquark QCD string. The predictions for the spectra, decays and mixing with hadronic channels are presented. (orig.)

  9. The light scalar mesons as tetraquarks

    Directory of Open Access Journals (Sweden)

    Gernot Eichmann


    Full Text Available We present a numerical solution of the four-quark Bethe–Salpeter equation for ground-state scalar tetraquarks with JPC=0++. We find that the four-body equation dynamically generates pseudoscalar-meson poles in the Bethe–Salpeter amplitude. The resulting tetraquarks are genuine four-quark states that are dominated by pseudoscalar meson–meson correlations. Diquark–antidiquark contributions are subleading because of their larger mass scale. In the light quark sector, the sensitivity of the tetraquark wave function to the pion poles leads to an isoscalar tetraquark mass Mσ∼350 MeV which is comparable to that of the σ/f0(500. The masses of its multiplet partners κ and a0/f0 follow a similar pattern. This provides support for a tetraquark interpretation of the light scalar meson nonet in terms of ‘meson molecules’.

  10. New physics effects from meson decays

    Indian Academy of Sciences (India)

    beyond the Standard Model from -meson decays, taking К-parity conserving and violating super- symmetry .... particular choice of the parameter space, can be much higher than the SM ones. .... CLEO has already given some food for thought.

  11. Pion physics at the meson factories

    International Nuclear Information System (INIS)

    Nagle, D.E.; Johnson, M.B.; Measday, D.F.


    Pi meson probes have contributed much to our ideas about how neutrons and protons are distributed and move relative to each other in nuclei, and along with other probes, to our understanding of basic symmetries in particle physics

  12. The interpretation of the iota meson

    International Nuclear Information System (INIS)

    Frank, M.


    The authors analyze the iota (1440) meson in a non-relativistic quark model. The authors review the experimental data, then attempt to incorporate it in the mass spectrum and radiative decays of the low-lying pseudoscalar and vector mesons. Correlating these results with production decay rates from J/psi and the radiative decays of iota, the authors conclude that the iota has to be interpreted as having a strong gluonium component


    Czech Academy of Sciences Publication Activity Database

    Donoval, Jan; Bydžovský, Petr


    Roč. 26, 3-4 (2011), s. 645-646 ISSN 0217-751X. [11th International Workshop on Meson Production , Properties and Interaction. Krakow, 10.06.2010-15.06.2010] R&D Projects: GA ČR GA202/08/0984 Institutional research plan: CEZ:AV0Z10480505 Keywords : Eta-meson photoproduction * form factors * nucleon resonances Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.053, year: 2011

  14. Meson-mass generation by instantons, 2

    Energy Technology Data Exchange (ETDEWEB)

    Saito, T [Kyoto Prefectural Univ. of Medicine (Japan); Shigemoto, K


    In a previous work we discussed how pseudo-scalar mesons and scalar mesons acquire their masses by instantons in the colored gauge field. We considered there the two-flavor model with chiral U(2) x U(2) symmetry. In the present paper the same problem is discussed, including the chiral flavor U(3) x U(3) symmetry. An importance of non-local effects due to instantons is emphasized.

  15. Oscillations of neutral B mesons systems

    CERN Document Server

    Boucrot, J.


    The oscillation phenomenon in the neutral B mesons systems is now well established. The motivations and principles of the measurements are given; then the most recent results from the LEP experiments, the CDF collaboration at Fermilab and the SLD collaboration at SLAC are reviewed. The present world average of the $\\bd$ meson oscillation frequency is $\\dmd = 0.471 \\pm 0.016 \\ps$ and the lower limit on the $\\bs$ oscillation frequency is

  16. Quark-gluon mixing in scalar mesons

    International Nuclear Information System (INIS)

    Eremyan, Sh.S.; Nazaryan, A.E.


    Scalar mesons are considered within the quark-gluon mixing model. It is shown that there exists decouplet of scalar particles consisting of S* (975), ε (1400), S*' (1700), δ (980) and κ (1350) resonances. It has turned out that the long ago known S* (975)-resonance is a nearly pure glouball. A good description of all available experimental data on scalar meson decays is obtained

  17. Bs mesons: semileptonic and nonleptonic decays

    Directory of Open Access Journals (Sweden)

    Albertus C.


    Full Text Available In this contribution we compute some nonleptonic and semileptonic decay widths of Bs mesons, working in the context of constituent quark models [1, 2]. For the case of semileptonic decays we consider reactions leading to kaons or different Jπ Ds mesons. The study of nonleptonic decays has been done in the factorisation approximation and includes the final states enclosed in Table 2.

  18. Beautiful mesons from QCD spectral sum rules

    International Nuclear Information System (INIS)

    Narison, S.


    We discuss the beautiful meson from the point of view of the QCD spectral sum rules (QSSR). The bottom quark mass and the mixed light quark-gluon condensates are determined quite accurately. The decay constant f B is estimated and we present some arguments supporting this result. The decay constants and the masses of the other members of the beautiful meson family are predicted. (orig.)

  19. Formation of the Chi 1 and Chi 2 charmonium states in pantip annihilation at the ISR

    International Nuclear Information System (INIS)

    Fay, J.


    R704 experiment has studied the Chi 1 and Chi 2 charmonium states (cantic) in their J/Psi Gamma decay. These states are directly formed in the interaction of a hydrogen molecular jet target with a antiprotons beam permanently cooled, circulating in the ring 2 of the ISR. This process allows a high luminosity to be reached (up to 3 10 30 cm -2 s -1 ). The huge hadronic background leads to detect only electromagnetic final states. The detector is a two-arm no magnetic spectrometer in two parts. The first one is devoted to charged particle detection: tracking (MWPC, scintillators) and electron identification (Cerenkov). The second one forms a calorimeter measuring the position and the energy of photons and electrons (lead-scintillator sandwiches, proportional chambers using analogue read-out and lead-glass wall). Event selection is based on Psi identification from two electron tracks (one in each arm) and search for the radiated photon reconstructed from the Chi decay kinematics. For Chi 1 and Chi 2 respectively, a set of 32 and 55 events is found with a negligeable background level and one obtains values on mass, width and branching ratios on pantip. These results are compared with theoretical prediction from QCD inspired models: masses are well described by potential methods and sum rules (within a 10 MeV uncertainly). For the widths, only a raw value can be achieved while branching ratios are in good agreement with our measurements [fr

  20. CHY-graphs on a torus

    Energy Technology Data Exchange (ETDEWEB)

    Cardona, Carlos [Physics Division, National Center for Theoretical Sciences, National Tsing-Hua University,Hsinchu, Taiwan 30013 (China); Gomez, Humberto [Instituto de Fisica - Universidade de São Paulo,Caixa Postal 66318, 05315-970 São Paulo, SP (Brazil); Facultad de Ciencias Basicas, Universidad Santiago de Cali,Calle 5 62-00 Barrio Pampalinda, Cali, Valle (Colombia)


    Recently, we proposed a new approach using a punctured Elliptic curve in the CHY framework in order to compute one-loop scattering amplitudes. In this note, we further develop this approach by introducing a set of connectors, which become the main ingredient to build integrands on M{sub 1,n}, the moduli space of n-punctured Elliptic curves. As a particular application, we study the Φ{sup 3} bi-adjoint scalar theory. We propose a set of rules to construct integrands on M{sub 1,n} from Φ{sup 3} integrands on M{sub 0,n}, the moduli space of n-punctured spheres. We illustrate these rules by computing a variety of Φ{sup 3} one-loop Feynman diagrams. Conversely, we also provide another set of rules to compute the corresponding CHY-integrand on M{sub 1,n} by starting instead from a given Φ{sup 3} one-loop Feynman diagram. In addition, our results can easily be extended to higher loops.

  1. Electroproduction and photoproduction of vector mesons and generalized vector meson dominance

    International Nuclear Information System (INIS)

    Fraas, H.; Kuroda, M.


    Using generalized vector meson dominance, electro- and photoproduction of vector mesons is studied. The unnatural parity exchange part of ω(1.2) production is estimated to be about one fourth of that of ω-production. The off diagonal transition model suggests the suppression of diffractive rho(1.2) and ω(1.2) production. (orig.) [de

  2. Mass-producing B mesons

    Energy Technology Data Exchange (ETDEWEB)

    Aleksan, Roy; Ali, Ahmed


    Since the discovery of the upsilon resonances in 1977 the physics of the fifth quark - beauty - has played a vital role in establishing and consolidating today's Standard Model of particle physics. In recent years, a wealth of data on B particle (containing the beauty quark) has emerged from the detectors ARGUS (at the DORIS ring, DESY, Hamburg) and CLEO (at the Cornell CESR ring) as well as from CERN's LEP electron-positron collider and the proton-antiproton colliders at CERN and Fermilab. But the most challenging goal of this physics is to explore the mystery of CP violation, so far only seen in neutral kaon decays. This subtle mechanism - a disregard for the combined symmetry of particle antiparticle switching and left-right reflection - possibly moulded the evolution of the Universe after the Big Bang, providing a world dominated by matter, rather than one where matter and antimatter play comparable roles. To fully explore CP violation in the laboratory needs a dedicated machine - a particle 'factory' - to mass produce B mesons. Only when this full picture of CP violation has been revealed will physicists finally be able to solve its mysteries. As well as major proposals in the US and Japan, several ideas have been launched in Europe. Over the years, many working groups have accumulated an impressive amount of data and knowledge on the physics as well as on the machine and detectors. The spearheads of experimental B physics are the ARGUS and CLEO collaborations. Highlights include the determination of the parameters of the (Cabibbo-Kobayashi-Maskawa, CKM) quark mixing matrix, testing the consistency of the Standard Model with six quarks and three leptons, and giving the first indirect hint that the as yet unseen sixth ('top') quark is very heavy, together with initial indications of how it should decay. Valuable complementary information has come from proton-antiproton collider data and particularly from the LEP experiments at the Z resonance. Experiments at

  3. Mass-producing B mesons

    International Nuclear Information System (INIS)

    Aleksan, Roy; Ali, Ahmed


    Since the discovery of the upsilon resonances in 1977 the physics of the fifth quark - beauty - has played a vital role in establishing and consolidating today's Standard Model of particle physics. In recent years, a wealth of data on B particle (containing the beauty quark) has emerged from the detectors ARGUS (at the DORIS ring, DESY, Hamburg) and CLEO (at the Cornell CESR ring) as well as from CERN's LEP electron-positron collider and the proton-antiproton colliders at CERN and Fermilab. But the most challenging goal of this physics is to explore the mystery of CP violation, so far only seen in neutral kaon decays. This subtle mechanism - a disregard for the combined symmetry of particle antiparticle switching and left-right reflection - possibly moulded the evolution of the Universe after the Big Bang, providing a world dominated by matter, rather than one where matter and antimatter play comparable roles. To fully explore CP violation in the laboratory needs a dedicated machine - a particle 'factory' - to mass produce B mesons. Only when this full picture of CP violation has been revealed will physicists finally be able to solve its mysteries. As well as major proposals in the US and Japan, several ideas have been launched in Europe. Over the years, many working groups have accumulated an impressive amount of data and knowledge on the physics as well as on the machine and detectors. The spearheads of experimental B physics are the ARGUS and CLEO collaborations. Highlights include the determination of the parameters of the (Cabibbo-Kobayashi-Maskawa, CKM) quark mixing matrix, testing the consistency of the Standard Model with six quarks and three leptons, and giving the first indirect hint that the as yet unseen sixth ('top') quark is very heavy, together with initial indications of how it should decay. Valuable complementary information has come from proton-antiproton collider data and particularly from the LEP experiments at the

  4. Ramp-up of CHI Initiated Plasmas on NSTX

    International Nuclear Information System (INIS)

    Mueller, D.; Bell, M.G.; Bell, R.E.; LeBlanc, B.; Roquemore, A.L.; Raman, R.; Jarboe, T.R.; Nelson, B.A.; Soukhanovskii, V.


    Experiments on the National Spherical Torus (NSTX) have now demonstrated flux savings using transient coaxial helicity injection (CHI). In these discharges, the discharges initiated by CHI are ramped up with an inductive transformer and exhibit higher plasma current than discharges without the benefit of CHI initiation.

  5. Oscillazioni del mesone D^0

    CERN Document Server

    Schiraldi, Vito; Morello, Michael Joseph

    In fisica delle particelle, con il termine di "oscillazione" si indica la trasformazione di una particella neutra nella sua antiparticella e viceversa, fenomeno dovuto al fatto che gli autostati di flavor non sono autostati della matrice di massa. Il Modello Standard delle interazioni fondamentali predice che l'oscillazione del mesone D^0 avvenga su tempi molto maggiori di una vita media, e appaia perciò come un effetto piccolo, inferiore al percento, in contrasto con il caso dei mesoni B^0 e B^0_s che oscillano con molta maggiore rapidità. Sperimentalmente, l'oscillazione dei mesoni D^0 è rimasta inosservata fino a tempi recenti: la prima evidenza sperimentale dell'esistenza di un effetto di oscillazione è stata ottenuta soltanto nella primavera del 2007 dagli esperimenti BaBar (SLAC, USA) e Belle (KEKB, Japan). Nell'agosto 2007 anche l’esperimento CDF (Fermilab, USA) ha presentato una evidenza simile, basata sull'analisi di una parte del campione di dati disponibile. La tesi descrive gli aspetti speri...

  6. Meson Spectroscopy in the Light Quark Sector (United States)

    De Vita, R.


    Understanding the hadron spectrum is one of the fundamental issues in modern particle physics. We know that existing hadron configurations include baryons, made of three quarks, and mesons, made of quark-antiquark pairs. However most of the mass of the hadrons is not due to the mass of these elementary constituents but to their binding force. Studying the hadron spectrum is therefore a tool to understand one of the fundamental forces in nature, the strong force, and Quantum Chromo Dynamics (QCD), the theory that describes it. This investigation can provide an answer to fundamental questions as what is the origin of the mass of hadrons, what is the origin of quark confinement, what are the relevant degrees of freedom to describe these complex systems and how the transition between the elementary constituents, quarks and gluons, and baryons and mesons occurs. In this field a key tool is given by meson spectroscopy. Mesons, being made by a quark and an anti-quark, are the simplest quark bound system and therefore the ideal benchmark to study the interaction between quarks and understand what the role of gluons is. In this investigation, it is fundamental to precisely determine the spectrum and properties of mesons but also to search for possible unconventional states beyond the qbar q configuration as tetraquarks (qqoverline{qq}), hybrids (qbar qg) and glueballs. These states can be distinguished unambiguously from regular mesons when they have exotic quantum numbers, i.e. combinations of total angular momentum, spin and parity that are not allowed for qbar q states. These are called exotic quantum numbers and the corresponding states are referred to as exotics. The study of the meson spectrum and the search for exotics is among the goals of several experiments in the world that exploit different reaction processes, as e+e- annihilation, pbar p annihilation, pion scattering, proton-proton scattering and photo-production, to produce meson states. This intense effort is

  7. CORNELL: CLEO discovers B meson penguins

    International Nuclear Information System (INIS)



    The CLEO collaboration at Cornell's CESR electron-positron storage ring has discovered a rare type of B meson decay in which only a high energy photon and a K* meson are produced. These decays provide the first unambiguous evidence for an alternative route for heavy quark decay that has been given the whimsical name ''penguin diagram''. In the mid-1970s penguin diagrams were proposed to explain the puzzling strangeness quantum number selection rules in the decay of K mesons. At the same time it was realized that penguin diagrams could also be important in the CP violation seen in neutral K meson decay. CP violation, an asymmetry between matter and antimatter, is an essential ingredient in understanding why there is much more matter than antimatter in the universe. CP violation introduces a definite direction to the arrow of time, which could otherwise point equally forwards or backwards. In addition, penguin decays are very sensitive to some extensions of the Standard Model of weak decay. Although penguin diagrams were first proposed to explain an effect in K meson decay, the K system gives no unique signature for them, and verification of penguin processes meant looking elsewhere. In the Standard Model, quarks decay under the influence of the weak force, emitting a W boson. Since the W is charged, the charge of the initial quark differs from that of the final quark, so the charge of the quark changes as well as its flavour

  8. CORNELL: CLEO discovers B meson penguins

    Energy Technology Data Exchange (ETDEWEB)



    The CLEO collaboration at Cornell's CESR electron-positron storage ring has discovered a rare type of B meson decay in which only a high energy photon and a K* meson are produced. These decays provide the first unambiguous evidence for an alternative route for heavy quark decay that has been given the whimsical name ''penguin diagram''. In the mid-1970s penguin diagrams were proposed to explain the puzzling strangeness quantum number selection rules in the decay of K mesons. At the same time it was realized that penguin diagrams could also be important in the CP violation seen in neutral K meson decay. CP violation, an asymmetry between matter and antimatter, is an essential ingredient in understanding why there is much more matter than antimatter in the universe. CP violation introduces a definite direction to the arrow of time, which could otherwise point equally forwards or backwards. In addition, penguin decays are very sensitive to some extensions of the Standard Model of weak decay. Although penguin diagrams were first proposed to explain an effect in K meson decay, the K system gives no unique signature for them, and verification of penguin processes meant looking elsewhere. In the Standard Model, quarks decay under the influence of the weak force, emitting a W boson. Since the W is charged, the charge of the initial quark differs from that of the final quark, so the charge of the quark changes as well as its flavour.

  9. Rare meson decays into very light neutralinos

    Energy Technology Data Exchange (ETDEWEB)

    Dreiner, H.K.; Grab, S. [Bonn Univ. (Germany). Bethe Center for Theoretical Physics und Physikalisches Inst.; Koschade, D. [RWTH Aachen Univ. (Germany). Inst. fuer Theoretische Physik; London Univ. (United Kingdom). Centre for Reserach in String Theory; Kraemer, M.; O' Leary, B. [RWTH Aachen Univ. (Germany). Inst. fuer Theoretische Physik; Langenfeld, U. [Deutsches Elektronen-Synchrotron (DESY), Zeuthen (Germany)


    We investigate the bounds on the mass of the lightest neutralino from rare meson decays within the MSSM with and without minimal flavor violation. We present explicit formulae for the two-body decays of mesons into light neutralinos and perform the first complete calculation of the loop-induced decays of kaons to pions and light neutralinos and B mesons to kaons and light neutralinos. We find that the supersymmetric branching ratios are strongly suppressed within the MSSM with minimal flavor violation, and that no bounds on the neutralino mass can be inferred from experimental data, i.e. a massless neutralino is allowed. The branching ratios for kaon and B meson decays into light neutralinos may, however, be enhanced when one allows for non-minimal flavor violation. We find new constraints on the MSSM parameter space for such scenarios and discuss prospects for future kaon and B meson experiments. Finally, we comment on the search for light neutralinos in monojet signatures at the Tevatron and at the LHC. (orig.)

  10. Charged track multiplicity in B meson decay

    International Nuclear Information System (INIS)

    Brandenburg, G.; Ershov, A.; Gao, Y. S.; Kim, D. Y.-J.; Wilson, R.; Browder, T. E.; Li, Y.; Rodriguez, J. L.; Yamamoto, H.; Bergfeld, T.


    We have used the CLEO II detector to study the multiplicity of charged particles in the decays of B mesons produced at the Υ(4S) resonance. Using a sample of 1.5x10 6 B meson pairs, we find the mean inclusive charged particle multiplicity to be 10.71±0.02 -0.15 +0.21 for the decay of the pair. This corresponds to a mean multiplicity of 5.36±0.01 -0.08 +0.11 for a single B meson. Using the same data sample, we have also extracted the mean multiplicities in semileptonic and nonleptonic decays. We measure a mean of 7.82±0.05 -0.19 +0.21 charged particles per BB(bar sign) decay when both mesons decay semileptonically. When neither B meson decays semileptonically, we measure a mean charged particle multiplicity of 11.62±0.04 -0.18 +0.24 per BB(bar sign) pair. (c) 2000 The American Physical Society

  11. Radiative transitions in mesons within a non relativistic quark model

    International Nuclear Information System (INIS)

    Bonnaz, R.; Silvestre-Brac, B.; Gignoux, C.


    An exhaustive study of radiative transitions in mesons is performed in a non relativistic quark model. Three different types of mesons wave functions are tested. The effect of some usual approximations is commented. Overall agreement with experimental data is obtained

  12. Static-light meson masses from twisted mass lattice QCD

    International Nuclear Information System (INIS)

    Jansen, Karl; Michael, Chris; Shindler, Andrea; Wagner, Marc


    We compute the static-light meson spectrum using two-flavor Wilson twisted mass lattice QCD. We have considered five different values for the light quark mass corresponding to 300 MeV PS S mesons. (orig.)

  13. Psi Chi/APA Edwin B. Newman Graduate Research Award. (United States)


    The Edwin B. Newman Graduate Research Award is sponsored jointly by Psi Chi, the national honor society in psychology, and the APA. The award is presented annually to the psychology graduate student who submits the best research paper that was published or presented at a national, regional, or state psychological association conference during the past calendar year. The Edwin B. Newman Graduate Research Award is given jointly by Psi Chi and APA. Members of the 2016 Edwin B. Newman Award Committee were Shawn Carlton, PhD, Psi Chi representative; Christina Frederick-Recascino, PhD; John Norcross, PhD, APA representative; Karenna Malavanti, PhD, Psi Chi representative; Steven Kohn, PhD, Psi Chi representative; Warren Fass, PhD, Psi Chi representative; Chris Lovelace, PhD, Psi Chi representative; and Cathy Epkins, PhD, APA representative. (PsycINFO Database Record (c) 2016 APA, all rights reserved).

  14. Temperature-dependent cross sections for meson-meson nonresonant reactions in hadronic matter

    International Nuclear Information System (INIS)

    Zhang Yiping; Xu Xiaoming; Ge Huijun


    We present a potential of which the short-distance part is given by one gluon exchange plus perturbative one- and two-loop corrections and of which the large-distance part exhibits a temperature-dependent constant value. The Schroedinger equation with this temperature-dependent potential yields a temperature dependence of the mesonic quark-antiquark relative-motion wave function and of meson masses. The temperature dependence of the potential, the wave function and the meson masses brings about temperature dependence of cross sections for the nonresonant reactions ππ→ρρ for I=2, KK→K*K* for I=1, KK*→K*K* for I=1, πK→ρK* for I=3/2, πK*→ρK* for I=3/2, ρK→ρK* for I=3/2 and πK*→ρK for I=3/2. As the temperature increases, the rise or fall of peak cross sections is determined by the increased radii of initial mesons, the loosened bound states of final mesons, and the total-mass difference of the initial and final mesons. The temperature-dependent cross sections and meson masses are parametrized.

  15. Negative meson capture in hydrogen

    International Nuclear Information System (INIS)

    Baird, T.J.


    The processes of deexcitation and capture of negative mesons and hadrons in atomic hydrogen are investigated. Only slow collisions in which the projectile-atom relative velocity is less than one atomic unit are considered, and the motion of the incident particle is treated classically. For each classical trajectory the probability of ionizing the hydrogen atom is determined, together with the energy spectrum of the emitted electron. Ionization probabilities are calculated using the time-dependent formulation of the perturbed stationary state method. Exact two-center electronic wave functions are used for both bound and continuum states. The total ionization cross section and electron energy spectrum have been calculated for negative muons, kaons and antiprotons at incident relative velocities between 0.04 and 1.0 atomic units. The electron energy spectrum has a sharp peak for electron kinetic energies on the order of 10 -3 Rydbergs. The ionization process thus favors the emission of very slow electrons. The cross section for ionization with capture of the incident particle was calculated for relative kinetic energies greater than 1.0 Rydberg. Since ionization was found to occur with the emission of electrons of nearly zero kinetic energy, the fraction of ionizing collisions which result in capture decreases very rapidly with projectile kinetic energy. The energy distributions of slowed down muons and hadrons were also computed. These distributions were used together with the capture cross section to determine the distribution of kinetic energies at which capture takes place. It was found that most captures occur for kinetic energies slightly less than 1.0 Rydbergs with relatively little capture at thermal energies. The captured particles therefore tend to go into very large and loosely found orbits with binding energies less than 0.1 Rydbergs

  16. Vector mesons on the light front

    International Nuclear Information System (INIS)

    Naito, K.; Maedan, S.; Itakura, K.


    We apply the light-front quantization to the Nambu-Jona-Lasinio model with the vector interaction, and compute vector meson's mass and light-cone wavefunction in the large N limit. Following the same procedure as in the previous analyses for scalar and pseudo-scalar mesons, we derive the bound-state equations of a qq-bar system in the vector channel. We include the lowest order effects of the vector interaction. The resulting transverse and longitudinal components of the bound-state equation look different from each other. But eventually after imposing an appropriate cutoff, one finds these two are identical, giving the same mass and the same (spin-independent) light-cone wavefunction. Mass of the vector meson decreases as one increases the strength of the vector interaction

  17. Meson spectral functions at finite temperature

    International Nuclear Information System (INIS)

    Wetzorke, I.; Karsch, F.; Laermann, E.; Petreczky, P.; Stickan, S.


    The Maximum Entropy Method provides a Bayesian approach to reconstruct the spectral functions from discrete points in Euclidean time. The applicability of the approach at finite temperature is probed with the thermal meson correlation function. Furthermore the influence of fuzzing/smearing techniques on the spectral shape is investigated. We present first results for meson spectral functions at several temperatures below and above T c . The correlation functions were obtained from quenched calculations with Clover fermions on large isotropic lattices of the size (24 - 64) 3 x 16. We compare the resulting pole masses with the ones obtained from standard 2-exponential fits of spatial and temporal correlation functions at finite temperature and in the vacuum. The deviation of the meson spectral functions from free spectral functions is examined above the critical temperature. (orig.)

  18. Meson spectral functions at finite temperature

    International Nuclear Information System (INIS)

    Wetzorke, I.; Karsch, F.; Laermann, E.; Petreczky, P.; Stickan, S.


    The Maximum Entropy Method provides a Bayesian approach to reconstruct the spectral functions from discrete points in Euclidean time. The applicability of the approach at finite temperature is probed with the thermal meson correlation function. Furthermore the influence of fuzzing/smearing techniques on the spectral shape is investigated. We present first results for meson spectral functions at several temperatures below and above T c . The correlation functions were obtained from quenched calculations with Clover fermions on large isotropic lattices of the size (24 - 64) 3 x 16. We compare the resulting pole masses with the ones obtained from standard 2-exponential fits of spatial and temporal correlation functions at finite temperature and in the vacuum. The deviation of the meson spectral functions from free spectral functions is examined above the critical temperature

  19. Semileptonic decays of the Bc meson

    International Nuclear Information System (INIS)

    Barik, N.; Naimuddin, Sk.; Dash, P. C.; Kar, Susmita


    We study the semileptonic transitions B c →η c ,J/Ψ,D,D*,B,B*,B s ,B s * in the leading order in the framework of a relativistic independent quark model based on a confining potential in the equally mixed scalar-vector harmonic form. We compute relevant weak form factors as overlap integrals of the meson-wave functions obtained in the relativistic independent quark model in the whole accessible kinematical range. We predict that the semileptonic transitions of the B c meson are mostly dominated by two Cabibbo-Kobayashi-Maskawa (CKM)-favored modes, B c →B s (B s *)eν, contributing about 77% of the total decay width, and its decays to vector meson final states take place in the predominantly transverse mode. Our predicted values for the total decay rates, branching ratios, polarization ratios, the forward-backward asymmetry factor, etc., are broadly in agreement with other model predictions.

  20. The vector meson with anomalous magnetic moment

    International Nuclear Information System (INIS)

    Boyarkin, O.M.


    The possibility of introducing an anomalous magnetic moment into the Stuckelberg version of the charged vector meson theory is considered. It is shown that the interference of states with spins equal to one and zero is absent in the presence of an anomalous magnetic moment of a particle. The differential cross section of scattering on the Coulomb field of a nucleus is calculated, and so are the differential and integral cross sections of meson pair production on annihilation of two gamma quanta. The two-photon mechanism of production of a meson pair in colliding electron-positron beams is considered. It is shown that with any value of the anomalous magnetic moment the cross section of the esup(+)esup(-) → esup(+)esup(-)γsup(*)γsup(*) → esup(+)esup(-)Wsup(+)Wsup(-) reaction exceeds that of the esup(+)esup(-) → γsup(*) → Wsup(+)Wsup(-) at sufficiently high energies

  1. Meson spectral functions at finite temperature

    Energy Technology Data Exchange (ETDEWEB)

    Wetzorke, I.; Karsch, F.; Laermann, E.; Petreczky, P.; Stickan, S


    The Maximum Entropy Method provides a Bayesian approach to reconstruct the spectral functions from discrete points in Euclidean time. The applicability of the approach at finite temperature is probed with the thermal meson correlation function. Furthermore the influence of fuzzing/smearing techniques on the spectral shape is investigated. We present first results for meson spectral functions at several temperatures below and above T{sub c}. The correlation functions were obtained from quenched calculations with Clover fermions on large isotropic lattices of the size (24 - 64){sup 3} x 16. We compare the resulting pole masses with the ones obtained from standard 2-exponential fits of spatial and temporal correlation functions at finite temperature and in the vacuum. The deviation of the meson spectral functions from free spectral functions is examined above the critical temperature.

  2. Meson spectral functions at finite temperature

    Energy Technology Data Exchange (ETDEWEB)

    Wetzorke, I.; Karsch, F.; Laermann, E.; Petreczky, P.; Stickan, S. [Bielefeld Univ. (Germany). Fakultaet fuer Physik


    The Maximum Entropy Method provides a Bayesian approach to reconstruct the spectral functions from discrete points in Euclidean time. The applicability of the approach at finite temperature is probed with the thermal meson correlation function. Furthermore the influence of fuzzing/smearing techniques on the spectral shape is investigated. We present first results for meson spectral functions at several temperatures below and above T{sub c}. The correlation functions were obtained from quenched calculations with Clover fermions on large isotropic lattices of the size (24 - 64){sup 3} x 16. We compare the resulting pole masses with the ones obtained from standard 2-exponential fits of spatial and temporal correlation functions at finite temperature and in the vacuum. The deviation of the meson spectral functions from free spectral functions is examined above the critical temperature. (orig.)

  3. C(1480) meson and electromagnetic processes

    International Nuclear Information System (INIS)

    Landsberg, L.G.


    Possible processes of production of the vector meson C(1480) → var-phi π, a candidate for exotic states, in electromagnetic processes are considered [photoproduction, e + e - →C(1480) → var-phi π 0 , and the reaction of production of C(1480) in the Coulomb field of a nucleus]. It is shown that coherent Coulomb production of the C(1480) meson allows one to determine the absolute value of BR[C(1480) → var-phi π], which is essential for the interpretation of the nature of this hadron. Possibilities of observing C(1480) mesons in e + e - collisions at the var-phi factory DAΦNE are studied. 27 refs., 12 figs., 1 tab

  4. Photoproduction of scalar mesons at medium energies

    Energy Technology Data Exchange (ETDEWEB)

    Da Silva, M. L. [Instituto de Fisica e Matematica, Universidade Federal de Pelotas, Caixa Postal 354, CEP 96010-090, Pelotas, RS (Brazil); Machado, M. V. [High Energy Physics Phenomenology Group, GFPAE IF-UFRGS, Caixa Postal 15051, CEP 91501-970, Porto Alegre, RS (Brazil)


    In this work we will focus on photoproduction of mesons states a{sub 0}(980), f{sub 0}(1500) and f{sub 0}(1710). The f{sub 0}(1500) and f{sub 0}(1710) mesons will be considered in distinct mixing possibilities and assuming that a{sub 0}(980) is member of the ground-state nonet. The theoretical formalism is the Regge approach with reggeized {rho} and {omega} exchange. The differential and integrated total cross section are computed for the cases of the mesons a{sub 0}(980), f{sub 0}(1500) and f{sub 0}(1710) focusing the GlueX energy regime with photon energy E = 9 GeV.

  5. From meson-baryon scattering to meson photoproduction

    Energy Technology Data Exchange (ETDEWEB)

    Mai, Maxim


    In the present work we investigate the properties of the lowest baryon resonances. The starting point of our analyses is the low-energy effective theory of quantum chromodynamics, called chiral perturbation theory. As such it describes the long-range observables in terms of the low-energy effects, while the high-energy effects are subsumed in the so-called low-energy constants. In the region of the aforesaid lowest baryon resonances any strict perturbative expansion fails and some resummation scheme is required. For this we employ the Bethe-Salpeter equation (BSE) which guarantees the exact unitarity of the S-matrix and allows to generate resonances dynamically, however, abandoning some other basic principles of quantum field theory as described in chapter 2. Restricting the driving term of this equation to local terms of the second chiral order, we derive an exact solution of the BSE for meson-baryon scattering in chapter 2. Without putting the interaction kernel on shell we preserve the exact correspondence of this solution to an infinite chain of Feynman diagrams. In chapter 4 we apply this ansatz for antikaon-nucleon scattering, trying to get a new insight into the nature of the subthreshold resonance, i.e. {Lambda}(1405). The properties of this resonance have been debated for decades and in recent years it has again attracted a lot of attention by theoreticians since this resonance can be dynamically generated from the so-called chiral unitary approaches. Moreover, the recent measurement of the energy shift and width of kaonic hydrogen in the SIDDHARTA experiment at DA{Phi}NE has provided a very tight constraint on K{sup -}p scattering length. Typically, these approaches predict a two pole structure of {Lambda}(1405), but the question is how precise one can determine the position of these poles relying on data at and above the anti KN threshold. Moreover, we apply our framework for the analysis of pion-nucleon scattering in chapter 3. There we show that the

  6. Production and decay rates of the iota meson

    International Nuclear Information System (INIS)

    Frank, M.; O'Donnell, P.J.; Toronto Univ., Ontario


    We correlate the results for the mass spectrum of low lying isoscalar-pseudoscalar mesons with the production decay rates from J/psi->γP, with P=eta 1 , eta' 1 , eta 2 and iota and study the radiative decays of the iota meson. We conclude that the iota meson has to be interpreted as having a strong gluonium component. (orig.)

  7. Further evidence for magnetic charge from meson spectroscopy

    International Nuclear Information System (INIS)

    Akers, D.


    Recently evidence was presented for the existence of magnetic charge from Zeeman splitting in meson states. The model by Akers predicted the existence of a new eta meson at 1814 MeV with I/sup G/ (J/sup PC/) = O + (O -+ ). Experimental evidence for this new meson is cited and discussed

  8. Is a charmed axial-vector meson already found

    International Nuclear Information System (INIS)

    Matsuda, S.


    A calculation is presented of the production rate via e + e - annihilation for a charmed p-wave meson of Jsup(P) = 1 + , based on a non-relativistic quark model of charmed hadrons. The results strongly suggest that the charmed axial-vector meson should be found copiously in association with a ground-state charmed meson. (author)

  9. On some rare weak decays of vector mesons

    International Nuclear Information System (INIS)

    Kurdadze, L.M.; Silagadze, Z.K.


    Some semileptonic weak decays of vector mesons are considered in the framework of the most popular quark models. Two the most popular models go give more elaborated estimates for the vector meson semileptonic decay rates are used. Unfortunately the predicted branching ratios are too small to make a study of these decays realistic at meson factories under construction [ru

  10. Semileptonic decays of B mesons into excited charm mesons: leading order and 1/mc contributions

    International Nuclear Information System (INIS)

    Mannel, T.


    We use the heavy quark effective theory to investigate the form factors that describe the semileptonic decays of a B meson into excited daughter mesons. For an excited daughter meson with charm, a single form factor is needed at leading order, while five form factors and two dimensionful constants are needed to order 1/m c in the heavy quark expansion. For non-charmed final states, a total of four form factors are needed at leading order. For the process B→D(*)Xlν, four form factors are also needed at leading order. (orig.)

  11. Nonleptonic B decays involving tensor mesons

    Energy Technology Data Exchange (ETDEWEB)

    Lopez Castro, G. [Departamento de Fisica, Cinvestav del IPN, Apdo. Postal 14-740, 07000 Mexico, D.F. (Mexico); Munoz, J.H. [Departamento de Fisica, Cinvestav del IPN, Apdo. Postal 14-740, 07000 Mexico, D.F. (Mexico)]|[Departamento de Fisica, Universidad del Tolima, A.A. 546, Ibague (Colombia)


    Two-body nonleptonic decays of B mesons into PT and VT modes are calculated using the nonrelativistic quark model of Isgur {ital et al.} The predictions obtained for B{r_arrow}{pi}D{sub 2}{sup {asterisk}},{rho}D{sub 2}{sup {asterisk}} are a factor of 3{endash}5 below present experimental upper limits. Interesting patterns are obtained for ratios of B decays involving mesons with different spin excitations and their relevance for additional tests of forms factor models are briefly discussed. {copyright} {ital 1997} {ital The American Physical Society}

  12. Covariant, chirally symmetric, confining model of mesons

    International Nuclear Information System (INIS)

    Gross, F.; Milana, J.


    We introduce a new model of mesons as quark-antiquark bound states. The model is covariant, confining, and chirally symmetric. Our equations give an analytic solution for a zero-mass pseudoscalar bound state in the case of exact chiral symmetry, and also reduce to the familiar, highly successful nonrelativistic linear potential models in the limit of heavy-quark mass and lightly bound systems. In this fashion we are constructing a unified description of all the mesons from the π through the Υ. Numerical solutions for other cases are also presented

  13. Perturbative QCD effects in heavy meson decays

    International Nuclear Information System (INIS)

    Szezepaniak, A.; Henley, E.M.


    The amplitude for the exclusive nonleptonic decay of a heavy meson into two light pseudoscalar mesons is analyzed using the factorization formalism of perturbative QCD for exclusive reactions at large momentum transfer. We calculate the form factor b → u transition and compare it to the old quark model calculation and the new one based on the light cone formulation of the full quark model wave function. The new results we obtain are smaller by a factor of 2 - 3 as compared to the old value. (orig.)

  14. Hard production of exotic hybrid mesons

    Energy Technology Data Exchange (ETDEWEB)

    Anikin, I.; Teryaev, O.V. [Bogoliubov Lab. of Theoretical Physics, JINR, Dubna (Russian Federation); Pire, B.; Anikin, I. [Ecole Polytechnique, CPHT, 91 - Palaiseau (France); Szymanowski, I. [Soltan Institute for Nuclear Studies, Warsaw (Poland); Liege Univ. (Belgium); Anikin, I.; Wallon, S. [Paris-11 Univ., Lab. de Physique Theorique, 91 - Orsay (France)


    Exotic hybrid mesons H, with quantum numbers J{sup PC} = 1{sup -+} may be copiously produced in the hard exclusive processes {gamma}{sup *}(Q{sup 2}){gamma} {yields} H and {gamma}{sup *}(Q{sup 2})P(p) {yields} HP(p') because they have a leading twist distribution amplitude with a sizable coupling constant f{sub H}, which may be estimated through QCD sum rules. The reaction rates scale in the same way as the corresponding rates for usual mesons. (authors)

  15. On meson resonances and chiral symmetry

    International Nuclear Information System (INIS)

    Lutz, M.F.M.


    We study meson resonances with quantum numbers J P = 1 + in terms of the chiral SU(3) Lagrangian. At leading order a parameter-free prediction is obtained for the scattering of Goldstone bosons off vector mesons with J P = 1 - once we insist on approximate crossing symmetry of the unitarized scattering amplitude. A resonance spectrum arises that is remarkably close to the empirical pattern. In particular, we find that the strangeness-zero resonances h 1 (1380), f 1 (1285) and b 1 (1235) are formed due to strong K anti K μ and K K μ channels. This leads to large coupling constants of those resonances to the latter states. (orig.)

  16. Isospin-violating mixing in meson nonets

    International Nuclear Information System (INIS)

    Isgur, N.


    Segregation into ideally mixed nonets results when the OZI-violating interaction which would mix u anti u, d anti d, and s anti s mesons into isospin and SU(3) eigenstates is much weaker than the s anti s-d anti d mass difference. We show that the d anti d-u anti u mass difference can begin to induce a similar segregation into d anti d and anti u mesons which leads to large isospin violations. An experimental example of such large isospin breaking (approx. 30%) which we predict has probably already been seen in f → K anti K. (orig.)

  17. Dipole moments of the rho meson

    International Nuclear Information System (INIS)

    Hecht, M.B.; McKellar, B.H.P.


    The electric and magnetic dipole moments (EDM) of the rho meson are calculated using the propagators and vertices derived from the quantum chromodynamics Dyson-Schwinger equations. Results obtained from using the Bethe-Salpeter amplitude studied by Chappell, Mitchell et. al., and Pichowsky and Lee, are compared. The rho meson EDM is generated through the inclusion of a quark electric dipole moment, which is left as a free variable. These results are compared to the perturbative results to obtain a measure of the effects of quark interactions and confinement. The two dipole moments are also calculated using the phenomenological MIT bag model to provide a further basis for comparison

  18. Meson wave functions in 2-dim QCD

    International Nuclear Information System (INIS)

    Hildebrandt, S.; Visnjic, V.


    We consider the eigenvalue problem of 't Hooft for the meson spectrum in 2-dim QCD by defining some alternative formulations whose equivalence we prove. Hence we are able to prove that the spectrum is discrete and of finite multiplicity and to derive bounds (upper and lower) for the eigenvalues (ground state, with state and n → infinitely state). We prove that the functions are analytic and use this to carry out explicit numerical calculations of the wave functions for various values of the quark masses and to recalculate the meson spectrum. (orig.) [de

  19. Quarkonium Contribution to Meson Molecules

    Energy Technology Data Exchange (ETDEWEB)

    Cincioglu, E.; Yilmazer, A.U. [Ankara University, Department of Physics Engineering, Ankara (Turkey); Nieves, J. [Instituto de Fisica Corpuscular (IFIC) Centro Mixto CSIC-Universidad de Valencia, Institutos de Investigacion de Paterna, Valencia (Spain); Ozpineci, A. [Middle East Technical University, Department of Physics, Ankara (Turkey)


    Starting from a molecular picture for the X(3872) resonance, this state and its J{sup PC} = 2{sup ++} heavy-quark spin symmetry partner [X{sub 2}(4012)] are analyzed within a model which incorporates possible mixings with 2P charmonium (c anti c) states. Since it is reasonable to expect the bare χ{sub c1}(2P) to be located above the D anti D{sup *} threshold, but relatively close to it, the presence of the charmonium state provides an effective attraction that will contribute to binding the X(3872), but it will not appear in the 2{sup ++} sector. Indeed in the latter sector, the χ{sub c2}(2P) should provide an effective small repulsion, because it is placed well below the D{sup *} anti D{sup *} threshold. We show how the 1{sup ++} and 2{sup ++} bare charmonium poles are modified due to the D{sup (*)} anti D{sup (*)} loop effects, and the first one is moved to the complex plane. The meson loops produce, besides some shifts in the masses of the charmonia, a finite width for the 1{sup ++} dressed charmonium state. On the other hand, X(3872) and X{sub 2}(4012) start developing some charmonium content, which is estimated by means of the compositeness Weinberg sum rule. It turns out that in the heavy-quark limit, there is only one coupling between the 2P charmonia and the D{sup (*)} anti D{sup (*)} pairs. We also show that, for reasonable values of this coupling, leading to X(3872) molecular probabilities of around 70-90 %, the X{sub 2} resonance destabilizes and disappears from the spectrum, becoming either a virtual state or one being located deep into the complex plane, with decreasing influence in the D{sup *} anti D{sup *} scattering line. Moreover, we also discuss how around 10-30 % charmonium probability in the X(3872) might explain the ratio of radiative decays of this resonance into ψ(2S)γ and J/ψγ. Finally, we qualitatively discuss within this scheme, the hidden bottom flavor sector, paying a special attention to the implications for the X{sub b} and X

  20. Issues in light meson spectroscopy: The case for meson spectroscopy at CEBAF

    Energy Technology Data Exchange (ETDEWEB)

    Godfrey, S. [Carleton Univ., Ottawa (Canada)


    The author reviews some outstanding issues in meson spectroscopy. The most important qualitative issue is whether hadrons with explicit gluonic degrees of freedom exist. To answer this question requires a much better understanding of conventional q{bar q} mesons. The author therefore begins by examining the status of conventional meson spectroscopy and how the situation can be improved. The expected properties of gluonic excitations are discussed with particular emphasis on hybrids to give guidance to experimental searches. Multiquark systems are commented upon as they are likely to be important in the mass region under study and will have to be understood better. In the final section the author discusses the opportunities that CEBAF can offer for the study of meson spectroscopy.

  1. Radiative decays of vector mesons in the chiral bag model

    International Nuclear Information System (INIS)

    Tabachenko, A.N.


    A new model of radiative π-meson decays of vector mesons in the chiral bag model is proposed. The quark-π-meson interaction has the form of a pseudoscalar coupling and is located on the bag surface. The vector meson decay width depends on the quark masses, the π-meson decay constant, the radius of the bag, and the free parameter Z 2 , which specifies the disappearance of the bag during the decay. The obtained results for the omega- and p-decay widths are in satisfactory agreement with the experiment

  2. Meson exchange corrections in deep inelastic scattering on deuteron

    International Nuclear Information System (INIS)

    Kaptari, L.P.; Titov, A.I.


    Starting with the general equations of motion of the nucleons interacting with the mesons the one-particle Schroedinger-like equation for the nucleon wave function and the deep inelastic scattering amplitude with the meson-exchange currents are obtained. Effective pion-, sigma-, and omega-meson exchanges are considered. It is found that the mesonic corrections only partially (about 60%) restore the energy sum rule breaking because of the nucleon off-mass-shell effects in nuclei. This results contradicts with the prediction based on the calculation of the energy sum rule limited by the second order of the nucleon-meson vertex and static approximation. 17 refs.; 3 figs

  3. Role of vector mesons in pion electroproduction

    International Nuclear Information System (INIS)

    Uleshchenko, V.V.


    The talk is concerned with mechanisms of pion production in deeply inelastic scattering related to the interaction of virtual photon with the nucleon via an intermediate vector-meson state of the probe. A clear evidence of these mechanisms in the HERMES experimental data is revealed

  4. Scattering of vector mesons off nucleons

    International Nuclear Information System (INIS)

    Lutz, M.F.M.; Friman, B.; Wolf, G.


    We construct a relativistic and unitary approach to 'high' energy pion- and photon-nucleon reactions taking the πN, πΔ, ρN, ωN, ηN, K Λ, KΣ final states into account. Our scheme dynamically generates the s- and d-wave nucleon resonances N(1535), N(1650) and N(1520) and isobar resonances Δ(1620) and δ(1700) in terms of quasi-local interaction vertices. The description of photon-induced processes is based on a generalized vector-meson dominance assumption which directly relates the electromagnetic quasi-local 4-point interaction vertices to the corresponding vertices involving the ρ and ω fields. We obtain a satisfactory description of the elastic and inelastic pion- and photon-nucleon scattering data in the channels considered. The resulting s-wave ρ- and ω-nucleon scattering amplitudes are presented. Using these amplitudes we compute the leading density modification of the ρ and ω mass distributions in nuclear matter. We find a repulsive mass shift for the ω meson at small nuclear density but predict considerable strength in resonance-hole like ω-meson modes. Compared to previous calculations our result for the ρ-meson spectral function shows a significantly smaller in-medium effect. This reflects a not too large coupling strength of the N(1520) resonance to the ρN channel. (orig.)

  5. meson properties and its leptonic radiative decays

    Indian Academy of Sciences (India)

    Now there is no one who doubt the color-singlet mechanism for double heavy meson production. Whereas the so-called color-octet mechanism still need to be tested, although it has been proposed for years and obtained a few experimental supports. Besides the reasons mentioned here precisely, the first observation of the ...

  6. Vector mesons in strongly interacting matter

    Indian Academy of Sciences (India)

    E-mail: Abstract. .... constraints on hadronic spectral functions but cannot predict their detailed shape. Hadronic ..... nuclear medium, despite a cut on low momentum ω-mesons: pω ≤ 500 MeV/c. A.

  7. Charmonium meson and hybrid radiative transitions

    Energy Technology Data Exchange (ETDEWEB)

    Guo, Peng [Indiana U., JLAB; Yépez-Martínez, Tochtli [Indiana U.; Szczepaniak, Adam P. [Indiana U., JLAB


    We consider the non-relativistic limit of the QCD Hamiltonian in the Coulomb gauge, to describe radiative transitions between conventional charmonium states and from the lowest multiplet of cc¯ hybrids to charmonium mesons. The results are compared to potential quark models and lattices calculations.

  8. Skyrmions and vector mesons: a symmetric approach

    International Nuclear Information System (INIS)

    Caldi, D.G.


    We propose an extension of the effective, low-energy chiral Lagrangian known as the Skyrme model, to one formulated by a non-linear sigma model generalized to include vector mesons in a symmetric way. The model is based on chiral SU(6) x SU(6) symmetry spontaneously broken to static SU(6). The rho and other vector mesons are dormant Goldstone bosons since they are in the same SU(6) multiplet as the pion and other pseudoscalars. Hence the manifold of our generalized non-linear sigma model is the coset space (SU(6) x SU(6))/Su(6). Relativistic effects, via a spin-dependent mass term, break the static SU(6) and give the vectors a mass. The model can then be fully relativistic and covariant. The lowest-lying Skyrmion in this model is the whole baryonic 56-plet, which splits into the octet and decuplet in the presence of relativistic SU(6)-breaking. Due to the built-in SU(6) and the presence of vector mesons, the model is expected to have better phenomenological results, as well as providing a conceptually more unified picture of mesons and baryons. 29 references

  9. QED effects in the pseudoscalar meson sector

    Energy Technology Data Exchange (ETDEWEB)

    Horsley, R. [School of Physics and Astronomy, University of Edinburgh, Peter Guthrie Tait Road, Edinburgh, EH9 3FD (United Kingdom); Nakamura, Y. [RIKEN Advanced Institute for Computational Science, Kobe, Hyogo, 650-0047 (Japan); Perlt, H. [Institut für Theoretische Physik, Universität Leipzig, Brüderstrasse 16, Leipzig, 04109 (Germany); Pleiter, D. [Jülich Supercomputer Centre, Forschungszentrum Jülich, Jülich, 52425 (Germany); Institut für Theoretische Physik, Universität Regensburg, Regensburg, 93040 (Germany); Rakow, P.E.L. [Theoretical Physics Division, Department of Mathematical Sciences, University of Liverpool, Peach Street , Liverpool, L69 3BX (United Kingdom); Schierholz, G. [Deutsches Elektronen-Synchrotron DESY, Hamburg, 22603 (Germany); Schiller, A. [Institut für Theoretische Physik, Universität Leipzig, Brüderstrasse 16, Leipzig, 04109 (Germany); Stokes, R. [CSSM, Department of Physics, University of Adelaide, Adelaide, SA, 5005 (Australia); Stüben, H. [Regionales Rechenzentrum, Universität Hamburg, Hamburg, 20146 (Germany); Young, R.D.; Zanotti, J.M. [CSSM, Department of Physics, University of Adelaide, Adelaide, SA, 5005 (Australia); Collaboration: the QCDSF and UKQCD collaboration


    In this paper we present results on the pseudoscalar meson masses from a fully dynamical simulation of QCD+QED, concentrating particularly on violations of isospin symmetry. We calculate the π{sup +}–π{sup 0} splitting and also look at other isospin violating mass differences. We have presented results for these isospin splittings in In this paper we give more details of the techniques employed, discussing in particular the question of how much of the symmetry violation is due to QCD, arising from the different masses of the u and d quarks, and how much is due to QED, arising from the different charges of the quarks. This decomposition is not unique, it depends on the renormalisation scheme and scale. We suggest a renormalisation scheme in which Dashen’s theorem for neutral mesons holds, so that the electromagnetic self-energies of the neutral mesons are zero, and discuss how the self-energies change when we transform to a scheme such as (MS)-bar , in which Dashen’s theorem for neutral mesons is violated.

  10. Decay of the Ds-meson

    International Nuclear Information System (INIS)

    Duong Van Phi; Duong Anh Duc


    The decay channels of the D s -meson are deduced from a Selection Rule and a Lagrangian, formed on L*O(4) group invariance and on principle of minimal structure. A comparison of the results with experimental data is made. (author). 4 refs

  11. Composite vector mesons and string models

    International Nuclear Information System (INIS)

    Mandelstam, S.


    The author discusses the general question of gauge mesons in extended supergravities, and whether such theories can produce the gauge mesons corresponding to a group at least as large as SU(3) x SU(2) x U(1). An exciting conjecture in this direction was made a few years ago by previous authors, who suggested that there might be composite SU(8) gauge mesons in a supergravity model known as the N=8 model. Until we have a consistent, renormalizable theory of supergravity we cannot really obtain any indication of the truth or falseness of that conjecture. One form of the Neveu-Schwarz string model has been shown to be a theory of supergravity; it is finite at the one-loop level and probably in any order of perturbation theory. The discussion is within the framework of this model. The author questions whether massive vector mesons can possibly lose their mass due to interactions. Arguments have been given on both sides of this question, and the author believes that this can occur under certain circumstances. Our conclusions is that the FNNS mechanism will create a gauge symmetry in addition to the rigid symmetry

  12. Atomic capture of negative mesons in hydrogen

    International Nuclear Information System (INIS)

    Leon, M.


    After a brief description of the present state of theoretical understanding of atomic capture of negative mesons, a very simple model calculation of negative muon capture by the simplest atoms, hydrogen is described. Also the possibility of generalizing these results to more complicated atoms and even molecules is noted. 15 references

  13. Anomalies in radiation decays of charmed mesons

    International Nuclear Information System (INIS)

    Kalinovskij, Yu.L.; Pervushin, V.N.; Sarikov, N.A.


    The amplitudes of the charmed meson decays D→0 - +0 - +γ and F→0 - +0 - +γ are calculated in the framework of the SU(4)xSU(4)-chiral Lagrangians with account for anomalies. It is shown that in this approach no E1-transition exists

  14. Mesons in the Eguchi Kawai model

    International Nuclear Information System (INIS)

    Haan, O.


    Fermions in the fundamental representation of the SU(N) gauge group are incorporated into the Eguchi Kawai reduction scheme. The proof for the equivalence of reduced and extended theories is given. This equivalence can be used, to calculate chiral condensate and meson propagators from the fermion matrix of a partially reduced TEK model. (orig.)

  15. On hadronic production of the Bc meson

    International Nuclear Information System (INIS)

    Chang Chaohsi; Chen Yuqi; Han Guoping; Jiang Hongtao


    Various approaches to the hadronic productions of the double heavy meson B c are investigated in this paper. The resultant cross sections obtained by the approaches are compared with in several aspects. One may see that the differences are quite substantial. The advantages and shortcomings of the approaches are discussed. (author). 17 refs, 4 figs

  16. Mesonic spectroscopy of Minimal Walking Technicolor

    DEFF Research Database (Denmark)

    Del Debbio, Luigi; Lucini, Biagio; Patella, Agostino


    We investigate the structure and the novel emerging features of the mesonic non-singlet spectrum of the Minimal Walking Technicolor (MWT) theory. Precision measurements in the nonsinglet pseudoscalar and vector channels are compared to the expectations for an IR-conformal field theory and a QCD...

  17. Vector mesons in strongly interacting matter

    Indian Academy of Sciences (India)

    Results on the light vector mesons ρ, , and , are summarized and compared. Almost all experiments report a softening of the spectral functions with increases in width depending on the density and temperature of the hadronic environment. No evidence for mass shifts is found in majority of the experiments. Remaining ...

  18. Versatile secondary beam for the meson area

    International Nuclear Information System (INIS)

    Kirk, T.


    A new secondary beam design is outlined for the Meson M6 Beamline that combines versatility with economy. The beamline described will transport charged particles of either sign to 800 GeV/c and bring the beam to a focus in one of three potential experimental areas. The plan makes maximal use of existing civil construction

  19. Relativistic meson spectroscopy in momentum space

    International Nuclear Information System (INIS)

    Hersbach, H.


    In this paper a relativistic constituent-quark model based on the Ruijgrok--de Groot formalism is presented. The quark model is not defined in configuration space, but in momentum space. The complete meson spectrum, with the exception of the self-conjugate light unflavored mesons, is calculated. The potential used consists of a one-gluon exchange (OGE) part and a confining part. For the confining part a relativistic generalization of the linear plus constant potential was used, which is well defined in momentum space without introducing any singularities. For the OGE part several potentials were investigated. Retardations were included at all places. By the use of a fitting procedure involving 52 well-established mesons, but results were obtained for a potential consisting of a purely vector Richardson potential and a purely scalar confining potential. Reasonable results were also obtained for a modified Richardson potential. Most meson masses, with the exception of the π, the K, and the K 0 * , were found to be quite well described by the model

  20. Meson degrees of freedom in nuclei

    International Nuclear Information System (INIS)

    Delorme, J.


    A review is presented of the successes and shortcomings of the theory of meson degrees of freedom in nuclei with special emphasis on recent progress and on the necessity to bridge the gap with the degrees of freedom of QCD theory. (orig.)

  1. New physics effects from meson decays

    Indian Academy of Sciences (India)

    Abstract. In this talk, we point out some of the present and future possible signatures of physics beyond the Standard Model from -meson decays, taking -parity conserving and violating supersymmetry as illustrative examples. An expanded version is available on hep-ph archive.

  2. Asymptotics of Heavy-Meson Form Factors

    CERN Document Server

    Grozin, A.G.; Grozin, Andrey G.; Neubert, Matthias


    Using methods developed for hard exclusive QCD processes, we calculate the asymptotic behaviour of heavy-meson form factors at large recoil. It is determined by the leading- and subleading-twist meson wave functions. For $1\\ll |v\\cdot v'|\\ll m_Q/\\Lambda$, the form factors are dominated by the Isgur--Wise function, which is determined by the interference between the wave functions of leading and subleading twist. At $|v\\cdot v'|\\gg m_Q/\\Lambda$, they are dominated by two functions arising at order $1/m_Q$ in the heavy-quark expansion, which are determined by the leading-twist wave function alone. The sum of these contributions describes the form factors in the whole region $|v\\cdot v'|\\gg 1$. As a consequence, there is an exact zero in the form factor for the scattering of longitudinally polarized $B^*$ mesons at some value $v\\cdot v'\\sim m_b/\\Lambda$, and an approximate zero in the form factor of $B$ mesons in the timelike region ($v\\cdot v'\\sim -m_b/\\Lambda$). We obtain the evolution equations and sum rules ...

  3. S-wave spectroscopy and Hyperne splitting of Bc meson

    International Nuclear Information System (INIS)

    Shah, Manan; Bhavsar, Tanvi; Vinodkumar, P.C.


    B c meson is the only heavy meson with two open flavours. This system is also interesting because they cannot annihilate into gluons. The mass spectra and hyperfine splitting of the B c meson are investigated in the Dirac framework with the help of linear + constant potential. The spin-spin interactions are also included in the calculation of the pseudoscalar and vector meson masses. Our computed result for the B c meson are in very good agreement with experimental results as well as other available theoretical result. Decay properties are also interesting because it is expected that decay of B c meson occur in to neutral meson. We hope our theoretical results are helpful for future experimental observations

  4. Tai chi chuan in medicine and health promotion. (United States)

    Lan, Ching; Chen, Ssu-Yuan; Lai, Jin-Shin; Wong, Alice May-Kuen


    Tai Chi Chuan (Tai Chi) is a Chinese traditional mind-body exercise and recently, it becomes popular worldwide. During the practice of Tai Chi, deep diaphragmatic breathing is integrated into body motions to achieve a harmonious balance between body and mind and to facilitate the flow of internal energy (Qi). Participants can choose to perform a complete set of Tai Chi or selected movements according to their needs. Previous research substantiates that Tai Chi has significant benefits to health promotion, and regularly practicing Tai Chi improves aerobic capacity, muscular strength, balance, health-related quality of life, and psychological well-being. Recent studies also prove that Tai Chi is safe and effective for patients with neurological diseases (e.g., stroke, Parkinson's disease, traumatic brain injury, multiple sclerosis, cognitive dysfunction), rheumatological disease (e.g., rheumatoid arthritis, ankylosing spondylitis, and fibromyalgia), orthopedic diseases (e.g., osteoarthritis, osteoporosis, low-back pain, and musculoskeletal disorder), cardiovascular diseases (e.g., acute myocardial infarction, coronary artery bypass grafting surgery, and heart failure), chronic obstructive pulmonary diseases, and breast cancers. Tai Chi is an aerobic exercise with mild-to-moderate intensity and is appropriate for implementation in the community. This paper reviews the existing literature on Tai Chi and introduces its health-promotion effect and the potential clinical applications.

  5. Tai Chi Chuan in Medicine and Health Promotion

    Directory of Open Access Journals (Sweden)

    Ching Lan


    Full Text Available Tai Chi Chuan (Tai Chi is a Chinese traditional mind-body exercise and recently, it becomes popular worldwide. During the practice of Tai Chi, deep diaphragmatic breathing is integrated into body motions to achieve a harmonious balance between body and mind and to facilitate the flow of internal energy (Qi. Participants can choose to perform a complete set of Tai Chi or selected movements according to their needs. Previous research substantiates that Tai Chi has significant benefits to health promotion, and regularly practicing Tai Chi improves aerobic capacity, muscular strength, balance, health-related quality of life, and psychological well-being. Recent studies also prove that Tai Chi is safe and effective for patients with neurological diseases (e.g., stroke, Parkinson's disease, traumatic brain injury, multiple sclerosis, cognitive dysfunction, rheumatological disease (e.g., rheumatoid arthritis, ankylosing spondylitis, and fibromyalgia, orthopedic diseases (e.g., osteoarthritis, osteoporosis, low-back pain, and musculoskeletal disorder, cardiovascular diseases (e.g., acute myocardial infarction, coronary artery bypass grafting surgery, and heart failure, chronic obstructive pulmonary diseases, and breast cancers. Tai Chi is an aerobic exercise with mild-to-moderate intensity and is appropriate for implementation in the community. This paper reviews the existing literature on Tai Chi and introduces its health-promotion effect and the potential clinical applications.

  6. Measurement of the ratio of prompt {chi}{sub c} to J/{psi} production in pp collisions at {radical}(s)=7 TeV

    Energy Technology Data Exchange (ETDEWEB)

    Aaij, R. [Nikhef National Institute for Subatomic Physics, Amsterdam (Netherlands); Abellan Beteta, C. [Universitat de Barcelona, Barcelona (Spain); Adeva, B. [Universidad de Santiago de Compostela, Santiago de Compostela (Spain); Adinolfi, M. [H.H. Wills Physics Laboratory, University of Bristol, Bristol (United Kingdom); Adrover, C. [CPPM, Aix-Marseille Universite, CNRS/IN2P3, Marseille (France); Affolder, A. [Oliver Lodge Laboratory, University of Liverpool, Liverpool (United Kingdom); Ajaltouni, Z. [Clermont Universite, Universite Blaise Pascal, CNRS/IN2P3, LPC, Clermont-Ferrand (France); Albrecht, J.; Alessio, F. [European Organization for Nuclear Research (CERN), Geneva (Switzerland); Alexander, M. [School of Physics and Astronomy, University of Glasgow, Glasgow (United Kingdom); Ali, S. [Nikhef National Institute for Subatomic Physics, Amsterdam (Netherlands); Alkhazov, G. [Petersburg Nuclear Physics Institute (PNPI), Gatchina (Russian Federation); Alvarez Cartelle, P. [Universidad de Santiago de Compostela, Santiago de Compostela (Spain); Alves, A.A. [Sezione INFN di Roma La Sapienza, Roma (Italy); Amato, S. [Universidade Federal do Rio de Janeiro (UFRJ), Rio de Janeiro (Brazil); Amhis, Y. [Ecole Polytechnique Federale de Lausanne (EPFL), Lausanne (Switzerland); Anderson, J. [Physik-Institut, Universitaet Zuerich, Zuerich (Switzerland); Appleby, R.B. [School of Physics and Astronomy, University of Manchester, Manchester (United Kingdom); Aquines Gutierrez, O. [Max-Planck-Institut fuer Kernphysik (MPIK), Heidelberg (Germany); Archilli, F. [Laboratori Nazionali dell' INFN di Frascati, Frascati (Italy); European Organization for Nuclear Research (CERN), Geneva (Switzerland); and others


    The prompt production of charmonium {chi}{sub c} and J/{psi} states is studied in proton-proton collisions at a centre-of-mass energy of {radical}(s)=7 TeV at the Large Hadron Collider. The {chi}{sub c} and J/{psi} mesons are identified through their decays {chi}{sub c}{yields}J/{psi}{gamma} and J/{psi}{yields}{mu}{sup +}{mu}{sup -} using 36 pb{sup -1} of data collected by the LHCb detector in 2010. The ratio of the prompt production cross-sections for {chi}{sub c} and J/{psi}, {sigma}({chi}{sub c}{yields}J/{psi}{gamma})/{sigma}(J/{psi}), is determined as a function of the J/{psi} transverse momentum in the range 2

  7. Measurement of the ratio of prompt $\\chi_{c}$ to $J/\\psi$ production in $pp$ collisions at $\\sqrt{s}=7$ TeV

    CERN Document Server

    INSPIRE-00258707; Abellan Beteta, C; Adeva, B; Adinolfi, M; Adrover, C; Affolder, A; Ajaltouni, Z; Albrecht, J; Alessio, F; Alexander, M; Ali, S; Alkhazov, G; Alvarez Cartelle, P; Alves Jr, A A; Amato, S; Amhis, Y; Anderson, J; Appleby, R B; Aquines Gutierrez, O; Archilli, F; Arrabito, L; Artamonov, A; Artuso, M; Aslanides, E; Auriemma, G; Bachmann, S; Back, J J; Balagura, V; Baldini, W; Barlow, R J; Barschel, C; Barsuk, S; Barter, W; Bates, A; Bauer, C; Bauer, Th; Bay, A; Bediaga, I; Belogurov, S; Belous, K; Belyaev, I; Ben-Haim, E; Benayoun, M; Bencivenni, G; Benson, S; Benton, J; Bernet, R; Bettler, M-O; van Beuzekom, M; Bien, A; Bifani, S; Bird, T; Bizzeti, A; Bjørnstad, P M; Blake, T; Blanc, F; Blanks, C; Blouw, J; Blusk, S; Bobrov, A; Bocci, V; Bondar, A; Bondar, N; Bonivento, W; Borghi, S; Borgia, A; Bowcock, T J V; Bozzi, C; Brambach, T; van den Brand, J; Bressieux, J; Brett, D; Britsch, M; Britton, T; Brook, N H; Brown, H; Büchler-Germann, A; Burducea, I; Bursche, A; Buytaert, J; Cadeddu, S; Callot, O; Calvi, M; Calvo Gomez, M; Camboni, A; Campana, P; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carson, L; Carvalho Akiba, K; Casse, G; Cattaneo, M; Cauet, Ch; Charles, M; Charpentier, Ph; Chiapolini, N; Ciba, K; Cid Vidal, X; Ciezarek, G; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Coca, C; Coco, V; Cogan, J; Collins, P; Comerma-Montells, A; Contu, A; Cook, A; Coombes, M; Corti, G; Couturier, B; Cowan, G A; Currie, R; D'Ambrosio, C; David, P; David, P N Y; De Bonis, I; De Bruyn, K; De Capua, S; De Cian, M; De Lorenzi, F; De Miranda, J M; De Paula, L; De Simone, P; Decamp, D; Deckenhoff, M; Degaudenzi, H; Del Buono, L; Deplano, C; Derkach, D; Deschamps, O; Dettori, F; Dickens, J; Dijkstra, H; Diniz Batista, P; Domingo Bonal, F; Donleavy, S; Dordei, F; Dosil Suárez, A; Dossett, D; Dovbnya, A; Dupertuis, F; Dzhelyadin, R; Dziurda, A; Easo, S; Egede, U; Egorychev, V; Eidelman, S; van Eijk, D; Eisele, F; Eisenhardt, S; Ekelhof, R; Eklund, L; Elsasser, Ch; Elsby, D; Esperante Pereira, D; Falabella, A; Färber, C; Fardell, G; Farinelli, C; Farry, S; Fave, V; Fernandez Albor, V; Ferro-Luzzi, M; Filippov, S; Fitzpatrick, C; Fontana, M; Fontanelli, F; Forty, R; Francisco, O; Frank, M; Frei, C; Frosini, M; Furcas, S; Gallas Torreira, A; Galli, D; Gandelman, M; Gandini, P; Gao, Y; Garnier, J-C; Garofoli, J; Garra Tico, J; Garrido, L; Gascon, D; Gaspar, C; Gauld, R; Gauvin, N; Gersabeck, M; Gershon, T; Ghez, Ph; Gibson, V; Gligorov, V V; Göbel, C; Golubkov, D; Golutvin, A; Gomes, A; Gordon, H; Grabalosa Gándara, M; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graziani, G; Grecu, A; Greening, E; Gregson, S; Gui, B; Gushchin, E; Guz, Yu; Gys, T; Hadjivasiliou, C; Haefeli, G; Haen, C; Haines, S C; Hampson, T; Hansmann-Menzemer, S; Harji, R; Harnew, N; Harrison, J; Harrison, P F; Hartmann, T; He, J; Heijne, V; Hennessy, K; Henrard, P; Hernando Morata, J A; van Herwijnen, E; Hicks, E; Holubyev, K; Hopchev, P; Hulsbergen, W; Hunt, P; Huse, T; Huston, R S; Hutchcroft, D; Hynds, D; Iakovenko, V; Ilten, P; Imong, J; Jacobsson, R; Jaeger, A; Jahjah Hussein, M; Jans, E; Jansen, F; Jaton, P; Jean-Marie, B; Jing, F; John, M; Johnson, D; Jones, C R; Jost, B; Kaballo, M; Kandybei, S; Karacson, M; Karbach, T M; Keaveney, J; Kenyon, I R; Kerzel, U; Ketel, T; Keune, A; Khanji, B; Kim, Y M; Knecht, M; Koopman, R F; Koppenburg, P; Korolev, M; Kozlinskiy, A; Kravchuk, L; Kreplin, K; Kreps, M; Krocker, G; Krokovny, P; Kruse, F; Kruzelecki, K; Kucharczyk, M; Kudryavtsev, V; Kvaratskheliya, T; La Thi, V N; Lacarrere, D; Lafferty, G; Lai, A; Lambert, D; Lambert, R W; Lanciotti, E; Lanfranchi, G; Langenbruch, C; Latham, T; Lazzeroni, C; Le Gac, R; van Leerdam, J; Lees, J-P; Lefèvre, R; Leflat, A; Lefrançois, J; Leroy, O; Lesiak, T; Li, L; Li Gioi, L; Lieng, M; Liles, M; Lindner, R; Linn, C; Liu, B; Liu, G; von Loeben, J; Lopes, J H; Lopez Asamar, E; Lopez-March, N; Lu, H; Luisier, J; Mac Raighne, A; Machefert, F; Machikhiliyan, I V; Maciuc, F; Maev, O; Magnin, J; Malde, S; Mamunur, R M D; Manca, G; Mancinelli, G; Mangiafave, N; Marconi, U; Märki, R; Marks, J; Martellotti, G; Martens, A; Martin, L; Martín Sánchez, A; Martinelli, M; Martinez Santos, D; Massafferri, A; Mathe, Z; Matteuzzi, C; Matveev, M; Maurice, E; Maynard, B; Mazurov, A; McGregor, G; McNulty, R; Meissner, M; Merk, M; Merkel, J; Miglioranzi, S; Milanes, D A; Minard, M-N; Molina Rodriguez, J; Monteil, S; Moran, D; Morawski, P; Mountain, R; Mous, I; Muheim, F; Müller, K; Muresan, R; Muryn, B; Muster, B; Mylroie-Smith, J; Naik, P; Nakada, T; Nandakumar, R; Nasteva, I; Needham, M; Neufeld, N; Nguyen, A D; Nguyen-Mau, C; Nicol, M; Niess, V; Nikitin, N; Nikodem, T; Nomerotski, A; Novoselov, A; Oblakowska-Mucha, A; Obraztsov, V; Oggero, S; Ogilvy, S; Okhrimenko, O; Oldeman, R; Orlandea, M; Otalora Goicochea, J M; Owen, P; Pal, B K; Palacios, J; Palano, A; Palutan, M; Panman, J; Papanestis, A; Pappagallo, M; Parkes, C; Parkinson, C J; Passaleva, G; Patel, G D; Patel, M; Paterson, S K; Patrick, G N; Patrignani, C; Pavel-Nicorescu, C; Pazos Alvarez, A; Pellegrino, A; Penso, G; Pepe Altarelli, M; Perazzini, S; Perego, D L; Perez Trigo, E; Pérez-Calero Yzquierdo, A; Perret, P; Perrin-Terrin, M; Pessina, G; Petrolini, A; Phan, A; Picatoste Olloqui, E; Pie Valls, B; Pietrzyk, B; Pilař, T; Pinci, D; Plackett, R; Playfer, S; Plo Casasus, M; Polok, G; Poluektov, A; Polycarpo, E; Popov, D; Popovici, B; Potterat, C; Powell, A; Prisciandaro, J; Pugatch, V; Puig Navarro, A; Qian, W; Rademacker, J H; Rakotomiaramanana, B; Rangel, M S; Raniuk, I; Raven, G; Redford, S; Reid, M M; dos Reis, A C; Ricciardi, S; Richards, A; Rinnert, K; Roa Romero, D A; Robbe, P; Rodrigues, E; Rodrigues, F; Rodriguez Perez, P; Rogers, G J; Roiser, S; Romanovsky, V; Rosello, M; Rouvinet, J; Ruf, T; Ruiz, H; Sabatino, G; Saborido Silva, J J; Sagidova, N; Sail, P; Saitta, B; Salzmann, C; Sannino, M; Santacesaria, R; Santamarina Rios, C; Santinelli, R; Santovetti, E; Sapunov, M; Sarti, A; Satriano, C; Satta, A; Savrie, M; Savrina, D; Schaack, P; Schiller, M; Schleich, S; Schlupp, M; Schmelling, M; Schmidt, B; Schneider, O; Schopper, A; Schune, M-H; Schwemmer, R; Sciascia, B; Sciubba, A; Seco, M; Semennikov, A; Senderowska, K; Sepp, I; Serra, N; Serrano, J; Seyfert, P; Shapkin, M; Shapoval, I; Shatalov, P; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, O; Shevchenko, V; Shires, A; Silva Coutinho, R; Skwarnicki, T; Smith, N A; Smith, E; Sobczak, K; Soler, F J P; Solomin, A; Soomro, F; Souza De Paula, B; Spaan, B; Sparkes, A; Spradlin, P; Stagni, F; Stahl, S; Steinkamp, O; Stoica, S; Stone, S; Storaci, B; Straticiuc, M; Straumann, U; Subbiah, V K; Swientek, S; Szczekowski, M; Szczypka, P; Szumlak, T; T'Jampens, S; Teodorescu, E; Teubert, F; Thomas, C; Thomas, E; van Tilburg, J; Tisserand, V; Tobin, M; Tolk, S; Topp-Joergensen, S; Torr, N; Tournefier, E; Tourneur, S; Tran, M T; Tsaregorodtsev, A; Tuning, N; Ubeda Garcia, M; Ukleja, A; Urquijo, P; Uwer, U; Vagnoni, V; Valenti, G; Vazquez Gomez, R; Vazquez Regueiro, P; Vecchi, S; Velthuis, J J; Veltri, M; Viaud, B; Videau, I; Vieira, D; Vilasis-Cardona, X; Visniakov, J; Vollhardt, A; Volyanskyy, D; Voong, D; Vorobyev, A; Vorobyev, V; Voss, H; Waldi, R; Wandernoth, S; Wang, J; Ward, D R; Watson, N K; Webber, A D; Websdale, D; Whitehead, M; Wiedner, D; Wiggers, L; Wilkinson, G; Williams, M P; Williams, M; Wilson, F F; Wishahi, J; Witek, M; Witzeling, W; Wotton, S A; Wyllie, K; Xie, Y; Xing, F; Xing, Z; Yang, Z; Young, R; Yushchenko, O; Zangoli, M; Zavertyaev, M; Zhang, F; Zhang, L; Zhang, W C; Zhang, Y; Zhelezov, A; Zhong, L; Zvyagin, A


    The prompt production of charmonium $\\chi_{c}$ and $J/\\psi$ states is studied in proton-proton collisions at a centre-of-mass energy of $\\sqrt{s}=7$ TeV at the Large Hadron Collider. The $\\chi_{c}$ and $J/\\psi$ mesons are identified through their decays $\\chi_{c}\\rightarrow J/\\psi \\gamma$ and $J/\\psi\\rightarrow \\mu^+\\mu^-$ using 36 pb$^{-1}$ of data collected by the LHCb detector in 2010. The ratio of the prompt production cross-sections for $\\chi_{c}$ and $J/\\psi$, $\\sigma (\\chi_{c}\\rightarrow J/\\psi \\gamma)/ \\sigma (J/\\psi)$, is determined as a function of the $J/\\psi$ transverse momentum in the range $2 < p_{\\mathrm T}^{J/\\psi} < 15$ GeV/$c$. The results are in excellent agreement with next-to-leading order non-relativistic expectations and show a significant discrepancy compared with the colour singlet model prediction at leading order, especially in the low $p_{\\mathrm T}^{J/\\psi}$ region.

  8. Measurement of B(psi -> gamma chi(c1)) and search for psi -> gamma chi(c2)

    NARCIS (Netherlands)

    Ablikim, M.; Achasov, M. N.; Ai, X. C.; Albayrak, O.; Albrecht, M.; Ambrose, D. J.; Amoroso, A.; An, F. F.; An, Q.; Bai, J. Z.; Ferroli, R. Baldini; Ban, Y.; Bennett, D. W.; Bennett, J. V.; Bertani, M.; Bettoni, D.; Bian, J. M.; Bianchi, F.; Boger, E.; Bondarenko, O.; Boyko, I.; Briere, R. A.; Cai, H.; Cai, X.; Cakir, O.; Calcaterra, A.; Cao, G. F.; Cetin, S. A.; Chang, J. F.; Chelkov, G.; Chen, G.; Chen, H. S.; Chen, H. Y.; Chen, J. C.; Chen, M. L.; Chen, S. J.; Chen, X.; Chen, X. R.; Chen, Y. B.; Cheng, H. P.; Chu, X. K.; Cibinetto, G.; Cronin-Hennessy, D.; Dai, H. L.; Dai, J. P.; Dbeyssi, A.; Dedovich, D.; Deng, Z. Y.; Denig, A.; Denysenko, I.; Destefanis, M.; De Mori, F.; Ding, Y.; Dong, C.; Dong, J.; Dong, L. Y.; Dong, M. Y.; Du, S. X.; Duan, P. F.; Fan, J. Z.; Fang, J.; Fang, S. S.; Fang, X.; Fang, Y.; Fava, L.; Feldbauer, F.; Felici, G.; Feng, C. Q.; Fioravanti, E.; Fritsch, M.; Fu, C. D.; Gao, Q.; Gao, X. Y.; Gao, Y.; Gao, Z.; Garzia, I.; Geng, C.; Goetzen, K.; Gong, W. X.; Gradl, W.; Greco, M.; Gu, M. H.; Gu, Y. T.; Guan, Y. H.; Guo, A. Q.; Guo, L. B.; Guo, Y.; Guo, Y. P.; Haddadi, Z.; Hafner, A.; Han, S.; Han, Y. L.; Hao, X. Q.; Harris, F. A.; He, K. L.; He, Z. Y.; Held, T.; Heng, Y. K.; Hou, Z. L.; Hu, C.; Hu, H. M.; Hu, J. F.; Hu, T.; Hu, Y.; Huang, G. M.; Huang, G. S.; Huang, H. P.; Huang, J. S.; Huang, X. T.; Huang, Y.; Hussain, T.; Ji, Q.; Ji, Q. P.; Ji, X. B.; Ji, X. L.; Jiang, L. L.; Jiang, L. W.; Jiang, X. S.; Liao, J. B.; Liao, Z.; Jin, D. P.; Jin, S.; Johansson, T.; Julin, A.; Kalantar-Nayestanaki, N.; Kang, X. L.; Kang, X. S.; Kavatsyuk, M.; Ke, B. C.; Kliemt, R.; Kloss, B.; Kolcu, O. B.; Kopf, B.; Komicer, M.; Kuehn, W.; Kupsc, A.; Lai, W.; Lange, J. S.; Lara, M.; Larin, P.; Leng, C.; Li, C. H.; Li, Cheng; Li, D. M.; Li, F.; Li, G.; Li, H. B.; Li, J. C.; Li, Jin; Li, K.; Li, K.; Li, Lei; Li, P. R.; Li, T.; Li, W. D.; Li, W. G.; Li, X. L.; Li, X. M.; Li, X. N.; Li, X. Q.; Li, Z. B.; Liang, H.; Liang, Y. F.; Liang, Y. T.; Liao, G. R.; Lin, D. X.; Liu, B. J.; Liu, C. X.; Liu, F. H.; Liu, Fang; Liu, Feng; Liu, H. B.; Liu, H. H.; Liu, H. H.; Liu, H. M.; Liu, J.; Liu, J. P.; Liu, J. Y.; Liu, K.; Liu, K. Y.; Liu, L. D.; Liu, P. L.; Liu, Q.; Liu, S. B.; Liu, X.; Liu, X. X.; Liu, Y. B.; Liu, Z. A.; Liu, Zhiqiang; Liu, Zhiging; Loehner, H.; Lou, X. C.; Lu, H. J.; Lu, J. G.; Lu, R. Q.; Lu, Y.; Lu, Y. P.; Luo, C. L.; Luo, M. X.; Luo, T.; Luo, X. L.; Lv, M.; Lyu, X. R.; Ma, F. C.; Ma, H. L.; Ma, L. L.; Ma, Q. M.; Ma, S.; Ma, T.; Ma, X. N.; Ma, X. Y.; Maas, F. E.; Maggiora, M.; Malik, Q. A.; Mao, Y. J.; Mao, Z. P.; Marcello, S.; Messchendorp, J. G.; Min, J.; Min, T. J.; Mitchell, R. E.; Mo, X. H.; Mo, Y. J.; Morales, C. Morales; Moriya, K.; Muchnoi, N. Yu.; Muramatsu, H.; Nefedov, Y.; Nerling, F.; Nikolaev, I. B.; Ning, Z.; Nisar, S.; Niu, S. L.; Niu, X. Y.; Olsen, S. L.; Ouyang, Q.; Pacetti, S.; Patteri, P.; Pelizaeus, M.; Peng, H. P.; Peters, K.; Pettersson, J.; Ping, J. L.; Ping, R. G.; Poling, R.; Pu, Y. N.; Qi, M.; Qian, S.; Qiao, C. F.; Qin, L. Q.; Qin, N.; Qin, X. S.; Qin, Y.; Qin, Z. H.; Qiu, J. F.; Rashid, K. H.; Redmer, C. F.; Ren, H. L.; Ripka, M.; Rong, G.; Ruan, X. D.; Santoro, V.; Sarantsev, A.; Savrie, M.; Schoenning, K.; Schumann, S.; Shan, W.; Shao, M.; Shen, C. P.; Shen, P. X.; Shen, X. Y.; Sheng, H. Y.; Song, W. M.; Song, X. Y.; Sosio, S.; Spataro, S.; Sun, G. X.; Sun, J. F.; Sun, S. S.; Sun, Y. J.; Sun, Y. Z.; Sun, Z. J.; Sun, Z. T.; Tang, C. J.; Tang, X.; Tapan, I.; Thomdike, E. H.; Tiemens, M.; Toth, D.; Ullrich, M.; Uman, I.; Varner, G. S.; Wang, B.; Wang, B. L.; Wang, D.; Wang, D. Y.; Wang, K.; Wang, L. L.; Wang, L. S.; Wang, M.; Wang, P.; Wang, P. L.; Wang, Q. J.; Wang, S. G.; Wang, W.; Wang, X. F.; Wang, Y. D.; Wang, Y. F.; Wang, Y. Q.; Wang, Z.; Wang, Z. G.; Wang, Z. H.; Wang, Z. Y.; Weber, T.; Wei, D. H.; Wei, J. B.; Weidenkaff, P.; Wen, S. P.; Wiedner, U.; Wolke, M.; Wu, L. H.; Wu, Z.; Xia, L. G.; Xia, Y.; Xiao, D.; Xiao, Z. J.; Xie, Y. G.; Xiu, Q. L.; Xu, G. F.; Xu, L.; Xu, Q. J.; Xu, Q. N.; Xu, X. P.; Yan, L.; Yan, W. B.; Yan, W. C.; Yan, Y. H.; Yang, H. X.; Yang, L.; Yang, Y.; Yang, Y. X.; Ye, H.; Ye, M.; Ye, M. H.; Yin, J. H.; Yu, B. X.; Yu, C. X.; Yu, H. W.; Yu, J. S.; Yuan, C. Z.; Yuan, W. L.; Yuan, Y.; Yuncu, A.; Zafar, A. A.; Zallo, A.; Zeng, Y.; Zhang, B. X.; Zhang, B. Y.; Zhang, C.; Zhang, C. C.; Zhang, D. H.; Zhang, H. H.; Zhang, H. Y.; Zhang, J. J.; Zhang, J. L.; Zhang, J. Q.; Zhang, J. W.; Zhang, J. Y.; Zhang, J. Z.; Zhang, K.; Zhang, L.; Zhang, S. H.; Zhang, X. Y.; Zhang, Y.; Zhang, Y. H.; Zhang, Y. T.; Zhang, Z. H.; Zhang, Z. P.; Zhang, Z. Y.; Zhao, G.; Zhao, J. W.; Zhao, J. Y.; Zhao, J. Z.; Zhao, Lei; Zhao, Ling; Zhao, M. G.; Zhao, Q.; Zhao, Q. W.; Zhao, S. J.; Zhao, T. C.; Zhao, Y. B.; Zhao, Z. G.; Zheruchugov, A.; Zheng, B.; Zheng, J. P.; Zheng, W. J.; Zheng, Y. H.; Zhong, B.; Zhou, L.; Zhou, Li; Zhou, X.; Zhou, X. K.; Zhou, X. R.; Zhou, X. Y.; Zhu, K.; Zhu, K. J.; Zhu, S.; Zhu, X. L.; Zhu, Y. C.; Zhu, Y. S.; Zhu, Z. A.; Zhuang, J.; Zotti, L.; Zou, B. S.; Zou, J. H.


    We report a measurement of the branching fraction for psi(3770) -> gamma chi(c1) and search for the transition psi(3770) -> gamma chi(c2) based on 2.92 fb(-1) of e(+)e(-) data accumulated at root s = 3.773 GeV with the BESIII detector at the BEPCII collider. We measure B(psi(3770) -> gamma chi(c1))

  9. Your Chi-Square Test Is Statistically Significant: Now What? (United States)

    Sharpe, Donald


    Applied researchers have employed chi-square tests for more than one hundred years. This paper addresses the question of how one should follow a statistically significant chi-square test result in order to determine the source of that result. Four approaches were evaluated: calculating residuals, comparing cells, ransacking, and partitioning. Data…

  10. Studies on inclusive meson resonance and particle production

    International Nuclear Information System (INIS)

    Saarikko, Heimo


    Production and decay of meson resonances are studied in medium energy meson-proton collisions. Strong evidence is found that hadronic collisions are dominated by resonance production. Especially the vector mesons have often large inclusive cross sections, typically of the order of few millibarns at the present energies. In all, a majority of pions and kaons appear to be decay products of resonances or other unstable particles. The detailed kinematics of the parent resonance's decays is found to play an important role in determining inclusive pion spectra. The squared transverse momentum distributions of hadrons heavier than the pion appear to have in common an exponential behaviour, with a universal slope for the esponential fall-off. The observed vector meson yields suggest that only a small fraction of the direct lepton production observed at large transverse momentum in nucleon-nucleon interactions is accounted for by the ''old'' vector mesons. An attempt has been made to separate out the central production and fragmentation components of the meson production. Both the central production and the fragmentation of the incoming meson are found to be important mechanisms in the non-strange meson production whereas the central production of strange meson resonances is rare at our energies. The ratios of the observed meson yields are found to be generally in good agreement with a simple quark-counting model. (author)

  11. About oscillations in the system of K0 mesons

    International Nuclear Information System (INIS)

    Beshtoev, Kh.M.


    This work considers K 0 -, K 0 bar - meson mixings and oscillations via K 1 0 , K 2 0 - meson states at strangeness violation by the weak interactions and K 1 0 -, K 2 0 - meson mixings and oscillations via K S -, K L - meson states at CP violation by the weak interactions without and with taking into account decay widths. We work in the framework of the masses mixing scheme. It is shown that K 1 0 -(K S -) meson states appear at big distances from the K 0 -mesons source after their decays (τ L ≥ τ S (τ 2 ≥τ 1 )) due to oscillations of residual K 2 0 (K L ) mesons and then again we see short-living K 1 0 (K S ) mesons. It is implied that K L ↔K S meson oscillations are absent. The case is also considered when at CP violation unitarity is violated, but orthogonality of K S , K L states remains. The general expressions for probabilities of meson oscillations (transitions) are given

  12. Spin O decay angular distribution for interfering mesons in electroproduction

    Energy Technology Data Exchange (ETDEWEB)

    Funsten, H.; Gilfoyle, G.


    Self analyzing meson electroproduction experiments are currently being planned for the CEBAF CLAS detector. These experiments deduce the spin polarization of outgoing unstable spin s (?)0 mesons from their decay angular distribution, W({theta},{psi}). The large angular acceptance of the CLAS detector permits kinematic tracking of a sufficient number of these events to accurately determine electroproduction amplitudes from the deduced polarization. Maximum polarization information is obtained from W({theta},{psi}) for decay into spin 0 daughters. The helicity of the decaying meson is transferred to the daughter`s relative orbital angular momentum m-projection; none is {open_quotes}absorbed{close_quotes} into daughter helicities. The decaying meson`s helicity maximally appears in W({theta},{psi}). W({theta},{psi}) for spin 0 daughters has been derived for (1) vector meson electroproduction and (2) general interfering mesons produced by incident pions. This paper derives W({theta},{psi}) for electroproduction of two interfering mesons that decay into spin 0 daughters. An application is made to the case of interfering scalar and vector mesons. The derivation is an extension of work by Schil using the general decay formalism of Martin. The expressions can be easily extended to the case of N interfering mesons since interference occurs pairwise in the observable W ({theta},{psi}), a quadratic function of the meson amplitudes. The derivation uses the virtual photon density matrix of Schil which is transformed by a meson electroproduction transition operator, T. The resulting density matrix for the interfering mesons is then converted into a corresponding statistical tensor and contracted into the efficiency tensor for spin 0 daughters.

  13. Psi Chi/APA Edwin B. Newman Graduate Research Award. (United States)


    The Edwin B. Newman Graduate Research Award is sponsored jointly by Psi Chi, the national honor society in psychology, and the APA. The award is presented annually to the psychology graduate student who submits the best research paper that was published or presented at a national, regional, or state psychological association conference during the past calendar year. The Edwin B. Newman Graduate Research Award was established in 1979. The award was established to recognize young researchers at the beginning of their professional lives and to commemorate both the 50th anniversary of Psi Chi and the 100th anniversary of psychology as a science (dating from the founding of Wundt's laboratory). It was named for Dr. Edwin B. Newman, the first national president of Psi Chi (1929) and one of its founders. He was a prolific researcher and a long-time chair of the Department of Psychology at Harvard University. Newman was a member of APA's Board of Directors, served as recording secretary of the board from 1962 to 1967, and was parliamentarian for the APA Council of Representatives for many years. He served both Psi Chi and APA in a distinguished manner for half a century. The Edwin B. Newman Graduate Research Award is given jointly by Psi Chi and APA. Members of the 2017 Edwin B. Newman Award Committee were Shawn Carlton, PhD, Psi Chi representative; Christina Frederick-Recascino, PhD; John Norcross, PhD, APA representative; Karenna Malavanti, PhD, Psi Chi representative; Steven Kohn, PhD, Psi Chi representative; Warren Fass, PhD, Psi Chi representative; Chris Lovelace, PhD, Psi Chi representative; and Cathy Epkins, PhD, APA representative. (PsycINFO Database Record (c) 2017 APA, all rights reserved).

  14. Workshop on mesons and mesonic states up to slightly above 1 GeV/c2

    International Nuclear Information System (INIS)

    Oelert, W.; Sefzick, T.


    The new accelerator COSY-Juelich will provide protons with momenta up to 3.3 GeV/c. Thus an effective mass slightly above 1 GeV/c 2 can be produced in the pp-interaction. Employing higher mass targets also heavier mesons can be observed. The production of single mesons and of mesonic states with and without strangeness can be investgated at COSY. The structure of some mesons in the mass range of 950 McV/c 2 to 1020 MeV/c 2 is still not well understood. While the Φ(1020) at the upper limit of this range is believed to be of rahter pure santi s nature the content of the η'(958) meson at the lower limit of this range is still under discussion. New results suggest that what is called the f o meson (former notation S*) consists in reality of two close and narrow states; one of them being a santi s - quarks configuration while the other should be a flavour singlet which couples to ππ and Kanti K with similar strengths. Also the discussion on possible gluonium candidates is still alive. It is speculated that some of these mesons - till now supposed to have widths of 30 to 50 MeV/c 2 - could rather be an overlay of structures with much smaller widths. Another features of resonances in this region is their partial decay into the Kanti K channel if their actual mass is large enough. Strong decays in Kanti K could be a signal of a Kanti K 'molecular' nature of the resonance. In particular the atomic K + K - structure should exist. In order to have review of the physics related to these problems there was a workshop held on: MESONS and MESONIC STATES up to slightly above 1 GeV/c 2 at the ZEL - Forschungszentrum - Juelich February 19 to 20, 1990. The following contains copies of the shown transparencies and short write-ups as far as available. (orig.)

  15. Observation of Matter-Antimatter Asymmetry in the Neutral B Meson System

    Energy Technology Data Exchange (ETDEWEB)

    Rahatlou, S


    In this dissertation, a measurement of CP-violating effects in decays of neutral B meson is presented. The data sample for this measurement consists of about 88 million {Upsilon}(4S) {yields} B{bar B} decays collected between 1999 and 2002 with the BABAR detector at the PEP-II asymmetric-energy e{sup +}e{sup -} collider, located at the Stanford Linear Accelerator Center. One neutral B meson is fully reconstructed in the CP eigenstates J/{psi} K{sub S}{sup 0}, {psi}(2S)K{sub S}{sup 0}, {chi}{sub c1}K{sub S}{sup 0}, and {eta}{sub c}K{sub S}{sup 0}, or in the flavor eigenstates D(*){sup -} {pi}{sup +}/{rho}{sup +}/a{sub 1}{sup +} and J/{psi} K*{sup 0} (K*{sup 0} {yields} K{sup +}{pi}{sup -}). The other B meson is determined to be either a B{sup 0} or a {bar B}{sup 0}, at the time of its decay, from the properties of its decay products. The proper time {Delta}t elapsed between the decay of the two mesons is determined by reconstructing their decay vertices, and by measuring the distance between them. The CP asymmetry amplitude sin2{beta} is determined by the distributions of {Delta}t in events with a reconstructed B meson in CP eigenstates. The detector resolution and the b-flavor-tagging parameters are constrained by the {Delta}t distributions of events with a fully reconstructed flavor eigenstate. From a simultaneous maximum-likelihood fit to the {Delta}t distributions of all selected events in CP and flavor eigenstates, the value of sin2{beta} is measured to be 0.755 {+-} 0.074(stat) {+-} 0.030(syst). This value is in agreement with the Standard Model prediction, and represents a successful test of the Kobayashi-Maskawa mechanism of CP violation.

  16. Meson exchange and neutral weak currents

    Energy Technology Data Exchange (ETDEWEB)

    Beck, D.H. [Univ. of Illinois, Urbana, IL (United States)


    Measurements of parity-violating electron scattering asymmetries to determine weak neutral currents in nuclei will be effected by the presence of meson exchange currents. Present low momentum transfer calculations, based on a flavor independent framework, show these effects to be small. In general, however, as the momentum transfer increases to values typical of deep-inelastic scattering, fragmentation functions show a clear flavor dependence. It is suggested that a good experimental starting point for understanding the flavor dependence of meson production and exchange currents is the Q{sup 2} dependence of parity-violating asymmetry in inclusive single pion electroproduction. A CEBAF facility with doubled energy is necessary to approach momentum transfers where this process begins to scale.

  17. Meson-exchange N-N potential

    International Nuclear Information System (INIS)

    Nutt, W.T.


    A meson-theoretic model of the intermediate range nucleon-nucleon potential is presented with emphasis placed on the two-pion exchange contribution. The Bethe-Salpeter equation is reduced, by the Blankenbecler-Sugar technique, to a Lippmann-Schwinger equation, from which an approximate nonlocal, energy-dependent potential is obtained. The nucleon-antinucleon pair contribution, which plagues meson-theoretical two-pion calculations, is suppressed by the complex poles of the one-nucleon Green's function. The importance of the retention of the explicit energy dependence of the potential is demonstrated by calculating the off-shell scattering matrices. The potential is presented in a linearized (in energy) form with the core region adjusted to produce a fit to low energy data

  18. Oxygen enhancement ratio for negative pi mesons

    International Nuclear Information System (INIS)

    Hall, E.J.; Astor, M.


    Experiments were performed at the Los Alamos Meson Physics Facility (LAMPF) to determine the oxygen enhancement ratio (OER) for the clinically used beam of negative pi mesons. V79 Chinese hamster cells, cultured in vitro, were used as the biological test system; hypoxia was produced by metabolic depletion as a result of sealing 2 million cells in 1 ml glass ampules. The Bragg peak of the pion depth dose curve was spread out to cover 10 cm by using a dynamic range shifter. Cells were irradiated at the center of the spead out Bragg peak, where the dose/rate was 0.1 Gy/min over a 6 x 6 cm field. The OER obtained was 2.2, compared with 3.8 obtained for γ rays under the same conditions

  19. A transverse lattice QCD model for mesons

    Energy Technology Data Exchange (ETDEWEB)

    Patel, Apoorva D.; Ratabole, Raghunath


    QCD is analysed with two light-front continuum dimensions and two transverse lattice dimensions. In the limit of large number of colours and strong transverse gauge coupling, the contributions of light-front and transverse directions factorise in the dynamics, and the theory can be analytically solved in a closed form. An integral equation is obtained, describing the properties of mesons, which generalises the 't Hooft equation by including spin degrees of freedom. The meson spectrum, light-front wavefunctions and form factors can be obtained by solving this equation numerically. These results would be a good starting point to model QCD observables which only weakly depend on transverse directions, e.g. deep inelastic scattering structure functions.

  20. Inclusive vector meson production and hadron structure

    International Nuclear Information System (INIS)

    Boeckmann, K.


    It is shown that J/PSI production in hadronic interactions is dominated by central production from sea quarks even at beam momenta as low as 40 GeV/c. All known experimental data on inclusive vector meson production support the hypothesis that cross sections obtained from meson-nucleon and nucleon-nucleon interactions have to be compared in the quark C.M. system. With the distinction of sea quark and valence quark interactions in the additive quark model a consistent description of inclusive rho, K*, PHI and J/PSI production in hadronic interactions. A natural connection of inclusive rho 0 production cross sections in anti pp, pp and πp interactions is obtained. (orig.) [de

  1. The lightest hybrid meson supermultiplet in QCD

    Energy Technology Data Exchange (ETDEWEB)

    Dudek, Jozef J


    We interpret the spectrum of meson states recently obtained in non-perturbative lattice QCD calculations in terms of constituent quark-antiquark bound states and states, called 'hybrids', in which the q{bar q} pair is supplemented by an excitation of the gluonic field. We identify a lightest supermultiplet of hybrid mesons with J{sup PC} = (0,1,2){sup {-+}}, 1{sup -} built from a gluonic excitation of chromomagnetic character coupled to q{bar q} in an S-wave. The next lightest hybrids are suggested to be quark orbital excitations with the same gluonic excitation, while the next distinct gluonic excitation is significantly heavier. Existing models of gluonic excitations are compared to these findings and possible phenomenological consequences explored.

  2. Quasi-exotic open-flavor mesons

    Energy Technology Data Exchange (ETDEWEB)

    Hilger, T.; Krassnigg, A. [University of Graz, NAWI Graz, Institute of Physics, Graz (Austria)


    Meson states with exotic quantum numbers arise naturally in a covariant bound-state framework in QCD. We investigate the consequences of shifting quark masses such that the states are no longer restricted to certain C-parities, but only by J{sup P}. Then, a priori, one can no longer distinguish exotic or conventional states. In order to identify signatures of the different states to look for experimentally, we provide the behavior of masses, leptonic decay constants, and orbital-angular-momentum decomposition of such mesons, as well as the constellations in which they could be found. Most prominently, we consider the case of charged quasi-exotic excitations of the pion. (orig.)

  3. Production of polarized vector mesons off nuclei

    International Nuclear Information System (INIS)

    Kopeliovich, B. Z.; Nemchik, J.; Schmidt, Ivan


    Using the light-cone QCD dipole formalism we investigate manifestations of color transparency (CT) and coherence length (CL) effects in electroproduction of longitudinally (L) and transversally (T) polarized vector mesons. Motivated by forthcoming data from the HERMES experiment we predict both the A and Q 2 dependence of the L/T ratios for ρ 0 mesons produced coherently and incoherently off nuclei. For an incoherent reaction the CT and CL effects add up and result in a monotonic A dependence of the L/T ratio at different values of Q 2 . In contrast, for a coherent process the contraction of the CL with Q 2 causes an effect opposite to that of CT and we expect quite a nontrivial A dependence

  4. A neural network to identify neutral mesons

    International Nuclear Information System (INIS)

    Lefevre, F.; Lautridou, P.; Marques, M.; Matulewicz, T.; Ostendorf, R.; Schutz, Y.


    Both π 0 and η mesons decay long before they can reach a detector. They predominantly decay by emission of two photons, and are identified by constructing the invariant mass of the photons. Misidentified mesons result from ambiguity in associating photons. Our work tries to select which pair is the most likely to be a physical one rather than a chance one. We first designed a Hopfield neural net, but all the activities converged rapidly towards zero except the highest one. To improve the solution we slew down the computation in order to let the network explore several states and to impose activities to converge towards one for all selected pairs. This was achieved by adding links connecting each cell to itself. The network performance is all the more interesting that the solid angle covered by the detector is greater than 15%. (D.L.). 5 refs

  5. LHCb: LHCb results on $B$ meson mixing

    CERN Multimedia

    Eitschberger, U


    On the poster three LHCb results on B meson mixing using a datasample of 1 fb$^{-1}$ of $pp$ collisions at $\\sqrt{s} =$ 7 TeV are presented. The B meson oscillation frequencies are measured as $\\Delta m_d = 0.5156 \\pm 0.0051 (\\text{stat}) \\pm 0.0033 (\\text{syst}) \\text{ps}^{-1}$ and $\\Delta m_s = 17.768 \\pm 0.023 (\\text{stat}) \\pm 0.006 (\\text{syst}) \\text{ps}^{-1}$. The CP violation observables in the decay channel $B^0 \\rightarrow J/\\psi K^0_S$ are determined as $S_{J/\\psi K^0_S} = 0.73 \\pm 0.07 (\\text{stat})\\pm 0.04 (\\text{syst})$ and $C_{J/\\psi K^0_S} = 0.03 \\pm 0.09 (\\text{stat})\\pm 0.01 (\\text{syst})$.

  6. A Dependence of Charmed Meson Production

    Energy Technology Data Exchange (ETDEWEB)

    Alves, Gilvan Augusto [Rio de Janeiro, CBPF


    One report is presented of a recent direct measurement of the nucleon number (A) dependence of the production cross sections for the charmed mesons $D^0$ and $D^+$ using $\\pi^+_{-}$ and $K^+_{-}$ beams incident on a segmented target of Be, Al, Cu and W. The data derive from the experiment E769 - Hadroproductlon of Charm at Fermilab. The experimental apparatus is described together with the following analysis. Starting from a sample of -1500 D mesons in the range of $O< x_{f} <1$, the data are found to be well described by the parameterization $\\sigma_{A}$ = $\\sigma_{O}$ , with $\\alpha = 0.99 \\pm 0.03$. The $x_f$ dependence of $\\alpha$ is examined and the results obtained are compared with those of other .experiments and wl th -theoretical expectations based on perturbatlve QCD and on an EMC like model of nuclear shadowing

  7. Exclusive vector meson production at HERA

    Energy Technology Data Exchange (ETDEWEB)

    Szuba, Dorota [Hamburg University, Hamburg (Germany); Collaboration: H1 Collaboration; ZEUS Collaboration


    The exclusive photoproduction of {Upsilon} has been studied with the ZEUS detector in ep collisions at HERA. The exponential slope, b, of the |t|-dependence of the cross section, where t is the squared four-momentum transfer at the proton vertex, has been measured. This constitutes the first measurement of the |t|-dependence of the {gamma}p{yields}{Upsilon}p cross section. The differential crosssections as a function of t at lower energies of {gamma}p centre-of-mass has been studied in exclusive diffractive photoproduction of J/{psi} mesons with the H1 detector. The exclusive electroproduction of two pions has been measured by the ZEUS experiment. The two-pion invariant-mass distribution is interpreted in terms of the pion electromagnetic form factor, assuming that the studied mass range includes the contributions of the {rho}, {rho} Prime and . {rho}'' vector-meson states.

  8. Exclusive vector meson production at HERA

    International Nuclear Information System (INIS)

    Szuba, Dorota


    The exclusive photoproduction of Υ has been studied with the ZEUS detector in ep collisions at HERA. The exponential slope, b, of the |t|-dependence of the cross section, where t is the squared four-momentum transfer at the proton vertex, has been measured. This constitutes the first measurement of the |t|-dependence of the γp→Υp cross section. The differential crosssections as a function of t at lower energies of γp centre-of-mass has been studied in exclusive diffractive photoproduction of J/ψ mesons with the H1 detector. The exclusive electroproduction of two pions has been measured by the ZEUS experiment. The two-pion invariant-mass distribution is interpreted in terms of the pion electromagnetic form factor, assuming that the studied mass range includes the contributions of the ρ, ρ′ and . ρ'' vector-meson states.

  9. Meson Spectroscopy from QCD - Project Results

    Energy Technology Data Exchange (ETDEWEB)

    Dudek, Jozef [Old Dominion Univ., Norfolk, VA (United States)


    Highlights of the research include: the determination of the form of the lowest energy gluonic excitation within QCD and the spectrum of hybrid hadrons which follows; the first calculation of the spectrum of hybrid baryons within a first-principles approach to QCD; a detailed mapping out of the phase-shift of elastic ππ scattering featuring the ρ resonance at two values of the light quark mass within lattice QCD; the first (and to date, only) determinations of coupled-channel meson-meson scattering within first-principles QCD; the first (and to date, only) determinations of the radiative coupling of a resonant state, the ρ appearing in πγ→ππ; the first (and to date, only) determination of the properties of the broad σ resonance in elastic ππ scattering within QCD without unjustified approximations.

  10. Meson spectroscopy experiment at KEK - E/iota puzzle

    International Nuclear Information System (INIS)

    Tsuru, Tsuneaki


    Physics interests at the KEK (National Laboratory for High Energy Physics) are (1) search for exotic mesons such as glueballs (gg), meiktons (q anti q g) and multiquark states (q sup(2 - )q 2 ), (2) search for missing ordinary mesons (q anti q) and confirmation of unestablished mesons, and (3) new informations of quark contents of mesons, mixing angles of SU(3) singlet-octet and tests of conservations law. Special interest is in search for exotics such as glueballs and meiktons. (2) is a so-called meson spectroscopy experiment. This is important not only in itself but also in identifying newly discovered states as exotics because exotics have often same quantum numbers as ordinary mesons. Contents are the following: glueballs and E/iota puzzles, spectrometer system, experiments, performance of the spectrometer, physics outputs, E/iota puzzles and πI experiment, future plans. (Mori, K.)

  11. Holographic picture of heavy vector meson melting

    Energy Technology Data Exchange (ETDEWEB)

    Braga, Nelson R.F.; Diles, Saulo [Universidade Federal do Rio de Janeiro, Instituto de Fisica, Rio de Janeiro, RJ (Brazil); Martin Contreras, Miguel Angel [Universidad de los Andes, High Energy Group, Department of Physics, Bogota (Colombia)


    The fraction of heavy vector mesons produced in a heavy ion collision, as compared to a proton-proton collision, serves as an important indication of the formation of a thermal medium, the quark-gluon plasma. This sort of analysis strongly depends on understanding the thermal effects of a medium like the plasma on the states of heavy mesons. In particular, it is crucial to know the temperature ranges where they undergo a thermal dissociation, or melting. AdS/QCD models are know to provide an important tool for the calculation of hadronic masses, but in general are not consistent with the observation that decay constants of heavy vector mesons decrease with excitation level. It has recently been shown that this problem can be overcome using a soft wall background and introducing an extra energy parameter, through the calculation of correlation functions at a finite position of anti-de Sitter space. This approach leads to the evaluation of masses and decay constants of S wave quarkonium states with just one flavor dependent and one flavor independent parameter. Here we extend this more realistic model to finite temperatures and analyze the thermal behavior of the states 1S, 2S and 3S of bottomonium and charmonium. The corresponding spectral function exhibits a consistent picture for the melting of the states where, for each flavor, the higher excitations melt at lower temperatures. We estimate for these six states the energy ranges in which the heavy vector mesons undergo a transition from a well-defined peak in the spectral function to complete melting in the thermal medium. A very clear distinction between the heavy flavors emerges, with the bottomonium state Υ(1S) surviving a deconfinement transition at temperatures much larger than the critical deconfinement temperature of the medium. (orig.)

  12. Production ratio of pseudoscalar to vector mesons

    International Nuclear Information System (INIS)

    Chliapnikov, P.V.; Uvarov, V.A.


    The P/V ratio of directly produced pseudoscalar (P) to vector (V) mesons is analysed using the data on the K S 0 and K * (892) total inclusive cross sections in pp, π + p and K ± p reactions. The indication for a change of P/V from a value of about 1 at low energies, where the fragmentation processes dominate, to a value of 1/3, suggested by spin-statistics, at high energies is discussed. (orig.)

  13. Exclusive ω meson production at COMPASS

    Directory of Open Access Journals (Sweden)

    Nowak Wolf-Dieter


    Full Text Available Exclusive ω meson production is studied by the COMPASS Collaboration using the CERN 160 GeV/c muon beam and a transversely polarised proton target. Single-spin and double-spin asymmetries are measured, some of which are sensitive to the Generalised Parton Distributions E that are related to quark orbital angular momenta. The results, which are sensitive also to the pion-pole contribution to the production mechanism, are compared to the predictions of a phenomenological model.

  14. Euclidean fields: vector mesons and photons

    International Nuclear Information System (INIS)

    Loffelholz, J.


    Free transverse vector fields of mass >= 0 are studied. The model is related to the usual free vector meson and electromagnetic quantum field theories by extension of the field operators from transverse to arbitrary test functions. The one-particle states in transverse gauge and their localization are described. Reflexion positivity is proved and derived are free Feynman-Kac-Nelson formulas. An Euclidean approach to a photon field in a spherical world using dilatation covariance and inversions is given

  15. Particle states of a quantized meson field

    International Nuclear Information System (INIS)

    Skyrme, T.H.R.


    A simple non-linear field theory is considered as the model for a recently proposed classical field theory of mesons and their particle sources. Quantization may be made according to canonical procedures; the problem is to show the existence of quantum states corresponding with the particle-like solutions of the classical field equations. A plausible way to do this is suggested. (author). 5 refs

  16. Updating experimental results on light meson spectroscopy

    International Nuclear Information System (INIS)

    Diekmann, B.


    A recollection and summary is given on the understanding of light qanti q (q = u,d,s) mesons under the regime of the qanti q potential turning from a coulombic behaviour to a 'confining' one. In the second part the experimental knowledge obtained in the last years is updated: e + e - experiments, fixed target experiments with hadrons (kaons) and photons and panti p annihilations at LEAR discovered unknown objects and added new constraints on known but not fully understood states. (orig.)

  17. LAMPF: the meson factory. A LASL monograph

    Energy Technology Data Exchange (ETDEWEB)

    Allred, J.C.


    A general and simplified introduction to the entire concept of LAMPF is given in terms of its experimental capabilities. Parts of the current experimental program are used as illustrative examples. Topics discussed include: (1) the evolution of the meson factory; (2) accelerator construction; (3) strong focusing; (4) accelerator innovations at LAMPF; (5) photons and pions; (6) muons as nuclear probes; (7) nuclear chemistry; (8) radiobiology and medical applications; (9) radioisotope production; (10) materials testing; and (11) LAMPF management and users group. (PMA)

  18. Remarks on the exotic U-meson

    International Nuclear Information System (INIS)

    Chan Hongmo; Tsou Sheungtsun


    In expectation of imminent results from the new hyperon beam experiment at CERN concerning the exotic U-meson at 3.1 GeV, we propose a detailed program of experimental tests to check the suggestion that U is a qqq-barq-bar ''M-diquonium'' state. Apart from some very characteristic decay modes, the U is expected to occur together with several analogous states with various quantum numbers to which it is intimately related. (author)

  19. Non-conventional mesons at PANDA

    International Nuclear Information System (INIS)

    Giacosa, Francesco


    Non-conventional mesons, such as glueballs and tetraquarks, will be in the focus of the PANDA experiment at the FAIR facility. In this lecture we recall the basic properties of QCD and describe some features of unconventional states. We focus on the search of the not-yet discovered glueballs and the use of the extended Linear Sigma Model for this purpose, and on the already discovered but not-yet understood X, Y, Z states. (paper)

  20. Bubble chamber: D meson production and decay

    CERN Multimedia


    This event shows real particle tracks from the Big European Bubble Chamber (BEBC), which was used to observe neutrino and hadron beams between 1973 and 1984 from the PS and SPS accelerators. In this event a neutrino interacts with a proton producing an excited D meson. A labeled diagram is seen on the right as the particles spiral in the magnetic field of the detector.

  1. B meson physics and related new physics

    International Nuclear Information System (INIS)

    Tanimoto, Morimitsu


    We have surveyed the some models focusing on the mixings, the CP violation and the rare decay in the B meson system. The ARGUS data of the B d 0 -B-bar d 0 mixing gives us some constraints as to parameters of these models. Especially, we have investigated the composite scale in detail using the ARGUS data of the B d 0 -B-bar d 0 mixing and obtained some interesting results. (author)

  2. LAMPF: the meson factory. A LASL monograph

    International Nuclear Information System (INIS)

    Allred, J.C.


    A general and simplified introduction to the entire concept of LAMPF is given in terms of its experimental capabilities. Parts of the current experimental program are used as illustrative examples. Topics discussed include: (1) the evolution of the meson factory; (2) accelerator construction; (3) strong focusing; (4) accelerator innovations at LAMPF; (5) photons and pions; (6) muons as nuclear probes; (7) nuclear chemistry; (8) radiobiology and medical applications; (9) radioisotope production; (10) materials testing; and (11) LAMPF management and users group

  3. Hypernuclear physics with a neutral meson spectrometer

    International Nuclear Information System (INIS)

    Peng, J.C.


    The (K - , π degrees) reaction, which complements the (K - , π - ) and the (π + , K + ) reactions, offers another means to study hypernuclear physics. The physics motivation for measuring the (K - , π degrees) reaction is discussed. The feasibility for detecting π degrees using the LAMPF Neutral Meson Spectrometer is studied with Monte-Carlo simulations. We conclude that the (K - , π degrees) reaction can be well measured at existing kaon beam lines

  4. Quark-hadron duality in meson physics

    International Nuclear Information System (INIS)

    Anisovich, V.V.


    Quark hadron dualism is discussed, based on observing the changes in the quark model characteristics after the inclusion into hadron degrees of freedom. A standard version of the potential model is presented. The potential which is responsible for the formation of mesons may be divided into two pieces: a short-range part for distances about 0.3 - 0.5 fm and a long-range part at distances more than 1 fm. (R.P.). 5 refs., 2 figs

  5. Quark-hadron duality in meson physics

    Energy Technology Data Exchange (ETDEWEB)

    Anisovich, V.V. [Petersburg Nuclear Physics Inst., Gatchina (Russian Federation)


    Quark hadron dualism is discussed, based on observing the changes in the quark model characteristics after the inclusion into hadron degrees of freedom. A standard version of the potential model is presented. The potential which is responsible for the formation of mesons may be divided into two pieces: a short-range part for distances about 0.3 - 0.5 fm and a long-range part at distances more than 1 fm. (R.P.). 5 refs., 2 figs.

  6. Experimental status of scalar and tensor mesons

    International Nuclear Information System (INIS)

    Von Dombrowski, S.


    The recent discoveries of a 0 (1450) and f 0 (1370)/f 0 (1500) in antiproton-proton annihilation at rest shed new light on the interpretation of light scalar mesons. The properties of f 0 (1500) match the expectations of a scalar glueball mixed with nearby qq states. New decay modes of the ξ(2230) are reported in radiative J/Ψ decays, pointing also towards a (tensor) glueball nature of this state. Results from different experiments are discussed and compared. (orig.)

  7. Tai Chi Chuan Exercise for Patients with Cardiovascular Disease

    Directory of Open Access Journals (Sweden)

    Ching Lan


    Full Text Available Exercise training is the cornerstone of rehabilitation for patients with cardiovascular disease (CVD. Although high-intensity exercise has significant cardiovascular benefits, light-to-moderate intensity aerobic exercise also offers health benefits. With lower-intensity workouts, patients may be able to exercise for longer periods of time and increase the acceptance of exercise, particularly in unfit and elderly patients. Tai Chi Chuan (Tai Chi is a traditional Chinese mind-body exercise. The exercise intensity of Tai Chi is light to moderate, depending on its training style, posture, and duration. Previous research has shown that Tai Chi enhances aerobic capacity, muscular strength, balance, and psychological well-being. Additionally, Tai Chi training has significant benefits for common cardiovascular risk factors, such as hypertension, diabetes mellitus, dyslipidemia, poor exercise capacity, endothelial dysfunction, and depression. Tai Chi is safe and effective in patients with acute myocardial infarction (AMI, coronary artery bypass grafting (CABG surgery, congestive heart failure (HF, and stroke. In conclusion, Tai Chi has significant benefits to patients with cardiovascular disease, and it may be prescribed as an alternative exercise program for selected patients with CVD.

  8. Κ-meson decays and parity violation

    International Nuclear Information System (INIS)

    Dalitz, R.H.


    Between 1948 and 1954 many Κ-meson decay modes were observed, including the tau, pion and xi positives, in emulsion experiments all with masses around 500 MeV. An attempt was made to rationalize the various names for the new particles being discovered. A period of experimental consolidation followed. An attempt was then made to determine the spin parity of the three-pion system from tau plus decay using matrix calculations. New stripped emulsion techniques now permitted a secondary-particle track to be followed to its endpoint. Stacked emulsions were flown in balloons to study Κ mesons and hyperons using cosmic radiation. Later similar work used the new particle accelerators, the Cosmotron and the Bevatron as sources. The author showed that the tau plus and theta plus were competing decay modes of the same Κ + meson, but this meant that parity conservation was violated. Later theoreticians T D Lee and C N Yang provided evidence for this surprising idea from their work on semileptonic weak interactions. (UK)

  9. D mesons in asymmetric nuclear matter

    International Nuclear Information System (INIS)

    Mishra, Amruta; Mazumdar, Arindam


    We calculate the in-medium D and D meson masses in isospin-asymmetric nuclear matter in an effective chiral model. The D and D mass modifications arising from their interactions with the nucleons and the scalar mesons in the effective hadronic model are seen to be appreciable at high densities and have a strong isospin dependence. These mass modifications can open the channels of the decay of the charmonium states (Ψ ' ,χ c ,J/Ψ) to DD pairs in dense hadronic matter. The isospin asymmetry in the doublet D=(D 0 ,D + ) is seen to be particularly appreciable at high densities and should show in observables such as their production and flow in asymmetric heavy-ion collisions in the compressed baryonic matter experiments in the future facility of FAIR, GSI. The results of the present work are compared to calculations of the D(D) in-medium masses in the literature using the QCD sum rule approach, quark meson coupling model, and coupled channel approach as well as to those from studies of quarkonium dissociation using heavy-quark potentials from lattice QCD at finite temperatures

  10. Phases, quantum interferences and effective vector meson masses in nuclei

    Energy Technology Data Exchange (ETDEWEB)

    Soyeur, M.


    We discuss the prospects for observing the mass of {rho}- and {omega}-mesons around nuclear matter density by studying their coherent photoproduction in nuclear targets and subsequent in-medium decay into e{sup +}e{sup -}pairs. The quantum interference of {rho} and {omega}-mesons in the e{sup +}e{sup -}channel and the interference between Bethe-Heitler pairs and dielectrons from vector meson decays are of particular interest. (author). 21 refs.

  11. On the mesonic-exchange currents in the photomesic reactions

    International Nuclear Information System (INIS)

    Lazard, C.; Maric, Z.; Zivanovic, D.


    The γd→π 0 d reaction is analysed in the framework of the relativistic many-body theory with mesonic degrees of freedom explicitly present. It is shown that the mesonic correlations can be grouped into transition operators containing vertices of some elementary reactions between photon, nucleons and pions. The wave function corrections due to meson exchange currents are included in the transition operators and the S-matrix is obtained with the non relativistic deuteron wave function

  12. The Rainich problem for coupled gravitational and scalar meson fields

    International Nuclear Information System (INIS)

    Hyde, J.M.


    The equations of the coupled gravitational and scalar meson fields in general relativity are considered. It is shown that the wave equation for the scalar meson field which is usually specified explicitly in addition to the Einstein field equations is implied by Einstein's equations. Using this result it is then shown how the scalar field may be eliminated explicitly from the field equations, thus solving the Rainich problem for the coupled gravitational and scalar meson fields. (author) [fr

  13. Inclusive spectra of hadrons in B-meson decays

    International Nuclear Information System (INIS)

    Dobrovol'skaya, A.V.; Ter-Martirosyan, K.A.; Zoller, V.R.


    The inclusive spectra of hadrons (mainly pions) produced in the semileptonic and nonleptonic decays of B-mesons are calculated. Parameters of spectra for different types of hard qq-bar-strings, appearing in the B-meson decays, are determined using the data on e+e-annihilation. Numerical results for B-meson decay induced by both b→b and b→u transitions are presented. 10 refs.; 5 figs

  14. Decays of mesons with charm quarks on the lattice

    International Nuclear Information System (INIS)

    Ali Khan, A.; Braun, V.; Burch, T.; Goeckeler, M.; Schaefer, A.; Schierholz, G.


    We investigate mesons containing charm quarks on fine lattices with a -1 ∝ 5 GeV. The quenched approximation is employed using theWilson gauge action at β = 6.6 and nonperturbatively O(a) improvedWilson quarks. We present results for decay constants using various interpolating fields and give preliminary results for form factors of semileptonic decays of D s mesons to light pseudoscalar mesons. (orig.)

  15. Finite temperature QCD sum rule and the ρ-meson

    International Nuclear Information System (INIS)

    Liu Jueping; Jin Yaping


    The contributions from the three-gluon condensates to the finite temperature QCD sum rule for the ρ-meson are calculated, and then the dependence of the properties of the ρ-meson upon temperature is investigated in a string model of condensates. The results show that the parameters characterizing the properties of the ρ-meson change noticeably when the temperature closes to the critical temperature of the condensates, and if the critical temperatures of condensates are the same

  16. Asymptotic energy scale factors for pseudoscalar meson scattering and charmed meson couplings

    International Nuclear Information System (INIS)

    Thews, R.L.


    Energy scale factors ν 0 for PP → PP scattering amplitudes are related via absence of exotic resonances of ratios of tensor to vector coupling strengths. These same ratios are extracted from FESR's for non-exotic reactions. The scale factors obtained are all of the order of 1.0 GeV 2 or less, indepedent of quantum numbers. This contradicts the expectations of dual amplitudes in which ν 0 =1/α', and trajectory slopes are smaller for charmed mesons. Decay widths for tensor mesons are predicted. An observed SU(3) violation for the ratio A 2 → KantiK/K** → Kπ is shown to be consistent with the FESR results. Charmed meson decays are predicted to be factors of 2 to 3 larger than those predicted by SU(4). (author)

  17. Antiproton-proton annihilation into light neutral meson pairs within an effective meson theory (United States)

    Wang, Ying; Bystritskiy, Yury M.; Ahmadov, Azad I.; Tomasi-Gustafsson, Egle


    Antiproton-proton annihilation into light neutral mesons in the few GeV energy domain is investigated in view of a global description of the existing data and predictions for future work at the Antiproton Annihilation at Darmstadt (PANDA) experiment at the Facility for Antiproton and Ion Research (FAIR). An effective meson model earlier developed, with mesonic and baryonic degrees of freedom in s , t , and u channels, is applied here to π0π0 production. Form factors with logarithmic s and t (u ) dependencies are applied. A fair agreement with the existing angular distributions is obtained. Applying SU(3) symmetry, it is straightforward to recover the angular distributions for π0η and η η production in the same energy range. A good agreement is generally obtained with all existing data.

  18. From meson- and photon-nucleon scattering to vector mesons in nuclear matter

    International Nuclear Information System (INIS)

    Wolf, Gy.; Lutz, M.F.M.; Friman, B.


    A relativistic and unitary approach to pion- and photon-nucleon scattering taking into account the πN, ρN, ωN, ηN, πΔ, KΛ and KΣ channels is presented. The scheme dynamically generates the s- and d-wave baryon resonances N(1535), N(1650), N(1520) and N(1700) and as well as Δ(1620) and Δ(1700) in terms of quasi-local two-body interaction terms. A fair description of the experimental data relevant to the properties of slow vector mesons in nuclear matter is obtained. The resulting s-wave ρ- and ω-meson-nucleon scattering amplitudes which define the leading density modification of the ρ- and ω-meson spectral functions in nuclear matter are presented. (author)

  19. Spin information from vector-meson decay in photoproduction

    International Nuclear Information System (INIS)

    Kloet, W.M.; Chiang, W.; Tabakin, F.


    For the photoproduction of vector mesons, all single and double spin observables involving vector-meson two-body decays are defined consistently in the γN center-of-mass frame. These definitions yield a procedure for extracting physically meaningful single and double spin observables that are subject to known rules concerning their angle and energy evolution. As part of this analysis, we show that measuring the two-meson decay of a photo produced ρ or φ does not determine the vector meson's vector polarization, but only its tensor polarization. The vector meson decay into lepton pairs is also insensitive to the vector meson's vector polarization, unless one measures the spin of one of the leptons. Similar results are found for all double spin observables which involve observation of vector-meson decay. To access the vector meson's vector polarization, one therefore needs to either measure the spin of the decay leptons, make an analysis of the background interference effects, or relate the vector meson's vector polarization to other accessible spin observables. copyright 1998 The American Physical Society

  20. Photoproduction of vector mesons off nucleons near threshold

    International Nuclear Information System (INIS)

    Friman, B.; Soyeur, M.


    We propose a simple meson-exchange model of the photoproduction of ρ-and ω-mesons off protons near threshold (E γ < or∼2 GeV). We show that this model provides a good description of the available data and implies a large ρ-nucleon interaction in the scalar channel (σ-exchange). We use this phenomenological interaction to estimate the leading contribution to the self-energy of ρ-mesons in matter. We discuss the implications of our calculation for experimental studies of the ρ-meson mass in nuclei. (orig.)

  1. Search for gluonic excitations in light unconventional mesons

    Energy Technology Data Exchange (ETDEWEB)

    Paul Eugenio


    Studies of meson spectra via strong decays provide insight regarding QCD at the confinement scale. These studies have led to phenomenologicalmodels for QCD such as the constituent quark model. However, QCD allows for a much richer spectrum of meson states which include extra states such as exotics, hybrids, multi-quarks, and glueballs. First discussion of the status of exotic meson searches is given followed by a discussion of plans at Jefferson Lab to double the energy of the machine to 12 GeV, which will allow us to access photoproduction of mesons in search for gluonic excited states.

  2. The Meson Spectroscopy Program at the Jefferson Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Filippi, Alessandro [Istituto Nazionale di Fisica Nucleare (INFN), Torino (Italy). et al.


    The experimental techniques that will be applied by the next generation meson spectroscopy experiments at JLab are described. For the first time, these experiments will be able to exploit the features of a photon beam of unprecedented intensity and momentum resolution, that will allow to perform precision studies of meson states with masses below 3 GeV/c2. Photon induced reactions will enhance the production of spin-1 mesons, that are of particular interest according to the most recent Lattice QCD calculations of the lightest exotic hybrid meson.

  3. Photoproduction of vector mesons off nucleons near threshold

    International Nuclear Information System (INIS)

    Friman, B.


    A simple meson-exchange model is proposed for the photoproduction of ρ- and ω-mesons off protons near threshold. This model provides a good description of the available data and implies a large ρ-nucleon interaction in the scalar channel (σ-exchange). This phenomenological interaction is applied to estimate the leading contribution to the self-energy of ρ-mesons in matter. The implications of our calculation for experimental studies of the ρ-meson mass in nuclei are discussed. (author)

  4. Meson masses and decay constants from unquenched lattice QCD

    Energy Technology Data Exchange (ETDEWEB)

    Jansen, K. [Deutsches Elektronen-Synchrotron (DESY), Zeuthen (Germany); McNeile, C. [Glasgow Univ. (United Kingdom). Dept. of Physics and Astronomy; Michael, C. [Liverpool Univ. (United Kingdom). Theoretical Physics Div., Dept. of Mathematical Sciences; Urbach, C. [Humboldt Univ. Berlin (Germany). Inst. fuer Physik


    We report results for the masses of the flavour non-singlet light 0{sup ++}, 1{sup --}, and 1{sup +-} mesons from unquenched lattice QCD at two lattice spacings. The twisted mass formalism was used with two flavours of sea quarks. For the 0{sup ++} and 1{sup +-} mesons we look for the effect of decays on the mass dependence. For the light vector mesons we study the chiral extrapolations of the mass. We report results for the leptonic and transverse decay constants of the meson. We test the mass dependence of the KRSF relations. (orig.)

  5. Scattering amplitudes to all orders in meson exchange

    International Nuclear Information System (INIS)

    Silbar, R.R.; Mattis, M.P.


    As the number of colors in QCD, N C , becomes large, it is possible to sum up all meson-exchange contributions, however arbitrarily complicated, to meson-baryon and baryon-baryon scattering. A semi-classical structure for the two-flavor theory emerges, in close correspondence to vector-meson-augmented Skyrme models. In this limit, baryons act as extended static sources for the classical meson fields. This leads to non-linear differential equations for the classical meson fields which can be solved numerically for static radial (hedgehog-like) solutions. The non-linear terms in the equations of motion for the quantized meson fields can then be simplified, to leading order in 1/N C , by replacing all factors of the meson field but one by the previously-found classical field. This results in linear, Schroedinger-like equations, which are easily solved. For the meson-baryon case the solution can be subsequently analyzed to obtain the phase shifts for the scattering and, from these, the baryon resonance spectrum of the model. As the warm-up, we have carried out this calculation for the simple case of σ mesons only, finding sensible results. 8 refs., 3 figs

  6. Meson masses and decay constants from unquenched lattice QCD

    International Nuclear Information System (INIS)

    Jansen, K.; McNeile, C.; Michael, C.; Urbach, C.


    We report results for the masses of the flavour non-singlet light 0 ++ , 1 -- , and 1 +- mesons from unquenched lattice QCD at two lattice spacings. The twisted mass formalism was used with two flavours of sea quarks. For the 0 ++ and 1 +- mesons we look for the effect of decays on the mass dependence. For the light vector mesons we study the chiral extrapolations of the mass. We report results for the leptonic and transverse decay constants of the meson. We test the mass dependence of the KRSF relations. (orig.)

  7. Search for rare B meson decays into D+s mesons

    International Nuclear Information System (INIS)

    Albrecht, H.; Ehrlichmann, H.; Hamacher, T.


    A search has been performed for rare B meson decays into D s + mesons arising from b → u transitions, W exchange modes, B + annihilation processes, and decays where the D s + is not produced via a W → c anti s quark pair coupling, using the ARGUS detector operating on the Y(4S) resonance at the e + e - storage ring DORIS II. Upper limits for individual decay modes are obtained. In addition, from a study of D s + l - correlations an upper limit of BR(B → D s + l - X) < 1.2% (90% CL) is determined. (orig.)

  8. Chi-square test and its application in hypothesis testing

    Directory of Open Access Journals (Sweden)

    Rakesh Rana


    Full Text Available In medical research, there are studies which often collect data on categorical variables that can be summarized as a series of counts. These counts are commonly arranged in a tabular format known as a contingency table. The chi-square test statistic can be used to evaluate whether there is an association between the rows and columns in a contingency table. More specifically, this statistic can be used to determine whether there is any difference between the study groups in the proportions of the risk factor of interest. Chi-square test and the logic of hypothesis testing were developed by Karl Pearson. This article describes in detail what is a chi-square test, on which type of data it is used, the assumptions associated with its application, how to manually calculate it and how to make use of an online calculator for calculating the Chi-square statistics and its associated P-value.

  9. Pronto chi parla. Cesare e le intercettazioni telefoniche

    Directory of Open Access Journals (Sweden)

    Paolo Caponi


    Full Text Available Pronto chi parla. Cesare e le intercettazioni telefoniche (Ugo Guspini, L’orecchio del regime. Le intercettazioni telefoniche al tempo del fascismo, Milano, Mursia, 1973, pp. 262 di Paolo Caponi

  10. Health benefits of tai chi: What is the evidence? (United States)

    Huston, Patricia; McFarlane, Bruce


    To summarize the evidence on the health benefits of tai chi. A literature review was conducted on the benefits of tai chi for 25 specific conditions, as well as for general health and fitness, to update a 2014 review of systematic reviews. Systematic reviews and recent clinical trials were assessed and organized into 5 different groups: evidence of benefit as excellent, good, fair, or preliminary, or evidence of no direct benefit. During the past 45 years more than 500 trials and 120 systematic reviews have been published on the health benefits of tai chi. Systematic reviews of tai chi for specific conditions indicate excellent evidence of benefit for preventing falls, osteoarthritis, Parkinson disease, rehabilitation for chronic obstructive pulmonary disease, and improving cognitive capacity in older adults. There is good evidence of benefit for depression, cardiac and stroke rehabilitation, and dementia. There is fair evidence of benefit for improving quality of life for cancer patients, fibromyalgia, hypertension, and osteoporosis. Current evidence indicates no direct benefit for diabetes, rheumatoid arthritis, or chronic heart failure. Systematic reviews of general health and fitness benefits show excellent evidence of benefit for improving balance and aerobic capacity in those with poor fitness. There is good evidence for increased strength in the lower limbs. There is fair evidence for increased well-being and improved sleep. There were no studies that found tai chi worsened a condition. A recent systematic review on the safety of tai chi found adverse events were typically minor and primarily musculoskeletal; no intervention-related serious adverse events have been reported. There is abundant evidence on the health and fitness effects of tai chi. Based on this, physicians can now offer evidence-based recommendations to their patients, noting that tai chi is still an area of active research, and patients should continue to receive medical follow-up for any

  11. Tai Chi for chronic obstructive pulmonary disease (COPD). (United States)

    Ngai, Shirley P C; Jones, Alice Y M; Tam, Wilson Wai San


    Tai Chi, a systematic callisthenic exercise first developed in ancient China, involves a series of slow and rhythmic circular motions. It emphasises use of 'mind' or concentration to control breathing and circular body motions to facilitate flow of internal energy (i.e. 'qi') within the body. Normal flow of 'qi' is believed to be essential to sustain body homeostasis, ultimately leading to longevity. The effect of Tai Chi on balance and muscle strength in the elderly population has been reported; however, the effect of Tai Chi on dyspnoea, exercise capacity, pulmonary function and psychosocial status among people with chronic obstructive pulmonary disease (COPD) remains unclear. • To explore the effectiveness of Tai Chi in reducing dyspnoea and improving exercise capacity in people with COPD.• To determine the influence of Tai Chi on physiological and psychosocial functions among people with COPD. We searched the Cochrane Airways Group Specialised Register of trials (which included the Cochrane Central Register of Controlled Trials (CENTRAL), MEDLINE, EMBASE, the Cumulative Index to Nursing and Allied Health Literature (CINAHL), the Allied and Complementary Medicine Database (AMED) and PsycINFO); handsearched respiratory journals and meeting abstracts; and searched Chinese medical databases including Wanfang Data, Chinese Medical Current Contents (CMCC), Chinese Biomedical Database (CBM), China Journal Net (CJN) and China Medical Academic Conference (CMAC), from inception to September 2015. We checked the reference lists of all primary studies and review articles for relevant additional references. We included randomised controlled trials (RCTs) comparing Tai Chi (Tai Chi alone or Tai Chi in addition to another intervention) versus control (usual care or another intervention identical to that used in the Tai Chi group) in people with COPD. Two independent review authors screened and selected studies. Two independent review authors extracted data from included

  12. From Tornadoes to Earthquakes: Forecast Verification for Binary Events Applied to the 1999 Chi-Chi, Taiwan,Earthquake

    Directory of Open Access Journals (Sweden)

    Chien-Chih Chen


    Full Text Available Forecast verification procedures for statistical events with binary outcomes typically rely on the use of contingency tables and Relative Operating Characteristic (ROC diagrams. Originally developed for the statistical evaluation of tornado forecasts on a county-by-county basis, these methods can be adapted to the evaluation of competing earthquake forecasts. Here we apply these methods retrospectively to two forecasts for the M 7.3 1999 Chi-Chi, Taiwan, earthquake. We show that a previously proposed forecast method that is based on evaluating changes in seismic intensity on a regional basis is superior to a forecast based only on the magnitude of seismic intensity in the same region. Our results confirm earlier suggestions that the earthquake preparation process for events such as the Chi-Chi earthquake involves anomalous activation or quiescence, and that signatures of these processes can be detected in seismicity data using appropriate methods.

  13. In-medium QCD sum rules for {omega} meson, nucleon and D meson

    Energy Technology Data Exchange (ETDEWEB)

    Thomas, Ronny


    The modifications of hadronic properties caused by an ambient nuclear medium are investigated within the scope of QCD sum rules. This is exemplified for the cases of the {omega} meson, the nucleon and the D meson. By virtue of the sum rules, integrated spectral densities of these hadrons are linked to properties of the QCD ground state, quantified in condensates. For the cases of the {omega} meson and the nucleon it is discussed how the sum rules allow a restriction of the parameter range of poorly known four-quark condensates by a comparison of experimental and theoretical knowledge. The catalog of independent four-quark condensates is covered and relations among these condensates are revealed. The behavior of four-quark condensates under the chiral symmetry group and the relation to order parameters of spontaneous chiral symmetry breaking are outlined. In this respect, also the QCD condensates appearing in differences of sum rules of chiral partners are investigated. Finally, the effects of an ambient nuclear medium on the D meson are discussed and relevant condensates are identified. (orig.)

  14. Chiral Quark-Meson model of N and DELTA with vector mesons

    International Nuclear Information System (INIS)

    Broniowski, W.; Banerjee, M.K.


    Vector mesons rho, A 1 and ω are introduced in the Chiral Quark-Meson Theory (CQMT) of N and Δ. We propose a new viewpoint for developing CQMT from QCD at the mean-field level. The SU(2) x SU(2) chiral Lagrangian incorporates universal coupling. Accordingly, rho is coupled to the conserved isospin current, A to the partially conserved axial-vector current (PCAC), and ω to the conserved baryon current. As a result the only parameter of the model not directly related to experiment is the quark-pion coupling constant. A fully self-consistent mean-field solution to the model is found for fields in the hedgehog ansatz. The vector mesons play a very important role in the system. They contribute significantly to the values of observables and produce a high-quality fit to many data. The classical stability of the system with respect to hedgehog excitations is analyzed through the use of the Quark-Meson RPA equations (QMRPA)

  15. Simplified Tai Chi Program Training versus Traditional Tai Chi on the Functional Movement Screening in Older Adults

    Directory of Open Access Journals (Sweden)

    Huiru Wang


    Full Text Available Background. The present study aimed to evaluate and compare the effect of two different types of Tai Chi programs on the Functional Movement Screening (FMS in older adults. Methods. Ninety older adults (65.5 ± 4.6 years old who met the eligibility criteria were randomized into three different groups based on a ratio of 1 : 1 : 1: a traditional Tai Chi exercise (TTC, a simplified Tai Chi exercise (TCRT, or a control group (routine activity. The FMS consisted of the deep squat, hurdle step, in-line lunge, shoulder mobility, active straight leg rise, trunk stability push-up, and rotatory stability, which was used to measure physical function before the present study and after six months of Tai Chi interventions. Results. Seventy-nine participants completed the present study (control = 27, TTC = 23, and TCRT = 29. Significant improvement on the FMS tests between the baseline and after the six-month intervention was observed in both Tai Chi programs, whereas no significant improvement was observed in the control group. In addition, participants in the TCRT group demonstrated greater improvement than those in the TTC group. Conclusions. The TCRT is more effective in improving the physical function in older adults when compared to the traditional Tai Chi modality, particularly for improving balance.

  16. Relating Trp-Glu dipeptide fluorescence to molecular conformation: the role of the discrete Chi 1 and Chi 2 angles. (United States)

    Eisenberg, Azaria Solomon; Juszczak, Laura J


    Molecular dynamics (MD), coupled with fluorescence data for charged dipeptides of tryptophanyl glutamic acid (Trp-Glu), reveal a detailed picture of how specific conformation affects fluorescence. Fluorescence emission spectra and time-resolved emission measurements have been collected for all four charged species. MD simulations 20 to 30 ns in length have also been carried out for the Trp-Glu species, as simulation provides aqueous phase conformational data that can be correlated with the fluorescence data. The calculations show that each dipeptide species is characterized by a similar set of six, discrete Chi 1, Chi 2 dihedral angle pairs. The preferred Chi 1 angles--60°, 180°, and 300°--play the significant role in positioning the terminal amine relative to the indole ring. A Chi 1 angle of 60° results in the arching of the backbone over the indole ring and no interaction of the ring with the terminal amine. Chi 1 values of 180° and 300° result in an extension of the backbone away from the indole ring and a NH3 cation-π interaction with indole. This interaction is believed responsible for charge transfer quenching. Two fluorescence lifetimes and their corresponding amplitudes correlate with the Chi 1 angle probability distribution for all four charged Trp-Glu dipeptides. Fluorescence emission band maxima are also consistent with the proposed pattern of terminal amine cation quenching of fluorescence. Copyright © 2013 Wiley Periodicals, Inc.

  17. On the spin-parity of a E(1420) meson

    International Nuclear Information System (INIS)

    Asatryan, G.M.; Zaslavskij, A.N.


    The phenomenological analysis of data on the E(1420)-meson decay is carried out. The Adair distribution are constructed for the decays E→deltaπ, K* anti K(antiK*K), K anti K π, νππ in different reactions: the correlations in which the spin of E-meson is most explicitely manifested are marked

  18. {pi}{eta} pair hard electroproduction and exotic hybrid mesons

    Energy Technology Data Exchange (ETDEWEB)

    Anikin, I.V. [LPT, Universite Paris-Sud, 91405-Orsay, France, UMR 8627 du CNRS (France); BLTP, JINR, 141980 Dubna (Russian Federation); CPHT, Ecole Polytechnique, 91128 Palaiseau, France, UMR 7644 du CNRS (France); Pire, B. [CPHT, Ecole Polytechnique, 91128 Palaiseau, France, UMR 7644 du CNRS (France); Szymanowski, L. [Soltan Institute for Nuclear Studies, Warsaw (Poland) and Univ. de Liege, B-4000 Liege (Belgium); Teryaev, O.V. [BLTP, JINR, 141980 Dubna (Russian Federation); Wallon, S. [LPT, Universite Paris-Sud, 91405-Orsay, France, UMR 8627 du CNRS (France)


    We show that hard electroproduction is a promising way to study exotic hybrid mesons, in particular through the hybrid decay channel H->{pi}{eta}. We discuss the {pi}{eta} generalized distribution amplitude, calculate the production amplitude and propose a forward-backward asymmetry as a signal for the hybrid meson production.

  19. πη pair hard electroproduction and exotic hybrid mesons

    International Nuclear Information System (INIS)

    Anikin, I.V.; Pire, B.; Szymanowski, L.; Teryaev, O.V.; Wallon, S.


    We show that hard electroproduction is a promising way to study exotic hybrid mesons, in particular through the hybrid decay channel H->πη. We discuss the πη generalized distribution amplitude, calculate the production amplitude and propose a forward-backward asymmetry as a signal for the hybrid meson production

  20. Recent trends in the mesonic description of nuclei

    International Nuclear Information System (INIS)

    Delorme, J.


    A survey is given of some recent developments in the domain of meson induced phenomena in nuclei. The manifestations of mesonic degrees of freedom are considered in the context of exchange currents as well as that of effective interactions. The significance of past successes is reexamined in the light of recent progress towards a QCD based nuclear theory

  1. Mesons versus quasi-normal modes: undercooling and overheating

    NARCIS (Netherlands)

    Paredes Galan, A.; Peeters, K.; Zamaklar, m.


    In holographic models of gauge theories with matter, there generically exists a first order phase transition in which mesons dissociate. We perform a careful analysis of the meson and quasi-particle spectra in the overheated resp. undercooled regimes close to the junction of the two phases. We show

  2. Limits on rare exclusive decays of B mesons

    International Nuclear Information System (INIS)

    Avery, P.; Besson, D.; Bowcock, T.; Giles, R.T.; Hassard, J.; Kinoshita, K.; Pipkin, F.M.; Wilson, R.; Wolinski, J.; Xiao, D.; Gentile, T.; Haas, P.; Hempstead, M.; Jensen, T.; Kagan, H.; Kass, R.; Behrends, S.; Guida, J.M.; Guida, J.A.; Morrow, F.; Poling, R.; Thorndike, E.H.; Tipton, P.; Alam, M.S.; Katayama, N.; Kim, I.J.; Sun, C.R.; Tanikella, V.; Bortoletto, D.; Chen, A.; Garren, L.; Goldberg, M.; Holmes, R.; Horwitz, N.; Jawahery, A.; Lubrano, P.; Moneti, G.C.; Sharma, V.; Csorna, S.E.; Mestayer, M.D.; Panvini, R.S.; Word, G.B.; Bean, A.; Bobbink, G.J.; Brock, I.C.; Engler, A.; Ferguson, T.; Kraemer, R.W.; Rippich, C.; Vogel, H.; Bebek, C.; Berkelman, K.; Blucher, E.; Cassel, D.G.; Copie, T.; DeSalvo, R.; DeWire, J.W.; Ehrlich, R.; Galik, R.S.; Gilchriese, M.G.D.; Gittelman, B.; Gray, S.W.; Halling, A.M.; Hartill, D.L.; Heltsley, B.K.; Holzner, S.; Ito, M.; Kandaswamy, J.; Kowalewski, R.; Kreinick, D.L.; Kubota, Y.; Mistry, N.B.; Mueller, J.; Namjoshi, R.; Nordberg, E.; Ogg, M.; Perticone, D.; Peterson, D.; Pisharody, M.; Read, K.; Riley, D.; Silverman, A.; Stone, S.; Yi Xia; Sadoff, A.J.


    We have set upper limits for rare exclusive decays of B mesons arising from higher order processes in the standard model of electroweak interactions. Such decays may occur via ''penguin diagrams'' in B decay. We also set an upper limit on a lepton-number-violating decay mode of the neutral B meson. (orig.)

  3. Electro- and chromomagnetism in the charm meson spectrum

    CERN Document Server

    Fritzsch, Harald


    How the D and F meson spectrum is influenced by the chromomagnetic and electromagnetic hyperfine interaction is discussed. In particular a relation between the hyperfine splitting of charmed mesons and the magnetic moments of the baryons is derived. It is found that M(F/sub + /*)-M(F/sub +/) approximately=100+or-8 MeV. (12 refs).

  4. Electro- and chromomagnetism in the charm meson spectrum

    International Nuclear Information System (INIS)

    Fritzsch, H.


    How the D and F meson spectrum is influenced by the chromomagnetic and electomagnetic hyperfine interaction is discussed. In particular a relation between the hyperfine splitting of charmed mesons and the magnetic moments of the baryons is derived. M(Fsub(+)*)-M(Fsub(+)) approximately 100+-8 MeV. (Auth.)

  5. Modification of the omega-meson lifetime in nuclear matter

    NARCIS (Netherlands)

    Kotulla, M.; Trnka, D.; Muehlich, P.; Anton, G.; Bacelar, J. C. S.; Bartholomy, O.; Bayadilov, D.; Beloglazov, Y. A.; Bogendoerfer, R.; Castelijns, R.; Crede, V.; Dutz, H.; Ehmanns, A.; Elsner, D.; Ewald, R.; Fabry, I.; Fuchs, M.; Essig, K.; Funke, Ch.; Gothe, R.; Gregor, R.; Gridnev, A. B.; Gutz, E.; Hoeffgen, S.; Hoffmeister, P.; Horn, I.; Hoessl, J.; Jaegle, I.; Junkersfeld, J.; Kalinowsky, H.; Klein, Frank; Klein, Fritz; Klempt, E.; Konrad, M.; Kopf, B.; Krusche, B.; Langheinrich, J.; Loehner, H.; Lopatin, I. V.; Lotz, J.; Lugert, S.; Menze, D.; Messchendorp, J. G.; Mertens, T.; Metag, V.; Mosel, U.; Nanova, M.; Novotny, R.; Ostrick, M.; Pant, L. M.; van Pee, H.; Pfeiffer, M.; Roy, A.; Radkov, A.; Schadmand, S.; Schmidt, Ch.; Schmieden, H.; Schoch, B.; Shende, S.; Suft, G.; Sumachev, V. V.; Szczepanek, T.; Suele, A.; Thoma, U.; Varma, R.; Walther, D.; Weinheimer, Ch.; Wendel, Ch.


    Information on hadron properties in the nuclear medium has been derived from the photoproduction of omega mesons on the nuclei C, Ca, Nb, and Pb using the Crystal Barrel/TAPS detector at the ELSA tagged photon facility in Bonn. The dependence of the omega-meson cross section on the nuclear mass

  6. First measurement of the B S meson mass (United States)

    Buskulic, D.; De Bonis, I.; Decamp, D.; Ghez, P.; Goy, C.; Lees, J.-P.; Minard, M.-N.; Pietrzyk, B.; Ariztizabal, F.; Comas, P.; Crespo, J. M.; Delfino, M.; Efthymiopoulos, I.; Fernandez, E.; Fernandez-Bosman, M.; Gaitan, V.; Garrido, Ll.; Mattison, T.; Pacheco, A.; Padilla, C.; Pascual, A.; Creanza, D.; de Palma, M.; Farilla, A.; Iaselli, G.; Maggi, G.; Natali, S.; Nuzzo, S.; Quattromini, M.; Ranieri, A.; Raso, G.; Romano, F.; Ruggieri, F.; Selvaggi, G.; Silvestris, L.; Tempesta, P.; Zito, G.; Chai, Y.; Hu, H.; Huang, D.; Huang, X.; Lin, J.; Wang, T.; Xie, Y.; Xu, D.; Xu, R.; Zhang, J.; Zhang, L.; Zhao, W.; Blucher, E.; Bonvicini, G.; Boudreau, J.; Casper, D.; Drevermann, H.; Forty, R. W.; Ganis, G.; Gay, C.; Hagelberg, R.; Harvey, J.; Haywood, S.; Hilgart, J.; Jacobsen, R.; Jost, B.; Knobloch, J.; Lehraus, I.; Lohse, T.; Maggi, M.; Markou, C.; Martinez, M.; Mato, P.; Meinhard, H.; Minten, A.; Miotto, A.; Miquel, R.; Moser, H.-G.; Palazzi, P.; Pater, J. R.; Perlas, J. A.; Pusztaszeri, J.-F.; Ranjard, F.; Redlinger, G.; Rolandi, L.; Rothberg, J.; Ruan, T.; Saich, M.; Schlatter, D.; Schmelling, M.; Sefkow, F.; Tejessy, W.; Veenhof, R.; Wachsmuth, H.; Wiedenmann, W.; Wildish, T.; Witzeling, W.; Wotschack, J.; Ajaltouni, Z.; Badaud, F.; Bardadin-Otwinowska, M.; El Fellous, R.; Falvard, A.; Gay, P.; Guicheney, C.; Henrard, P.; Jousset, J.; Michel, B.; Montret, J.-C.; Pallin, D.; Perret, P.; Podlyski, F.; Proriol, J.; Prulhière, F.; Saadi, F.; Fearnley, T.; Hansen, J. D.; Hansen, J. R.; Hansen, P. H.; Møllerud, R.; Nilsson, B. S.; Kyriakis, A.; Simopoulou, E.; Vayaki, A.; Zachariadou, K.; Badier, J.; Blondel, A.; Bonneaud, G.; Brient, J. C.; Fouque, G.; Orteu, S.; Rougé, A.; Rumpf, M.; Tanaka, R.; Verderi, M.; Videau, H.; Candlin, D. J.; Parsons, M. I.; Veitch, E.; Focardi, E.; Moneta, L.; Parrini, G.; Corden, M.; Georgiopoulos, C.; Ikeda, M.; Lannutti, J.; Levinthal, D.; Sawyer, L.; Wasserbaech, S.; Antonelli, A.; Baldini, R.; Bencivenni, G.; Bologna, G.; Bossi, F.; Campana, P.; Capon, G.; Cerutti, F.; Chiarella, V.; D'Ettorre-Piazzoli, B.; Felici, G.; Laurelli, P.; Mannocchi, G.; Murtas, F.; Murtas, G. P.; Passalacqua, L.; Pepe-Altarelli, M.; Picchi, P.; Colrain, P.; ten Have, I.; Lynch, J. G.; Maitland, W.; Morton, W. T.; Raine, C.; Reeves, P.; Scarr, J. M.; Smith, K.; Smith, M. G.; Thompson, A. S.; Turnbull, R. M.; Brandl, B.; Braun, O.; Geweniger, C.; Hanke, P.; Hepp, V.; Kluge, E. E.; Maumary, Y.; Putzer, A.; Rensch, B.; Stahl, A.; Tittel, K.; Wunsch, M.; Beuselinck, R.; Binnie, D. M.; Cameron, W.; Cattaneo, M.; Colling, D. J.; Dornan, P. J.; Greene, A. M.; Hassard, J. F.; Lieske, N. M.; Moutoussi, A.; Nash, J.; Patton, S.; Payne, D. G.; Phillips, M. J.; San Martin, G.; Sedgbeer, J. K.; Tomalin, I. R.; Wright, A. G.; Girtler, P.; Kneringer, E.; Kuhn, D.; Rudolph, G.; Bowdery, C. K.; Brodbeck, T. J.; Finch, A. J.; Foster, F.; Hughes, G.; Jackson, D.; Keemer, N. R.; Nuttall, M.; Patel, A.; Sloan, T.; Snow, S. W.; Whelan, E. P.; Kleinknecht, K.; Raab, J.; Renk, B.; Sander, H.-G.; Schmidt, H.; Steeg, F.; Walther, S. M.; Wanke, R.; Wolf, B.; Bencheikh, A. M.; Benchouk, C.; Bonissent, A.; Carr, J.; Coyle, P.; Drinkard, J.; Etienne, F.; Nicod, D.; Papalexiou, S.; Payre, P.; Roos, L.; Rousseau, D.; Schwemling, P.; Talby, M.; Adlung, S.; Assmann, R.; Bauer, C.; Blum, W.; Brown, D.; Cattaneo, P.; Dehning, B.; Dietl, H.; Dydak, F.; Frank, M.; Halley, A. W.; Jacobs, K.; Lauber, J.; Lütjens, G.; Lutz, G.; Männer, W.; Richter, R.; Schröder, J.; Schwarz, A. S.; Settles, R.; Seywerd, H.; Stierlin, U.; Stiegler, U.; St. Denis, R.; Wolf, G.; Alemany, R.; Boucrot, J.; Callot, O.; Cordier, A.; Davier, M.; Duflot, L.; Grivaz, J.-F.; Heusse, Ph.; Jaffe, D. E.; Janot, P.; Kim, D. W.; Le Diberder, F.; Lefrançois, J.; Lutz, A.-M.; Schune, M.-H.; Veillet, J.-J.; Videau, I.; Zhang, Z.; Abbaneo, D.; Bagliesi, G.; Batignani, G.; Bottigli, U.; Bozzi, C.; Calderini, G.; Carpinelli, M.; Ciocci, M. A.; Dell'Orso, R.; Ferrante, I.; Fidecaro, F.; Foà, L.; Forti, F.; Giassi, A.; Giorgi, M. A.; Gregorio, A.; Ligabue, F.; Lusiani, A.; Mannelli, E. B.; Marrocchesi, P. S.; Messineo, A.; Palla, F.; Rizzo, G.; Sanguinetti, G.; Spagnolo, P.; Steinberger, J.; Tenchini, R.; Tonelli, G.; Triggiani, G.; Vannini, C.; Venturi, A.; Verdini, P. G.; Walsh, J.; Betteridge, A. P.; Carter, J. M.; Gao, Y.; Green, M. G.; March, P. V.; Mir, Ll. M.; Medcalf, T.; Quazi, I. S.; Strong, J. A.; West, L. R.; Botterill, D. R.; Clifft, R. W.; Edgecock, T. R.; Norton, P. R.; Thompson, J. C.; Bloch-Devaux, B.; Colas, P.; Duarte, H.; Emery, S.; Kozanecki, W.; Lançon, E.; Lemaire, M. C.; Locci, E.; Marx, B.; Perez, P.; Rander, J.; Renardy, J.-F.; Rosowsky, A.; Roussarie, A.; Schuller, J.-P.; Schwindling, J.; Si Mohand, D.; Vallage, B.; Johnson, R. P.; Litke, A. M.; Taylor, G.; Wear, J.; Ashman, J. G.; Babbage, W.; Booth, C. N.; Buttar, C.; Cartwright, S.; Combley, F.; Dawson, I.; Thompson, L. F.; Barberio, E.; Böhrer, A.; Brandt, S.; Cowan, G.; Grupen, C.; Lutters, G.; Rivera, F.; Schäfer, U.; Smolik, L.; Bosisio, L.; Della Marina, R.; Giannini, G.; Gobbo, B.; Ragusa, F.; Bellantoni, L.; Chen, W.; Cinabro, D.; Conway, J. S.; Feng, Z.; Ferguson, D. P. S.; Gao, Y. S.; Grahl, J.; Harton, J. L.; LeClaire, B. W.; Lishka, C.; Pan, Y. B.; Saadi, Y.; Schmitt, M.; Sharma, V.; Shi, Z. H.; Walsh, A. M.; Weber, F. V.; Wu, Sau Lan; Wu, X.; Zheng, M.; Zobernig, G.


    In a sample of about 1.1 million hadronic Z decays recorded with the ALEPH detector during the 1990-1992 running of LEP, two unambiguous B S meson candidates were observed. From these events the mass of the B S meson has been measured to be 5.3686 ± 0.0056 (stat.) ± 0.0015 (syst.) GeV.

  7. Production of φ-Mesons in anti NN-Annihilation

    International Nuclear Information System (INIS)

    Sapozhnikov, M.G.


    Recent results from the experiments on the φ-meson production in the annihilation of stopped antiprotons have demonstrated a significant (by a factor of 30-50) violation of the OZI rule. Experimental information on the φ-meson production is discussed and possible theoretical explanations of the strong OZI rule violation are reviewed. 37 refs., 4 figs., 2 tabs

  8. Semileptonic B-meson decays in SU(3)

    International Nuclear Information System (INIS)

    Li Zuohong; Hou Yunzhi


    Based on the SU(3) approximate symmetry in the strong interaction three-body and four-body semileptonic B-meson decays are analyzed. Relations between decay rates are derived. Some of these relations may provide information on the nature of various competing dynamical effects that can occur in semileptonic B-meson decays

  9. Beauty vector meson decay constants from QCD sum rules

    Energy Technology Data Exchange (ETDEWEB)

    Lucha, Wolfgang [Institute for High Energy Physics, Austrian Academy of Sciences, Nikolsdorfergasse 18, A-1050 Vienna (Austria); Melikhov, Dmitri [Institute for High Energy Physics, Austrian Academy of Sciences, Nikolsdorfergasse 18, A-1050 Vienna (Austria); D. V. Skobeltsyn Institute of Nuclear Physics, M. V. Lomonosov Moscow State University, 119991, Moscow (Russian Federation); Simula, Silvano [Istituto Nazionale di Fisica Nucleare, Sezione di Roma Tre, Via della Vasca Navale 84, I-00146, Roma (Italy)


    We present the outcomes of a very recent investigation of the decay constants of nonstrange and strange heavy-light beauty vector mesons, with special emphasis on the ratio of any such decay constant to the decay constant of the corresponding pseudoscalar meson, by means of Borel-transformed QCD sum rules. Our results suggest that both these ratios are below unity.

  10. Mesonic and isobar modes in matter

    International Nuclear Information System (INIS)

    Riek, Felix C.


    Experiments with heavy ion collisions, like the ones performed at the GSI, are a tool to gain insight in the structure of matter. One key point needed to understand the experimental data is the theoretical description of the in medium properties of mesons and baryons. In this thesis we first developed a self-consistent description for the light vector mesons, ρ and ω, and the pion at finite temperature and in a baryon free environment. A generalisation of these calculations towards finite densities mandatorily needs a reliable description for the pion and the Δ(1232) resonance. Here we extended the approaches discussed in literature by the inclusion of vertex corrections and a selfconsistent and completely relativistic description. Within these models we were able to show that even at high temperatures the ρ-meson properties are not changed dramatically when temperature effects are considered only. In contrast to this the behaviour of the pion and the Δ-isobar is dramatically changed a finite density. The isobar mass-shift is given by an appropriate choice of the mean-fields. Therefore we can not draw a final conclusion about such shifts within our model. In order to do so more calculations, especially of the photo absorption on the nucleus, have to be performed. A further aspect of the calculations presented is that due to a consistent consideration of vertex corrections we were able to achieve a description of the Δ-resonance without the usually used soft formfactor. This is especially important for the in-medium calculations because only in this way we can guarantee that soft modes of the spectrum are treated consistently. The techniques developed within this thesis allow for a straight forward generalisation of the presented models with respect to the consideration of more resonances or couplings. Doing so the here obtained description of the in-medium properties of the considered particles can be refined. (orig.)

  11. Mesonic and isobar modes in matter

    Energy Technology Data Exchange (ETDEWEB)

    Riek, Felix C.


    Experiments with heavy ion collisions, like the ones performed at the GSI, are a tool to gain insight in the structure of matter. One key point needed to understand the experimental data is the theoretical description of the in medium properties of mesons and baryons. In this thesis we first developed a self-consistent description for the light vector mesons, {rho} and {omega}, and the pion at finite temperature and in a baryon free environment. A generalisation of these calculations towards finite densities mandatorily needs a reliable description for the pion and the {delta}(1232) resonance. Here we extended the approaches discussed in literature by the inclusion of vertex corrections and a selfconsistent and completely relativistic description. Within these models we were able to show that even at high temperatures the {rho}-meson properties are not changed dramatically when temperature effects are considered only. In contrast to this the behaviour of the pion and the {delta}-isobar is dramatically changed a finite density. The isobar mass-shift is given by an appropriate choice of the mean-fields. Therefore we can not draw a final conclusion about such shifts within our model. In order to do so more calculations, especially of the photo absorption on the nucleus, have to be performed. A further aspect of the calculations presented is that due to a consistent consideration of vertex corrections we were able to achieve a description of the {delta}-resonance without the usually used soft formfactor. This is especially important for the in-medium calculations because only in this way we can guarantee that soft modes of the spectrum are treated consistently. The techniques developed within this thesis allow for a straight forward generalisation of the presented models with respect to the consideration of more resonances or couplings. Doing so the here obtained description of the in-medium properties of the considered particles can be refined. (orig.)

  12. Recent developments at the TRIUMF meson factory

    International Nuclear Information System (INIS)

    Craddock, M.K.


    The TRIUMF meson factory, which is based on a 6-sector isochronous cyclotron accelerating H - ions to 520 MeV, has been operating since December 1974. Two proton beams are extracted simultaneously to feed the two experimental areas. Characteristics of the beams and beam lines are given. Work is also proceeding on (i) additional beam lines, (ii) a 180 kW beam dump and thermal neutron source, (iii) a medium resolution proton spectrometer, and (iv) adding third harmonic flat-topping to the RF to permit separation of the internal orbits and reduction of the energy spread of the extracted beam to 0.1 MeV. (author)

  13. Holographic corrections to meson scattering amplitudes

    Energy Technology Data Exchange (ETDEWEB)

    Armoni, Adi; Ireson, Edwin, E-mail:


    We compute meson scattering amplitudes using the holographic duality between confining gauge theories and string theory, in order to consider holographic corrections to the Veneziano amplitude and associated higher-point functions. The generic nature of such computations is explained, thanks to the well-understood nature of confining string backgrounds, and two different examples of the calculation in given backgrounds are used to illustrate the details. The effect we discover, whilst only qualitative, is re-obtainable in many such examples, in four-point but also higher point amplitudes.

  14. Spectroscopic properties of the B meson

    Directory of Open Access Journals (Sweden)

    Devlani Nayneshkumar


    Full Text Available Investigation of the B(bq̄; q = u, d meson properties is carried out using variational method within phenomenological quark antiquark potential(coulomb plus power model using the Gaussian wave function. O(1/m correction to the potential energy term and relativistic corrections to the kinetic energy term of the hamiltonian are incorporated. Spin-orbit, spin-spin and tensor interactions are employed to obtain the mass spectra. Various other properties such as the decay constants, e1 and m1 transitions are also obtained

  15. Tensor glueball-meson mixing phenomenology

    International Nuclear Information System (INIS)

    Burakovsky, L.; Page, P.R.


    The overpopulated isoscalar tensor states are sifted using Schwinger-type mass relations. Two solutions are found: one where the glueball is the f J (2220), and one where the glueball is more distributed, with f 2 (1820) having the largest component. The f 2 (1565) and f J (1710) cannot be accommodated as glueball-(hybrid) meson mixtures in the absence of significant coupling to decay channels. f 2 '(1525)→ππ is in agreement with experiment. The f J (2220) decays neither flavour democratically nor is narrow. (orig.)

  16. Strange mesons in dense nuclear matter

    International Nuclear Information System (INIS)

    Senger, P.


    Experimental data on the production of kaons and antikaons in heavy ion collisions at relativistic energies are reviewed with respect to in-medium effects. The K - /K + ratios measured in nucleus-nucleus collisions are 1-2 orders of magnitude larger than in proton-proton collisions. The azimuthal angle distributions of K + mesons indicate a repulsive kaon-nucleon potential. Microscopic transport calculations consistently explain both the yields and the emission patterns of kaons and antikaons when assuming that their properties are modified in dense nuclear matter. The K + production excitation functions measured in light and heavy collision systems provide evidence for a soft nuclear equation-of-state. (orig.)

  17. Theoretical aspects of light meson spectroscopy

    International Nuclear Information System (INIS)

    Barnes, T.; Univ. of Tennessee, Knoxville, TN


    In this pedagogical review the authors discuss the theoretical understanding of light hadron spectroscopy in terms of QCD and the quark model. They begin with a summary of the known and surmised properties of QCD and confinement. Following this they review the nonrelativistic quark potential model for q anti q mesons and discuss the quarkonium spectrum and methods for identifying q anti q states. Finally, they review theoretical expectations for non-q anti q states (glueballs, hybrids and multiquark systems) and the status of experimental candidates for these states

  18. Status of Meson Photoproduction Experiments with CLAS

    Energy Technology Data Exchange (ETDEWEB)

    Pasyuk, Eugene A.


    A large part of the experimental program in Hall B of the Jefferson Lab is dedicated to baryon spectroscopy. Meson photoproduction experiments are essential part of this program. CEBAF Large Acceptance Spectrometer (CLAS) and availability of circularly and linearly polarized tagged photon beams in combination with longitudinally and transversely polarized frozen spin targets provide unique conditions for this type of experiments. For the first time, a complete or nearly complete measurement became possible and will allow model independent extraction of the reaction amplitude. The measurements were complete with both proton and deuteron targets. An overview of the collected experimental data will be presented.

  19. Low-energy meson physics (chiral theory)

    International Nuclear Information System (INIS)

    Volkov, M.K.; Pervushin, V.N.


    A quantum chiral theory which allows to obtain low-energy expansions of various hadron processes without introducing arbitrary parameters into the theory with the exception of hadron masses and interaction constants is presented. A hypothesis about the dynamic symmetry of strong interactions is suggested. The interaction lagrangian is derived which satisfies conditions of the dynamic symmetry. Examples of the use of the quantum chiral theory for describing low-energy processes of meson interaction are given. It is noted that the results obtained reproduce the actual qualitative pattern of various physical processes and in most cases result in good quantitative agreement with experiments

  20. Heavy mesons in the bootstrap quark model

    International Nuclear Information System (INIS)

    Gerasyuta, S.M.; Sarantsev, A.V.


    In the frame of an approach developed for light quarks the scattering amplitudes of heavy quarks qQ-bar→qQ-bar→,QQ-bar→QQ-bar (q=u,d,s; Q=c,b,t) are calculated. The obtained mass values of the lowest c,b-mesons multiplets (J P =0 - ,1 - ,0 + ) are in a good agreement with the experimental ones. The masses of the new heavy particles with the t-quark are predicted. 46 refs.; 4 figs.; 5 tabs

  1. Discovery of massive neutral vector mesons

    International Nuclear Information System (INIS)



    Personal accounts of the discovery of massive neutral vector mesons (psi particles) are given by researchers S. Ting, G. Goldhaber, and B. Richter. The double-arm spectrometer and the Cherenkov effect are explained in a technical note, and the solenoidal magnetic detector is discussed in an explanatory note for nonspecialists. Reprints of three papers in Physical Review Letters which announced the discovery of the particles are given: Experimental observation of a heavy particle J, Discovery of a narrow resonance in e + e - annihilation, and Discovery of a second narrow resonance in e + e - annihilation. A discussion of subsequent developments and scientific biographies of the three authors are also presented. 25 figures

  2. Large acceptance spectrometers for π0 mesons

    International Nuclear Information System (INIS)

    Awes, T.C.; Ferguson, R.L.; Obenshain, F.E.


    A spectrometer composed of lead-oxide loaded glass blocks has been constructed for detection of neutral pi mesons emitted in low energy heavy ion reactions. The spectrometer detects the Cerenkov radiation emitted when the high energy photons (Eγ approx. 70 MeV) resulting from π 0 decay create electron-position pairs in the glass, initiating electromagnetic showers. A geometric acceptance of better than 5% of 4π is possible; the π 0 detection efficiency varies between this value at T/sub π/ = 0 MeV and 1% for T/sub π/ approx. 100 MeV

  3. Quantum chromodynamics with infinite number of vector mesons

    International Nuclear Information System (INIS)

    Geshkenbejn, B.V.


    Families of vector mesons Ρ,Ψ,Υ, contain an infinite number of resonances with gradually increasing widths are considered. The asymptotic freedom requirement involves a relationship between the electric width of k-th resonance and its mass M k derivative over the number k. It is shown that for the families of Ψ and Υ mesons the moment from experimental function R(s) is equal to the sum of the moment from a bare quark loop and the edge term which stems from replacing of summation by integration. These equalities are fulfilled up to 1% for 60 moments in the Ψ-meson family and up to 2% for 96 moments in the Υ-meson family. The electronic widths of the resonances and the Ρ-meson mass are calculated. 7 refs

  4. High statistics inclusive φ meson production at SPS energies

    International Nuclear Information System (INIS)

    Dijkstra, H.; Belau, E.


    Inclusive φ meson production has been measured for 100 GeV/c and 200 GeV/c incident π - , anti p and K - , and for 120 GeV/c and 200 GeV/c incident π + , p and K + , using a Be target. A total of 630,000 φ mesons has been recorded in the kinematic range 0 F F and dσ/dp T 2 . The longitudinal momentum distributions show that the strange valence quarks of the incident K mesons play an important role in φ meson production, even at small x F . The decay angular distribution of the φ meson is evaluated in the Gottfried-Jackson frame and is expressed in the elements of the density matrix. There is a small but significant cos 2 θ GJ dependence for small p T , which decreases for increasing p T . (Auth.)

  5. Measurement of elastic electroproduction of $\\phi$ mesons at HERA

    CERN Document Server

    Adloff, C.; Andrieu, B.; Arkadov, V.; Astvatsatourov, A.; Ayyaz, I.; Babaev, A.; Bahr, J.; Baranov, P.; Barrelet, E.; Bartel, W.; Bassler, U.; Bate, P.; Beglarian, A.; Behnke, O.; Beier, C.; Belousov, A.; Benisch, T.; Berger, Christoph; Bernardi, G.; Berndt, T.; Bizot, J.C.; Borras, K.; Boudry, V.; Braunschweig, W.; Brisson, V.; Broker, H.B.; Brown, D.P.; Bruckner, W.; Bruel, P.; Bruncko, D.; Burger, J.; Busser, F.W.; Bunyatyan, A.; Burkhardt, H.; Burrage, A.; Buschhorn, G.; Campbell, A.J.; Cao, Jun; Carli, T.; Caron, S.; Chabert, E.; Clarke, D.; Clerbaux, B.; Collard, C.; Contreras, J.G.; Coughlan, J.A.; Cousinou, M.C.; Cox, B.E.; Cozzika, G.; Cvach, J.; Dainton, J.B.; Dau, W.D.; Daum, K.; David, M.; Davidsson, M.; Delcourt, B.; Delerue, N.; Demirchyan, R.; De Roeck, A.; De Wolf, E.A.; Diaconu, C.; Dixon, P.; Dodonov, V.; Dowell, J.D.; Droutskoi, A.; Duprel, C.; Eckerlin, Guenter; Eckstein, D.; Efremenko, V.; Egli, S.; Eichler, R.; Eisele, F.; Eisenhandler, E.; Ellerbrock, M.; Elsen, E.; Erdmann, M.; Erdmann, W.; Faulkner, P.J.W.; Favart, L.; Fedotov, A.; Felst, R.; Ferencei, J.; Ferron, S.; Fleischer, M.; Flugge, G.; Fomenko, A.; Foresti, I.; Formanek, J.; Foster, J.M.; Franke, G.; Gabathuler, E.; Gabathuler, K.; Garvey, J.; Gassner, J.; Gayler, Joerg; Gerhards, R.; Ghazarian, S.; Goerlich, L.; Gogitidze, N.; Goldberg, M.; Goodwin, C.; Grab, C.; Grassler, H.; Greenshaw, T.; Grindhammer, Guenter; Hadig, T.; Haidt, D.; Hajduk, L.; Haynes, W.J.; Heinemann, B.; Heinzelmann, G.; Henderson, R.C.W.; Hengstmann, S.; Henschel, H.; Heremans, R.; Herrera, G.; Herynek, I.; Hilgers, M.; Hiller, K.H.; Hladky, J.; Hoting, P.; Hoffmann, D.; Hoprich, W.; Horisberger, R.; Hurling, S.; Ibbotson, M.; Issever, C.; Jacquet, M.; Jaffre, M.; Janauschek, L.; Jansen, D.M.; Janssen, X.; Jemanov, V.; Jonsson, L.; Johnson, D.P.; Jones, M.A.S.; Jung, H.; Kastli, H.K.; Kant, D.; Kapichine, M.; Karlsson, M.; Karschnick, O.; Kaufmann, O.; Kausch, M.; Keil, F.; Keller, N.; Kennedy, J.; Kenyon, I.R.; Kermiche, S.; Kiesling, Christian M.; Klein, M.; Kleinwort, C.; Knies, G.; Koblitz, B.; Kolya, S.D.; Korbel, V.; Kostka, P.; Kotelnikov, S.K.; Krasny, M.W.; Krehbiel, H.; Kroseberg, J.; Krucker, D.; Kruger, K.; Kupper, A.; Kuhr, T.; Kurca, T.; Kutuev, R.; Lachnit, W.; Lahmann, R.; Lamb, D.; Landon, M.P.J.; Lange, W.; Lastovicka, T.; Lebedev, A.; Leissner, B.; Lemrani, R.; Lendermann, V.; Levonian, S.; Lindstrom, M.; Lobodzinska, E.; Lobodzinski, B.; Loktionova, N.; Lubimov, V.; Luders, S.; Luke, D.; Lytkin, L.; Magnussen, N.; Mahlke-Kruger, H.; Malden, N.; Malinovski, E.; Malinovski, I.; Maracek, R.; Marage, P.; Marks, J.; Marshall, R.; Martyn, H.U.; Martyniak, J.; Maxfield, S.J.; Mehta, A.; Meier, K.; Merkel, P.; Metlica, F.; Meyer, H.; Meyer, J.; Meyer, P.O.; Mikocki, S.; Milstead, D.; Mkrtchyan, T.; Mohr, R.; Mohrdieck, S.; Mondragon, M.N.; Moreau, F.; Morozov, A.; Morris, J.V.; Muller, K.; Murin, P.; Nagovizin, V.; Naroska, B.; Naumann, J.; Naumann, T.; Nellen, G.; Newman, Paul R.; Nicholls, T.C.; Niebergall, F.; Niebuhr, C.; Nix, O.; Nowak, G.; Nunnemann, T.; Olsson, J.E.; Ozerov, D.; Panassik, V.; Pascaud, C.; Patel, G.D.; Perez, E.; Phillips, J.P.; Pitzl, D.; Poschl, R.; Potachnikova, I.; Povh, B.; Rabbertz, K.; Radel, G.; Rauschenberger, J.; Reimer, P.; Reisert, B.; Reyna, D.; Riess, S.; Rizvi, E.; Robmann, P.; Roosen, R.; Rostovtsev, A.; Royon, C.; Rusakov, S.; Rybicki, K.; Sankey, D.P.C.; Scheins, J.; Schilling, F.P.; Schleper, P.; Schmidt, D.; Schoeffel, L.; Schoning, A.; Schorner, T.; Schroder, V.; Schultz-Coulon, H.C.; Sedlak, K.; Sefkow, F.; Chekelian, V.I.; Sheviakov, I.; Shtarkov, L.N.; Siegmon, G.; Sievers, P.; Sirois, Y.; Sloan, T.; Smirnov, P.; Solochenko, V.; Solovev, Y.; Spaskov, V.; Specka, Arnd E.; Spitzer, H.; Stamen, R.; Steinhart, J.; Stella, B.; Stellberger, A.; Stiewe, J.; Straumann, U.; Struczinski, W.; Swart, M.; Tasevsky, M.; Tchernyshov, V.; Tchetchelnitski, S.; Thompson, Graham; Thompson, P.D.; Tobien, N.; Traynor, D.; Truoel, Peter; Tsipolitis, G.; Turnau, J.; Turney, J.E.; Tzamariudaki, E.; Udluft, S.; Usik, A.; Valkar, S.; Valkarova, A.; Vallee, C.; Van Mechelen, P.; Vazdik, Y.; von Dombrowski, S.; Wacker, K.; Wallny, R.; Walter, T.; Waugh, B.; Weber, G.; Weber, M.; Wegener, D.; Wegner, A.; Wengler, T.; Werner, M.; White, G.; Wiesand, S.; Wilksen, T.; Winde, M.; Winter, G.G.; Wissing, C.; Wobisch, M.; Wollatz, H.; Wunsch, E.; Wyatt, A.C.; Zacek, J.; Zalesak, J.; Zhang, Z.; Zhokin, A.; Zomer, F.; Zsembery, J.


    The elastic electroproduction of phi mesons is studied at HERA with the H1 detector for photon virtualities 1 < Q^2 < 15 GeV^2 and hadronic centre of mass energies 40 < W < 130 GeV. The Q^2 and t dependences of the cross section are extracted (t being the square of the four-momentum transfer to the target proton). When plotted as function of (Q^2 + M_V^2) and scaled by the appropriate SU(5) quark charge factor, the phi meson cross section agrees within errors with the cross sections of the vector mesons V = rho, omega and J/psi. A detailed analysis is performed of the phi meson polarisation state and the ratio of the production cross sections for longitudinally and transversely polarised phi mesons is determined. A small but significant violation of s-channel helicity conservation (SCHC) is observed.

  6. Heavy meson observables and Dyson-Schwinger equations

    International Nuclear Information System (INIS)

    Ivanov, M. A.


    Dyson-Schwinger equation (DSE) studies show that the b-quark mass-function is approximately constant, and that this is true to a lesser extent for the c-quark. This observation provides the basis for a study of the leptonic and semileptonic decays of heavy pseudoscalar mesons using a ''heavy-quark'' limit of the DSES, which, when exact, reduces the number of independent form factors. Semileptonic decays with light mesons in the final state are also accessible because the DSES provide a description of light-quark propagation characteristics and light-meson structure. A description of B-meson decays is straightforward, however, the study of decays involving the D-meson indicates that c-quark mass-corrections are quantitatively important

  7. Meson widths from string worldsheet instantons

    International Nuclear Information System (INIS)

    Faulkner, Thomas; Liu, Hong


    We show that open strings living on a D-brane which lies outside an AdS black hole can tunnel into the black hole through worldsheet instantons. These instantons have a simple interpretation in terms of thermal quarks in the dual Yang-Mills (YM) theory. As an application we calculate the width of a meson in a strongly coupled quark-gluon plasma which is described holographically as a massless mode on a D7 brane in AdS 5 xS 5 . While the width of the meson is zero to all orders in the 1/√(λ) expansion with λ the 't Hooft coupling, it receives non-perturbative contributions in 1/√(λ) from worldsheet instantons. We find that the width increases quadratically with momentum at large momentum and comment on potential phenomenological implications of this enhancement for heavy ion collisions. We also comment on how this non-perturbative effect has important consequences for the phase structure of the YM theory obtained in the classical gravity limit

  8. Vector Mesons in Cold Nuclear Matter

    International Nuclear Information System (INIS)

    Rodrigues, Tulio E; Arruda-Neto, Joāo Dias de Toledo


    The attenuation of vector mesons in cold nuclear matter is studied through the mechanism of incoherent photoproduction off complex nuclei. The latter is described via the time-dependent multi-collisional Monte Carlo (MCMC) intranuclear cascade model. The results for the transparency ratios of ω mesons reproduce previous measurements of CB-ELSA/TAPS with an inelastic ωN cross section around 40 mb for ρ ω ∼ 1.1 GeV/c. The corresponding in-medium width (nuclear rest frame) is extracted dinamically from the algorithm and depends on the average nuclear density p N and target nucleus: ∼ 49.2 MeV/c 2 for carbon (p N ≈ 0.114 far −3 ) and ∼ 77.3 MeV/c 2 for lead (p N ≈ 0.137 far −−3 ). The calculations fail to reproduce the huge absorption observed at JLab assuming the same inelastic cross section and the discrepancy between the two experiments remains a challenge.

  9. Scalar mesons in φ radiative decay

    International Nuclear Information System (INIS)

    Close, F.E.; Isgur, N.; Kumano, S.


    Existing predictions for the branching ratio for φ → KK γ via φ → S γ (where S denotes one of the scalar mesons f o (975) and a o (980)) vary by several orders of magnitude. Given the importance of these processes for both hadron spectroscopy and charge-parity-violation studies at φ factories (where φ→ K o K-bar o γ poses a possible background problem), this state of affairs is very undesirable. We show that the variety of predictions is due in part to errors and in part to differences in modelling. The latter variation leads us to argue that the radiative decays of these scalar states are interesting in their own right and may offer unique insights into the nature of the scalar mesons. As a byproduct we find that the branching ratio for φ → K o K-bar o γ is approx. -7 ) and will pose no significant background to proposed studies of CP-violation. (Author)

  10. Transitions between neutral mesons in multiquark schemes

    International Nuclear Information System (INIS)

    Volkov, G.G.; Liparteliani, A.G.; Monich, V.A.; Nikitin, Y.P.


    A six-quark scheme based on the gauge group SU(2)/sub L/ x U(1) is used to obtain expressions for the amplitudes of the transitions K 0 bold-arrow-left-right K-bar 0 , D 0 bold-arrow-left-right D-bar 0 , B 0 bold-arrow-left-right B-bar 0 , B/sub S/ 0 bold-arrow-left-right B-bar/sub S/ 0 , T 0 bold-arrow-left-right T-bar 0 , and T/sub C/ 0 bold-arrow-left-right T-bar/sub C/ 0 for finite 4-momenta of the external lines of the Feynman box diagrams. An estimate is made of the degree of applicability of the approximation of vanishingly small 4-momenta of the valence quarks which form the neutral mesons such as the K 0 and K-bar 0 mesons. Constraints are found on the parameters of the unitary matrix of the weak charged currents for arbitrary values of the t-quark mass. Estimates are given of the numerical values of the mixing and CP-violation parameters for neutral systems such as the K 0 --K-bar 0 system

  11. Flavor symmetry breaking and meson masses

    International Nuclear Information System (INIS)

    Bhagwat, Mandar S.; Roberts, Craig D.; Chang Lei; Liu Yuxin; Tandy, Peter C.


    The axial-vector Ward-Takahashi identity is used to derive mass formulas for neutral pseudoscalar mesons. Flavor symmetry breaking entails nonideal flavor content for these states. Adding that the η ' is not a Goldstone mode, exact chiral-limit relations are developed from the identity. They connect the dressed-quark propagator to the topological susceptibility. It is confirmed that in the chiral limit the η ' mass is proportional to the matrix element which connects this state to the vacuum via the topological susceptibility. The implications of the mass formulas are illustrated using an elementary dynamical model, which includes an Ansatz for that part of the Bethe-Salpeter kernel related to the non-Abelian anomaly. In addition to the current-quark masses, the model involves two parameters, one of which is a mass-scale. It is employed in an analysis of pseudoscalar- and vector-meson bound-states. While the effects of SU(N f =2) and SU(N f =3) flavor symmetry breaking are emphasized, the five-flavor spectra are described. Despite its simplicity, the model is elucidative and phenomenologically efficacious; e.g., it predicts η-η ' mixing angles of ∼-15 deg. and π 0 -η angles of ∼1 deg

  12. Precision measurement of $D$ meson mass differences

    CERN Document Server

    INSPIRE-00258707; Abellan Beteta, C; Adeva, B; Adinolfi, M; Adrover, C; Affolder, A; Ajaltouni, Z; Albrecht, J; Alessio, F; Alexander, M; Ali, S; Alkhazov, G; Alvarez Cartelle, P; Alves Jr, A A; Amato, S; Amerio, S; Amhis, Y; Anderlini, L; Anderson, J; Andreassen, R; Appleby, R B; Aquines Gutierrez, O; Archilli, F; Artamonov, A; Artuso, M; Aslanides, E; Auriemma, G; Bachmann, S; Back, J J; Baesso, C; Balagura, V; Baldini, W; Barlow, R J; Barschel, C; Barsuk, S; Barter, W; Bauer, Th; Bay, A; Beddow, J; Bedeschi, F; Bediaga, I; Belogurov, S; Belous, K; Belyaev, I; Ben-Haim, E; Benayoun, M; Bencivenni, G; Benson, S; Benton, J; Berezhnoy, A; Bernet, R; Bettler, M -O; van Beuzekom, M; Bien, A; Bifani, S; Bird, T; Bizzeti, A; Bjørnstad, P M; Blake, T; Blanc, F; Blouw, J; Blusk, S; Bocci, V; Bondar, A; Bondar, N; Bonivento, W; Borghi, S; Borgia, A; Bowcock, T J V; Bowen, E; Bozzi, C; Brambach, T; van den Brand, J; Bressieux, J; Brett, D; Britsch, M; Britton, T; Brook, N H; Brown, H; Burducea, I; Bursche, A; Busetto, G; Buytaert, J; Cadeddu, S; Callot, O; Calvi, M; Calvo Gomez, M; Camboni, A; Campana, P; Campora Perez, D; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carranza-Mejia, H; Carson, L; Carvalho Akiba, K; Casse, G; Cattaneo, M; Cauet, Ch; Charles, M; Charpentier, Ph; Chen, P; Chiapolini, N; Chrzaszcz, M; Ciba, K; Cid Vidal, X; Ciezarek, G; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Coca, C; Coco, V; Cogan, J; Cogneras, E; Collins, P; Comerma-Montells, A; Contu, A; Cook, A; Coombes, M; Coquereau, S; Corti, G; Couturier, B; Cowan, G A; Craik, D C; Cunliffe, S; Currie, R; D'Ambrosio, C; David, P; David, P N Y; Davis, A; De Bonis, I; De Bruyn, K; De Capua, S; De Cian, M; De Miranda, J M; De Paula, L; De Silva, W; De Simone, P; Decamp, D; Deckenhoff, M; Del Buono, L; Derkach, D; Deschamps, O; Dettori, F; Di Canto, A; Dijkstra, H; Dogaru, M; Donleavy, S; Dordei, F; Dosil Suárez, A; Dossett, D; Dovbnya, A; Dupertuis, F; Dzhelyadin, R; Dziurda, A; Dzyuba, A; Easo, S; Egede, U; Egorychev, V; Eidelman, S; van Eijk, D; Eisenhardt, S; Eitschberger, U; Ekelhof, R; Eklund, L; El Rifai, I; Elsasser, Ch; Elsby, D; Falabella, A; Färber, C; Fardell, G; Farinelli, C; Farry, S; Fave, V; Ferguson, D; Fernandez Albor, V; Ferreira Rodrigues, F; Ferro-Luzzi, M; Filippov, S; Fiore, M; Fitzpatrick, C; Fontana, M; Fontanelli, F; Forty, R; Francisco, O; Frank, M; Frei, C; Frosini, M; Furcas, S; Furfaro, E; Gallas Torreira, A; Galli, D; Gandelman, M; Gandini, P; Gao, Y; Garofoli, J; Garosi, P; Garra Tico, J; Garrido, L; Gaspar, C; Gauld, R; Gersabeck, E; Gersabeck, M; Gershon, T; Ghez, Ph; Gibson, V; Gligorov, V V; Göbel, C; Golubkov, D; Golutvin, A; Gomes, A; Gordon, H; Grabalosa Gándara, M; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graziani, G; Grecu, A; Greening, E; Gregson, S; Grünberg, O; Gui, B; Gushchin, E; Guz, Yu; Gys, T; Hadjivasiliou, C; Haefeli, G; Haen, C; Haines, S C; Hall, S; Hampson, T; Hansmann-Menzemer, S; Harnew, N; Harnew, S T; Harrison, J; Hartmann, T; He, J; Heijne, V; Hennessy, K; Henrard, P; Hernando Morata, J A; van Herwijnen, E; Hicks, E; Hill, D; Hoballah, M; Hombach, C; Hopchev, P; Hulsbergen, W; Hunt, P; Huse, T; Hussain, N; Hutchcroft, D; Hynds, D; Iakovenko, V; Idzik, M; Ilten, P; Jacobsson, R; Jaeger, A; Jans, E; Jaton, P; Jing, F; John, M; Johnson, D; Jones, C R; Jost, B; Kaballo, M; Kandybei, S; Karacson, M; Karbach, T M; Kenyon, I R; Kerzel, U; Ketel, T; Keune, A; Khanji, B; Kochebina, O; Komarov, I; Koopman, R F; Koppenburg, P; Korolev, M; Kozlinskiy, A; Kravchuk, L; Kreplin, K; Kreps, M; Krocker, G; Krokovny, P; Kruse, F; Kucharczyk, M; Kudryavtsev, V; Kvaratskheliya, T; La Thi, V N; Lacarrere, D; Lafferty, G; Lai, A; Lambert, D; Lambert, R W; Lanciotti, E; Lanfranchi, G; Langenbruch, C; Latham, T; Lazzeroni, C; Le Gac, R; van Leerdam, J; Lees, J -P; Lefèvre, R; Leflat, A; Lefrançois, J; Leo, S; Leroy, O; Lesiak, T; Leverington, B; Li, Y; Li Gioi, L; Liles, M; Lindner, R; Linn, C; Liu, B; Liu, G; Lohn, S; Longstaff, I; Lopes, J H; Lopez Asamar, E; Lopez-March, N; Lu, H; Lucchesi, D; Luisier, J; Luo, H; Machefert, F; Machikhiliyan, I V; Maciuc, F; Maev, O; Malde, S; Manca, G; Mancinelli, G; Marconi, U; Märki, R; Marks, J; Martellotti, G; Martens, A; Martin, L; Martín Sánchez, A; Martinelli, M; Martinez Santos, D; Martins Tostes, D; Massafferri, A; Matev, R; Mathe, Z; Matteuzzi, C; Maurice, E; Mazurov, A; McCarthy, J; McNab, A; McNulty, R; Meadows, B; Meier, F; Meissner, M; Merk, M; Milanes, D A; Minard, M -N; Molina Rodriguez, J; Monteil, S; Moran, D; Morawski, P; Morello, M J; Mountain, R; Mous, I; Muheim, F; Müller, K; Muresan, R; Muryn, B; Muster, B; Naik, P; Nakada, T; Nandakumar, R; Nasteva, I; Needham, M; Neufeld, N; Nguyen, A D; Nguyen, T D; Nguyen-Mau, C; Nicol, M; Niess, V; Niet, R; Nikitin, N; Nikodem, T; Nomerotski, A; Novoselov, A; Oblakowska-Mucha, A; Obraztsov, V; Oggero, S; Ogilvy, S; Okhrimenko, O; Oldeman, R; Orlandea, M; Otalora Goicochea, J M; Owen, P; Oyanguren, A; Pal, B K; Palano, A; Palutan, M; Panman, J; Papanestis, A; Pappagallo, M; Parkes, C; Parkinson, C J; Passaleva, G; Patel, G D; Patel, M; Patrick, G N; Patrignani, C; Pavel-Nicorescu, C; Pazos Alvarez, A; Pellegrino, A; Penso, G; Pepe Altarelli, M; Perazzini, S; Perego, D L; Perez Trigo, E; Pérez-Calero Yzquierdo, A; Perret, P; Perrin-Terrin, M; Pessina, G; Petridis, K; Petrolini, A; Phan, A; Picatoste Olloqui, E; Pietrzyk, B; Pilař, T; Pinci, D; Playfer, S; Plo Casasus, M; Polci, F; Polok, G; Poluektov, A; Polycarpo, E; Popov, D; Popovici, B; Potterat, C; Powell, A; Prisciandaro, J; Pugatch, V; Puig Navarro, A; Punzi, G; Qian, W; Rademacker, J H; Rakotomiaramanana, B; Rangel, M S; Raniuk, I; Rauschmayr, N; Raven, G; Redford, S; Reid, M M; dos Reis, A C; Ricciardi, S; Richards, A; Rinnert, K; Rives Molina, V; Roa Romero, D A; Robbe, P; Rodrigues, E; Rodriguez Perez, P; Roiser, S; Romanovsky, V; Romero Vidal, A; Rouvinet, J; Ruf, T; Ruffini, F; Ruiz, H; Ruiz Valls, P; Sabatino, G; Saborido Silva, J J; Sagidova, N; Sail, P; Saitta, B; Salzmann, C; Sanmartin Sedes, B; Sannino, M; Santacesaria, R; Santamarina Rios, C; Santovetti, E; Sapunov, M; Sarti, A; Satriano, C; Satta, A; Savrie, M; Savrina, D; Schaack, P; Schiller, M; Schindler, H; Schlupp, M; Schmelling, M; Schmidt, B; Schneider, O; Schopper, A; Schune, M -H; Schwemmer, R; Sciascia, B; Sciubba, A; Seco, M; Semennikov, A; Senderowska, K; Sepp, I; Serra, N; Serrano, J; Seyfert, P; Shapkin, M; Shapoval, I; Shatalov, P; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, O; Shevchenko, V; Shires, A; Silva Coutinho, R; Skwarnicki, T; Smith, N A; Smith, E; Smith, M; Sokoloff, M D; Soler, F J P; Soomro, F; Souza, D; Souza De Paula, B; Spaan, B; Sparkes, A; Spradlin, P; Stagni, F; Stahl, S; Steinkamp, O; Stoica, S; Stone, S; Storaci, B; Straticiuc, M; Straumann, U; Subbiah, V K; Swientek, S; Syropoulos, V; Szczekowski, M; Szczypka, P; Szumlak, T; T'Jampens, S; Teklishyn, M; Teodorescu, E; Teubert, F; Thomas, C; Thomas, E; van Tilburg, J; Tisserand, V; Tobin, M; Tolk, S; Tonelli, D; Topp-Joergensen, S; Torr, N; Tournefier, E; Tourneur, S; Tran, M T; Tresch, M; Tsaregorodtsev, A; Tsopelas, P; Tuning, N; Ubeda Garcia, M; Ukleja, A; Urner, D; Uwer, U; Vagnoni, V; Valenti, G; Vazquez Gomez, R; Vazquez Regueiro, P; Vecchi, S; Velthuis, J J; Veltri, M; Veneziano, G; Vesterinen, M; Viaud, B; Vieira, D; Vilasis-Cardona, X; Vollhardt, A; Volyanskyy, D; Voong, D; Vorobyev, A; Vorobyev, V; Voß, C; Voss, H; Waldi, R; Wallace, R; Wandernoth, S; Wang, J; Ward, D R; Watson, N K; Webber, A D; Websdale, D; Whitehead, M; Wicht, J; Wiechczynski, J; Wiedner, D; Wiggers, L; Wilkinson, G; Williams, M P; Williams, M; Wilson, F F; Wishahi, J; Witek, M; Wotton, S A; Wright, S; Wu, S; Wyllie, K; Xie, Y; Xing, F; Xing, Z; Yang, Z; Young, R; Yuan, X; Yushchenko, O; Zangoli, M; Zavertyaev, M; Zhang, F; Zhang, L; Zhang, W C; Zhang, Y; Zhelezov, A; Zhokhov, A; Zhong, L; Zvyagin, A


    Using three- and four-body decays of $D$ mesons produced in semileptonic $b$-hadron decays, precision measurements of $D$ meson mass differences are made together with a measurement of the $D^{0}$ mass. The measurements are based on a dataset corresponding to an integrated luminosity of 1.0 fb$^{-1}$ collected in $pp$ collisions at 7~TeV. Using the decay $D^0 \\rightarrow K^{+} K^{-} K^{-} \\pi^{+}$, the $D^0$ mass is measured to be \\begin{alignat*}{3} M(D^0) \\phantom{ghd} &=&~1864.75 \\pm 0.15 \\,({\\rm stat}) \\pm 0.11 \\,({\\rm syst}) \\, \\textrm{MeV}/c^2. \\end{alignat*} The mass differences \\begin{alignat*}{3} M(D^{+}) - M(D^{0}) &=& 4.76 \\pm 0.12 \\,({\\rm stat}) \\pm 0.07 \\,({\\rm syst}) \\, \\textrm{MeV}/c^2, \\\\ M(D^{+}_s) - M(D^{+}) &=& \\phantom{00}98.68 \\pm 0.03 \\,({\\rm stat}) \\pm 0.04 \\,({\\rm syst}) \\, \\textrm{MeV}/c^2 \\end{alignat*} are measured using the $D^0 \\rightarrow K^{+} K^{-} \\pi^{+} \\pi^{-}$ and $D^{+}_{(s)} \\rightarrow K^{+}K^{-} \\pi^{+}$ modes.

  13. High-energy photoproduction of neutral mesons

    CERN Document Server

    Charity, Tim


    This thesis presents results from the first full period of data-taking of the experiment WA69 at the Omega^'^ectrometer, CERN, Geneva. The experiment used a tagged photon beam of energy 60-180 GeV incident on a liquid hydrogen target to study photoproduction of hadronic states. The various components of the experiment are described, with particular emphasis on the electromagnetic calorimeters, and the associated offline software for event reconstruction and acceptance calculation. The performance of the outer calorimeter is discussed, and the pi^0 detection and reconstruction efficiency is examined by comparison with pi^{+/- } production. Searches for photoproduction of neutral meson states reveal a clear signal for the pi^0, eta^0 , and omega^0 mesons. The cross-section for elastic omega^0 production is estimated, and found to be consistent with the established value of 1 mub. The cross-section for inclusive pi^0 and eta^0 production is studied using the variable Feynman-x (x_{F }), and pi^0 production as a ...

  14. Light-Meson Spectroscopy at COMPASS

    CERN Document Server

    Krinner, Fabian


    The goal of the COMPASS experiment at CERN is to study the structure and spectroscopy of hadrons. The two-stage spectrometer has large acceptance and covers a wide kinematic range for charged as well as neutral particles allowing to access a wide range of reactions. Light mesons are studied with negative (mostly $\\pi^-$) and positive ($p$, $\\pi^+$) hadron beams with a momentum of $190\\,\\text{GeV}/c$. The light-meson spectrum is measured in different final states produced in diffractive dissociation reactions with squared four-momentum transfer $t$ to the target between $0.1$ and $1.0\\,(\\text{GeV}/c)^2$. The flagship channel is the $\\pi^-\\pi^+\\pi^-$ final state, for which COMPASS has recorded the currently world's largest data sample. These data not only allow us to measure the properties of known resonances with high precision, but also to search for new states. Among these is a new axial-vector signal, the $a_1(1420)$, with unusual properties. The findings are confirmed by the analysis of the $\\pi^-\\pi^0\\pi^...

  15. A CHI wiggler ubitron amplifier experiment: Wiggler characterization

    Energy Technology Data Exchange (ETDEWEB)

    Taccetti, J.M.; Jackson, R.H.; Freund, H.P. [Naval Research Lab., Washington, DC (United States)] [and others


    A 35 GHz CHI (Coaxial Hybrid Iron) wiggler ubitron amplifier experiment is under construction at the Naval Research Laboratory. The CHI wiggler configuration has the potential of generating high wiggler magnetic fields at short periods with excellent beam focusing and transport properties. This makes it a desirable configuration for the generation of high power coherent radiation in relatively compact systems. The CHI wiggler consists of alternating rings of magnetic and non-magnetic materials concentric with a central rod of similar alternating design but shifted along the axis by half a period. Once inserted in a solenoidal magnetic field, the CHI structure deforms the axial field to create a radial field oscillating with the same periodicity as the rings. An annular electron beam is propagated through the coaxial gap where the oscillating radial field imparts an azimuthal wiggle motion. The principal goals of the experiment are to investigate the performance tradeoffs involved in the CHI configuration for high frequency amplifiers operating at low voltages with small wiggler periods. The nominal design parameters are a center frequency of 35 GHz, wiggler period of 0.75 cm, and beam voltage of approximately 150 kV. Calculations have shown an intrinsic (untapered) efficiency of {approximately} 7% when operating at 6.3 kG axial field (wiggler field, B{sub w}{approximately}1270 G). The calculated gain was 36 dB, saturating at a distance of 46 cm. These parameters yield an instantaneous amplifier bandwidth of {approximately} 25%. There appears to be room for further improvement in efficiency, a matter which will be scrutinized more closely in the final design. A prototype CHI wiggler is presently being fabricated for use in conjunction with an existing 30 kG superconducting solenoid. The performance properties of the prototype will be characterized and compared with linear and non-linear calculations.

  16. Tai Chi training reduced coupling between respiration and postural control. (United States)

    Holmes, Matthew L; Manor, Brad; Hsieh, Wan-hsin; Hu, Kun; Lipsitz, Lewis A; Li, Li


    In order to maintain stable upright stance, the postural control system must account for the continuous perturbations to the body's center-of-mass including those caused by spontaneous respiration. Both aging and disease increase "posturo-respiratory synchronization;" which reflects the degree to which respiration affects postural sway fluctuations over time. Tai Chi training emphasizes the coordination of respiration and bodily movements and may therefore optimize the functional interaction between these two systems. The purpose of the project was to examine the effect of Tai Chi training on the interaction between respiration and postural control in older adults. We hypothesized that Tai Chi training would improve the ability of the postural control system to compensate for respiratory perturbations and thus, reduce posturo-respiratory synchronization. Participants were recruited from supportive housing facilities and randomized to a 12-week Tai Chi intervention (n=28; 86 ± 5 yrs) or educational-control program (n=34, 85 ± 6 yrs). Standing postural sway and respiration were simultaneously recorded with a force plate and respiratory belt under eyes-open and eyes-closed conditions. Posturo-respiratory synchronization was determined by quantifying the variation of the phase relationship between the dominant oscillatory mode of respiration and corresponding oscillations within postural sway. Groups were similar in age, gender distribution, height, body mass, and intervention compliance. Neither intervention altered average sway speed, sway magnitude or respiratory rate. As compared to the education-control group, however, Tai Chi training reduced posturo-respiratory synchronization when standing with eyes open or closed (ppostural control or respiration, yet reduced the coupling between respiration and postural control. The beneficial effects of Tai Chi training may therefore stem in part from optimization of this multi-system interaction. Copyright © 2015

  17. The phi-meson and Chiral-mass-meson production in heavy-ion collisions as potential probes of quark-gluon-plasma and Chiral symmetry transitions (United States)

    Takahashi, Y.; Eby, P. B.


    Possibilities of observing abundances of phi mesons and narrow hadronic pairs, as results of QGP and Chiral transitions, are considered for nucleus-nucleus interactions. Kinematical requirements in forming close pairs are satisfied in K+K decays of S(975) and delta (980) mesons with small phi, and phi (91020) mesons with large PT, and in pi-pi decays of familiar resonance mesons only in a partially restored chiral symmetry. Gluon-gluon dominance in QGP can enhance phi meson production. High hadronization rates of primordial resonance mesons which form narrow hadronic pairs are not implausible. Past cosmic ray evidences of anomalous phi production and narrow pair abundances are considered.

  18. Chi-squared goodness of fit tests with applications

    CERN Document Server

    Balakrishnan, N; Nikulin, MS


    Chi-Squared Goodness of Fit Tests with Applications provides a thorough and complete context for the theoretical basis and implementation of Pearson's monumental contribution and its wide applicability for chi-squared goodness of fit tests. The book is ideal for researchers and scientists conducting statistical analysis in processing of experimental data as well as to students and practitioners with a good mathematical background who use statistical methods. The historical context, especially Chapter 7, provides great insight into importance of this subject with an authoritative author team

  19. A randomized trial of tai chi for fibromyalgia. (United States)

    Wang, Chenchen; Schmid, Christopher H; Rones, Ramel; Kalish, Robert; Yinh, Janeth; Goldenberg, Don L; Lee, Yoojin; McAlindon, Timothy


    Previous research has suggested that tai chi offers a therapeutic benefit in patients with fibromyalgia. We conducted a single-blind, randomized trial of classic Yang-style tai chi as compared with a control intervention consisting of wellness education and stretching for the treatment of fibromyalgia (defined by American College of Rheumatology 1990 criteria). Sessions lasted 60 minutes each and took place twice a week for 12 weeks for each of the study groups. The primary end point was a change in the Fibromyalgia Impact Questionnaire (FIQ) score (ranging from 0 to 100, with higher scores indicating more severe symptoms) at the end of 12 weeks. Secondary end points included summary scores on the physical and mental components of the Medical Outcomes Study 36-Item Short-Form Health Survey (SF-36). All assessments were repeated at 24 weeks to test the durability of the response. Of the 66 randomly assigned patients, the 33 in the tai chi group had clinically important improvements in the FIQ total score and quality of life. Mean (+/-SD) baseline and 12-week FIQ scores for the tai chi group were 62.9+/-15.5 and 35.1+/-18.8, respectively, versus 68.0+/-11 and 58.6+/-17.6, respectively, for the control group (change from baseline in the tai chi group vs. change from baseline in the control group, -18.4 points; Ptai chi group versus 28.0+/-7.8 and 29.4+/-7.4 for the control group (between-group difference, 7.1 points; P=0.001), and the mental-component scores were 42.6+/-12.2 and 50.3+/-10.2 for the tai chi group versus 37.8+/-10.5 and 39.4+/-11.9 for the control group (between-group difference, 6.1 points; P=0.03). Improvements were maintained at 24 weeks (between-group difference in the FIQ score, -18.3 points; PTai chi may be a useful treatment for fibromyalgia and merits long-term study in larger study populations. (Funded by the National Center for Complementary and Alternative Medicine and others; number, NCT00515008.)

  20. Testing subleading multiple soft graviton theorem for CHY prescription (United States)

    Chakrabarti, Subhroneel; Kashyap, Sitender Pratap; Sahoo, Biswajit; Sen, Ashoke; Verma, Mritunjay


    In arXiv:1707.06803 we derived the subleading multiple soft graviton theorem in a generic quantum theory of gravity for arbitrary number of soft external gravitons and arbitrary number of finite energy external states carrying arbitrary mass and spin. In this paper we verify this explicitly using the CHY formula for tree level scattering amplitudes of arbitrary number of gravitons in Einstein gravity. We pay special care to fix the signs of the amplitudes and resolve an apparent discrepancy between our general results in arXiv:1707.06803 and previous results on soft graviton theorem from CHY formula.

  1. Neutral and charged scalar mesons, pseudoscalar mesons, and diquarks in magnetic fields (United States)

    Liu, Hao; Wang, Xinyang; Yu, Lang; Huang, Mei


    We investigate both (pseudo)scalar mesons and diquarks in the presence of external magnetic field in the framework of the two-flavored Nambu-Jona-Lasinio (NJL) model, where mesons and diquarks are constructed by infinite sum of quark-loop chains by using random phase approximation. The polarization function of the quark-loop is calculated to the leading order of 1 /Nc expansion by taking the quark propagator in the Landau level representation. We systematically investigate the masses behaviors of scalar σ meson, neutral and charged pions as well as the scalar diquarks, with respect to the magnetic field strength at finite temperature and chemical potential. It is shown that the numerical results of both neutral and charged pions are consistent with the lattice QCD simulations. The mass of the charge neutral pion keeps almost a constant under the magnetic field, which is preserved by the remnant symmetry of QCD ×QED in the vacuum. The mass of the charge neutral scalar σ is around two times quark mass and increases with the magnetic field due to the magnetic catalysis effect, which is an typical example showing that the polarized internal quark structure cannot be neglected when we consider the meson properties under magnetic field. For the charged particles, the one quark-antiquark loop contribution to the charged π± increases essentially with the increase of magnetic fields due to the magnetic catalysis of the polarized quarks. However, the one quark-quark loop contribution to the scalar diquark mass is negative comparing with the point-particle result and the loop effect is small.

  2. Latest results from meson photoproduction at ELSA and MAMI (United States)

    Krusche, B.


    Photoproduction of mesons plays a key role for the investigation of the excitation spectrum of the nucleon and thus for our understanding of the strong interaction in the non-perturbative regime. In this contribution we discuss recent results from the experiments at the tagged photon beams of the electron accelerators ELSA in Bonn and MAMI in Mainz. They include the measurement of cross sections and (double) polarization observables for single meson production and production of meson pairs off free protons as well as of quasi-free nucleons bound in light nuclei (in particular the deuteron).

  3. SU(3) properties of semileptonic and nonleptonic decays of mesons

    International Nuclear Information System (INIS)

    Montvay, I.


    The recent discovery of charmed D and F mesons led to an accumulation of a lot of information on the weak decays of these particles. The facts known at present are generally consistent with the Glashow-Iliopoulos-Maiami scheme for the weak currents, which are predicted the fourth flavour of quarks, the charm. The weak decays of the charmed mesons are governed by SU(3) rules analogous to the Okubo-Zweig-Iizuka rule for strong decays. Such Su(3) rules are given for semileptonic and nonleptonic decays of strange and charmed mesons. These relations depend on the colour structure of currents in the nonleptonic case. (D.P.)

  4. A calculation of the physical mass of sigma meson

    International Nuclear Information System (INIS)

    Morones-Ibarra, J.R.; Santos-Guevara, Ayax


    We calculate the physical mass and the width of the sigma meson by considering that it couples in vacuum to two virtual pions. The mass is calculated by using the spectral function, and we find that it is about 600 MeV. In addition, we obtained 220 MeV as the value for the width of its spectral function. The value obtained for the mass is in good agreement with that reported in the Particle Data Book for the σ meson, which is also named f 0 (600). This result also shows that σ-meson can be considered as a two-pion resonance. (author)

  5. Mesonic atom production in high-energy nuclear collisions

    International Nuclear Information System (INIS)

    Wakai, M.; Bando, H.; Sano, M.


    The production probability of π-mesonic atom in high-energy nuclear collisions is estimated by a coalescence model. The production cross section is calculated for p + Ne and Ne + Ne systems at 2.1 GeV/A and 5.0 GeV/A beam energy. It is shown that nuclear fragments with larger charge numbers have the advantage in the formation of π-mesonic atoms. The cross section is proportional to Z 3 and of the order of magnitude of 1 ∼ 10 μb in all the above cases. The production cross sections of K-mesonic atoms are also estimated. (author)

  6. Meson-induced correlations of nucleons in nuclear Compton scattering

    International Nuclear Information System (INIS)

    Huett, M.; Milstein, A.I.


    The nonresonant (seagull) contribution to the nuclear Compton amplitude at low energies is strongly influenced by nucleon correlations arising from meson exchange. We study this problem in a modified Fermi gas model, where nuclear correlation functions are obtained with the help of perturbation theory. The dependence of the mesonic seagull amplitude on the nuclear radius is investigated and the influence of a realistic nuclear density on this amplitude is discussed. We found that different form factors appear for the static part (proportional to the enhancement constant κ) of the mesonic seagull amplitude and for the parts, which contain the contribution from electromagnetic polarizabilities. copyright 1998 The American Physical Society

  7. Semileptonic Branching Fractions of Charged and Neutral B Mesons

    International Nuclear Information System (INIS)

    Athanas, M.; Brower, W.; Masek, G.; Paar, H.P.; Gronberg, J.; Kutschke, R.; Menary, S.; Morrison, R.J.; Nakanishi, S.; Nelson, H.N.; Nelson, T.K.; Qiao, C.; Richman, J.D.; Ryd, A.; Tajima, H.; Sperka, D.; Witherell, M.S.; Balest, R.; Cho, K.; Ford, W.T.; Johnson, D.R.; Lingel, K.; Lohner, M.; Rankin, P.; Smith, J.G.; Alexander, J.P.; Bebek, C.; Berkelman, K.; Bloom, K.; Browder, T.E.; Cassel, D.G.; Cho, H.A.; Coffman, D.M.; Crowcroft, D.S.; Drell, P.S.; Dumas, D.; Ehrlich, R.; Gaidarev, P.; Garcia-Sciveres, M.; Geiser, B.; Gittelman, B.; Gray, S.W.; Hartill, D.L.; Heltsley, B.K.; Henderson, S.; Jones, C.D.; Jones, S.L.; Kandaswamy, J.; Katayama, N.; Kim, P.C.; Kreinick, D.L.; Ludwig, G.S.; Masui, J.; Mevissen, J.; Mistry, N.B.; Ng, C.R.; Nordberg, E.; Patterson, J.R.; Peterson, D.; Riley, D.; Salman, S.; Sapper, M.; Wuerthwein, F.; Avery, P.; Freyberger, A.; Rodriguez, J.; Yang, S.; Yelton, J.; Cinabro, D.; Liu, T.; Saulnier, M.; Wilson, R.; Yamamoto, H.; Bergfeld, T.; Eisenstein, B.I.; Gollin, G.; Ong, B.; Palmer, M.; Selen, M.; Thaler, J.J.; Edwards, K.W.; Ogg, M.; Bellerive, A.; Britton, D.I.; Hyatt, E.R.F.; MacFarlane, D.B.; Patel, P.M.; Spaan, B.; Sadoff, A.J.; Ammar, R.; Baringer, P.; Bean, A.; Besson, D.; Coppage, D.; Copty, N.; Davis, R.; Hancock, N.; Kelly, M.; Kotov, S.; Kravchenko, I.; Kwak, N.; Lam, H.; Kubota, Y.; Lattery, M.; Momayezi, M.; Nelson, J.K.; Patton, S.; Poling, R.; Savinov, V.; Schrenk, S.; Wang, R.; Alam, M.S.; Kim, I.J.; Ling, Z.; Mahmood, A.H.; O'Neill, J.J.; Severini, H.; Sun, C.R.; Wappler, F.; Crawford, G.; Daubenmier, C.M.; Fulton, R.; Fujino, D.; Gan, K.K.; Honscheid, K.; Kagan, H.; Kass, R.; Lee, J.; Malchow, R.; Skovpen, Y.; Sung, M.; White, C.; Zoeller, M.M.; Butler, F.; Fu, X.; Nemati, B.; Ross, W.R.; Skubic, P.; Wood, M.; Bishai, M.; Fast, J.; Gerndt, E.; McIlwain, R.L.; Miao, T.; Miller, D.H.; Modesitt, M.; Payne, D.; Shibata, E.I.; Shipsey, I.P.J.; Wang, P.N.; Battle, M.; Ernst, J.; Gibbons, L.; Kwon, Y.


    An examination of leptons in Υ(4S) events tagged by reconstructed B meson decays yields semileptonic branching fractions of b - =(10.1±1.8±1.5)% for charged and b 0 =(10.9±0.7±1.1)% for neutral B mesons. This is the first measurement for charged B mesons. Assuming equality of the charged and neutral semileptonic widths, the ratio b - /b 0 =0.93±0.18±0.12 is equivalent to the ratio of lifetimes

  8. In-medium meson properties and screening correlators

    International Nuclear Information System (INIS)

    Bazavov, A; Karsch, F; Mukherjee, Swagato; Petreczky, P; Maezawa, Y


    We study spatial meson correlation functions consisting of strange quarks, strange and charm quarks and charm quarks in (2 + 1)-flavor QCD using the highly improved staggered quark action. We find that the in-medium modification of the meson correlators decreases with increasing charm quark content and decreasing size. In particular, we find strong in-medium modification of φ and D s meson correlators around the chiral transition temperature T c , while J/ψ and η c correlators show strong in-medium modification only at temperatures of 1.4T c .

  9. Electroproduction of pseudoscalar mesons at large transverse momenta

    Energy Technology Data Exchange (ETDEWEB)

    Domokos, G.; Kovesi-Domokos, S.; Yunn, B. C.


    Inclusive electroproduction of spinless (pseudoscalar) mesons at large transverse momenta is studied in the framework of local scale invariance. Scaling laws are established for the structure iunctions and approximate analytic expressions are derived for the scaling functions. It is predicted that the cross section decreases essentially according to a power law as a function of the transverse momentum of the observed meson, similarly to hadronic cross sections. The production rate of heavy mesons is found to rise slowly with the laboratory energy of the virtual photon. (auth)

  10. Scattering phaseshift formulas for mesons and baryons in elongated boxes (United States)

    Lee, Frank X.; Alexandru, Andrei


    We derive Lüscher phaseshift formulas for two-particle states in boxes elongated in one of the dimensions. Such boxes offer a cost-effective way of varying the relative momentum of the particles. Boosted states in the elongated direction, which allow wider access to energies, are also considered. The formulas for the various scenarios (moving and zero-momentum states in cubic and elongated boxes) are compared and relations between them are clarified. The results are applicable to a wide set of meson-meson and meson-baryon elastic scattering processes, with the two-particle system having equal or unequal masses.

  11. Light meson decays in CLAS and CLAS12

    Energy Technology Data Exchange (ETDEWEB)

    Kunkel, Michael [Forschungszentrum Juelich (Germany); Collaboration: CLAS Collaboration


    Photoproduction experiments with the CEBAF Large Acceptance Spectrometer (CLAS) at the Thomas Jefferson National Facility produce data sets with competitive statistics of light mesons. With these data sets, measurements of transition form factors for η, ω, and η' mesons via conversion decays can be performed using the invariant mass distribution of the final state dileptons. Tests of fundamental symmetries and information on the light quark mass difference can be performed using a Dalitz plot analysis of the meson decay. An overview of preliminary results, from existing CLAS data, and future prospects within the newly upgraded CLAS12 apparatus are given.

  12. Anomalous effect in Schumann resonance phenomena observed in Japan, possibly associated with the Chi-chi earthquake in Taiwan

    Directory of Open Access Journals (Sweden)

    M. Hayakawa


    Full Text Available The Schumann resonance phenomenon has been monitored at Nakatsugawa (near Nagoya in Japan since the beginning of 1999, and due to the occurance of a severe earthquake (so-called Chi-chi earthquake on 21 September 1999 in Taiwan we have examined our Schumann resonance data at Nakatsugawa during the entire year of 1999. We have found a very anomalous effect in the Schumann resonance, possibly associated with two large land earthquakes (one is the Chi-chi earthquake and another one on 2 November 1999 (Chia-yi earthquake with a magnitude again greater than 6.0. Conspicuous effects are observed for the larger Chi-chi earthquake, so that we summarize the characteristics for this event. The anomaly is characterized mainly by the unusual increase in amplitude of the fourth Schumann resonance mode and a significant frequency shift of its peak frequency (~1.0Hz from the conventional value on the By magnetic field component which is sensitive to the waves propagating in the NS meridian plane. Anomalous Schumann resonance signals appeared from about one week to a few days before the main shock. Secondly, the goniometric estimation of the arrival angle of the anomalous signal is found to coincide with the Taiwan azimuth (the unresolved dual direction indicates toward South America. Also, the pulsed signals, such as the Q-bursts, were simultaneously observed with the "carrier" frequency around the peak frequency of the fourth Schumann resonance mode. The anomaly for the second event for the Chia-yi earthquake on 2 November had much in common. But, most likely due to a small magnitude, the anomaly appears one day before and lasts until one day after the main shock, with the enhancement at the fourth Schumann resonance mode being smaller in amplitude than the case of the Chi-chi earthquake. Yet, the other characteristics, including the goniometric direction finding result, frequency shift, etc., are nearly the same. Although the emphasis of the present study is

  13. Anomalous effect in Schumann resonance phenomena observed in Japan, possibly associated with the Chi-chi earthquake in Taiwan

    Directory of Open Access Journals (Sweden)

    M. Hayakawa


    Full Text Available The Schumann resonance phenomenon has been monitored at Nakatsugawa (near Nagoya in Japan since the beginning of 1999, and due to the occurance of a severe earthquake (so-called Chi-chi earthquake on 21 September 1999 in Taiwan we have examined our Schumann resonance data at Nakatsugawa during the entire year of 1999. We have found a very anomalous effect in the Schumann resonance, possibly associated with two large land earthquakes (one is the Chi-chi earthquake and another one on 2 November 1999 (Chia-yi earthquake with a magnitude again greater than 6.0. Conspicuous effects are observed for the larger Chi-chi earthquake, so that we summarize the characteristics for this event. The anomaly is characterized mainly by the unusual increase in amplitude of the fourth Schumann resonance mode and a significant frequency shift of its peak frequency (~1.0Hz from the conventional value on the By magnetic field component which is sensitive to the waves propagating in the NS meridian plane. Anomalous Schumann resonance signals appeared from about one week to a few days before the main shock. Secondly, the goniometric estimation of the arrival angle of the anomalous signal is found to coincide with the Taiwan azimuth (the unresolved dual direction indicates toward South America. Also, the pulsed signals, such as the Q-bursts, were simultaneously observed with the "carrier" frequency around the peak frequency of the fourth Schumann resonance mode. The anomaly for the second event for the Chia-yi earthquake on 2 November had much in common. But, most likely due to a small magnitude, the anomaly appears one day before and lasts until one day after the main shock, with the enhancement at the fourth Schumann resonance mode being smaller in amplitude than the case of the Chi-chi earthquake. Yet, the other characteristics, including the goniometric direction finding result, frequency shift, etc., are nearly the same. Although the emphasis of

  14. Cabibbo-Kobayashi-Maskawa-favored B decays to a scalar meson and a D meson

    Energy Technology Data Exchange (ETDEWEB)

    Zou, Zhi-Tian; Li, Ying [Yantai University, Department of Physics, Yantai (China); Liu, Xin [Jiangsu Normal University, School of Physics and Electronic Engineering, Xuzhou (China)


    In this work, we attempt to study the Cabibbo-Kobayashi-Maskawa-favored B → anti DS (''S'' denoting the scalar meson) decays within the perturbative QCD approach at the leading order and the leading power. Although the light scalar mesons are widely perceived as primarily the four-quark bound states, in practice it is hard for us to make quantitative predictions based on the four-quark picture for light scalars. Hence, we calculate the decays with light scalars in the two-quark model. For the decays with scalar mesons above 1 GeV, we have explored two possible scenarios, depending on whether the light scalars are treated as the lowest lying q anti q states or four-quark particles. In total, we calculated the branching fractions of 72 decay modes, and most of them are in the range 10{sup -4}-10{sup -7}, which are measurable in the on-going LHCb experiment and the forthcoming Belle-II experiment. Moreover, since in the standard model these decays occur only through tree operators and have no CP asymmetries, any deviation will be a signal of new physics beyond the standard model. Despite large uncertainties induced by nonperturbative parameters and corrections of high order and high power, our results and discussions will be useful for the on-going LHCb and the forthcoming Belle-II experiments. (orig.)

  15. Escape angles in bulk chi((2)) soliton interactions

    DEFF Research Database (Denmark)

    Johansen, Steffen Kjær; Bang, Ole; Sørensen, Mads Peter


    We develop a theory for nonplanar interaction between two identical type I spatial solitons propagating at opposite, but arbitrary transverse angles in quadratic nonlinear (or so-called chi((2))) bulk, media. We predict quantitatively the outwards escape angle, below which the solitons turn around...

  16. Programme Note: Realities and Opportunities in Ho Chi Minh City. (United States)

    Franchet, Chi Nguyen


    The current status of street children in Ho Chi Minh City, Vietnam, is characterized by marginalization from society through street vending, begging, theft, and prostitution. Evaluation of a drop-in center serving children without family linkages indicates need for needs assessments, follow-up activities, measurement of individual child progress,…

  17. Role of Tai Chi in the treatment of rheumatologic diseases. (United States)

    Wang, Chenchen


    Rheumatologic diseases (e.g., fibromyalgia, osteoarthritis, and rheumatoid arthritis) consist of a complex interplay between biologic and psychological aspects, resulting in therapeutically challenging chronic conditions to control. Encouraging evidence suggests that Tai Chi, a multi-component Chinese mind-body exercise, has multiple benefits for patients with a variety of chronic disorders, particularly those with musculoskeletal conditions. Thus, Tai Chi may modulate complex factors and improve health outcomes in patients with chronic rheumatologic conditions. As a form of physical exercise, Tai Chi enhances cardiovascular fitness, muscular strength, balance, and physical function. It also appears to be associated with reduced stress, anxiety, and depression, as well as improved quality of life. Thus, Tai Chi can be safely recommended to patients with fibromyalgia, osteoarthritis, and rheumatoid arthritis as a complementary and alternative medical approach to improve patient well-being. This review highlights the current body of knowledge about the role of this ancient Chinese mind-body medicine as an effective treatment of rheumatologic diseases to better inform clinical decision-making for our patients.

  18. China's Chemical Information Online Service: ChI2Net. (United States)

    Naiyan, Yu; And Others


    Describes the Chemical Integrated Information Service Network (ChI2Net), a comprehensive online information service system which includes chemical, technical, economic, market, news, and management information based on computer and modern communication technology that was built by the China National Chemical Information Centre. (Author/LRW)

  19. CHI 2013 Human Work Interaction Design (HWID) SIG

    DEFF Research Database (Denmark)

    Clemmensen, Torkil; Campos, Pedro F.; Katre, Dinesh S.


    In this SIG we aim to introduce the IFIP 13.6 Human Work Interaction Design (HWID) approach to the CHI audience. The HWID working group aims at establishing relationships between extensive empirical work-domain studies and HCI design. We invite participants from industry and academia with an inte...

  20. Double asymptotics for the chi-square statistic. (United States)

    Rempała, Grzegorz A; Wesołowski, Jacek


    Consider distributional limit of the Pearson chi-square statistic when the number of classes m n increases with the sample size n and [Formula: see text]. Under mild moment conditions, the limit is Gaussian for λ = ∞, Poisson for finite λ > 0, and degenerate for λ = 0.


    African Journals Online (AJOL)


    the chi symbolism as exhibited in his famous work Things Fall. Apart. Things Fall Apart by Achebe gives fictionalized account of Igbo life and times which are close to the reality of our era. Philosophy ... solution which he offers to the problems of daily living in society. .... weighed on the balance of reality, they could stand for.

  2. Tai Chi and Postural Stability in Patients with Parkinson's Disease (United States)

    Li, Fuzhong; Harmer, Peter; Fitzgerald, Kathleen; Eckstrom, Elizabeth; Stock, Ronald; Galver, Johnny; Maddalozzo, Gianni; Batya, Sara S.


    Background Patients with Parkinson's disease have substantially impaired balance, leading to diminished functional ability and an increased risk of falling. Although exercise is routinely encouraged by health care providers, few programs have been proven effective. Methods We conducted a randomized, controlled trial to determine whether a tailored tai chi program could improve postural control in patients with idiopathic Parkinson's disease. We randomly assigned 195 patients with stage 1 to 4 disease on the Hoehn and Yahr staging scale (which ranges from 1 to 5, with higher stages indicating more severe disease) to one of three groups: tai chi, resistance training, or stretching. The patients participated in 60-minute exercise sessions twice weekly for 24 weeks. The primary outcomes were changes from baseline in the limits-of-stability test (maximum excursion and directional control; range, 0 to 100%). Secondary outcomes included measures of gait and strength, scores on functional-reach and timed up-and-go tests, motor scores on the Unified Parkinson's Disease Rating Scale, and number of falls. Results The tai chi group performed consistently better than the resistance-training and stretching groups in maximum excursion (between-group difference in the change from baseline, 5.55 percentage points; 95% confidence interval [CI], 1.12 to 9.97; and 11.98 percentage points; 95% CI, 7.21 to 16.74, respectively) and in directional control (10.45 percentage points; 95% CI, 3.89 to 17.00; and 11.38 percentage points; 95% CI, 5.50 to 17.27, respectively). The tai chi group also performed better than the stretching group in all secondary outcomes and outperformed the resistance-training group in stride length and functional reach. Tai chi lowered the incidence of falls as compared with stretching but not as compared with resistance training. The effects of tai chi training were maintained at 3 months after the intervention. No serious adverse events were observed. Conclusions

  3. Heavy meson form factors from QCD

    International Nuclear Information System (INIS)

    Falk, A.F.; Georgi, H.; Grinstein, B.


    We calculate the leading QCD radiative corrections to the relations which follow from the decoupling of the heavy quark spin as the quark mass goes infinity and from the symmetry between systems with different heavy quarks. One of the effects we calculate gives the leading q 2 -dependence of the form factor of a heavy quark, which in turn dominates the q 2 -dependence of the form factors of bound states of the heavy quark with light quarks. This, combined with the normalization of the form factor provided by symmetry, gives us a first principles calculation of the heavy meson (or baryon) form factors in the limit of very large heavy quark mass. (orig.)

  4. Light-Meson Spectroscopy at Compass

    Directory of Open Access Journals (Sweden)

    Krinner Fabian


    The light-meson spectrum is measured in different final states produced in diffractive dissociation reactions with squared four-momentum transfer t to the target between 0.1 and 1.0 (GeV/c2. The flagship channel is the π−π+π− final state, for which Compass has recorded the currently world’s largest data sample. These data not only allow us to measure the properties of known resonances with high precision, but also to search for new states. Among these is a new axial-vector signal, the a1(1420, with unusual properties. The findings are confirmed by the analysis of the π−π0π0 final state.

  5. Search for exotic mesons at SLAC

    International Nuclear Information System (INIS)

    Bonamy, P.; Baggett, N.; Fieguth, T.


    The theoretical justification and results from recent experimental searches for backward-produced exotic mesons including two experiments carried out by the collaboration at SLAC are reviewed. The first experiment put upper limits of about 1 to 2 μb for X ++ → (2π, 4π, 6π) ++ and anti ppπ + π + in the reaction π + + p → X ++ + n/sub forward/ at 8.4 GeV/c studied with the SLAC 14 inch rapid cycling bubble chamber triggered by a downstream neutron detector. Also the important features of the recently completed second experiment with the SLAC streamer chamber to study the reaction π - + p → X -- + p/sub forward/ at 14 GeV/c are discussed

  6. Pseudoscaler meson masses in the quark model

    International Nuclear Information System (INIS)

    Karl, G.


    Pseudoscaler meson masses and sum rules are compared in two different limits of a quark model with 4 quarks. The conventional limit corresponds to a heavy c anti c state and generalizes ideal mixing in a nonet. The second limit corresponds to a missing SU 4 unitary singlet and appears more relevant to the masses of π, K, eta, eta'. If SU 3 is broken only by the mass difference between the strange and nonstrange quarks, the physical masses imply that the u anti u, d anti d and s anti s pairs account only for 33% of the composition of the eta'(960), while for the eta(548) this fraction is 86%. If some of the remaining matter is in the form of the constituents of J/psi, the relative proportion of the relative decays J/psi → eta γ vs J/psi → etaγ is accounted for in satisfactory agreement with experiment. (author)

  7. Integral transform technique for meson wave functions

    International Nuclear Information System (INIS)

    Bakulev, A.P.; Mikhajlov, S.V.


    In a recent paper [1] we proposed a new approach for extracting the wave function of the π-meson φ π (x) and the masses and wave functions of its first resonances from the new QCD sum rules for nondiagonal correlators obtained in [2]. Here, we test our approach using an exactly solvable toy model as an illustrating example. We demonstrate the validity of the method and suggest a pure algebraic procedure for extracting the masses and wave functions relating to the case under investigation. We also explore the stability of the procedure under perturbations of the theoretical part of the sum rule. In application to the pion case, this results not only in the mass and wave function of the first resonance (π'), but also in the estimation of π''-mass. 17 refs., 11 figs

  8. Delta, iota and other meson spectroscopies

    International Nuclear Information System (INIS)

    Lipkin, H.J.


    This talk is given from the point of view of an experimentalist. Meson spectroscopy in the 1 to 3 GeV region is interesting because experiments exploring this region, in particular radiative psi decay, have found a rich structure of resonances too complicated to unravel with any one experiment, and not easily interpreted with any one theoretical model. None of the theoretical calculations predicting all kinds of interesting and exotic objects in this region is very convincing or reliable. Additional input from anti pp annihilation can be very useful in helping to find the answers to the following open questions: what exactly is this spectrum, what are the masses and quantum numbers of the resonances, as determined from analysis of data without theoretical prejudices; how is this spectrum described by QCD, is there evidence for new kinds of states like glue-balls, hybrids, axions, Higgses or multiquark exotics, and is there any evidence for new physics beyond QCD. 20 refs

  9. Rare decays of B-mesons

    International Nuclear Information System (INIS)

    Ali, A.


    This paper is organized as follows. First, we discuss the decay rates for b → (s,d) + γ in the lowest order (1 loop) and including the QCD corrections in the effective Hamiltonian method. The photon energy spectrum in the inclusive decays B → X s + γ is evaluated in this approach and the dominant background from the CC decays B → X c + γ is presented. Next, we discuss the calculations for the inclusive decays b → s + anti l (l = e,μ,ν), including the QCD corrections. Finally, we summarize rate estimates for the exclusive rare decays of the B-meson, B → K*γ, and B → (K,K*) anti l (l = e,μ,ν), as well as B o s,d → γγ and B o s,d → l + l - with (l = e,μ,r). (orig./HSI)

  10. Exclusive Backward-Angle Omega Meson Electroproduction

    Energy Technology Data Exchange (ETDEWEB)

    Wenliang, Li [Univ. of Regina, Regina, SK (Canada)


    Exclusive meson electroproduction at different squared four-momenta of the exchanged virtual photon, Q2 , and at different four-momentum transfers, t and u, can be used to probe QCD's transition from hadronic degrees of freedom at the long distance scale to quark-gluon degrees of freedom at the short distance scale. Backward-angle meson electroproduction was previously ignored, but is anticipated to offer complimentary information to conventional forward-angle meson electroproduction studies on nucleon structure. This work is a pioneering study of backward-angle ω cross sections through the exclusive 1H(e, e'p)ω reaction using the missing mass reconstruction technique. The extracted cross sections are separated into the transverse (T), longitudinal (L), and LT, TT interference terms. The analyzed data were part of experiment E01-004 (Fπ-2), which used 2.6-5.2 GeV electron beams and HMS+SOS spectrometers in Jefferson Lab Hall C. The primary objective was to detect coincidence π in the forward-angle, where the backward-angle omega events were fortuitously detected. The experiment has central Q2 values of 1.60 and 2.45 GeV2 , at W = 2.21 GeV. There was significant coverage in phi and epsilon, which allowed separation of σT,L,LT,TT . The data set has a unique u coverage of -u ~ 0, which corresponds to -t > 4 GeV2 . The separated σT result suggest a flat ~ 1/Q1.33±1.21 dependence, whereas sigma_L seems to hold a stronger 1/Q9.43±6.28 dependence. The σL/σT ratio indicate σT dominance at Q2 = 2.45 GeV2 at the ~90% confidence level. After translating the results into the -t space of the published CLAS data, our data show evidence of a backward-angle omega electroproduction peak at both Q2 settings. Previously, this phenomenon showing both forward and backward-angle peaks was only observed in the meson

  11. Form factors of heavy mesons in QCD

    International Nuclear Information System (INIS)

    Shifman, M.A.; Vysotsky, M.I.


    Logarithmic corrections to form factors of mesons built from heavy quarks are dirived in the framework of quantum chromodynamics. The reactions e + e - → etasub(c)γ and H → J/PSIγ are considered as an example. A novel feature as compared to the well studied problem of the pion form factor is the existence of the transformations between the quark-antiquark state c anti c and the gluonic one. O(αsub(s)) corrections are calculated exactly. An infinite series of the leading logarithmic terms is summed up with the help of the operator technique. Apart from already known results for quark operators some new results referring to gluon operators and their mixing with the quark ones are used. Two alternative derivations of the multiplicatively renormalizable operators are given. The first one reduces to a direct computation of the mixing matrix and its diagonalization, the second derivation is based on conformal symmetry considerations

  12. Meson spectra using relativistic quark models

    International Nuclear Information System (INIS)

    Eggers, M.C.


    The complexity of QCD has led to the use of simpler, phenomenological models for hadrons, notably potential models. A short overview of the origin, rationale, merits and demerits of such models is given. Nonrelativistic models and scaling laws are discussed using the WKB technique for illustrative purposes. The failure of nonrelativistic models to describe the lighter mesons motivates the introduction of relativistic equations. Relativistic kinematics are incorporated into a Schroedinger formalism using equations derived by A. Barut, while two-body kinematics are brought into a one-body form via a substitution related to the Todorov equation. The potential used involves a semi-analytic solution to a harmonic oscillator modified by a spin-spin interaction term. The results seem to indicate that such a harmonic oscillator is unsuitable to describe diquark systems adequately

  13. Exotic meson decay widths using lattice QCD

    International Nuclear Information System (INIS)

    Cook, M. S.; Fiebig, H. R.


    A decay width calculation for a hybrid exotic meson h, with J PC =1 -+ , is presented for the channel h→πa 1 . This quenched lattice QCD simulation employs Luescher's finite box method. Operators coupling to the h and πa 1 states are used at various levels of smearing and fuzzing, and at four quark masses. Eigenvalues of the corresponding correlation matrices yield energy spectra that determine scattering phase shifts for a discrete set of relative πa 1 momenta. Although the phase shift data is sparse, fits to a Breit-Wigner model are attempted, resulting in a decay width of about 60 MeV when averaged over two lattice sizes having a lattice spacing of 0.07 fm

  14. Hard exclusive meson production to constrain GPDs

    Energy Technology Data Exchange (ETDEWEB)

    Wolbeek, Johannes ter; Fischer, Horst; Gorzellik, Matthias; Gross, Arne; Joerg, Philipp; Koenigsmann, Kay; Malm, Pasquale; Regali, Christopher; Schmidt, Katharina; Sirtl, Stefan; Szameitat, Tobias [Physikalisches Institut, Albert-Ludwigs-Universitaet Freiburg, Freiburg im Breisgau (Germany); Collaboration: COMPASS Collaboration


    The concept of Generalized Parton Distributions (GPDs) combines the two-dimensional spatial information, given by form factors, with the longitudinal momentum information from the PDFs. Thus, GPDs provide a three-dimensional 'tomography' of the nucleon. Furthermore, according to Ji's sum rule, the GPDs H and E enable access to the total angular momenta of quarks, antiquarks and gluons. While H can be approached using electroproduction cross section, hard exclusive meson production off a transversely polarized target can help to constrain the GPD E. At the COMPASS experiment at CERN, two periods of data taking were performed in 2007 and 2010, using a longitudinally polarized 160 GeV/c muon beam and a transversely polarized NH{sub 3} target. This talk introduces the data analysis of the process μ + p → μ' + p' + V, and recent results are presented.

  15. Photoproduction of scalar mesons at CLAS (United States)

    Chandavar, Shloka; Hicks, Kenneth; Weygand, Dennis; CLAS Collaboration


    A single gluon, which carries color charge, cannot exist independently outside a hadron. Lattice QCD calculations in pure SU(3), however, predict the existence of glueballs which are bound states of two or more gluons. In the real world, the challenge to identify glueballs experimentally is the fact they mix with meson states. The f0 (1500) is one of several candidates for the lightest glueball, with JPC =0++ . We investigate the presence of this particle in photoproduction by analyzing the reaction γp -->fJ p -->KS0KS0 p --> 2 (π+π-) p . This reaction was studied using data from the g12 experiment performed using the CLAS detector at Jefferson Lab. A preliminary partial wave analysis, performed on the KS0KS0 invariant mass spectrum, will be presented. These results update those presented for this reaction channel at previous conferences. This work is supported by grant from NSF.

  16. Meson-meson bound state in a 2+1 lattice QCD model with two flavors and strong coupling

    International Nuclear Information System (INIS)

    Faria da Veiga, Paulo A.; O'Carroll, Michael; Neto, Antonio Francisco


    We consider the existence of bound states of two mesons in an imaginary-time formulation of lattice QCD. We analyze an SU(3) theory with two flavors in 2+1 dimensions and two-dimensional spin matrices. For a small hopping parameter and a sufficiently large glueball mass, as a preliminary, we show the existence of isoscalar and isovector mesonlike particles that have isolated dispersion curves (upper gap up to near the two-particle threshold ∼-4lnκ). The corresponding meson masses are equal up to and including O(κ 3 ) and are asymptotically of order -2lnκ-κ 2 . Considering the zero total isospin sector, we show that there is a meson-meson bound state solution to the Bethe-Salpeter equation in a ladder approximation, below the two-meson threshold, and with binding energy of order bκ 2 ≅0.02359κ 2 . In the context of the strong coupling expansion in κ, we show that there are two sources of meson-meson attraction. One comes from a quark-antiquark exchange. This is not a meson exchange, as the spin indices are not those of the meson particle, and we refer to this as a quasimeson exchange. The other arises from gauge field correlations of four overlapping bonds, two positively oriented and two of opposite orientation. Although the exchange part gives rise to a space range-one attractive potential, the main mechanism for the formation of the bound state comes from the gauge contribution. In our lattice Bethe-Salpeter equation approach, this mechanism is manifested by an attractive distance-zero energy-dependent potential. We recall that no bound state appeared in the one-flavor case, where the repulsive effect of Pauli exclusion is stronger

  17. Inclusive weak decays of charmed mesons

    International Nuclear Information System (INIS)

    Matthews, C.G.


    Inclusive analysis provide a different insight into the understanding of weak decay physics. This thesis experimentally determines inclusive decay predictions of charmed D mesons. Exclusive decay predictions are also used from a variety of theoretical models to make predictions about inclusive properties. Both experimental and theoretical realms benefit from the new techniques presented in this thesis. Inclusive properties derived are the multiplicity distributions, average multiplicities and inclusive branching ratios of charged particles, charged and neutral kaons, and charged pions. The center-of-mass momentum spectra of charged and neutral kaons are also obtained. Additionally, in the theoretical realm only, the inclusive properties of neutral pions, and the center-of-mass momentum spectra of charged and neutral pions are determined. The experimental analysis, which uses data from the mark II experiment at the Stanford Linear Accelerator Center, employs an unfold technique utilizing fold matrices to obtain the charged particle and kaon properties. A new enhanced unfold technique involving fold tensors obtains the first-ever results for the inclusive charged pion properties. The average strange quark contents and the average charged lepton multiplicities of the D + , D 0 and D + 8 are also presented. In the theoretical analysis, the exclusive decay mode predictions from the factorization model for Bauer, Stech and Wirbel; the quark diagram scheme of Chau and Cheng; and the QCD sum rules model of Block and Shifman are processed to determine inclusive predictions will lead to a better understanding of the model. The thesis also derives inclusive predictions from the D meson exclusive branching ratios compiled by the Particle Data Group

  18. Production of charmed mesons in Z decays (United States)

    Buskulic, D.; de Bonis, I.; Decamp, D.; Ghez, P.; Goy, C.; Lees, J.-P.; Minard, M.-N.; Pietrzyk, B.; Ariztizabal, F.; Comas, P.; Crespo, J. M.; Efthymiopoulos, I.; Fernandez, E.; Fernandez-Bosman, M.; Gaitan, V.; Garrido, Ll.; Mattison, T.; Orteu, S.; Pacheco, A.; Padilla, C.; Pascual, A.; Creanza, D.; de Palma, M.; Farilla, A.; Iaselli, G.; Maggi, G.; Marinelli, N.; Natali, S.; Nuzzo, S.; Ranieri, A.; Raso, G.; Romano, F.; Ruggieri, F.; Selvaggi, G.; Silvestris, L.; Tempesta, P.; Zito, G.; Chai, Y.; Hu, H.; Huang, D.; Huang, X.; Lin, J.; Wang, T.; Xie, Y.; Xu, D.; Xu, R.; Zhang, J.; Zhang, L.; Zhao, W.; Bonvicini, G.; Boudreau, J.; Casper, D.; Drevermann, H.; Forty, R. W.; Ganis, G.; Gay, C.; Girone, M.; Hagelberg, R.; Harvey, J.; Hilgart, J.; Jacobsen, R.; Jost, B.; Knobloch, J.; Lehraus, I.; Maggi, M.; Markou, C.; Martinez, M.; Mato, P.; Meinhard, H.; Minten, A.; Miquel, R.; Moser, H.-G.; Palazzi, P.; Pater, J. R.; Perlas, J. A.; Perrodo, P.; Pusztaszeri, J.-F.; Ranjard, F.; Rolandi, L.; Rothberg, J.; Ruan, T.; Saich, M.; Schlatter, D.; Schmelling, M.; Sefkow, F.; Tejessy, W.; Tomalin, I. R.; Veenhof, R.; Wachsmuth, H.; Wasserbaech, S.; Wiedemann, W.; Wildish, T.; Witzeling, W.; Wotschack, J.; Ajaltouni, Z.; Bardadin-Otwinowska, M.; Barres, A.; Boyer, C.; Falvard, A.; Gay, P.; Guicheney, C.; Henrard, P.; Jousset, J.; Michel, B.; Montret, J.-C.; Pallin, D.; Perret, P.; Podlyski, F.; Proriol, J.; Saadi, F.; Fearnley, T.; Hansen, J. B.; Hansen, J. D.; Hansen, J. R.; Hansen, P. H.; Johnson, S. D.; Møllerud, R.; Nilsson, B. S.; Kyriakis, A.; Simopoulou, E.; Siotis, I.; Vayaki, A.; Zachariadou, K.; Badier, J.; Blondel, A.; Bonneaud, G.; Brient, J. C.; Bourdon, B.; Fouque, G.; Passalacqua, L.; Rougé, A.; Rumpf, M.; Tanaka, R.; Verderi, M.; Videau, H.; Candlin, D. J.; Parsons, M. I.; Veitch, E.; Focardi, E.; Moneta, L.; Parrini, G.; Corden, M.; Delfino, M.; Georgiopoulos, C.; Ikeda, M.; Jaffe, D. E.; Levinthal, D.; Antonelli, A.; Bencivenni, G.; Bologna, G.; Bossi, F.; Campana, P.; Capon, G.; Cerutti, F.; Chiarella, V.; Felici, G.; Laurelli, P.; Mannocchi, G.; Murtas, F.; Murtas, G. P.; Pepe=Altarelli, M.; Salomone, S.; Colrain, P.; Ten Have, I.; Lynch, J. G.; Maitland, W.; Morton, W. T.; Raine, C.; Reeves, P.; Scarr, J. M.; Smith, K.; Smith, M. G.; Thompson, A. S.; Thorn, S.; Turnbull, R. M.; Brandl, B.; Braun, O.; Geweniger, C.; Graefe, G.; Hanke, P.; Hepp, V.; Karger, C.; Kluge, E. E.; Maumary, Y.; Putzer, A.; Rensch, B.; Stahl, A.; Tittel, K.; Wunsch, M.; Beuselinck, M.; Binnie, D. M.; Cameron, W.; Cattaneo, M.; Colling, D. J.; Dornan, P. J.; Hassard, J. F.; Lieske, N. M.; Moutoussi, A.; Nash, J.; Patton, S.; Payne, D. G.; Phillips, M. J.; San Martin, G.; Sedgbeer, J. K.; Wright, A. G.; Girtler, P.; Kuhn, D.; Rudolph, G.; Vogl, R.; Bowdery, C. K.; Brodbeck, T. J.; Finch, A. J.; Foster, F.; Hughes, G.; Jackson, D.; Keemer, N. R.; Nuttal, M.; Patel, A.; Sloan, T.; Snow, S. W.; Whelan, E. P.; Galla, A.; Greene, A. M.; Kleinknecht, K.; Raab, J.; Renk, B.; Sander, H.-G.; Schmidt, H.; Walther, S. M.; Wanke, R.; Wolf, B.; Bencheikh, A. M.; Benchouk, C.; Bonissent, A.; Calvet, D.; Carr, J.; Coyle, P.; Diaconu, C.; Drinkard, J.; Etienne, F.; Nicod, D.; Payre, P.; Roos, L.; Rousseau, D.; Schwemling, P.; Talby, M.; Adlung, S.; Assmann, R.; Bauer, C.; Blum, W.; Brown, D.; Cattaneo, P.; Dehning, B.; Dietl, H.; Dydak, F.; Frank, M.; Halley, A. W.; Jakobs, K.; Lauber, J.; Lütjens, G.; Lutz, G.; Männer, G.; Richter, R.; Schröder, J.; Schwarz, A. S.; Settles, R.; Seywerd, H.; Stierlin, H.; Stiegler, U.; Denis, R. St.; Wolf, G.; Alemany, R.; Boucrot, J.; Callot, O.; Cordier, A.; Davier, M.; Duflot, L.; Grivaz, J.-F.; Heusse, Ph.; Janot, P.; Kim, D. W.; Le Diberder, F.; Lefrançois, J.; Lutz, A.-M.; Musolino, G.; Schune, M.-H.; Veillet, J.-J.; Videau, I.; Abbaneo, D.; Bagliesi, G.; Batignani, G.; Bottigli, U.; Bozzi, C.; Calderini, G.; Carpinelli, M.; Ciocci, M. A.; Ciulli, V.; Dell'Orso, R.; Ferrante, I.; Fidecaro, F.; Foà, L.; Forti, F.; Giassi, A.; Giorgi, M. A.; Gregorio, A.; Ligabue, F.; Luisiani, A.; Mannelli, E. B.; Marrocchesi, P. S.; Messineo, A.; Palla, F.; Rizzo, G.; Sanguinetti, G.; Spagnolo, P.; Steinberger, J.; Tenchini, R.; Tonelli, G.; Triggiani, G.; Valassi, A.; Vannini, C.; Venturi, A.; Verdini, P. G.; Walsh, J.; Betteridge, A. P.; Gao, Y.; Green, M. G.; Johnson, D. L.; March, P. V.; Medcalf, T.; Mir, Ll. M.; Quazi, I. S.; Strong, J. A.; Bertin, V.; Botterill, D. R.; Clifft, R. W.; Edgecock, T. R.; Haywood, S.; Edwards, M.; Norton, P. R.; Thompson, J. C.; Bloch-Devaux, B.; Colas, P.; Duarte, H.; Emery, S.; Kozanecki, W.; Lançon, E.; Lemaire, M. C.; Locci, E.; Marx, B.; Perez, P.; Rander, J.; Renardy, J.-F.; Rosowsky, A.; Roussarie, A.; Schuller, J.-P.; Schwindling, J.; Si Mohand, D.; Vallage, B.; Johnson, R. P.; Litke, A. M.; Taylor, G.; Wear, J.; Babbage, W.; Booth, C. N.; Buttar, C.; Cartwright, S.; Combley, F.; Dawson, I.; Thompson, L. F.; Barberio, E.; Böhrer, A.; Brandt, S.; Cowan, G.; Grupen, C.; Lutters, G.; Rivera, F.; Schäfer, U.; Smolik, L.; Bosisio, L.; Della Marina, R.; Giannini, G.; Bobbo, B.; Pitis, L.; Ragusa, F.; Bellantoni, L.; Chen, W.; Conway, J. S.; Feng, Z.; Ferguson, D. P. S.; Gao, Y. S.; Grahl, J.; Harton, J. L.; Hayes, O. J.; Nachtman, J. M.; Pan, Y. B.; Saadi, Y.; Schmitt, M.; Scott, I.; Sharma, V.; Shi, Z. H.; Turk, J. D.; Walsh, A. M.; Weber, F. V.; Wu, Sau Lan; Wu, X.; Zheng, M.; Zobernig, G.


    The production of charmed mesonsmathop {D^0 }limits^{( - )} , D ± , and D *± is studied in a sample of 478,000 hadronic Z decays. The production rates are measured to be 10052_2005_Article_BF01559519_TeX2GIFE1.gif begin{gathered} {Γ (Z to D^{* ± } X)}/{Γ _{had }} = 0.187 ± 0.015(exp .) ± 0.013(BR), \\ {Γ (Z to D^ ± X)}/{Γ _{had }} = 0.251 ± 0.026(exp .) ± 0.025(BR), \\ {Γ (Z to mathop {D^0 }limits^{( - )} X)}/{Γ _{had }} = 0.518 ± 0.052(exp .) ± 0.035(BR), \\ where the errors from this analysis are separated from those coming from the D branching ratios (BR). The D *± momentum distribution is extracted separately forZ to cbar c andZ to bbar b events with the help of event shape variables. It is consistent with the prediction of the JETSET Monte Carlo program after adjustment of the charm fragmentation function. Constraining the shape of theZ to bbar b contribution, the average fraction of the beam energy taken by a D * meson produced in the fragmentation of a charm quark is extracted by a parametric fit to be c =0.495±0.011±0.007. Evidence for D **0 ( D 1(2420)0 and/or D {2/*}(2460)0) production is found in theD^{* ± } π ^ mp channel, accounting for a fraction (18±5±2)% of all D *± production. The relative production of vector and pseudoscalar mesons is dicussed, together with the possible effects of D ** production. The c-quark forward-backward Z-pole asymmetry is detrmined from that of high momentum D *± to be A {/FB 0,c }=(7.7±4.4)%.

  19. Heavy meson decays and p anti p collisions

    International Nuclear Information System (INIS)

    Berger, E.L.; Damgaard, P.H.; Tsokos, K.


    We use the formalism of exclusive processes at high momentum transfer, to give predictions for the decay of the 2 ++ chi state into a p anti p pair and the production cross section for chi in p anti p collisions

  20. Test of scalar meson structure in φ radiative decays

    International Nuclear Information System (INIS)

    Kumano, S.


    We show that φ radiative decays into scalar mesons [f 0 (975), a 0 (980) ≡ S] can provide important clues on the internal structures of these mesons. Radiative decay widths vary widely: B.R. = 10 -4 -10 -6 depending on the substructures (qq-bar, qqq-barq-bar, KK-bar, glueball). Hence, we could discriminate among various models by measuring these widths at future φ factories. The understanding of these meson structures is valuable not only in hadron spectroscopy but also in nuclear physics in connection with the widely-used but little-understood σ meson. We also find that the decay φ→S γ →K 0 K-bar 0 γ is not strong enough to pose a significant background problem for studying CP violation via φ→K 0 K-bar 0 at the φ factories. (author)

  1. Meson life time in the anisotropic quark-gluon plasma

    International Nuclear Information System (INIS)

    Ali-Akbari, Mohammad; Allahbakhshi, Davood


    In the hot (an)isotropic plasma the meson life time τ is defined as a time scale after which the meson dissociates. According to the gauge/gravity duality, this time can be identified with the inverse of the imaginary part of the frequency of the quasinormal modes, ω_I, in the (an)isotropic black hole background. In the high temperature limit, we numerically show that at fixed temperature(entropy density) the life time of the mesons decreases(increases) as the anisotropy parameter raises. For general case, at fixed temperature we introduce a polynomial function for ω_I and observe that the meson life time decreases. Moreover, we realize that (s/T"3)"6, where s and T are entropy density and temperature of the plasma respectively, can be expressed as a function of anisotropy parameter over temperature. Interestingly, this function is a Padé approximant.

  2. A unified model of K- and π-mesons

    International Nuclear Information System (INIS)

    Skyrme, T.H.R.


    On the foundation of an antecedent non-linear meson field theory it is suggested that the π-meson field may be described in terms of collective motions of the K-meson fields. A particular model of the K-nucleon interaction is considered whose collective π-modes have symmetrical PV coupling with the nucleon system; parity is conserved to a great extent for the π-nucleon system in the absence of strange particles. The direct K-nucleon interactions do not conserve parity; their sign and symmetry are qualitatively acceptable. The masses and coupling constants of the meson fields are determinate in terms of one universal coupling constant and a cut-off. The structure of this model suggests a natural way for the introduction of the 'spurion', describing weak interactions that violate strangeness. (author). 6 refs

  3. Light meson decays from photon-induced reactions with CLAS

    Energy Technology Data Exchange (ETDEWEB)

    Kunkel, Michael C. [Forschungszentrum Juelich (Germany); Collaboration: CLAS-Collaboration


    Photo-production experiments with the CEBAF Large Acceptance Spectrometer (CLAS) at the Thomas Jefferson National Laboratory produce data sets with unprecedented statistics of light mesons. With these data sets, measurements of transition form factors for η, ω, and η' via conversion decays are performed using a line shape analysis on the invariant mass of the final state dileptons. Tests of fundamental symmetries and information on the light quark mass difference are performed using a Dalitz plot analysis of the meson decay. In addition, the data allows for a search for dark matter, such as the heavy photon via conversion decays of light mesons and physics beyond the Standard Model is searched for via invisible decays of η mesons. An overview of the first results and future prospects is given.

  4. Angular Momentum Content of the ρ Meson in Lattice QCD

    International Nuclear Information System (INIS)

    Glozman, Leonid Ya.; Lang, C. B.; Limmer, Markus


    The variational method allows one to study the mixing of interpolators with different chiral transformation properties in the nonperturbatively determined physical state. It is then possible to define and calculate in a gauge-invariant manner the chiral as well as the partial wave content of the quark-antiquark component of a meson in the infrared, where mass is generated. Using a unitary transformation from the chiral basis to the 2S+1 L J basis one may extract a partial wave content of a meson. We present results for the ground state of the ρ meson using quenched simulations as well as simulations with n f =2 dynamical quarks, all for lattice spacings close to 0.15 fm. We point out that these results indicate a simple 3 S 1 -wave composition of the ρ meson in the infrared, like in the SU(6) flavor-spin quark model.

  5. Angular Momentum Content of the ρ Meson in Lattice QCD (United States)

    Glozman, Leonid Ya.; Lang, C. B.; Limmer, Markus


    The variational method allows one to study the mixing of interpolators with different chiral transformation properties in the nonperturbatively determined physical state. It is then possible to define and calculate in a gauge-invariant manner the chiral as well as the partial wave content of the quark-antiquark component of a meson in the infrared, where mass is generated. Using a unitary transformation from the chiral basis to the LJ2S+1 basis one may extract a partial wave content of a meson. We present results for the ground state of the ρ meson using quenched simulations as well as simulations with nf=2 dynamical quarks, all for lattice spacings close to 0.15 fm. We point out that these results indicate a simple S13-wave composition of the ρ meson in the infrared, like in the SU(6) flavor-spin quark model.

  6. Meson masses in electromagnetic fields with Wilson fermions (United States)

    Bali, G. S.; Brandt, B. B.; Endrődi, G.; Gläßle, B.


    We determine the light meson spectrum in QCD in the presence of background magnetic fields using quenched Wilson fermions. Our continuum extrapolated results indicate a monotonous reduction of the connected neutral pion mass as the magnetic field grows. The vector meson mass is found to remain nonzero, a finding relevant for the conjectured ρ -meson condensation at strong magnetic fields. The continuum extrapolation was facilitated by adding a novel magnetic field-dependent improvement term to the additive quark mass renormalization. Without this term, sizable lattice artifacts that would deceptively indicate an unphysical rise of the connected neutral pion mass for strong magnetic fields are present. We also investigate the impact of these lattice artifacts on further observables like magnetic polarizabilities and discuss the magnetic field-induced mixing between ρ -mesons and pions. We also derive Ward-Takashi identities for QCD +QED both in the continuum formulation and for (order a -improved) Wilson fermions.

  7. QCD sum rules for the decay amplitudes of pseudoscalar mesons

    International Nuclear Information System (INIS)

    Narison, S.


    Bounds on the π and K meson decay amplitudes are obtained to a good accuracy from QCD sum rules of the Laplace transform type. A relation between fsub(π) and the rho meson coupling to the photon is given. Using the heavy quarks q 2 =0 sum rule to two loops we find our best bounds: fsub(D) approximately < (101+-25) MeV and fsub(F) approximately < (147+-41.6) MeV to be compared to fsub(π) approximately 93.3 MeV. We also derive a relation between the D and F meson masses and the charm quark mass. Our results are extended to the beautiful B mesons. (author)

  8. Improved measurement of the B 0 and B + meson lifetimes (United States)

    Buskulic, D.; de Bonis, I.; Decamp, D.; Ghez, P.; Goy, C.; Lees, J. P.; Lucotte, A.; Minard, M. N.; Odier, P.; Pietrzyk, B.; Casado, M. P.; Chmeissani, M.; Crespo, J. M.; Delfino, M.; Efthymiopoulos, I.; Fernandez, E.; Fernandez-Bosman, M.; Garrido, L.; Juste, A.; Martinez, M.; Orteu, S.; Pacheco, A.; Padilla, C.; Pascual, A.; Perlas, J. A.; Riu, I.; Sanchez, F.; Teubert, F.; Colaleo, A.; Creanza, D.; de Palma, M.; Gelao, G.; Girone, M.; Iaselli, G.; Maggi, G.; Maggi, M.; Marinelli, N.; Nuzzo, S.; Ranieri, A.; Raso, G.; Ruggieri, F.; Selvaggi, G.; Silvestris, L.; Tempesta, P.; Zito, G.; Huang, X.; Lin, J.; Ouyang, Q.; Wang, T.; Xie, Y.; Xu, R.; Xue, S.; Zhang, J.; Zhang, L.; Zhao, W.; Alemany, R.; Bazarko, A. O.; Bonvicini, G.; Cattaneo, M.; Comas, P.; Coyle, P.; Drevermann, H.; Forty, R. W.; Frank, M.; Hagelberg, R.; Harvey, J.; Janot, P.; Jost, B.; Kneringer, E.; Knobloch, J.; Lehraus, I.; Martin, E. B.; Mato, P.; Minten, A.; Miquel, R.; Mir, Ll. M.; Moneta, L.; Oest, T.; Palla, F.; Pater, J. R.; Pusztaszeri, J. F.; Ranjard, F.; Rensing, P.; Rolandi, L.; Schlatter, D.; Schmelling, M.; Schneider, O.; Tejessy, W.; Tomalin, I. R.; Venturi, A.; Wachsmuth, H.; Wagner, A.; Wildish, T.; Ajaltouni, Z.; Barrès, A.; Boyer, C.; Falvard, A.; Gay, P.; Guicheney, C.; Henrard, P.; Jousset, J.; Michel, B.; Monteil, S.; Montret, J.-C.; Pallin, D.; Perret, P.; Podlyski, F.; Proriol, J.; Rossignol, J. M.; Fearnley, T.; Hansen, J. B.; Hansen, J. D.; Hansen, J. R.; Hansen, P. H.; Nilsson, B. S.; Wäänänen, A.; Kyriakis, A.; Markou, C.; Simopoulou, E.; Siotis, I.; Vayaki, A.; Zachariadou, K.; Blondel, A.; Bonneaud, G.; Brient, J. C.; Bourdon, P.; Rougé, A.; Rumpf, M.; Valassi, A.; Verderi, M.; Videau, H.; Candlin, D. J.; Parsons, M. I.; Focardi, E.; Parrini, G.; Corden, M.; Georgiopoulos, C.; Jaffe, D. E.; Antonelli, A.; Bencivenni, G.; Bologna, G.; Bossi, F.; Campana, P.; Capon, G.; Casper, D.; Chiarella, V.; Felici, G.; Laurelli, P.; Mannocchi, G.; Murtas, F.; Murtas, G. P.; Passalacqua, L.; Pepe-Altarelli, M.; Curtis, L.; Dorris, S. J.; Halley, A. W.; Knowles, I. G.; Lynch, J. G.; O'Shea, V.; Raine, C.; Reeves, P.; Scarr, J. M.; Smith, K.; Thompson, A. S.; Thomson, F.; Thorn, S.; Turnbull, R. M.; Becker, U.; Geweniger, C.; Graefe, G.; Hanke, P.; Hansper, G.; Hepp, V.; Kluge, E. E.; Putzer, A.; Rensch, B.; Schmidt, M.; Sommer, J.; Stenzel, H.; Tittel, K.; Werner, S.; Wunsch, M.; Abbaneo, D.; Beuselinck, R.; Binnie, D. M.; Cameron, W.; Dornan, P. J.; Moutoussi, A.; Nash, J.; Sedgbeer, J. K.; Stacey, A. M.; Williams, M. D.; Dissertori, G.; Girtler, P.; Kuhn, D.; Rudolph, G.; Betteridge, A. P.; Bowdery, C. K.; Colrain, P.; Crawford, G.; Finch, A. J.; Foster, F.; Hughes, G.; Sloan, T.; Williams, M. I.; Galla, A.; Greene, A. M.; Kleinknecht, K.; Quast, G.; Renk, B.; Rohne, E.; Sander, H. G.; van Gemmeren, P.; Zeitnitz, C.; Aubert, J. J.; Bencheikh, A. M.; Benchouk, C.; Bonissent, A.; Bujosa, G.; Calvet, D.; Carr, J.; Diaconu, C.; Etienne, F.; Konstantinidis, N.; Payre, P.; Rousseau, D.; Talby, M.; Sadouki, A.; Thulasidas, M.; Trabelsi, K.; Aleppo, M.; Ragusa, F.; Abt, I.; Assmann, R.; Bauer, C.; Blum, W.; Dietl, H.; Dydak, F.; Ganis, G.; Gotzhein, C.; Jakobs, K.; Kroha, H.; Lütjens, G.; Lutz, G.; Männer, W.; Moser, H. G.; Richter, R.; Rosado-Schlosser, A.; Schael, S.; Settles, R.; Seywerd, H.; St. Denis, R.; Wiedenmann, W.; Wolf, G.; Boucrot, J.; Callot, O.; Cordier, A.; Davier, M.; Duflot, L.; Grivaz, J. F.; Heusse, Ph.; Jacquet, M.; Kim, D. W.; Le Diberder, F.; Lefrançois, J.; Lutz, A. M.; Nikolic, I.; Park, H. J.; Park, I. C.; Schune, M. H.; Simion, S.; Veillet, J. J.; Videau, I.; Azzurri, P.; Bagliesi, G.; Batignani, G.; Bettarini, S.; Bozzi, C.; Calderini, G.; Carpinelli, M.; Ciocci, M. A.; Ciulli, V.; Dell'Orso, R.; Fantechi, R.; Ferrante, I.; Foà, L.; Forti, F.; Giassi, A.; Giorgi, M. A.; Gregorio, A.; Ligabue, F.; Lusiani, A.; Marrocchesi, P. S.; Messineo, A.; Rizzo, G.; Sanguinetti, G.; Sciabà, A.; Spagnolo, P.; Steinberger, J.; Tenchini, R.; Tonelli, G.; Vannini, C.; Verdini, P. G.; Walsh, J.; Blair, G. A.; Bryant, L. M.; Cerutti, F.; Chambers, J. T.; Gao, Y.; Green, M. G.; Medcalf, T.; Perrodo, P.; Strong, J. A.; von Wimmersperg-Toeller, J. H.; Botterill, D. R.; Clifft, R. W.; Edgecock, T. R.; Haywood, S.; Maley, P.; Norton, P. R.; Thompson, J. C.; Wright, A. E.; Bloch-Devaux, B.; Colas, P.; Emery, S.; Kozanecki, W.; Lançon, E.; Lemaire, M. C.; Locci, E.; Marx, B.; Perez, P.; Rander, J.; Renardy, J. F.; Roussarie, A.; Schuller, J. P.; Schwindling, J.; Trabelsi, A.; Vallage, B.; Black, S. N.; Dann, J. H.; Johnson, R. P.; Kim, H. Y.; Litke, A. M.; McNeil, M. A.; Taylor, G.; Booth, C. N.; Boswell, R.; Brew, C. A. J.; Cartwright, S.; Combley, F.; Koksal, A.; Letho, M.; Newton, W. M.; Reeve, J.; Thompson, L. F.; Böhrer, A.; Brandt, S.; Büscher, V.; Cowan, G.; Grupen, C.; Lutters, G.; Minguet-Rodriguez, J.; Rivera, F.; Saraiva, P.; Smolik, L.; Stephan, F.; Apollonio, M.; Bosisio, L.; Della Marina, R.; Giannini, G.; Gobbo, B.; Musolino, G.; Rothberg, J.; Wasserbaech, S.; Armstrong, S. R.; Bellantoni, L.; Elmer, P.; Feng, Z.; Ferguson, D. P. S.; Gao, Y. S.; González, S.; Grahl, J.; Greening, T. C.; Harton, J. L.; Hayes, O. J.; Hu, H.; McNamara, P. A.; Nachtman, J. M.; Orejudos, W.; Pan, Y. B.; Saadi, Y.; Schmitt, M.; Scott, I. J.; Sharma, V.; Walsh, A. M.; Wu, Sau Lan; Wu, X.; Yamartino, J. M.; Zheng, M.; Zobernig, G.


    The lifetimes of the B 0 and B + mesons have been measured with the Aleph detector at LEP, using approximately 3 million hadronic Z decays collected in the period 1991 1994. In the first of three methods, semileptonic decays of B 0 and B + mesons were partially reconstructed by identifying events containing a lepton with an associated D*- orbar D^0 meson. The second method used fully reconstructed B 0 and B + mesons. The third method, used to measure the B 0 lifetime, employed a partial reconstruction technique to identify B 0→ D*- π + X decays. The combined results are begin{gathered} tau _0 = 1.55 ± 0.06 ± 0.03 ps, \\ tau _ + = 1.58 ± 0.09 ± 0.03 ps, \\ tfrac{{tau _ + }}{{tau _0 }} = 1.03 ± 0.08 ± 0.02. \\ .

  9. Vector meson decays in the chiral bag model

    International Nuclear Information System (INIS)

    Maxwell, O.V.; Jennings, B.K.


    Vector meson decays are examined in a model where a confined quark and antiquark annihilate, producing a pair of elementary pseudoscalar mesons. Two versions of the pseudoscalar meson-quark interaction are employed, one where the coupling is restricted to the bag surface and one where it extends throughout the bag volume. Energy conservation is ensured in the model through insertion of exponential factors containing the bag energy at each interaction vertex. To guarantee momentum conservation, a wave-packet description is utilized in which the decay widths are normalized by a factor involving the overlap of the initial bag state with the confined qanti q state of zero momentum. With either interaction, the model yields a value for the p-width that exceeds the empirical width by a factor two. For the Ksup(*) and PHI mesons, the computed widths depend strongly on the interaction employed. Implications of these results for chiral bag models are discussed. (orig.)

  10. Two-photon widths of the chi(c0,2) states and helicity analysis for chi(c2) -> gamma gamma

    NARCIS (Netherlands)

    Ablikim, M.; Achasov, M. N.; Ambrose, D. J.; An, F. F.; An, Q.; An, Z. H.; Bai, J. Z.; Ban, Y.; Becker, J.; Berger, N.; Bertani, M.; Bian, J. M.; Boger, E.; Bondarenko, O.; Boyko, I.; Briere, R. A.; Bytev, V.; Cai, X.; Calcaterra, A.; Cao, G. F.; Chang, J. F.; Chelkov, G.; Chen, G.; Chen, H. S.; Chen, J. C.; Chen, M. L.; Chen, S. J.; Chen, Y.; Chen, Y. B.; Cheng, H. P.; Chu, Y. P.; Cronin-Hennessy, D.; Dai, H. L.; Dai, J. P.; Dedovich, D.; Deng, Z. Y.; Denig, A.; Denysenko, I.; Destefanis, M.; Ding, W. M.; Ding, Y.; Dong, L. Y.; Dong, M. Y.; Du, S. X.; Fang, J.; Fang, S. S.; Fava, L.; Feldbauer, F.; Feng, C. Q.; Ferroli, R. B.; Fu, C. D.; Fu, J. L.; Gao, Y.; Geng, C.; Goetzen, K.; Gong, W. X.; Gradl, W.; Greco, M.; Gu, M. H.; Gu, Y. T.; Guan, Y. H.; Guo, A. Q.; Guo, L. B.; Guo, Y. P.; Han, Y. L.; Hao, X. Q.; Harris, F. A.; He, K. L.; He, M.; He, Z. Y.; Held, T.; Heng, Y. K.; Hou, Z. L.; Hu, H. M.; Hu, J. F.; Hu, T.; Huang, B.; Huang, G. M.; Huang, J. S.; Huang, X. T.; Huang, Y. P.; Hussain, T.; Ji, C. S.; Ji, Q.; Ji, X. B.; Ji, X. L.; Jia, L. K.; Jiang, L. L.; Jiang, X. S.; Jiao, J. B.; Jiao, Z.; Jin, D. P.; Jin, S.; Jing, F. F.; Kalantar-Nayestanaki, N.; Kavatsyuk, M.; Kuehn, W.; Lai, W.; Lange, J. S.; Leung, J. K. C.; Li, C. H.; Li, Cheng; Li, Cui; Li, D. M.; Li, F.; Li, G.; Li, H. B.; Li, J. C.; Li, K.; Li, Lei; Li, N. B.; Li, Q. J.; Li, S. L.; Li, W. D.; Li, W. G.; Li, X. L.; Li, X. N.; Li, X. Q.; Li, X. R.; Li, Z. B.; Liang, H.; Liang, Y. F.; Liang, Y. T.; Liao, G. R.; Liao, X. T.; Liu, B. J.; Liu, B. J.; Liu, C. L.; Liu, C. X.; Liu, C. Y.; Liu, F. H.; Liu, Fang; Liu, Feng; Liu, H.; Liu, H. B.; Liu, H. H.; Liu, H. M.; Liu, H. W.; Liu, J. P.; Liu, K. Y.; Liu, Kai; Liu, Kun; Liu, P. L.; Liu, S. B.; Liu, X.; Liu, X. H.; Liu, Y.; Liu, Y. B.; Liu, Z. A.; Liu, Zhiqiang; Liu, Zhiqing; Loehner, H.; Lu, G. R.; Lu, H. J.; Lu, J. G.; Lu, Q. W.; Lu, X. R.; Lu, Y. P.; Luo, C. L.; Luo, M. X.; Luo, T.; Luo, X. L.; Lv, M.; Ma, C. L.; Ma, F. C.; Ma, H. L.; Ma, Q. M.; Ma, S.; Ma, T.; Ma, X. Y.; Ma, Y.; Maas, F. E.; Maggiora, M.; Malik, Q. A.; Mao, H.; Mao, Y. J.; Mao, Z. P.; Messchendorp, J. G.; Min, J.; Min, T. J.; Mitchell, R. E.; Mo, X. H.; Morales, C. Morales; Motzko, C.; Muchnoi, N. Yu.; Nefedov, Y.; Nicholson, C.; Nikolaev, I. B.; Ning, Z.; Olsen, S. L.; Ouyang, Q.; Pacetti, S.; Park, J. W.; Pelizaeus, M.; Peters, K.; Ping, J. L.; Ping, R. G.; Poling, R.; Prencipe, E.; Pun, C. S. J.; Qi, M.; Qian, S.; Qiao, C. F.; Qin, X. S.; Qin, Y.; Qin, Z. H.; Qiu, J. F.; Rashid, K. H.; Rong, G.; Ruan, X. D.; Sarantsev, A.; Schulze, J.; Shao, M.; Shen, C. P.; Shen, X. Y.; Sheng, H. Y.; Shepherd, M. R.; Song, X. Y.; Spataro, S.; Spruck, B.; Sun, D. H.; Sun, G. X.; Sun, J. F.; Sun, S. S.; Sun, X. D.; Sun, Y. J.; Sun, Y. Z.; Sun, Z. J.; Sun, Z. T.; Tang, C. J.; Tang, X.; Thorndike, E. H.; Tian, H. L.; Toth, D.; Ullrich, M.; Varner, G. S.; Wang, B.; Wang, B. Q.; Wang, K.; Wang, L. L.; Wang, L. S.; Wang, M.; Wang, P.; Wang, P. L.; Wang, Q.; Wang, Q. J.; Wang, S. G.; Wang, X. F.; Wang, X. L.; Wang, Y. D.; Wang, Y. F.; Wang, Y. Q.; Wang, Z.; Wang, Z. G.; Wang, Z. Y.; Wei, D. H.; Weidenkaff, P.; Wen, Q. G.; Wen, S. P.; Werner, M.; Wiedner, U.; Wu, L. H.; Wu, N.; Wu, S. X.; Wu, W.; Wu, Z.; Xia, L. G.; Xiao, Z. J.; Xie, Y. G.; Xiu, Q. L.; Xu, G. F.; Xu, G. M.; Xu, H.; Xu, Q. J.; Xu, X. P.; Xu, Y.; Xu, Z. R.; Xue, F.; Xue, Z.; Yan, L.; Yan, W. B.; Yang, H. X.; Yang, T.; Yang, Y.; Yang, Y. X.; Ye, H.; Ye, M.; Ye, M. H.; Yu, B. X.; Yu, C. X.; Yu, J. S.; Yu, S. P.; Yuan, C. Z.; Yuan, W. L.; Yuan, Y.; Zafar, A. A.; Zallo, A.; Zeng, Y.; Zhang, B. X.; Zhang, B. Y.; Zhang, C. C.; Zhang, D. H.; Zhang, H. H.; Zhang, H. Y.; Zhang, J.; Zhang, J. G.; Zhang, J. Q.; Zhang, J. W.; Zhang, J. Y.; Zhang, J. Z.; Zhang, L.; Zhang, S. H.; Zhang, T. R.; Zhang, X. J.; Zhang, X. Y.; Zhang, Y.; Zhang, Y. H.; Zhang, Y. S.; Zhang, Z. P.; Zhang, Z. Y.; Zhao, G.; Zhao, H. S.; Zhao, J. W.; Zhao, K. X.; Zhao, Lei; Zhao, Ling; Zhao, M. G.; Zhao, Q.; Zhao, S. J.; Zhao, T. C.; Zhao, X. H.; Zhao, Y. B.; Zhao, Z. G.; Zhemchugov, A.; Zheng, B.; Zheng, J. P.; Zheng, Y. H.; Zheng, Z. P.; Zhong, B.; Zhong, J.; Zhou, L.; Zhou, X. K.; Zhou, X. R.; Zhu, C.; Zhu, K.; Zhu, K. J.; Zhu, S. H.; Zhu, X. L.; Zhu, X. W.; Zhu, Y. M.; Zhu, Y. S.; Zhu, Z. A.; Zhuang, J.; Zou, B. S.; Zou, J. H.; Zuo, J. X.


    Based on a data sample of 106 X 10(6) psi' events collected with the BESIII detector, the decays psi' -> gamma chi(c0,2), chi(c0,2) -> gamma gamma are studied to determine the two-photon widths of the chi(c0,2) states. The two-photon decay branching fractions are determined to be B(chi(c0) -> gamma

  11. Using anti pp annihilation to find exotic mesons

    International Nuclear Information System (INIS)

    Sharpe, S.R.


    Present data suggests that a number of mesons have been found which cannot be accommodated in standard anti qq multiplets. Theory suggests that such exotic mesons should exist in the spectrum of Quantum Chromodynamics, but provides little guide to their properties. It is argued that a high luminosity, low energy anti pp machine would be a powerful tool with which to search for such exotics

  12. On rescattering in meson coherent photoproduction on nuclei

    International Nuclear Information System (INIS)

    Starkov, N.I.; Tsarev, V.A.


    Screening corrections for cross section of π deg-meson photoproduction on He nuclei were calculated: γ + 4 He → π 0 + 4 He. On the basis of the Glauber theory the effect of meson rescattering in the range of small transferred pulses (t) 2 and ''mean'' photon energies 2 2 ), determined by interference of members of one-and twofold interactions. The results are compared with those obtained by other authors

  13. Vector meson photoproduction with a linearly polarized beam (United States)

    Mathieu, V.; Nys, J.; Fernández-Ramírez, C.; Jackura, A.; Pilloni, A.; Sherrill, N.; Szczepaniak, A. P.; Fox, G.; Joint Physics Analysis Center


    We propose a model based on Regge theory to describe photoproduction of light vector mesons. We fit the SLAC data and make predictions for the energy and momentum-transfer dependence of the spin-density matrix elements in photoproduction of ω , ρ0 and ϕ mesons at Eγ˜8.5 GeV , which are soon to be measured at Jefferson Lab.

  14. Magnetic dipole moments of the heavy tensor mesons in QCD

    Energy Technology Data Exchange (ETDEWEB)

    Aliev, T. M., E-mail: [Physics Department, Middle East Technical University, 06531, Ankara (Turkey); Institute of Physics, Baku (Azerbaijan); Barakat, T., E-mail: tbarakat@KSU.EDU.SA [Physics Department, Middle East Technical University, 06531, Ankara (Turkey); Physics and Astronomy Department, King Saud University, Riyadh (Saudi Arabia); Savcı, M., E-mail: [Physics Department, Middle East Technical University, 06531, Ankara (Turkey)


    The magnetic dipole moments of the D{sub 2}, and D{sub S{sub 2}}, B{sub 2}, and B{sub S{sub 2}} heavy tensor mesons are estimated in framework of the light cone QCD sum rules. It is observed that the magnetic dipole moments for the charged mesons are larger than that of its neutral counterpart. It is found that the SU(3) flavor symmetry violation is about 10 % in both b and c sectors.

  15. Effects of an electromagnetic quark form factor on meson properties

    International Nuclear Information System (INIS)

    Silvestre-Brac, B.


    A form factor is introduced in the quark electromagnetic current. Its effect is analyzed on charge mean square radii and form factors in the mesonic sector. The decay of a vector meson into lepton-antilepton pair is also affected. Two different expressions for the form factors, and two different types of quark potential are tested and some relativistic kinematical corrections are proposed. In any case the introduction of a quark form factor greatly improves the agreement with experimental data

  16. {phi} meson electroproduction at small Bjorken-x

    Energy Technology Data Exchange (ETDEWEB)

    Kroll, P. [Wuppertal Univ., Fachbereich Physik (Germany)


    It is reported on an analysis of {phi}-meson electroproduction at small Bjorken-x(x{sub B{sub j}}) within the handbag approach. The amplitudes can be factorized into generalized parton distribution (GPDs) and a partonic subprocess, electroproduction off gluons. Cross-sections and spin density matrix elements are evaluated for {phi}-meson electroproduction and found to be in fair agreement with recent HERA data. (author)

  17. Doubly charmed exotic mesons: A gift of nature?

    Energy Technology Data Exchange (ETDEWEB)

    Carames, T.F. [Departamento de Fisica Fundamental, Universidad de Salamanca, E-37008 Salamanca (Spain); Valcarce, A., E-mail: valcarce@usal.e [Departamento de Fisica Fundamental, Universidad de Salamanca, E-37008 Salamanca (Spain); Vijande, J. [Departamento de Fisica Atomica, Molecular y Nuclear, Universidad de Valencia (UV) and IFIC (UV-CSIC), Valencia (Spain)


    We study doubly charmed exotic states by solving the scattering problem of two D mesons. Our results point to the existence of a stable isoscalar doubly charmed meson with quantum numbers (I)J{sup P}=(0)1{sup +}. We perform a thorough comparison to the results obtained within the hyperspherical harmonic formalism. Such exotic states could be measured at LHC and RHIC. Their experimental observation would, for the first time, confirm the contribution of multiquark structures to hadron spectroscopy.

  18. Production of charmed mesons in γγ interactions

    International Nuclear Information System (INIS)

    Braunschweig, W.; Gerhards, R.; Kirschfink, F.J.; Martyn, H.U.; Kolanoski, H.; Hart, J.C.; Saxon, D.H.; Brandt, S.; Holder, M.; Muller, D.; Ritz, S.; Strom, D.; Takashima, M.; Wu Saulan; Zobernig, G.


    Production of charmed mesons in γγ-interactions at PETRA energies has been observed in the TASSO detector. Cross sections for inclusive D *± and D 0 anti D 0 production have been measured. Neutral and charged meson pairs are estimated to be produced with comparable cross sections, and their sum to account for a sizeable function of σ tot (γγ→hadrons) near the canti c threshold. (orig.)

  19. Excited meson spectroscopy with two chirally improved quarks (United States)

    Engel, G.; Lang, C. B.; Mohler, D.; Limmer, M.; Schäfer, A.

    The excited isovector meson spectrum is explored using two chirally improved dynamical quarks. Seven ensembles, with pion masses down to \\approx 250 MeV are discussed and used for extrapolations to the physical point. Strange mesons are investigated using partially quenched s-quarks. Using the variational method, we extract excited states in several channels and most of the results are in good agreement with experiment.

  20. Asymmetries in heavy meson production from light quark fragmentation

    International Nuclear Information System (INIS)

    Dias de Deus, J.; Duraes, F.


    We discuss the possibility of the asymmetry in D - /D + production from π - beams, being a direct consequence of the properties of the light quark fragmentation function into heavy mesons. The main features of the asymmetry, as a function of x F , are easily described. An integrated sum rule for the D - , D + multiplicity difference is presented. Predictions for the asymmetry in B meson production are given. (orig.)


    Czech Academy of Sciences Publication Activity Database

    Frohlich, I.; Agakishiev, G.; Agodi, C.; Balanda, A.; Bellia, G.; Belver, D.; Belyaev, A.; Blanco, A.; Böhmer, M.; Boyard, J. L.; Braun-Munzinger, P.; Cabanelas, P.; Castro, E.; Chernenko, S.; Christ, T.; Destefanis, M.; Díaz, J.; Dohrmann, F.; Dybczak, A.; Eberl, T.; Fabbietti, L.; Fateev, O.; Finocchiaro, P.; Fonte, P.; Friese, J.; Galatyuk, T.; Garzón, J.A.; Gernhäuser, R.; Gil, A.; Gilardi, C.; Golubeva, M.; Gonzalez-Diaz, D.; Grosse, E.; Guber, F.; Heilmann, M.; Hennino, T.; Holzmann, R.; Ierusalimov, A.; Iori, I.; Ivashkin, A.; Jurkovic, M.; Kämpfer, B.; Kanaki, K.; Karavicheva, T.; Kirschner, D.; Koenig, I.; Koenig, W.; Kolb, B.W.; Kotte, R.; Kozuch, A.; Krása, Antonín; Křížek, Filip; Krücken, R.; Kuhn, W.; Kugler, Andrej; Kurepin, A.; Lamas-Valverde, J.; Lang, S.; Lange, J.S.; Lapidus, K.; Lopes, L.; Maier, L.; Mangiarotti, A.; Marín, J.; Markert, J.; Metag, V.; Michalska, B.; Michel, J.; Mishra, D.; Moriniére, E.; Mousa, J.; Muntz, C.; Naumann, L.; Novotny, R.; Otwinowski, J.; Pachmayer, Y.C.; Palka, M.; Parpottas, Y.; Pechenov, V.; Pechenova, O.; Cavalcanti, T.P.; Pietraszko, J.; Przygoda, W.; Ramstein, B.; Reshetin, A.; Roy-Stephan, M.; Rustamov, A.; Sadovsky, A.; Sailer, B.; Salabura, P.; Schmah, A.; Simon, R. S.; Sobolev, Yuri, G.; Spataro, S.; Spruck, B.; Strobele, H.; Stroth, J.; Sturm, C.; Sudol, M.; Tarantola, A.; Teilab, K.; Tlustý, Pavel; Traxler, M.; Trebacz, R.; Tsertos, H.; Veretenkin, I.; Wagner, Vladimír; Wen, H.; Wisniowski, M.; Wojcik, T.; Wüstenfeld, J.; Yurevich, S.; Zanevsky, Yu.; Zhou, P.; Zumbruch, P.


    Roč. 24, 2-3 (2009), s. 317-326 ISSN 0217-751X. [Conference MESON 2008. Jagiellonian Univ, Cracow, 06.06.2008-10.06.2008] R&D Projects: GA AV ČR IAA100480803; GA MŠk LC07050 Institutional research plan: CEZ:AV0Z10480505 Keywords : Mesons * di-electrons * resonances Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 0.941, year: 2009

  2. Application of heavy-light methods to B meson physics

    International Nuclear Information System (INIS)

    Eichten, E.; Hockney, G.; Thacker, H.B.


    The heavy-light method is applied to the study of the B meson spectrum, the pseudoscalar decay constant f B , the mixing (B) parameter, and exclusive semileptonic B meson decays. Preliminary results are discussed for f B and the B parameter at β = 5.7 and κ = 0.165 on a 12 3 x 24 lattice and at β = 5.9 and κ = 0.158 on a 16 3 x 32 lattice. 9 refs., 2 figs., 2 tabs

  3. Measurement of $\\chi_{c1}$ and $\\chi_{c2}$ production with $\\sqrt{s}=7$ TeV $pp$ collisions at ATLAS

    CERN Document Server

    Aad, Georges; Abbott, Brad; Abdallah, Jalal; Abdel Khalek, Samah; Abdinov, Ovsat; Aben, Rosemarie; Abi, Babak; Abolins, Maris; AbouZeid, Ossama; Abramowicz, Halina; Abreu, Henso; Abulaiti, Yiming; Acharya, Bobby Samir; Adamczyk, Leszek; Adams, David; Addy, Tetteh; Adelman, Jahred; Adomeit, Stefanie; Adye, Tim; Aefsky, Scott; Agatonovic-Jovin, Tatjana; Aguilar-Saavedra, Juan Antonio; Agustoni, Marco; Ahlen, Steven; Ahmad, Ashfaq; Ahmadov, Faig; Aielli, Giulio; {\\AA}kesson, Torsten Paul Ake; Akimoto, Ginga; Akimov, Andrei; Alam, Muhammad Aftab; Albert, Justin; Albrand, Solveig; Alconada Verzini, Maria Josefina; Aleksa, Martin; Aleksandrov, Igor; Alessandria, Franco; Alexa, Calin; Alexander, Gideon; Alexandre, Gauthier; Alexopoulos, Theodoros; Alhroob, Muhammad; Aliev, Malik; Alimonti, Gianluca; Alio, Lion; Alison, John; Allbrooke, Benedict; Allison, Lee John; Allport, Phillip; Allwood-Spiers, Sarah; Almond, John; Aloisio, Alberto; Alon, Raz; Alonso, Alejandro; Alonso, Francisco; Altheimer, Andrew David; Alvarez Gonzalez, Barbara; Alviggi, Mariagrazia; Amako, Katsuya; Amaral Coutinho, Yara; Amelung, Christoph; Ammosov, Vladimir; Amor Dos Santos, Susana Patricia; Amorim, Antonio; Amoroso, Simone; Amram, Nir; Amundsen, Glenn; Anastopoulos, Christos; Ancu, Lucian Stefan; Andari, Nansi; Andeen, Timothy; Anders, Christoph Falk; Anders, Gabriel; Anderson, Kelby; Andreazza, Attilio; Andrei, George Victor; Anduaga, Xabier; Angelidakis, Stylianos; Anger, Philipp; Angerami, Aaron; Anghinolfi, Francis; Anisenkov, Alexey; Anjos, Nuno; Annovi, Alberto; Antonaki, Ariadni; Antonelli, Mario; Antonov, Alexey; Antos, Jaroslav; Anulli, Fabio; Aoki, Masato; Aperio Bella, Ludovica; Apolle, Rudi; Arabidze, Giorgi; Aracena, Ignacio; Arai, Yasuo; Arce, Ayana; Arfaoui, Samir; Arguin, Jean-Francois; Argyropoulos, Spyridon; Arik, Engin; Arik, Metin; Armbruster, Aaron James; Arnaez, Olivier; Arnal, Vanessa; Arslan, Ozan; Artamonov, Andrei; Artoni, Giacomo; Asai, Shoji; Asbah, Nedaa; Ask, Stefan; {\\AA}sman, Barbro; Asquith, Lily; Assamagan, Ketevi; Astalos, Robert; Astbury, Alan; Atkinson, Markus; Atlay, Naim Bora; Auerbach, Benjamin; Auge, Etienne; Augsten, Kamil; Aurousseau, Mathieu; Avolio, Giuseppe; Azuelos, Georges; Azuma, Yuya; Baak, Max; Bacci, Cesare; Bach, Andre; Bachacou, Henri; Bachas, Konstantinos; Backes, Moritz; Backhaus, Malte; Backus Mayes, John; Badescu, Elisabeta; Bagiacchi, Paolo; Bagnaia, Paolo; Bai, Yu; Bailey, David; Bain, Travis; Baines, John; Baker, Oliver Keith; Baker, Sarah; Balek, Petr; Balli, Fabrice; Banas, Elzbieta; Banerjee, Swagato; Banfi, Danilo; Bangert, Andrea Michelle; Bansal, Vikas; Bansil, Hardeep Singh; Barak, Liron; Baranov, Sergei; Barber, Tom; Barberio, Elisabetta Luigia; Barberis, Dario; Barbero, Marlon; Barillari, Teresa; Barisonzi, Marcello; Barklow, Timothy; Barlow, Nick; Barnett, Bruce; Barnett, Michael; Baroncelli, Antonio; Barone, Gaetano; Barr, Alan; Barreiro, Fernando; Barreiro Guimaraes da Costa, Joao; Bartoldus, Rainer; Barton, Adam Edward; Bartos, Pavol; Bartsch, Valeria; Bassalat, Ahmed; Basye, Austin; Bates, Richard; Batkova, Lucia; Batley, Richard; Battistin, Michele; Bauer, Florian; Bawa, Harinder Singh; Beau, Tristan; Beauchemin, Pierre-Hugues; Beccherle, Roberto; Bechtle, Philip; Beck, Hans Peter; Becker, Anne Kathrin; Becker, Sebastian; Beckingham, Matthew; Beddall, Andrew; Beddall, Ayda; Bedikian, Sourpouhi; Bednyakov, Vadim; Bee, Christopher; Beemster, Lars; Beermann, Thomas; Begel, Michael; Behr, Katharina; Belanger-Champagne, Camille; Bell, Paul; Bell, William; Bella, Gideon; Bellagamba, Lorenzo; Bellerive, Alain; Bellomo, Massimiliano; Belloni, Alberto; Beloborodova, Olga; Belotskiy, Konstantin; Beltramello, Olga; Benary, Odette; Benchekroun, Driss; Bendtz, Katarina; Benekos, Nektarios; Benhammou, Yan; Benhar Noccioli, Eleonora; Benitez Garcia, Jorge-Armando; Benjamin, Douglas; Bensinger, James; Benslama, Kamal; Bentvelsen, Stan; Berge, David; Bergeaas Kuutmann, Elin; Berger, Nicolas; Berghaus, Frank; Berglund, Elina; Beringer, Jurg; Bernard, Clare; Bernat, Pauline; Bernhard, Ralf; Bernius, Catrin; Bernlochner, Florian Urs; Berry, Tracey; Berta, Peter; Bertella, Claudia; Bertolucci, Federico; Besana, Maria Ilaria; Besjes, Geert-Jan; Bessidskaia, Olga; Besson, Nathalie; Bethke, Siegfried; Bhimji, Wahid; Bianchi, Riccardo-Maria; Bianchini, Louis; Bianco, Michele; Biebel, Otmar; Bieniek, Stephen Paul; Bierwagen, Katharina; Biesiada, Jed; Biglietti, Michela; Bilbao De Mendizabal, Javier; Bilokon, Halina; Bindi, Marcello; Binet, Sebastien; Bingul, Ahmet; Bini, Cesare; Bittner, Bernhard; Black, Curtis; Black, James; Black, Kevin; Blackburn, Daniel; Blair, Robert; Blanchard, Jean-Baptiste; Blazek, Tomas; Bloch, Ingo; Blocker, Craig; Blum, Walter; Blumenschein, Ulrike; Bobbink, Gerjan; Bobrovnikov, Victor; Bocchetta, Simona Serena; Bocci, Andrea; Boddy, Christopher Richard; Boehler, Michael; Boek, Jennifer; Boek, Thorsten Tobias; Boelaert, Nele; Bogaerts, Joannes Andreas; Bogdanchikov, Alexander; Bogouch, Andrei; Bohm, Christian; Bohm, Jan; Boisvert, Veronique; Bold, Tomasz; Boldea, Venera; Boldyrev, Alexey; Bolnet, Nayanka Myriam; Bomben, Marco; Bona, Marcella; Boonekamp, Maarten; Bordoni, Stefania; Borer, Claudia; Borisov, Anatoly; Borissov, Guennadi; Borri, Marcello; Borroni, Sara; Bortfeldt, Jonathan; Bortolotto, Valerio; Bos, Kors; Boscherini, Davide; Bosman, Martine; Boterenbrood, Hendrik; Bouchami, Jihene; Boudreau, Joseph; Bouhova-Thacker, Evelina Vassileva; Boumediene, Djamel Eddine; Bourdarios, Claire; Bousson, Nicolas; Boutouil, Sara; Boveia, Antonio; Boyd, James; Boyko, Igor; Bozovic-Jelisavcic, Ivanka; Bracinik, Juraj; Branchini, Paolo; Brandt, Andrew; Brandt, Gerhard; Brandt, Oleg; Bratzler, Uwe; Brau, Benjamin; Brau, James; Braun, Helmut; Brazzale, Simone Federico; Brelier, Bertrand; Brendlinger, Kurt; Brenner, Richard; Bressler, Shikma; Bristow, Timothy Michael; Britton, Dave; Brochu, Frederic; Brock, Ian; Brock, Raymond; Broggi, Francesco; Bromberg, Carl; Bronner, Johanna; Brooijmans, Gustaaf; Brooks, Timothy; Brooks, William; Brosamer, Jacquelyn; Brost, Elizabeth; Brown, Gareth; Brown, Jonathan; Bruckman de Renstrom, Pawel; Bruncko, Dusan; Bruneliere, Renaud; Brunet, Sylvie; Bruni, Alessia; Bruni, Graziano; Bruschi, Marco; Bryngemark, Lene; Buanes, Trygve; Buat, Quentin; Bucci, Francesca; Buchholz, Peter; Buckingham, Ryan; Buckley, Andrew; Buda, Stelian Ioan; Budagov, Ioulian; Budick, Burton; Buehrer, Felix; Bugge, Lars; Bugge, Magnar Kopangen; Bulekov, Oleg; Bundock, Aaron Colin; Bunse, Moritz; Burckhart, Helfried; Burdin, Sergey; Burgess, Thomas; Burghgrave, Blake; Burke, Stephen; Burmeister, Ingo; Busato, Emmanuel; Buscher, Volker; Bussey, Peter; Buszello, Claus-Peter; Butler, Bart; Butler, John; Butt, Aatif Imtiaz; Buttar, Craig; Butterworth, Jonathan; Buttinger, William; Buzatu, Adrian; Byszewski, Marcin; Cabrera Urb\\'an, Susana; Caforio, Davide; Cakir, Orhan; Calafiura, Paolo; Calderini, Giovanni; Calfayan, Philippe; Calkins, Robert; Caloba, Luiz; Caloi, Rita; Calvet, David; Calvet, Samuel; Camacho Toro, Reina; Camarri, Paolo; Cameron, David; Caminada, Lea Michaela; Caminal Armadans, Roger; Campana, Simone; Campanelli, Mario; Canale, Vincenzo; Canelli, Florencia; Canepa, Anadi; Cantero, Josu; Cantrill, Robert; Cao, Tingting; Capeans Garrido, Maria Del Mar; Caprini, Irinel; Caprini, Mihai; Capua, Marcella; Caputo, Regina; Cardarelli, Roberto; Carli, Tancredi; Carlino, Gianpaolo; Carminati, Leonardo; Caron, Sascha; Carquin, Edson; Carrillo-Montoya, German D; Carter, Antony; Carter, Janet; Carvalho, Joao; Casadei, Diego; Casado, Maria Pilar; Caso, Carlo; Castaneda-Miranda, Elizabeth; Castelli, Angelantonio; Castillo Gimenez, Victoria; Castro, Nuno Filipe; Catastini, Pierluigi; Catinaccio, Andrea; Catmore, James; Cattai, Ariella; Cattani, Giordano; Caughron, Seth; Cavaliere, Viviana; Cavalli, Donatella; Cavalli-Sforza, Matteo; Cavasinni, Vincenzo; Ceradini, Filippo; Cerio, Benjamin; Cerny, Karel; Santiago Cerqueira, Augusto; Cerri, Alessandro; Cerrito, Lucio; Cerutti, Fabio; Cervelli, Alberto; Cetin, Serkant Ali; Chafaq, Aziz; Chakraborty, Dhiman; Chalupkova, Ina; Chan, Kevin; Chang, Philip; Chapleau, Bertrand; Chapman, John Derek; Charfeddine, Driss; Charlton, Dave; Chavda, Vikash; Chavez Barajas, Carlos Alberto; Cheatham, Susan; Chekanov, Sergei; Chekulaev, Sergey; Chelkov, Gueorgui; Chelstowska, Magda Anna; Chen, Chunhui; Chen, Hucheng; Chen, Karen; Chen, Liming; Chen, Shenjian; Chen, Xin; Chen, Yujiao; Cheng, Yangyang; Cheplakov, Alexander; Cherkaoui El Moursli, Rajaa; Chernyatin, Valeriy; Cheu, Elliott; Chevalier, Laurent; Chiarella, Vitaliano; Chiefari, Giovanni; Childers, John Taylor; Chilingarov, Alexandre; Chiodini, Gabriele; Chisholm, Andrew; Chislett, Rebecca Thalatta; Chitan, Adrian; Chizhov, Mihail; Chouridou, Sofia; Chow, Bonnie Kar Bo; Christidi, Ilektra-Athanasia; Chromek-Burckhart, Doris; Chu, Ming-Lee; Chudoba, Jiri; Ciapetti, Guido; Ciftci, Abbas Kenan; Ciftci, Rena; Cinca, Diane; Cindro, Vladimir; Ciocio, Alessandra; Cirilli, Manuela; Cirkovic, Predrag; Citron, Zvi Hirsh; Citterio, Mauro; Ciubancan, Mihai; Clark, Allan G; Clark, Philip James; Clarke, Robert; Cleland, Bill; Clemens, Jean-Claude; Clement, Benoit; Clement, Christophe; Coadou, Yann; Cobal, Marina; Coccaro, Andrea; Cochran, James H; Coelli, Simone; Coffey, Laurel; Cogan, Joshua Godfrey; Coggeshall, James; Colas, Jacques; Cole, Brian; Cole, Stephen; Colijn, Auke-Pieter; Collins-Tooth, Christopher; Collot, Johann; Colombo, Tommaso; Colon, German; Compostella, Gabriele; Conde Muino, Patricia; Coniavitis, Elias; Conidi, Maria Chiara; Connelly, Ian; Consonni, Sofia Maria; Consorti, Valerio; Constantinescu, Serban; Conta, Claudio; Conti, Geraldine; Conventi, Francesco; Cooke, Mark; Cooper, Ben; Cooper-Sarkar, Amanda; Cooper-Smith, Neil; Copic, Katherine; Cornelissen, Thijs; Corradi, Massimo; Corriveau, Francois; Corso-Radu, Alina; Cortes-Gonzalez, Arely; Cortiana, Giorgio; Costa, Giuseppe; Costa, Mar\\'ia Jos\\'e; Costanzo, Davide; C\\^ot\\'e, David; Cottin, Giovanna; Courneyea, Lorraine; Cowan, Glen; Cox, Brian; Cranmer, Kyle; Cree, Graham; Cr\\'ep\\'e-Renaudin, Sabine; Crescioli, Francesco; Crispin Ortuzar, Mireia; Cristinziani, Markus; Crosetti, Giovanni; Cuciuc, Constantin-Mihai; Cuenca Almenar, Crist\\'obal; Cuhadar Donszelmann, Tulay; Cummings, Jane; Curatolo, Maria; Cuthbert, Cameron; Czirr, Hendrik; Czodrowski, Patrick; Czyczula, Zofia; D'Auria, Saverio; D'Onofrio, Monica; D'Orazio, Alessia; Da Cunha Sargedas De Sousa, Mario Jose; Da Via, Cinzia; Dabrowski, Wladyslaw; Dafinca, Alexandru; Dai, Tiesheng; Dallaire, Frederick; Dallapiccola, Carlo; Dam, Mogens; Daniells, Andrew Christopher; Dano Hoffmann, Maria; Dao, Valerio; Darbo, Giovanni; Darlea, Georgiana Lavinia; Darmora, Smita; Dassoulas, James; Davey, Will; David, Claire; Davidek, Tomas; Davies, Eleanor; Davies, Merlin; Davignon, Olivier; Davison, Adam; Davygora, Yuriy; Dawe, Edmund; Dawson, Ian; Daya-Ishmukhametova, Rozmin; De, Kaushik; de Asmundis, Riccardo; De Castro, Stefano; De Cecco, Sandro; de Graat, Julien; De Groot, Nicolo; de Jong, Paul; De La Taille, Christophe; De la Torre, Hector; De Lorenzi, Francesco; De Nooij, Lucie; De Pedis, Daniele; De Salvo, Alessandro; De Sanctis, Umberto; De Santo, Antonella; De Vivie De Regie, Jean-Baptiste; De Zorzi, Guido; Dearnaley, William James; Debbe, Ramiro; Debenedetti, Chiara; Dechenaux, Benjamin; Dedovich, Dmitri; Degenhardt, James; Del Peso, Jose; Del Prete, Tarcisio; Delemontex, Thomas; Deliot, Frederic; Deliyergiyev, Maksym; Dell'Acqua, Andrea; Dell'Asta, Lidia; Della Pietra, Massimo; della Volpe, Domenico; Delmastro, Marco; Delsart, Pierre-Antoine; Deluca, Carolina; Demers, Sarah; Demichev, Mikhail; Demilly, Aurelien; Demirkoz, Bilge; Denisov, Sergey; Derendarz, Dominik; Derkaoui, Jamal Eddine; Derue, Frederic; Dervan, Paul; Desch, Klaus Kurt; Deviveiros, Pier-Olivier; Dewhurst, Alastair; DeWilde, Burton; Dhaliwal, Saminder; Dhullipudi, Ramasudhakar; Di Ciaccio, Anna; Di Ciaccio, Lucia; Di Domenico, Antonio; Di Donato, Camilla; Di Girolamo, Alessandro; Di Girolamo, Beniamino; Di Mattia, Alessandro; Di Micco, Biagio; Di Nardo, Roberto; Di Simone, Andrea; Di Sipio, Riccardo; Di Valentino, David; Diaz, Marco Aurelio; Diehl, Edward; Dietrich, Janet; Dietzsch, Thorsten; Diglio, Sara; Dindar Yagci, Kamile; Dingfelder, Jochen; Dionisi, Carlo; Dita, Petre; Dita, Sanda; Dittus, Fridolin; Djama, Fares; Djobava, Tamar; Barros do Vale, Maria Aline; Do Valle Wemans, Andr\\'e; Doan, Thi Kieu Oanh; Dobos, Daniel; Dobson, Ellie; Dodd, Jeremy; Doglioni, Caterina; Doherty, Tom; Dohmae, Takeshi; Dolejsi, Jiri; Dolezal, Zdenek; Dolgoshein, Boris; Donadelli, Marisilvia; Donati, Simone; Dondero, Paolo; Donini, Julien; Dopke, Jens; Doria, Alessandra; Dos Anjos, Andre; Dotti, Andrea; Dova, Maria-Teresa; Doyle, Tony; Dris, Manolis; Dubbert, Jorg; Dube, Sourabh; Dubreuil, Emmanuelle; Duchovni, Ehud; Duckeck, Guenter; Ducu, Otilia Anamaria; Duda, Dominik; Dudarev, Alexey; Dudziak, Fanny; Duflot, Laurent; Duguid, Liam; Duhrssen, Michael; Dunford, Monica; Duran Yildiz, Hatice; Duren, Michael; Dwuznik, Michal; Ebke, Johannes; Edson, William; Edwards, Clive; Edwards, Nicholas Charles; Ehrenfeld, Wolfgang; Eifert, Till; Eigen, Gerald; Einsweiler, Kevin; Eisenhandler, Eric; Ekelof, Tord; El Kacimi, Mohamed; Ellert, Mattias; Elles, Sabine; Ellinghaus, Frank; Ellis, Katherine; Ellis, Nicolas; Elmsheuser, Johannes; Elsing, Markus; Emeliyanov, Dmitry; Enari, Yuji; Endner, Oliver Chris; Endo, Masaki; Engelmann, Roderich; Erdmann, Johannes; Ereditato, Antonio; Eriksson, Daniel; Ernis, Gunar; Ernst, Jesse; Ernst, Michael; Ernwein, Jean; Errede, Deborah; Errede, Steven; Ertel, Eugen; Escalier, Marc; Esch, Hendrik; Escobar, Carlos; Espinal Curull, Xavier; Esposito, Bellisario; Etienne, Francois; Etienvre, Anne-Isabelle; Etzion, Erez; Evangelakou, Despoina; Evans, Hal; Fabbri, Laura; Facini, Gabriel; Fakhrutdinov, Rinat; Falciano, Speranza; Fang, Yaquan; Fanti, Marcello; Farbin, Amir; Farilla, Addolorata; Farooque, Trisha; Farrell, Steven; Farrington, Sinead; Farthouat, Philippe; Fassi, Farida; Fassnacht, Patrick; Fassouliotis, Dimitrios; Fatholahzadeh, Baharak; Favareto, Andrea; Fayard, Louis; Federic, Pavol; Fedin, Oleg; Fedorko, Wojciech; Fehling-Kaschek, Mirjam; Feligioni, Lorenzo; Feng, Cunfeng; Feng, Eric; Feng, Haolu; Fenyuk, Alexander; Fernando, Waruna; Ferrag, Samir; Ferrando, James; Ferrara, Valentina; Ferrari, Arnaud; Ferrari, Pamela; Ferrari, Roberto; Ferreira de Lima, Danilo Enoque; Ferrer, Antonio; Ferrere, Didier; Ferretti, Claudio; Ferretto Parodi, Andrea; Fiascaris, Maria; Fiedler, Frank; Filip\\v{c}i\\v{c}, Andrej; Filipuzzi, Marco; Filthaut, Frank; Fincke-Keeler, Margret; Finelli, Kevin Daniel; Fiolhais, Miguel; Fiorini, Luca; Firan, Ana; Fischer, Julia; Fisher, Matthew; Fitzgerald, Eric Andrew; Flechl, Martin; Fleck, Ivor; Fleischmann, Philipp; Fleischmann, Sebastian; Fletcher, Gareth Thomas; Fletcher, Gregory; Flick, Tobias; Floderus, Anders; Flores Castillo, Luis; Florez Bustos, Andres Carlos; Flowerdew, Michael; Fonseca Martin, Teresa; Formica, Andrea; Forti, Alessandra; Fortin, Dominique; Fournier, Daniel; Fox, Harald; Francavilla, Paolo; Franchini, Matteo; Franchino, Silvia; Francis, David; Franklin, Melissa; Franz, Sebastien; Fraternali, Marco; Fratina, Sasa; French, Sky; Friedrich, Conrad; Friedrich, Felix; Froidevaux, Daniel; Frost, James; Fukunaga, Chikara; Fullana Torregrosa, Esteban; Fulsom, Bryan Gregory; Fuster, Juan; Gabaldon, Carolina; Gabizon, Ofir; Gabrielli, Alessandro; Gabrielli, Andrea; Gadatsch, Stefan; Gadfort, Thomas; Gadomski, Szymon; Gagliardi, Guido; Gagnon, Pauline; Galea, Cristina; Galhardo, Bruno; Gallas, Elizabeth; Gallo, Valentina Santina; Gallop, Bruce; Gallus, Petr; Galster, Gorm Aske Gram Krohn; Gan, KK; Gandrajula, Reddy Pratap; Gao, Jun; Gao, Yongsheng; Garay Walls, Francisca; Garberson, Ford; Garc\\'ia, Carmen; Garc\\'ia Navarro, Jos\\'e Enrique; Garcia-Sciveres, Maurice; Gardner, Robert; Garelli, Nicoletta; Garonne, Vincent; Gatti, Claudio; Gaudio, Gabriella; Gaur, Bakul; Gauthier, Lea; Gauzzi, Paolo; Gavrilenko, Igor; Gay, Colin; Gaycken, Goetz; Gazis, Evangelos; Ge, Peng; Gecse, Zoltan; Gee, Norman; Geerts, Daniel Alphonsus Adrianus; Geich-Gimbel, Christoph; Gellerstedt, Karl; Gemme, Claudia; Gemmell, Alistair; Genest, Marie-H\\'el\\`ene; Gentile, Simonetta; George, Matthias; George, Simon; Gerbaudo, Davide; Gershon, Avi; Ghazlane, Hamid; Ghodbane, Nabil; Giacobbe, Benedetto; Giagu, Stefano; Giangiobbe, Vincent; Giannetti, Paola; Gianotti, Fabiola; Gibbard, Bruce; Gibson, Stephen; Gilchriese, Murdock; Gillam, Thomas; Gillberg, Dag; Gillman, Tony; Gingrich, Douglas; Giokaris, Nikos; Giordani, MarioPaolo; Giordano, Raffaele; Giorgi, Francesco Michelangelo; Giovannini, Paola; Giraud, Pierre-Francois; Giugni, Danilo; Giuliani, Claudia; Giunta, Michele; Gjelsten, B{\\o}rge Kile; Gkialas, Ioannis; Gladilin, Leonid; Glasman, Claudia; Glatzer, Julian; Glazov, Alexandre; Glonti, George; Goblirsch-Kolb, Maximilian; Goddard, Jack Robert; Godfrey, Jennifer; Godlewski, Jan; Goeringer, Christian; Goldfarb, Steven; Golling, Tobias; Golubkov, Dmitry; Gomes, Agostinho; Gomez Fajardo, Luz Stella; Gon\\c calo, Ricardo; Goncalves Pinto Firmino Da Costa, Joao; Gonella, Laura; Gonz\\'alez de la Hoz, Santiago; Gonzalez Parra, Garoe; Gonzalez Silva, Laura; Gonzalez-Sevilla, Sergio; Goodson, Jeremiah Jet; Goossens, Luc; Gorbounov, Petr Andreevich; Gordon, Howard; Gorelov, Igor; Gorfine, Grant; Gorini, Benedetto; Gorini, Edoardo; Gori\\v{s}ek, Andrej; Gornicki, Edward; Goshaw, Alfred; Gossling, Claus; Gostkin, Mikhail Ivanovitch; Gouighri, Mohamed; Goujdami, Driss; Goulette, Marc Phillippe; Goussiou, Anna; Goy, Corinne; Gozpinar, Serdar; Grabas, Herve Marie Xavier; Graber, Lars; Grabowska-Bold, Iwona; Grafstrom, Per; Grahn, Karl-Johan; Gramling, Johanna; Gramstad, Eirik; Grancagnolo, Francesco; Grancagnolo, Sergio; Grassi, Valerio; Gratchev, Vadim; Gray, Heather; Gray, Julia Ann; Graziani, Enrico; Grebenyuk, Oleg; Greenwood, Zeno Dixon; Gregersen, Kristian; Gregor, Ingrid-Maria; Grenier, Philippe; Griffiths, Justin; Grigalashvili, Nugzar; Grillo, Alexander; Grimm, Kathryn; Grinstein, Sebastian; Gris, Philippe Luc Yves; Grishkevich, Yaroslav; Grivaz, Jean-Francois; Grohs, Johannes Philipp; Grohsjean, Alexander; Gross, Eilam; Grosse-Knetter, Joern; Grossi, Giulio Cornelio; Groth-Jensen, Jacob; Grout, Zara Jane; Grybel, Kai; Guescini, Francesco; Guest, Daniel; Gueta, Orel; Guicheney, Christophe; Guido, Elisa; Guillemin, Thibault; Guindon, Stefan; Gul, Umar; Gumpert, Christian; Gunther, Jaroslav; Guo, Jun; Gupta, Shaun; Gutierrez, Phillip; Gutierrez Ortiz, Nicolas Gilberto; Gutschow, Christian; Guttman, Nir; Guyot, Claude; Gwenlan, Claire; Gwilliam, Carl; Haas, Andy; Haber, Carl; Hadavand, Haleh Khani; Haefner, Petra; Hageboeck, Stephan; Hajduk, Zbigniew; Hakobyan, Hrachya; Haleem, Mahsana; Hall, David; Halladjian, Garabed; Hamacher, Klaus; Hamal, Petr; Hamano, Kenji; Hamer, Matthias; Hamilton, Andrew; Hamilton, Samuel; Han, Liang; Hanagaki, Kazunori; Hanawa, Keita; Hance, Michael; Hanke, Paul; Hansen, John Renner; Hansen, J{\\o}rgen Beck; Hansen, Jorn Dines; Hansen, Peter Henrik; Hansson, Per; Hara, Kazuhiko; Hard, Andrew; Harenberg, Torsten; Harkusha, Siarhei; Harper, Devin; Harrington, Robert; Harris, Orin; Harrison, Paul Fraser; Hartjes, Fred; Harvey, Alex; Hasegawa, Satoshi; Hasegawa, Yoji; Hassani, Samira; Haug, Sigve; Hauschild, Michael; Hauser, Reiner; Havranek, Miroslav; Hawkes, Christopher; Hawkings, Richard John; Hawkins, Anthony David; Hayashi, Takayasu; Hayden, Daniel; Hays, Chris; Hayward, Helen; Haywood, Stephen; Head, Simon; Heck, Tobias; Hedberg, Vincent; Heelan, Louise; Heim, Sarah; Heinemann, Beate; Heisterkamp, Simon; Hejbal, Jiri; Helary, Louis; Heller, Claudio; Heller, Matthieu; Hellman, Sten; Hellmich, Dennis; Helsens, Clement; Henderson, James; Henderson, Robert; Henrichs, Anna; Henriques Correia, Ana Maria; Henrot-Versille, Sophie; Hensel, Carsten; Herbert, Geoffrey Henry; Medina Hernandez, Carlos; Hern\\'andez Jim\\'enez, Yesenia; Herrberg-Schubert, Ruth; Herten, Gregor; Hertenberger, Ralf; Hervas, Luis; Hesketh, Gavin Grant; Hessey, Nigel; Hickling, Robert; Hig\\'on-Rodriguez, Emilio; Hill, John; Hiller, Karl Heinz; Hillert, Sonja; Hillier, Stephen; Hinchliffe, Ian; Hines, Elizabeth; Hirose, Minoru; Hirschbuehl, Dominic; Hobbs, John; Hod, Noam; Hodgkinson, Mark; Hodgson, Paul; Hoecker, Andreas; Hoeferkamp, Martin; Hoffman, Julia; Hoffmann, Dirk; Hofmann, Julia Isabell; Hohlfeld, Marc; Holmes, Tova Ray; Hong, Tae Min; Hooft van Huysduynen, Loek; Hostachy, Jean-Yves; Hou, Suen; Hoummada, Abdeslam; Howard, Jacob; Howarth, James; Hrabovsky, Miroslav; Hristova, Ivana; Hrivnac, Julius; Hryn'ova, Tetiana; Hsu, Pai-hsien Jennifer; Hsu, Shih-Chieh; Hu, Diedi; Hu, Xueye; Huang, Yanping; Hubacek, Zdenek; Hubaut, Fabrice; Huegging, Fabian; Huettmann, Antje; Huffman, Todd Brian; Hughes, Emlyn; Hughes, Gareth; Huhtinen, Mika; Hulsing, Tobias Alexander; Hurwitz, Martina; Huseynov, Nazim; Huston, Joey; Huth, John; Iacobucci, Giuseppe; Iakovidis, Georgios; Ibragimov, Iskander; Iconomidou-Fayard, Lydia; Idarraga, John; Ideal, Emma; Iengo, Paolo; Igonkina, Olga; Iizawa, Tomoya; Ikegami, Yoichi; Ikematsu, Katsumasa; Ikeno, Masahiro; Iliadis, Dimitrios; Ilic, Nikolina; Inamaru, Yuki; Ince, Tayfun; Ioannou, Pavlos; Iodice, Mauro; Iordanidou, Kalliopi; Ippolito, Valerio; Irles Quiles, Adrian; Isaksson, Charlie; Ishino, Masaya; Ishitsuka, Masaki; Ishmukhametov, Renat; Issever, Cigdem; Istin, Serhat; Ivashin, Anton; Iwanski, Wieslaw; Iwasaki, Hiroyuki; Izen, Joseph; Izzo, Vincenzo; Jackson, Brett; Jackson, John; Jackson, Matthew; Jackson, Paul; Jaekel, Martin; Jain, Vivek; Jakobs, Karl; Jakobsen, Sune; Jakoubek, Tomas; Jakubek, Jan; Jamin, David Olivier; Jana, Dilip; Jansen, Eric; Jansen, Hendrik; Janssen, Jens; Janus, Michel; Jared, Richard; Jarlskog, Goran; Jeanty, Laura; Jeng, Geng-yuan; Jen-La Plante, Imai; Jennens, David; Jenni, Peter; Jentzsch, Jennifer; Jeske, Carl; J\\'ez\\'equel, St\\'ephane; Jha, Manoj Kumar; Ji, Haoshuang; Ji, Weina; Jia, Jiangyong; Jiang, Yi; Jimenez Belenguer, Marcos; Jin, Shan; Jinaru, Adam; Jinnouchi, Osamu; Joergensen, Morten Dam; Joffe, David; Johansson, Erik; Johansson, Per; Johns, Kenneth; Jon-And, Kerstin; Jones, Graham; Jones, Roger; Jones, Tim; Jorge, Pedro; Joshi, Kiran Daniel; Jovicevic, Jelena; Ju, Xiangyang; Jung, Christian; Jungst, Ralph Markus; Jussel, Patrick; Juste Rozas, Aurelio; Kaci, Mohammed; Kaczmarska, Anna; Kadlecik, Peter; Kado, Marumi; Kagan, Harris; Kagan, Michael; Kajomovitz, Enrique; Kalinin, Sergey; Kama, Sami; Kanaya, Naoko; Kaneda, Michiru; Kaneti, Steven; Kanno, Takayuki; Kantserov, Vadim; Kanzaki, Junichi; Kaplan, Benjamin; Kapliy, Anton; Kar, Deepak; Karakostas, Konstantinos; Karastathis, Nikolaos; Karnevskiy, Mikhail; Karpov, Sergey; Karthik, Krishnaiyengar; Kartvelishvili, Vakhtang; Karyukhin, Andrey; Kashif, Lashkar; Kasieczka, Gregor; Kass, Richard; Kastanas, Alex; Kataoka, Yousuke; Katre, Akshay; Katzy, Judith; Kaushik, Venkatesh; Kawagoe, Kiyotomo; Kawamoto, Tatsuo; Kawamura, Gen; Kazama, Shingo; Kazanin, Vassili; Kazarinov, Makhail; Keeler, Richard; Keener, Paul; Kehoe, Robert; Keil, Markus; Keller, John; Keoshkerian, Houry; Kepka, Oldrich; Ker\\v{s}evan, Borut Paul; Kersten, Susanne; Kessoku, Kohei; Keung, Justin; Khalil-zada, Farkhad; Khandanyan, Hovhannes; Khanov, Alexander; Kharchenko, Dmitri; Khodinov, Alexander; Khomich, Andrei; Khoo, Teng Jian; Khoriauli, Gia; Khoroshilov, Andrey; Khovanskiy, Valery; Khramov, Evgeniy; Khubua, Jemal; Kim, Hyeon Jin; Kim, Shinhong; Kimura, Naoki; Kind, Oliver; King, Barry; King, Matthew; King, Robert Steven Beaufoy; King, Samuel Burton; Kirk, Julie; Kiryunin, Andrey; Kishimoto, Tomoe; Kisielewska, Danuta; Kitamura, Takumi; Kittelmann, Thomas; Kiuchi, Kenji; Kladiva, Eduard; Klein, Max; Klein, Uta; Kleinknecht, Konrad; Klimek, Pawel; Klimentov, Alexei; Klingenberg, Reiner; Klinger, Joel Alexander; Klinkby, Esben; Klioutchnikova, Tatiana; Klok, Peter; Kluge, Eike-Erik; Kluit, Peter; Kluth, Stefan; Kneringer, Emmerich; Knoops, Edith; Knue, Andrea; Kobayashi, Tomio; Kobel, Michael; Kocian, Martin; Kodys, Peter; Koenig, Sebastian; Koevesarki, Peter; Koffas, Thomas; Koffeman, Els; Kogan, Lucy Anne; Kohlmann, Simon; Kohout, Zdenek; Kohriki, Takashi; Koi, Tatsumi; Kolanoski, Hermann; Koletsou, Iro; Koll, James; Komar, Aston; Komori, Yuto; Kondo, Takahiko; Koneke, Karsten; Konig, Adriaan; Kono, Takanori; Konoplich, Rostislav; Konstantinidis, Nikolaos; Kopeliansky, Revital; Koperny, Stefan; Kopke, Lutz; Kopp, Anna Katharina; Korcyl, Krzysztof; Kordas, Kostantinos; Korn, Andreas; Korol, Aleksandr; Korolkov, Ilya; Korolkova, Elena; Korotkov, Vladislav; Kortner, Oliver; Kortner, Sandra; Kostyukhin, Vadim; Kotov, Sergey; Kotov, Vladislav; Kotwal, Ashutosh; Kourkoumelis, Christine; Kouskoura, Vasiliki; Koutsman, Alex; Kowalewski, Robert Victor; Kowalski, Tadeusz; Kozanecki, Witold; Kozhin, Anatoly; Kral, Vlastimil; Kramarenko, Viktor; Kramberger, Gregor; Krasny, Mieczyslaw Witold; Krasznahorkay, Attila; Kraus, Jana; Kravchenko, Anton; Kreiss, Sven; Kretzschmar, Jan; Kreutzfeldt, Kristof; Krieger, Nina; Krieger, Peter; Kroeninger, Kevin; Kroha, Hubert; Kroll, Joe; Kroseberg, Juergen; Krstic, Jelena; Kruchonak, Uladzimir; Kruger, Hans; Kruker, Tobias; Krumnack, Nils; Krumshteyn, Zinovii; Kruse, Amanda; Kruse, Mark; Kruskal, Michael; Kubota, Takashi; Kuday, Sinan; Kuehn, Susanne; Kugel, Andreas; Kuhl, Thorsten; Kukhtin, Victor; Kulchitsky, Yuri; Kuleshov, Sergey; Kuna, Marine; Kunkle, Joshua; Kupco, Alexander; Kurashige, Hisaya; Kurata, Masakazu; Kurochkin, Yurii; Kurumida, Rie; Kus, Vlastimil; Kuwertz, Emma Sian; Kuze, Masahiro; Kvita, Jiri; Kwee, Regina; La Rosa, Alessandro; La Rotonda, Laura; Labarga, Luis; Lablak, Said; Lacasta, Carlos; Lacava, Francesco; Lacey, James; Lacker, Heiko; Lacour, Didier; Lacuesta, Vicente Ram\\'on; Ladygin, Evgueni; Lafaye, Remi; Laforge, Bertrand; Lagouri, Theodota; Lai, Stanley; Laier, Heiko; Laisne, Emmanuel; Lambourne, Luke; Lampen, Caleb; Lampl, Walter; Lan\\c con, Eric; Landgraf, Ulrich; Landon, Murrough; Lang, Valerie Susanne; Lange, Clemens; Lankford, Andrew; Lanni, Francesco; Lantzsch, Kerstin; Lanza, Agostino; Laplace, Sandrine; Lapoire, Cecile; Laporte, Jean-Francois; Lari, Tommaso; Larner, Aimee; Lassnig, Mario; Laurelli, Paolo; Lavorini, Vincenzo; Lavrijsen, Wim; Laycock, Paul; Le, Bao Tran; Le Dortz, Olivier; Le Guirriec, Emmanuel; Le Menedeu, Eve; LeCompte, Thomas; Ledroit-Guillon, Fabienne Agnes Marie; Lee, Claire Alexandra; Lee, Hurng-Chun; Lee, Jason; Lee, Shih-Chang; Lee, Lawrence; Lefebvre, Guillaume; Lefebvre, Michel; Legger, Federica; Leggett, Charles; Lehan, Allan; Lehmacher, Marc; Lehmann Miotto, Giovanna; Lei, Xiaowen; Leister, Andrew Gerard; Leite, Marco Aurelio Lisboa; Leitner, Rupert; Lellouch, Daniel; Lemmer, Boris; Lendermann, Victor; Leney, Katharine; Lenz, Tatjana; Lenzen, Georg; Lenzi, Bruno; Leone, Robert; Leonhardt, Kathrin; Leontsinis, Stefanos; Leroy, Claude; Lessard, Jean-Raphael; Lester, Christopher; Lester, Christopher Michael; Lev\\^eque, Jessica; Levin, Daniel; Levinson, Lorne; Lewis, Adrian; Lewis, George; Leyko, Agnieszka; Leyton, Michael; Li, Bing; Li, Bo; Li, Haifeng; Li, Ho Ling; Li, Shu; Li, Xuefei; Liang, Zhijun; Liao, Hongbo; Liberti, Barbara; Lichard, Peter; Lie, Ki; Liebal, Jessica; Liebig, Wolfgang; Limbach, Christian; Limosani, Antonio; Limper, Maaike; Lin, Simon; Linde, Frank; Lindquist, Brian Edward; Linnemann, James; Lipeles, Elliot; Lipniacka, Anna; Lisovyi, Mykhailo; Liss, Tony; Lissauer, David; Lister, Alison; Litke, Alan; Liu, Bo; Liu, Dong; Liu, Jianbei; Liu, Kun; Liu, Lulu; Liu, Miaoyuan; Liu, Minghui; Liu, Yanwen; Livan, Michele; Livermore, Sarah; Lleres, Annick; Llorente Merino, Javier; Lloyd, Stephen; Lo Sterzo, Francesco; Lobodzinska, Ewelina; Loch, Peter; Lockman, William; Loddenkoetter, Thomas; Loebinger, Fred; Loevschall-Jensen, Ask Emil; Loginov, Andrey; Loh, Chang Wei; Lohse, Thomas; Lohwasser, Kristin; Lokajicek, Milos; Lombardo, Vincenzo Paolo; Long, Jonathan; Long, Robin Eamonn; Lopes, Lourenco; Lopez Mateos, David; Lopez Paredes, Brais; Lorenz, Jeanette; Lorenzo Martinez, Narei; Losada, Marta; Loscutoff, Peter; Losty, Michael; Lou, XinChou; Lounis, Abdenour; Love, Jeremy; Love, Peter; Lowe, Andrew; Lu, Feng; Lubatti, Henry; Luci, Claudio; Lucotte, Arnaud; Ludwig, Dorthe; Ludwig, Inga; Luehring, Frederick; Lukas, Wolfgang; Luminari, Lamberto; Lund, Esben; Lundberg, Johan; Lundberg, Olof; Lund-Jensen, Bengt; Lungwitz, Matthias; Lynn, David; Lysak, Roman; Lytken, Else; Ma, Hong; Ma, Lian Liang; Maccarrone, Giovanni; Macchiolo, Anna; Ma\\v{c}ek, Bo\\v{s}tjan; Machado Miguens, Joana; Macina, Daniela; Mackeprang, Rasmus; Madar, Romain; Madaras, Ronald; Maddocks, Harvey Jonathan; Mader, Wolfgang; Madsen, Alexander; Maeno, Mayuko; Maeno, Tadashi; Magnoni, Luca; Magradze, Erekle; Mahboubi, Kambiz; Mahlstedt, Joern; Mahmoud, Sara; Mahout, Gilles; Maiani, Camilla; Maidantchik, Carmen; Maio, Am\\'elia; Majewski, Stephanie; Makida, Yasuhiro; Makovec, Nikola; Mal, Prolay; Malaescu, Bogdan; Malecki, Pawel; Maleev, Victor; Malek, Fairouz; Mallik, Usha; Malon, David; Malone, Caitlin; Maltezos, Stavros; Malyshev, Vladimir; Malyukov, Sergei; Mamuzic, Judita; Mandelli, Luciano; Mandi\\'{c}, Igor; Mandrysch, Rocco; Maneira, Jos\\'e; Manfredini, Alessandro; Manhaes de Andrade Filho, Luciano; Manjarres Ramos, Joany Andreina; Mann, Alexander; Manning, Peter; Manousakis-Katsikakis, Arkadios; Mansoulie, Bruno; Mantifel, Rodger; Mapelli, Livio; March, Luis; Marchand, Jean-Francois; Marchese, Fabrizio; Marchiori, Giovanni; Marcisovsky, Michal; Marino, Christopher; Marques, Carlos; Marroquim, Fernando; Marshall, Zach; Marti, Lukas Fritz; Marti-Garcia, Salvador; Martin, Brian; Martin, Brian Thomas; Martin, Jean-Pierre; Martin, Tim; Martin, Victoria Jane; Martin dit Latour, Bertrand; Martinez, Homero; Martinez, Mario; Martin-Haugh, Stewart; Martyniuk, Alex; Marx, Marilyn; Marzano, Francesco; Marzin, Antoine; Masetti, Lucia; Mashimo, Tetsuro; Mashinistov, Ruslan; Masik, Jiri; Maslennikov, Alexey; Massa, Ignazio; Massol, Nicolas; Mastrandrea, Paolo; Mastroberardino, Anna; Masubuchi, Tatsuya; Matsunaga, Hiroyuki; Matsushita, Takashi; Mattig, Peter; Mattig, Stefan; Mattmann, Johannes; Mattravers, Carly; Maurer, Julien; Maxfield, Stephen; Maximov, Dmitriy; Mazini, Rachid; Mazzaferro, Luca; Mazzanti, Marcello; Mc Goldrick, Garrin; Mc Kee, Shawn Patrick; McCarn, Allison; McCarthy, Robert; McCarthy, Tom; McCubbin, Norman; McFarlane, Kenneth; Mcfayden, Josh; Mchedlidze, Gvantsa; Mclaughlan, Tom; McMahon, Steve; McPherson, Robert; Meade, Andrew; Mechnich, Joerg; Mechtel, Markus; Medinnis, Mike; Meehan, Samuel; Meera-Lebbai, Razzak; Mehlhase, Sascha; Mehta, Andrew; Meier, Karlheinz; Meineck, Christian; Meirose, Bernhard; Melachrinos, Constantinos; Mellado Garcia, Bruce Rafael; Meloni, Federico; Mendoza Navas, Luis; Mengarelli, Alberto; Menke, Sven; Meoni, Evelin; Mercurio, Kevin Michael; Mergelmeyer, Sebastian; Meric, Nicolas; Mermod, Philippe; Merola, Leonardo; Meroni, Chiara; Merritt, Frank; Merritt, Hayes; Messina, Andrea; Metcalfe, Jessica; Mete, Alaettin Serhan; Meyer, Carsten; Meyer, Christopher; Meyer, Jean-Pierre; Meyer, Jochen; Meyer, Joerg; Michal, Sebastien; Middleton, Robin; Migas, Sylwia; Mijovi\\'{c}, Liza; Mikenberg, Giora; Mikestikova, Marcela; Miku\\v{z}, Marko; Miller, David; Mills, Corrinne; Milov, Alexander; Milstead, David; Milstein, Dmitry; Minaenko, Andrey; Minano Moya, Mercedes; Minashvili, Irakli; Mincer, Allen; Mindur, Bartosz; Mineev, Mikhail; Ming, Yao; Mir, Lluisa-Maria; Mirabelli, Giovanni; Mitani, Takashi; Mitrevski, Jovan; Mitsou, Vasiliki A; Mitsui, Shingo; Miyagawa, Paul; Mjornmark, Jan-Ulf; Moa, Torbjoern; Moeller, Victoria; Mohapatra, Soumya; Mohr, Wolfgang; Molander, Simon; Moles-Valls, Regina; Molfetas, Angelos; Monig, Klaus; Monini, Caterina; Monk, James; Monnier, Emmanuel; Montejo Berlingen, Javier; Monticelli, Fernando; Monzani, Simone; Moore, Roger; Mora Herrera, Clemencia; Moraes, Arthur; Morange, Nicolas; Morel, Julien; Moreno, Deywis; Moreno Ll\\'acer, Mar\\'ia; Morettini, Paolo; Morgenstern, Marcus; Morii, Masahiro; Moritz, Sebastian; Morley, Anthony Keith; Mornacchi, Giuseppe; Morris, John; Morvaj, Ljiljana; Moser, Hans-Guenther; Mosidze, Maia; Moss, Josh; Mount, Richard; Mountricha, Eleni; Mouraviev, Sergei; Moyse, Edward; Mudd, Richard; Mueller, Felix; Mueller, James; Mueller, Klemens; Mueller, Thibaut; Mueller, Timo; Muenstermann, Daniel; Munwes, Yonathan; Murillo Quijada, Javier Alberto; Murray, Bill; Mussche, Ido; Musto, Elisa; Myagkov, Alexey; Myska, Miroslav; Nackenhorst, Olaf; Nadal, Jordi; Nagai, Koichi; Nagai, Ryo; Nagai, Yoshikazu; Nagano, Kunihiro; Nagarkar, Advait; Nagasaka, Yasushi; Nagel, Martin; Nairz, Armin Michael; Nakahama, Yu; Nakamura, Koji; Nakamura, Tomoaki; Nakano, Itsuo; Namasivayam, Harisankar; Nanava, Gizo; Napier, Austin; Narayan, Rohin; Nash, Michael; Nattermann, Till; Naumann, Thomas; Navarro, Gabriela; Neal, Homer; Nechaeva, Polina; Neep, Thomas James; Negri, Andrea; Negri, Guido; Negrini, Matteo; Nektarijevic, Snezana; Nelson, Andrew; Nelson, Timothy Knight; Nemecek, Stanislav; Nemethy, Peter; Nepomuceno, Andre Asevedo; Nessi, Marzio; Neubauer, Mark; Neumann, Manuel; Neusiedl, Andrea; Neves, Ricardo; Nevski, Pavel; Newcomer, Mitchel; Newman, Paul; Nguyen, Duong Hai; Nguyen Thi Hong, Van; Nickerson, Richard; Nicolaidou, Rosy; Nicquevert, Bertrand; Nielsen, Jason; Nikiforou, Nikiforos; Nikiforov, Andriy; Nikolaenko, Vladimir; Nikolic-Audit, Irena; Nikolics, Katalin; Nikolopoulos, Konstantinos; Nilsson, Paul; Ninomiya, Yoichi; Nisati, Aleandro; Nisius, Richard; Nobe, Takuya; Nodulman, Lawrence; Nomachi, Masaharu; Nomidis, Ioannis; Norberg, Scarlet; Nordberg, Markus; Novakova, Jana; Nozaki, Mitsuaki; Nozka, Libor; Ntekas, Konstantinos; Nuncio-Quiroz, Adriana-Elizabeth; Nunes Hanninger, Guilherme; Nunnemann, Thomas; Nurse, Emily; O'Brien, Brendan Joseph; O'grady, Fionnbarr; O'Neil, Dugan; O'Shea, Val; Oakes, Louise Beth; Oakham, Gerald; Oberlack, Horst; Ocariz, Jose; Ochi, Atsuhiko; Ochoa, Ines; Oda, Susumu; Odaka, Shigeru; Ogren, Harold; Oh, Alexander; Oh, Seog; Ohm, Christian; Ohshima, Takayoshi; Okamura, Wataru; Okawa, Hideki; Okumura, Yasuyuki; Okuyama, Toyonobu; Olariu, Albert; Olchevski, Alexander; Olivares Pino, Sebastian Andres; Oliveira, Miguel Alfonso; Oliveira Damazio, Denis; Oliver Garcia, Elena; Olivito, Dominick; Olszewski, Andrzej; Olszowska, Jolanta; Onofre, Ant\\'onio; Onyisi, Peter; Oram, Christopher; Oreglia, Mark; Oren, Yona; Orestano, Domizia; Orlando, Nicola; Oropeza Barrera, Cristina; Orr, Robert; Osculati, Bianca; Ospanov, Rustem; Otero y Garzon, Gustavo; Otono, Hidetoshi; Ouchrif, Mohamed; Ouellette, Eric; Ould-Saada, Farid; Ouraou, Ahmimed; Oussoren, Koen Pieter; Ouyang, Qun; Ovcharova, Ana; Owen, Mark; Owen, Simon; Ozcan, Veysi Erkcan; Ozturk, Nurcan; Pachal, Katherine; Pacheco Pages, Andres; Padilla Aranda, Cristobal; Pagan Griso, Simone; Paganis, Efstathios; Pahl, Christoph; Paige, Frank; Pais, Preema; Pajchel, Katarina; Palacino, Gabriel; Palestini, Sandro; Pallin, Dominique; Palma, Alberto; Palmer, Jody; Pan, Yibin; Panagiotopoulou, Evgenia; Panduro Vazquez, William; Pani, Priscilla; Panikashvili, Natalia; Panitkin, Sergey; Pantea, Dan; Papadopoulou, Theodora; Papageorgiou, Konstantinos; Paramonov, Alexander; Paredes Hernandez, Daniela; Parker, Michael Andrew; Parodi, Fabrizio; Parsons, John; Parzefall, Ulrich; Pashapour, Shabnaz; Pasqualucci, Enrico; Passaggio, Stefano; Passeri, Antonio; Pastore, Fernanda; Pastore, Francesca; P\\'asztor, Gabriella; Pataraia, Sophio; Patel, Nikhul; Pater, Joleen; Patricelli, Sergio; Pauly, Thilo; Pearce, James; Pedersen, Maiken; Pedraza Lopez, Sebastian; Pedro, Rute; Peleganchuk, Sergey; Pelikan, Daniel; Peng, Haiping; Penning, Bjoern; Penwell, John; Perepelitsa, Dennis; Perez Cavalcanti, Tiago; Perez Codina, Estel; Perez Garcia-Estan, Maria Teresa; Perez Reale, Valeria; Perini, Laura; Pernegger, Heinz; Perrino, Roberto; Peschke, Richard; Peshekhonov, Vladimir; Peters, Krisztian; Peters, Yvonne; Petersen, Brian; Petersen, Jorgen; Petersen, Troels; Petit, Elisabeth; Petridis, Andreas; Petridou, Chariclia; Petrolo, Emilio; Petrucci, Fabrizio; Petteni, Michele; Pezoa, Raquel; Phillips, Peter William; Piacquadio, Giacinto; Pianori, Elisabetta; Picazio, Attilio; Piccaro, Elisa; Piccinini, Maurizio; Piec, Sebastian Marcin; Piegaia, Ricardo; Pignotti, David; Pilcher, James; Pilkington, Andrew; Pina, Joao Antonio; Pinamonti, Michele; Pinder, Alex; Pinfold, James; Pingel, Almut; Pinto, Belmiro; Pizio, Caterina; Pleier, Marc-Andre; Pleskot, Vojtech; Plotnikova, Elena; Plucinski, Pawel; Poddar, Sahill; Podlyski, Fabrice; Poettgen, Ruth; Poggioli, Luc; Pohl, David-leon; Pohl, Martin; Polesello, Giacomo; Policicchio, Antonio; Polifka, Richard; Polini, Alessandro; Pollard, Christopher Samuel; Polychronakos, Venetios; Pomeroy, Daniel; Pomm\\`es, Kathy; Pontecorvo, Ludovico; Pope, Bernard; Popeneciu, Gabriel Alexandru; Popovic, Dragan; Poppleton, Alan; Portell Bueso, Xavier; Pospelov, Guennady; Pospisil, Stanislav; Potamianos, Karolos; Potrap, Igor; Potter, Christina; Potter, Christopher; Poulard, Gilbert; Poveda, Joaquin; Pozdnyakov, Valery; Prabhu, Robindra; Pralavorio, Pascal; Pranko, Aliaksandr; Prasad, Srivas; Pravahan, Rishiraj; Prell, Soeren; Price, Darren; Price, Joe; Price, Lawrence; Prieur, Damien; Primavera, Margherita; Proissl, Manuel; Prokofiev, Kirill; Prokoshin, Fedor; Protopapadaki, Eftychia-sofia; Protopopescu, Serban; Proudfoot, James; Prudent, Xavier; Przybycien, Mariusz; Przysiezniak, Helenka; Psoroulas, Serena; Ptacek, Elizabeth; Pueschel, Elisa; Puldon, David; Purohit, Milind; Puzo, Patrick; Pylypchenko, Yuriy; Qian, Jianming; Quadt, Arnulf; Quarrie, David; Quayle, William; Quilty, Donnchadha; Radeka, Veljko; Radescu, Voica; Radhakrishnan, Sooraj Krishnan; Radloff, Peter; Ragusa, Francesco; Rahal, Ghita; Rajagopalan, Srinivasan; Rammensee, Michael; Rammes, Marcus; Randle-Conde, Aidan Sean; Rangel-Smith, Camila; Rao, Kanury; Rauscher, Felix; Rave, Tobias Christian; Ravenscroft, Thomas; Raymond, Michel; Read, Alexander Lincoln; Rebuzzi, Daniela; Redelbach, Andreas; Redlinger, George; Reece, Ryan; Reeves, Kendall; Reinsch, Andreas; Reisin, Hernan; Reisinger, Ingo; Relich, Matthew; Rembser, Christoph; Ren, Zhongliang; Renaud, Adrien; Rescigno, Marco; Resconi, Silvia; Resende, Bernardo; Reznicek, Pavel; Rezvani, Reyhaneh; Richter, Robert; Ridel, Melissa; Rieck, Patrick; Rijssenbeek, Michael; Rimoldi, Adele; Rinaldi, Lorenzo; Ritsch, Elmar; Riu, Imma; Rivoltella, Giancesare; Rizatdinova, Flera; Rizvi, Eram; Robertson, Steven; Robichaud-Veronneau, Andree; Robinson, Dave; Robinson, James; Robson, Aidan; Rocha de Lima, Jose Guilherme; Roda, Chiara; Roda Dos Santos, Denis; Rodrigues, Luis; Roe, Shaun; R{\\o}hne, Ole; Rolli, Simona; Romaniouk, Anatoli; Romano, Marino; Romeo, Gaston; Romero Adam, Elena; Rompotis, Nikolaos; Roos, Lydia; Ros, Eduardo; Rosati, Stefano; Rosbach, Kilian; Rose, Anthony; Rose, Matthew; Rosendahl, Peter Lundgaard; Rosenthal, Oliver; Rossetti, Valerio; Rossi, Elvira; Rossi, Leonardo Paolo; Rosten, Rachel; Rotaru, Marina; Roth, Itamar; Rothberg, Joseph; Rousseau, David; Royon, Christophe; Rozanov, Alexandre; Rozen, Yoram; Ruan, Xifeng; Rubbo, Francesco; Rubinskiy, Igor; Rud, Viacheslav; Rudolph, Christian; Rudolph, Matthew Scott; Ruhr, Frederik; Ruiz-Martinez, Aranzazu; Rumyantsev, Leonid; Rurikova, Zuzana; Rusakovich, Nikolai; Ruschke, Alexander; Rutherfoord, John; Ruthmann, Nils; Ruzicka, Pavel; Ryabov, Yury; Rybar, Martin; Rybkin, Grigori; Ryder, Nick; Saavedra, Aldo; Sacerdoti, Sabrina; Saddique, Asif; Sadeh, Iftach; Sadrozinski, Hartmut; Sadykov, Renat; Safai Tehrani, Francesco; Sakamoto, Hiroshi; Sakurai, Yuki; Salamanna, Giuseppe; Salamon, Andrea; Saleem, Muhammad; Salek, David; Sales De Bruin, Pedro Henrique; Salihagic, Denis; Salnikov, Andrei; Salt, Jos\\'e; Salvachua Ferrando, Bel\\'en; Salvatore, Daniela; Salvatore, Pasquale Fabrizio; Salvucci, Antonio; Salzburger, Andreas; Sampsonidis, Dimitrios; Sanchez, Arturo; S\\'anchez, Javier; Sanchez Martinez, Victoria; Sandaker, Heidi; Sander, Heinz Georg; Sanders, Michiel; Sandhoff, Marisa; Sandoval, Tanya; Sandoval, Carlos; Sandstroem, Rikard; Sankey, Dave; Sansoni, Andrea; Santoni, Claudio; Santonico, Rinaldo; Santos, Helena; Santoyo Castillo, Itzebelt; Sapp, Kevin; Sapronov, Andrey; Saraiva, Joao; Sarkisyan-Grinbaum, Edward; Sarrazin, Bjorn; Sartisohn, Georg; Sasaki, Osamu; Sasaki, Yuichi; Sasao, Noboru; Satsounkevitch, Igor; Sauvage, Gilles; Sauvan, Emmanuel; Sauvan, Jean-Baptiste; Savard, Pierre; Savinov, Vladimir; Savu, Dan Octavian; Sawyer, Craig; Sawyer, Lee; Saxon, David; Saxon, James; Sbarra, Carla; Sbrizzi, Antonio; Scanlon, Tim; Scannicchio, Diana; Scarcella, Mark; Schaarschmidt, Jana; Schacht, Peter; Schaefer, Douglas; Schaelicke, Andreas; Schaepe, Steffen; Schaetzel, Sebastian; Schafer, Uli; Schaffer, Arthur; Schaile, Dorothee; Schamberger, R. Dean; Scharf, Veit; Schegelsky, Valery; Scheirich, Daniel; Schernau, Michael; Scherzer, Max; Schiavi, Carlo; Schieck, Jochen; Schillo, Christian; Schioppa, Marco; Schlenker, Stefan; Schmidt, Evelyn; Schmieden, Kristof; Schmitt, Christian; Schmitt, Christopher; Schmitt, Sebastian; Schneider, Basil; Schnellbach, Yan Jie; Schnoor, Ulrike; Schoeffel, Laurent; Schoening, Andre; Schoenrock, Bradley Daniel; Schorlemmer, Andre Lukas; Schott, Matthias; Schouten, Doug; Schovancova, Jaroslava; Schram, Malachi; Schramm, Steven; Schreyer, Manuel; Schroeder, Christian; Schroer, Nicolai; Schuh, Natascha; Schultens, Martin Johannes; Schultz-Coulon, Hans-Christian; Schulz, Holger; Schumacher, Markus; Schumm, Bruce; Schune, Philippe; Schwartzman, Ariel; Schwegler, Philipp; Schwemling, Philippe; Schwienhorst, Reinhard; Schwindling, Jerome; Schwindt, Thomas; Schwoerer, Maud; Sciacca, Gianfranco; Scifo, Estelle; Sciolla, Gabriella; Scott, Bill; Scutti, Federico; Searcy, Jacob; Sedov, George; Sedykh, Evgeny; Seidel, Sally; Seiden, Abraham; Seifert, Frank; Seixas, Jos\\'e; Sekhniaidze, Givi; Sekula, Stephen; Selbach, Karoline Elfriede; Seliverstov, Dmitry; Sellers, Graham; Seman, Michal; Semprini-Cesari, Nicola; Serfon, Cedric; Serin, Laurent; Serkin, Leonid; Serre, Thomas; Seuster, Rolf; Severini, Horst; Sforza, Federico; Sfyrla, Anna; Shabalina, Elizaveta; Shamim, Mansoora; Shan, Lianyou; Shank, James; Shao, Qi Tao; Shapiro, Marjorie; Shatalov, Pavel; Shaw, Kate; Sherwood, Peter; Shimizu, Shima; Shimojima, Makoto; Shin, Taeksu; Shiyakova, Mariya; Shmeleva, Alevtina; Shochet, Mel; Short, Daniel; Shrestha, Suyog; Shulga, Evgeny; Shupe, Michael; Shushkevich, Stanislav; Sicho, Petr; Sidorov, Dmitri; Sidoti, Antonio; Siegert, Frank; Sijacki, Djordje; Silbert, Ohad; Silva, Jos\\'e; Silver, Yiftah; Silverstein, Daniel; Silverstein, Samuel; Simak, Vladislav; Simard, Olivier; Simic, Ljiljana; Simion, Stefan; Simioni, Eduard; Simmons, Brinick; Simoniello, Rosa; Simonyan, Margar; Sinervo, Pekka; Sinev, Nikolai; Sipica, Valentin; Siragusa, Giovanni; Sircar, Anirvan; Sisakyan, Alexei; Sivoklokov, Serguei; Sjolin, Jorgen; Sjursen, Therese; Skinnari, Louise Anastasia; Skottowe, Hugh Philip; Skovpen, Kirill; Skubic, Patrick; Slater, Mark; Slavicek, Tomas; Sliwa, Krzysztof; Smakhtin, Vladimir; Smart, Ben; Smestad, Lillian; Smirnov, Sergei; Smirnov, Yury; Smirnova, Lidia; Smirnova, Oxana; Smith, Kenway; Smizanska, Maria; Smolek, Karel; Snesarev, Andrei; Snidero, Giacomo; Snow, Joel; Snyder, Scott; Sobie, Randall; Socher, Felix; Sodomka, Jaromir; Soffer, Abner; Soh, Dart-yin; Solans, Carlos; Solar, Michael; Solc, Jaroslav; Soldatov, Evgeny; Soldevila, Urmila; Solfaroli Camillocci, Elena; Solodkov, Alexander; Solovyanov, Oleg; Solovyev, Victor; Soni, Nitesh; Sood, Alexander; Sopko, Vit; Sopko, Bruno; Sosebee, Mark; Soualah, Rachik; Soueid, Paul; Soukharev, Andrey; South, David; Spagnolo, Stefania; Span\\`o, Francesco; Spearman, William Robert; Spighi, Roberto; Spigo, Giancarlo; Spousta, Martin; Spreitzer, Teresa; Spurlock, Barry; St Denis, Richard Dante; Stahlman, Jonathan; Stamen, Rainer; Stanecka, Ewa; Stanek, Robert; Stanescu, Cristian; Stanescu-Bellu, Madalina; Stanitzki, Marcel Michael; Stapnes, Steinar; Starchenko, Evgeny; Stark, Jan; Staroba, Pavel; Starovoitov, Pavel; Staszewski, Rafal; Stavina, Pavel; Steele, Genevieve; Steinbach, Peter; Steinberg, Peter; Stekl, Ivan; Stelzer, Bernd; Stelzer, Harald Joerg; Stelzer-Chilton, Oliver; Stenzel, Hasko; Stern, Sebastian; Stewart, Graeme; Stillings, Jan Andre; Stockton, Mark; Stoebe, Michael; Stoerig, Kathrin; Stoicea, Gabriel; Stonjek, Stefan; Stradling, Alden; Straessner, Arno; Strandberg, Jonas; Strandberg, Sara; Strandlie, Are; Strauss, Emanuel; Strauss, Michael; Strizenec, Pavol; Strohmer, Raimund; Strom, David; Stroynowski, Ryszard; Stucci, Stefania Antonia; Stugu, Bjarne; Stumer, Iuliu; Stupak, John; Sturm, Philipp; Styles, Nicholas Adam; Su, Dong; Su, Jun; Subramania, Halasya Siva; Subramaniam, Rajivalochan; Succurro, Antonella; Sugaya, Yorihito; Suhr, Chad; Suk, Michal; Sulin, Vladimir; Sultansoy, Saleh; Sumida, Toshi; Sun, Xiaohu; Sundermann, Jan Erik; Suruliz, Kerim; Susinno, Giancarlo; Sutton, Mark; Suzuki, Yu; Svatos, Michal; Swedish, Stephen; Swiatlowski, Maximilian; Sykora, Ivan; Sykora, Tomas; Ta, Duc; Tackmann, Kerstin; Taenzer, Joe; Taffard, Anyes; Tafirout, Reda; Taiblum, Nimrod; Takahashi, Yuta; Takai, Helio; Takashima, Ryuichi; Takeda, Hiroshi; Takeshita, Tohru; Takubo, Yosuke; Talby, Mossadek; Talyshev, Alexey; Tam, Jason; Tamsett, Matthew; Tan, Kong Guan; Tanaka, Junichi; Tanaka, Reisaburo; Tanaka, Satoshi; Tanaka, Shuji; Tanasijczuk, Andres Jorge; Tani, Kazutoshi; Tannoury, Nancy; Tapprogge, Stefan; Tarem, Shlomit; Tarrade, Fabien; Tartarelli, Giuseppe Francesco; Tas, Petr; Tasevsky, Marek; Tashiro, Takuya; Tassi, Enrico; Tavares Delgado, Ademar; Tayalati, Yahya; Taylor, Christopher; Taylor, Frank; Taylor, Geoffrey; Taylor, Wendy; Teischinger, Florian Alfred; Teixeira Dias Castanheira, Matilde; Teixeira-Dias, Pedro; Temming, Kim Katrin; Ten Kate, Herman; Teng, Ping-Kun; Terada, Susumu; Terashi, Koji; Terron, Juan; Terzo, Stefano; Testa, Marianna; Teuscher, Richard; Therhaag, Jan; Theveneaux-Pelzer, Timoth\\'ee; Thoma, Sascha; Thomas, Juergen; Thompson, Emily; Thompson, Paul; Thompson, Peter; Thompson, Stan; Thomsen, Lotte Ansgaard; Thomson, Evelyn; Thomson, Mark; Thong, Wai Meng; Thun, Rudolf; Tian, Feng; Tibbetts, Mark James; Tic, Tom\\'{a}\\v{s}; Tikhomirov, Vladimir; Tikhonov, Yury; Timoshenko, Sergey; Tiouchichine, Elodie; Tipton, Paul; Tisserant, Sylvain; Todorov, Theodore; Todorova-Nova, Sharka; Toggerson, Brokk; Tojo, Junji; Tok\\'ar, Stanislav; Tokushuku, Katsuo; Tollefson, Kirsten; Tomlinson, Lee; Tomoto, Makoto; Tompkins, Lauren; Toms, Konstantin; Topilin, Nikolai; Torrence, Eric; Torres, Heberth; Torr\\'o Pastor, Emma; Toth, Jozsef; Touchard, Francois; Tovey, Daniel; Tran, Huong Lan; Trefzger, Thomas; Tremblet, Louis; Tricoli, Alessandro; Trigger, Isabel Marian; Trincaz-Duvoid, Sophie; Tripiana, Martin; Triplett, Nathan; Trischuk, William; Trocm\\'e, Benjamin; Troncon, Clara; Trottier-McDonald, Michel; Trovatelli, Monica; True, Patrick; Trzebinski, Maciej; Trzupek, Adam; Tsarouchas, Charilaos; Tseng, Jeffrey; Tsiareshka, Pavel; Tsionou, Dimitra; Tsipolitis, Georgios; Tsirintanis, Nikolaos; Tsiskaridze, Shota; Tsiskaridze, Vakhtang; Tskhadadze, Edisher; Tsukerman, Ilya; Tsulaia, Vakhtang; Tsung, Jieh-Wen; Tsuno, Soshi; Tsybychev, Dmitri; Tua, Alan; Tudorache, Alexandra; Tudorache, Valentina; Tuna, Alexander Naip; Tupputi, Salvatore; Turchikhin, Semen; Turecek, Daniel; Turk Cakir, Ilkay; Turra, Ruggero; Tuts, Michael; Tykhonov, Andrii; Tylmad, Maja; Tyndel, Mike; Uchida, Kirika; Ueda, Ikuo; Ueno, Ryuichi; Ughetto, Michael; Ugland, Maren; Uhlenbrock, Mathias; Ukegawa, Fumihiko; Unal, Guillaume; Undrus, Alexander; Unel, Gokhan; Ungaro, Francesca; Unno, Yoshinobu; Urbaniec, Dustin; Urquijo, Phillip; Usai, Giulio; Usanova, Anna; Vacavant, Laurent; Vacek, Vaclav; Vachon, Brigitte; Valencic, Nika; Valentinetti, Sara; Valero, Alberto; Valery, Loic; Valkar, Stefan; Valladolid Gallego, Eva; Vallecorsa, Sofia; Valls Ferrer, Juan Antonio; Van Berg, Richard; Van Der Deijl, Pieter; van der Geer, Rogier; van der Graaf, Harry; Van Der Leeuw, Robin; van der Ster, Daniel; van Eldik, Niels; van Gemmeren, Peter; Van Nieuwkoop, Jacobus; van Vulpen, Ivo; van Woerden, Marius Cornelis; Vanadia, Marco; Vandelli, Wainer; Vaniachine, Alexandre; Vankov, Peter; Vannucci, Francois; Vardanyan, Gagik; Vari, Riccardo; Varnes, Erich; Varol, Tulin; Varouchas, Dimitris; Vartapetian, Armen; Varvell, Kevin; Vassilakopoulos, Vassilios; Vazeille, Francois; Vazquez Schroeder, Tamara; Veatch, Jason; Veloso, Filipe; Veneziano, Stefano; Ventura, Andrea; Ventura, Daniel; Venturi, Manuela; Venturi, Nicola; Venturini, Alessio; Vercesi, Valerio; Verducci, Monica; Verkerke, Wouter; Vermeulen, Jos; Vest, Anja; Vetterli, Michel; Viazlo, Oleksandr; Vichou, Irene; Vickey, Trevor; Vickey Boeriu, Oana Elena; Viehhauser, Georg; Viel, Simon; Vigne, Ralph; Villa, Mauro; Villaplana Perez, Miguel; Vilucchi, Elisabetta; Vincter, Manuella; Vinogradov, Vladimir; Virzi, Joseph; Vitells, Ofer; Viti, Michele; Vivarelli, Iacopo; Vives Vaque, Francesc; Vlachos, Sotirios; Vladoiu, Dan; Vlasak, Michal; Vogel, Adrian; Vokac, Petr; Volpi, Guido; Volpi, Matteo; Volpini, Giovanni; von der Schmitt, Hans; von Radziewski, Holger; von Toerne, Eckhard; Vorobel, Vit; Vos, Marcel; Voss, Rudiger; Vossebeld, Joost; Vranjes, Nenad; Vranjes Milosavljevic, Marija; Vrba, Vaclav; Vreeswijk, Marcel; Vu Anh, Tuan; Vuillermet, Raphael; Vukotic, Ilija; Vykydal, Zdenek; Wagner, Wolfgang; Wagner, Peter; Wahrmund, Sebastian; Wakabayashi, Jun; Walch, Shannon; Walder, James; Walker, Rodney; Walkowiak, Wolfgang; Wall, Richard; Waller, Peter; Walsh, Brian; Wang, Chiho; Wang, Haichen; Wang, Hulin; Wang, Jike; Wang, Jin; Wang, Kuhan; Wang, Rui; Wang, Song-Ming; Wang, Tan; Wang, Xiaoxiao; Warburton, Andreas; Ward, Patricia; Wardrope, David Robert; Warsinsky, Markus; Washbrook, Andrew; Wasicki, Christoph; Watanabe, Ippei; Watkins, Peter; Watson, Alan; Watson, Ian; Watson, Miriam; Watts, Gordon; Watts, Stephen; Waugh, Anthony; Waugh, Ben; Webb, Samuel; Weber, Michele; Weber, Stefan Wolf; Webster, Jordan S; Weidberg, Anthony; Weigell, Philipp; Weingarten, Jens; Weiser, Christian; Weits, Hartger; Wells, Phillippa; Wenaus, Torre; Wendland, Dennis; Weng, Zhili; Wengler, Thorsten; Wenig, Siegfried; Wermes, Norbert; Werner, Matthias; Werner, Per; Wessels, Martin; Wetter, Jeffrey; Whalen, Kathleen; White, Andrew; White, Martin; White, Ryan; White, Sebastian; Whiteson, Daniel; Whittington, Denver; Wicke, Daniel; Wickens, Fred; Wiedenmann, Werner; Wielers, Monika; Wienemann, Peter; Wiglesworth, Craig; Wiik-Fuchs, Liv Antje Mari; Wijeratne, Peter Alexander; Wildauer, Andreas; Wildt, Martin Andre; Wilkens, Henric George; Will, Jonas Zacharias; Williams, Hugh; Williams, Sarah; Willis, William; Willocq, Stephane; Wilson, John; Wilson, Alan; Wingerter-Seez, Isabelle; Winkelmann, Stefan; Winklmeier, Frank; Wittgen, Matthias; Wittig, Tobias; Wittkowski, Josephine; Wollstadt, Simon Jakob; Wolter, Marcin Wladyslaw; Wolters, Helmut; Wong, Wei-Cheng; Wosiek, Barbara; Wotschack, Jorg; Woudstra, Martin; Wozniak, Krzysztof; Wraight, Kenneth; Wright, Michael; Wu, Sau Lan; Wu, Xin; Wu, Yusheng; Wulf, Evan; Wyatt, Terry Richard; Wynne, Benjamin; Xella, Stefania; Xiao, Meng; Xu, Chao; Xu, Da; Xu, Lailin; Yabsley, Bruce; Yacoob, Sahal; Yamada, Miho; Yamaguchi, Hiroshi; Yamaguchi, Yohei; Yamamoto, Akira; Yamamoto, Kyoko; Yamamoto, Shimpei; Yamamura, Taiki; Yamanaka, Takashi; Yamauchi, Katsuya; Yamazaki, Yuji; Yan, Zhen; Yang, Haijun; Yang, Hongtao; Yang, Un-Ki; Yang, Yi; Yanush, Serguei; Yao, Liwen; Yasu, Yoshiji; Yatsenko, Elena; Yau Wong, Kaven Henry; Ye, Jingbo; Ye, Shuwei; Yen, Andy L; Yildirim, Eda; Yilmaz, Metin; Yoosoofmiya, Reza; Yorita, Kohei; Yoshida, Rikutaro; Yoshihara, Keisuke; Young, Charles; Young, Christopher John; Youssef, Saul; Yu, David Ren-Hwa; Yu, Jaehoon; Yu, Jie; Yuan, Li; Yurkewicz, Adam; Zabinski, Bartlomiej; Zaidan, Remi; Zaitsev, Alexander; Zaman, Aungshuman; Zambito, Stefano; Zanello, Lucia; Zanzi, Daniele; Zaytsev, Alexander; Zeitnitz, Christian; Zeman, Martin; Zemla, Andrzej; Zengel, Keith; Zenin, Oleg; \\v{Z}eni\\v{s}, Tibor; Zerwas, Dirk; Zevi della Porta, Giovanni; Zhang, Dongliang; Zhang, Huaqiao; Zhang, Jinlong; Zhang, Lei; Zhang, Xueyao; Zhang, Zhiqing; Zhao, Zhengguo; Zhemchugov, Alexey; Zhong, Jiahang; Zhou, Bing; Zhou, Lei; Zhou, Ning; Zhu, Cheng Guang; Zhu, Hongbo; Zhu, Junjie; Zhu, Yingchun; Zhuang, Xuai; Zibell, Andre; Zieminska, Daria; Zimine, Nikolai; Zimmermann, Christoph; Zimmermann, Robert; Zimmermann, Simone; Zimmermann, Stephanie; Zinonos, Zinonas; Ziolkowski, Michael; Zitoun, Robert; Zobernig, Georg; Zoccoli, Antonio; zur Nedden, Martin; Zurzolo, Giovanni; Zutshi, Vishnu; Zwalinski, Lukasz


    The prompt and non-prompt production cross-sections for the $\\chi_{c1}$ and $\\chi_{c2}$ charmonium states are measured in $pp$ collisions at $\\sqrt{s}=7$ TeV with the ATLAS detector at the LHC using 4.5 fb-1 of integrated luminosity. The $\\chi_{c}$ states are reconstructed through the radiative decay $\\chi_{c}\\rightarrow J/\\psi\\,\\gamma$ (with $J/\\psi\\rightarrow\\mu^{+}\\mu^{-}$) where photons are reconstructed from $\\gamma\\rightarrow e^{+}e^{-}$ conversions. The production rate of the $\\chi_{c2}$ state relative to the $\\chi_{c1}$ state is measured for prompt and non-prompt $\\chi_{c}$ as a function of $J/\\psi$ transverse momentum. The prompt $\\chi_{c}$ cross-sections are combined with existing measurements of prompt $J/\\psi$ production to derive the fraction of prompt $J/\\psi$ produced in feed-down from $\\chi_{c}$ decays. The fractions of $\\chi_{c1}$ and $\\chi_{c2}$ produced in $b$-hadron decays are also measured. In addition to measurements of inclusive $\\chi_{c}$ production, the branching fraction ${\\cal B}(B^...

  4. Multistrange Meson-Baryon Dynamics and Resonance Generation (United States)

    Khemchandani, K. P.; Martínez Torres, A.; Hosaka, A.; Nagahiro, H.; Navarra, F. S.; Nielsen, M.


    In this talk I review our recent studies on meson-baryon systems with strangeness - 1 and - 2. The motivation of our works is to find resonances generated as a consequence of coupled channel meson-baryon interactions. The coupled channels are all meson-baryon systems formed by combining a pseudoscalar or a vector meson with an octet baryon such that the system has the strange quantum number equal to - 1 or - 2. The lowest order meson-baryon interaction amplitudes are obtained from Lagrangians based on the chiral and the hidden local symmetries related to the vector mesons working as the gauge bosons. These lowest order amplitudes are used as an input to solve the Bethe-Salpeter equation and a search for poles is made in the resulting amplitudes, in the complex plane. In case of systems with strangeness - 1, we find evidence for the existence of some hyperons such as: Λ(2000), Σ(1750), Σ(1940), Σ(2000). More recently, in the study of strangeness - 2 systems we have found two narrow resonances which can be related to Ξ (1690) and Ξ(2120). In this latter work, we have obtained the lowest order amplitudes relativistically as well as in the nonrelativistic approximation to solve the scattering equations. We find that the existence of the poles in the complex plane does not get affected by the computation of the scattering equation with the lowest order amplitudes obtained in the nonrelativistic approximation.

  5. Spectroscopy of pseudoscalar and vector mesons and their electroweak decays

    International Nuclear Information System (INIS)

    Ablakulov, Kh.


    Proceeding from the effective action of QCD for bilocal meson fields the formula for the action describing the spectroscopy of mesons and their electroweak decays is obtained. The numerical solutions of the Salpeter equation (SE) for the qq-bound state and the Schwinger-Dyson equation (SDE) for the quark phase function are obtained with potential as sum of the oscillator and Coulomb terms. It is shown that for the oscillator potential and current quark mass m 0 0 → γγ) are 3-4 times smaller than their experimentations. This discrepancy was not removed even choosing other shapes of the potential. In order to resolve this problem the modification of the SDE, which consists in introducing the additional terms that do not change asymptotical properties of solutions of this equation is proposed. Using such modification both constant fπ and Γ(π 0 → γγ) are reproduced on a good quantitative level. The new SE for vector mesons is proposed and its solution with potential mentioned above gives the mass spectra of these mesons. Considering the τ → ρν decay the representation for leptonic decay constant of ρ meson f π , which expresses via solutions of the SDE and the proposed SE with a given potential is obtained. It is shown that the proposed SE allows to describe both the spectroscopy of vector mesons and their leptonic decay constants on a satisfactory level in comparison with the experimental values. (author)

  6. Consumer Behaviour. Case: iPhone Ho Chi Minh City


    Tran, Thi Xuan Oanh


    The main aim of this thesis is to figure out the factors that have influenced consumer behaviour of young iPhone users in Ho Chi Minh City. In this study, the author draw a conclusion based on the data collected from the survey and proposed some feasible recommendations for Apple and other high-end smartphone companies to understand their consumers and enhance brand equity. For the secondary data, a variety of theories, including consumers’ characteristics, promotion and the decision mak...

  7. One implementation of the Chi Square Test with SPSS


    Tinoco Gómez, Oscar


    Chi Cuadrado illustrates the use of the statistical software SPSS applied to the test to prove independence between two variables. The application carries out in the evaluation of the impact generated in the educational page of the Faculty of Administrative Sciences of the National University Federico Villarreal in relation to the use of some of the tools of the technologies called of information and communication in the process of formation profesional. Se ilustra el uso del software esta...

  8. Solenoid-free plasma startup in NSTX using transient CHI

    International Nuclear Information System (INIS)

    Raman, R.; Jarboe, T.R.; Nelson, B.A.; Mueller, D.; Bell, M.G.; Bell, R.; Gates, D.; Gerhardt, S.; Hosea, J.; Kaita, R.; Kugel, H.; LeBlanc, B.; Menard, J.; Ono, M.; Paul, S.; Roquemore, L.; Maingi, R.; Maqueda, R.; Nagata, M.; Sabbagh, S.


    Experiments in NSTX have now demonstrated the coupling of toroidal plasmas produced by the technique of coaxial helicity injection (CHI) to inductive sustainment and ramp-up of the toroidal plasma current. In these discharges, the central Ohmic transformer was used to apply an inductive loop voltage to discharges with a toroidal current of about 100 kA created by CHI. The coupled discharges have ramped up to >700 kA and transitioned into an H-mode demonstrating compatibility of this startup method with conventional operation. The electron temperature in the coupled discharges reached over 800 eV and the resulting plasma had low inductance, which is preferred for long-pulse high-performance discharges. These results from NSTX in combination with the previously obtained record 160 kA non-inductively generated startup currents in an ST or tokamak in NSTX demonstrate that CHI is a viable solenoid-free plasma startup method for future STs and tokamaks.

  9. An Advanced Dictionary? Similarities and Differences between Duramazwi ReChiShona and Duramazwi Guru ReChiShona *

    Directory of Open Access Journals (Sweden)

    Emmanuel Chabata


    Full Text Available

    Abstract: In this article a comparative analysis of Duramazwi ReChiShona (DRC and Duramazwi Guru ReChiShona (DGC is made. Both DRC and DGC are monolingual Shona dictionaries compiled by a team of researchers under the African Languages Lexical (ALLEX Project, now the African Languages Research Institute (ALRI. During the compilation process, DRC was known as the General Shona Dictionary and DGC as the Advanced Shona Dictionary. A simple analysis of these titles shows that the dictionaries are similar in some ways and also different in others. The writer tries to show the ways in which DGC is regarded as a more advanced dictionary when compared to DRC. Although the argument of the article is mainly built on those differences which make DGC the more advanced, attention is also paid to the similarities between the dictionaries.


    Opsomming: 'n Gevorderde woordeboek? Ooreenkomste en verskille tussen Duramazwi ReChiShona en Duramazwi Guru ReChiShona. In hierdie artikel word 'n vergelykende ontleding van Duramazwi ReChiShona (DRC en Duramazwi Guru ReChiShona (DGC gemaak. Sowel die DRC en DGC is eentalige Sjonawoordeboeke, saamgestel deur ?n span navorsers by die African Languages Lexical (ALLEX Project, tans die African Languages Research Institute (ALRI. Gedurende die samestellingsproses was DRC bekend as die Algemene Sjonawoordeboek en DGC as die Gevorderde Sjonawoordeboek. 'n Eenvoudige ontleding van hierdie titels toon dat die woordeboeke op sommige maniere eenders en op ander ook verskillend is. Die skrywer probeer die maniere aantoon waarop DGC beskou word as 'n meer gevorderde woordeboek wanneer dit met DRC vergelyk word. Alhoewel die argument van die artikel hoofsaaklik gebou is op daardie verskille wat DGC die gevorderdste maak, word ook aandag gegee aan

  10. Transient Upper Crustal Tear Illuminated by the Chi Chi Earthquake: Results from Strain Inversions in the Luliao Region, Taiwan (United States)

    Lamont, E. A.; Lewis, J.; Byrne, T. B.; Crespi, J. M.; Rau, R.


    Modeling of earthquake focal mechanisms and coseismic GPS data from an area at the southern tip of the 1999 Chi Chi rupture suggests the existence of an evolving upper plate tear. The earthquakes occur in what we refer to as the Luliao seismic zone and define a steeply northeast-dipping tabular volume that extends from the surface to approximately 11 km. We find that the focal mechanisms from the six-month period following the 1999 Chi-Chi Earthquake yield best-fitting strain tensors that suggest the dominance of strike-slip faulting. Our strain inversions, using a micropolar continuum model, reveal orogen-perpendicular (NW-SE) minimum stretching (i.e., shortening) and orogen-parallel (NE-SW) maximum stretching. Additionally, our inversions indicate plane strain with positive, non-zero relative vorticity values, suggestive of counter-clockwise (map view) block rotations. Published coseismic GPS data provide additional evidence that this tabular volume of crust is the locus of strike-slip faulting accompanied by block rotation. Preliminary 2D strain inversions for GPS stations that span the inverted focal mechanisms reveal negative (counterclockwise) rotation values and principal strain axes that are generally consistent with our focal mechanism inversions. We interpret our findings to reflect an accommodation zone that is activated by differential westward expansion of the foreland fold and thrust belt. In particular, this zone separates an area of greater westward propagation near Taichung from an area of lesser propagation to the south near Chiayi. Differential expansion of the orogen appears to be influenced by an eastward pointing, lower-plate promontory south of the Sanyi-Puli seismic zone. Unlike the Luliao events, the Sanyi-Puli seismic zone extends from the near surface to approximately 30 km and we have interpreted it as a reactivated continental margin fracture zone inherited from South China Sea rifting. The lower-plate promontory is coincident with the

  11. On Decays of B Mesons to a Strange Meson and an Eta or Eta' Meson at Babar

    Energy Technology Data Exchange (ETDEWEB)

    Hirschauer, James Francis [Univ. of Colorado, Boulder, CO (United States)


    We describe studies of the decays of B mesons to final states ηK*(892), ηK*0(S-wave), ηK*2(1430), and η'K based on data collected with the BABAR detector at the PEP-II asymmetric-energy e+e- collier at the Stanford Linear Accelerator Center. We measure branching fractions and charge asymmetries for the decays B → ηK*, where K* indicates a spin 0, 1, or 2 Kπ system, making first observations of decays to final states ηK0*0(S-wave), ηK+*0 (S-wave), and ηK0*2(1430). We measure the time-dependent CP-violation parameters S and C for the decays B0 → η'K0, observing CP violation in a charmless B decay with 5σ significance considering both statistical and systematic uncertainties.

  12. High-energy behavior of fermion-meson and meson-meson scattering in a supersymmetric field theory

    International Nuclear Information System (INIS)

    Opoien, J.W.


    The high-energy behavior of fermion-boson and boson-boson scattering amplitudes of a supersymmetric field theory containing a spin-1/2 fermion field, a scalar field, and a pseudoscalar field is investigated. The results can be easily modified to apply to the Yukawa model and the neutral version of the linear sigma model. The results are also compared to those of fermion-fermion scattering in the same model. In the leading-logarithm approximation, ladders with fermions running along the sides in the t channel and mesons as rungs dominate in each order of two classes of diagrams. The sum of the dominant series give rise to fixed Regge cuts for all amplitudes in each of the three theories. All amplitudes in the supersymmetric theory possess a definite signature factor, while the amplitudes for fermion-fermion and fermion-antifermion scattering in the Y model and the sigma model lack it. The results of the supersymmetric theory are also compared to the results of the spontaneously broken non-Abelian gauge theory

  13. {eta} meson photoproduction on deuterium; Photoproduction du meson {eta} sur le deuterium

    Energy Technology Data Exchange (ETDEWEB)

    Hoffmann-Rothe, P.


    Measurements of the total and differential cross sections for {eta}-meson photoproduction on a D{sub 2} liquid target from threshold to 1.2 GeV, have been taken using the tagged Bremsstrahlung photon beam produced by the electrons extracted from the ELSA storage ring at Bonn. The reaction was identified by detecting the eta decay products in the neutral meson spectrometer SPES0-2{pi}, while the recoil baryons (proton, neutron or deuteron) were detected by a variety of large angle scintillator detectors. We succeeded to identify completely the final states corresponding to the production of an {eta} meson on a Quasi-Free (QF) proton, a QF neutron and the coherent deuteron. The differential cross sections corresponding to the production of a coherent deuteron n the final state have been measured, from threshold to 800 MeV; they are 6 times smaller the only previous measurement reported by Anderson and Prepost in 1969. This is consistent with an Isoscalar part of the Amplitude much smaller than the Isovector one. The differential cross sections are in good agreement with the theoretical prediction on the impulse approximation mechanism; indicating in particular, fairly small contributions from rescattering terms. A direct measurement of the neutron to proton cross section ratios has been obtained by integrating the counting rates on the corresponding QF peaks and is 0.70 {+-} 0.03, from 700 MeV to 900 MeV, with a small angular dependence. These two results by comparison to the measured free proton data should allow to reconstruct the free neutron cross sections in a rather model-independent way. (authors). 56 refs., 90 figs., 13 tabs.

  14. Hadroproduction of the {chi}{sub 1} and {chi}{sub 2} states of charmonium in 800-GeV/c proton-silicon interactions

    Energy Technology Data Exchange (ETDEWEB)

    Alexopoulos, T. [University of Wisconsin, Madison, Wisconsin 53706 (United States); Antoniazzi, L. [University and INFN of Pavia, I-27100 Pavia, (Italy); Arenton, M. [University of Virginia, Charlottesville, Virginia 22901 (United States); Ballagh, H. C. [University of California at Berkeley, Berkeley, California 94720 (United States); Bingham, H. [University of California at Berkeley, Berkeley, California 94720 (United States); Blankman, A. [University of Pennsylvania, Philadelphia, Pennsylvania 19104 (United States); Block, M. [Northwestern University, Evanston, Illinois 60208 (United States); Boden, A. [University of California at Los Angeles, Los Angeles, California 90024 (United States); Bonomi, G. [University and INFN of Pavia, I-27100 Pavia, (Italy); Cao, Z. L. [University of Virginia, Charlottesville, Virginia 22901 (United States)] (and others)


    The cross sections for the hadroproduction of the {chi}{sub 1} and {chi}{sub 2} states of charmonium in proton-silicon collisions at {radical}(s)=38.8 GeV have been measured in Fermilab fixed target experiment 771. The {chi} states were observed via their radiative decay to J/{psi}{gamma}, where the photon converted to e{sup +}e{sup -} in the material of the spectrometer. The estimated values for the {chi}{sub 1} and {chi}{sub 2} cross sections for x{sub F}>0 are 263{+-}69(stat){+-}32(syst) and 498{+-}143(stat){+-}67(syst) nb per nucleon, respectively. The resulting {sigma}({chi}{sub 1})/{sigma}({chi}{sub 2}) ratio of 0.53{+-}0.20(stat){+-}0.07(syst), although somewhat larger than most theoretical expectations, can be accommodated by the latest theoretical estimates. (c) 2000 The American Physical Society.

  15. Formation des etats $\\chi_1$ et $\\chi_2$ du charmonium dans l'annihilation $p\\bar{p}$ aux ISR


    Fay , J.


    Un des buts de l'expérience R704 est l'étude des états $\\chi_1$ et $\\chi_2$ du charmonium $(c\\bar{c)}$ dans leur annihilation J/$\\psi$ + photon. Ces états sont formés par interaction d'un jet moléculaire d'hydrogène sur un faisceau refroidi d'antiprotons. L'importance du bruit de fond hadronique conduit à ne s'intéresser qu'aux états finaux électromagnétiques. L'appareillage de détection est essentiellement constitué de deux bras symétriques non magnétiques en deux parties. La première s'inté...

  16. Coseismic Deformation of Chi-Chi Earthquake as Detected by Differential Synthetic Aperture Radar Interferometry and GPS Data

    Directory of Open Access Journals (Sweden)

    Chia-Sheng Hsieh Tian-Yuan Shih


    Full Text Available A rupture in the Chelungpu fault caused an Mw 7.6 earthquake on 21 September 1999 near Chi-Chi in central Taiwan. This earthquake was the most destructive experienced in Taiwan for the past century along this fault. In this study, we examined the earthquake-induced surface deformation pattern using differential synthetic aperture radar interferometry (D-InSAR combined with global positioning system (GPS data regarding the footwall of the Chelungpu fault. Six synthetic aperture radar (SAR scenes, approximately 100 × 100 km each, recorded by the European Remote Sensing Satellite 2 (ERS-2, spanning the rupture area, were selected for study. The data were used to generate a high-resolution, wide-area map of displacements in flat or semi-flat areas. Interferograms show radar line contours indicating line-of-sight (LOS changes corresponding to surface displacements caused by earthquake ruptures. These results were compared to synthetic interferograms generated from GPS data. Displacements shown by GPS data were interpolated onto wide-area maps and transformed to coincide with the radar LOS direction. The resulting coseismic displacement contour map showed a lobed pattern consistent with the precise GPSbased displacement field. Highly accurate vertical displacement was determined using D-InSAR data using the coordinate transform method, while GPS data was effective in showing the horizontal component. Thus, this study confirmed the effectiveness of the D-InSAR method for determining the coseismic deformation caused by the Chi-Chi earthquake at the footwall of the Chelungpu fault.

  17. A unitarized meson model including color Coulomb interaction

    International Nuclear Information System (INIS)

    Metzger, Kees.


    Ch. 1 gives a general introduction into the problem field of the thesis. It discusses in how far the internal structure of mesons is understood theoretically and which models exist. It discusses from a phenomenological point of view the problem of confinement indicates how quark models of mesons may provide insight in this phenomenon. In ch. 2 the formal theory of scattering in a system with confinement is given. It is shown how a coupled channel (CC) description and the work of other authors fit into this general framework. Explicit examples and arguments are given to support the CC treatment of such a system. In ch. 3 the full coupled-channel model as is employed in this thesis is presented. On the basis of arguments from the former chapters and the observed regularities in the experimental data, the choices underlying the model are supported. In this model confinement is described with a mass-dependent harmonic-oscillator potential and the presence of open (meson-meson) channels plays an essential role. In ch. 4 the unitarized model is applied to light scalar meson resonances. In this regime the contribution of the open channels is considerable. It is demonstrated that the model parameters as used for the description of the pseudo-scalar and vector mesons, unchanged can be used for the description of these mesons. Ch. 5 treats the color-Coulomb interaction. There the effect of the Coulomb interaction is studied in simple models without decay. The results of incorporating the color-Coulomb interaction into the full CC model are given in ch.6. Ch. 7 discusses the results of the previous chapters and the present status of the model. (author). 182 refs.; 16 figs.; 33 tabs

  18. Properties of the ρ meson in dense nuclear matter

    International Nuclear Information System (INIS)

    Herrmann, M.


    In order to reach a description of the ρ meson, which is in accordance with the principles of the gauge invariance of the electromagnetic interaction, the vector-dominance hypothesis, and the unitarity a model for the ρ meson in the vacuum is developed. Thereafter follows the calculation of the properties of the ρ meson in nuclear matter. First the connection between the spectral function of the ρ meson and the dilepton production rate for an equilibrium state is derived. Then the model for the pion in nuclear matter is described. Following approximations are applied: The description of the pion-baryon interaction pursues non-relativistically and both the width of the delta resonance and the short-range repulsive delta-nucleon interaction is neglected. The self-energy of the ρ meson in nuclear matter following from this description is formally derived from the requirement to couple the ρ meson to a conserved current. The corrections for the 3-point and 4-point vertex resulting from this are calculated and discussed. Thereafter the physical consequences of the changed self-energy of the ρ meson in nuclear matter are considered. By means of the spectral function it is shown that up to the two-fold of the ground-state density the position of the resonance is nearly not changed. At still higher densities the resonances is a little shifted to higher energies. In the range of an invariant mass of about 400 meV a strong increasement concentrated on a small range results. This is caused by coupling to a naked delta-hole state and a pion. Finally the possibilities are discussed to apply the results of this thesis to the prediction of experimental data. Thereby it is proved to be necessary to base on a simulation of the heavy ion reaction. (orig./HSI) [de

  19. Study of light mesons with WASA-at-COSY (United States)

    Prencipe, Elisabetta


    The WASA detector, operating at the COSY facility in Jülich (Germany) has been collecting data since 2007. The experiment allows to perform studies of light mesons, such as π0, η and ω rare decay processes, in order to perform precise measurements of branching ratios, determine Dalitz plot parameters, test symmetry and symmetry breaking, and evaluate transition form factors. In the experiments a proton or deuteron beam impinged on a pellet target of hydrogen or deuterium, which allows the reactions proton-proton (pp) or proton-deuteron (pd). A high-statistics sample of η mesons has been collected: in the reaction pd →3He η, 3×107η mesons were tagged at a beam energy of 1.0 GeV, while 5×108η mesons were produced in the reaction pp → ppη at 1.4 GeV. This corresponds to the production of 10 η/s and 100 η/s, respectively, for the two reaction processes. In the pp dataset a higher background level is found compared to the pd data set. In both cases, we identify the η mesons by means of the missing mass derived from the recoil particles. A kinematic fit largely rejects the background in our analysis. The advantage in using the pp dataset is that the production of η mesons is almost a factor of 10 higher than in the pd fusion to 3He. As we plan to measure the branching ratios of very rare processes, high statistics is needed. A summary of the recent activity on the study of light mesons with WASA-at-COSY here is given.

  20. Study of light mesons with WASA-at-COSY

    Directory of Open Access Journals (Sweden)

    Prencipe Elisabetta


    Full Text Available The WASA detector, operating at the COSY facility in Jülich (Germany has been collecting data since 2007. The experiment allows to perform studies of light mesons, such as π0, η and ω rare decay processes, in order to perform precise measurements of branching ratios, determine Dalitz plot parameters, test symmetry and symmetry breaking, and evaluate transition form factors. In the experiments a proton or deuteron beam impinged on a pellet target of hydrogen or deuterium, which allows the reactions proton-proton (pp or proton-deuteron (pd. A high-statistics sample of η mesons has been collected: in the reaction pd →3He η, 3×107η mesons were tagged at a beam energy of 1.0 GeV, while 5×108η mesons were produced in the reaction pp → ppη at 1.4 GeV. This corresponds to the production of 10 η/s and 100 η/s, respectively, for the two reaction processes. In the pp dataset a higher background level is found compared to the pd data set. In both cases, we identify the η mesons by means of the missing mass derived from the recoil particles. A kinematic fit largely rejects the background in our analysis. The advantage in using the pp dataset is that the production of η mesons is almost a factor of 10 higher than in the pd fusion to 3He. As we plan to measure the branching ratios of very rare processes, high statistics is needed. A summary of the recent activity on the study of light mesons with WASA-at-COSY here is given.

  1. Form factors of heavy mesons in QCD

    Energy Technology Data Exchange (ETDEWEB)

    Shifman, M A; Vysotsky, M I [Moskovskii Inst. Theoreticheskoj i Ehksperimental' noj Fiziki (USSR)


    We discuss logarithmic corrections to form factors of mesons built from heavy quarks. The reactions e/sup +/e/sup -/ ..-->.. etasub(c)..gamma.. and H ..-->.. J/psi..gamma.. are considered as an example. A novel feature as compared to the well-studied problem of the pion form factor is the existence of transitions between the quark-antiquark state canti c and the gluonic one. O(..cap alpha..sub(s)) corrections are calculated exactly. An infinite series of the leading logarithmic terms (..cap alpha..sub(s)ln(Q/sup 2//m/sup 2/sub(c)))sup(n) is summed up with the help of the operator technique. Apart from results already known for quark operators, we use some new results referring to gluon operator and their mixing with those made from quarks. Two alternative derivations of the multiplicatively renormalizable operators are given. The first one reduces to a direct computation of the mixing matrix and its diagonalization, the second is based on conformal symmetry considerations.

  2. Rare decays of B-mesons

    International Nuclear Information System (INIS)

    Ali, A.


    This article is dedicated to the memory of Andrei D. Sakharov, a great scientist and human rights activist. Sakharov was blessed with the rare gift of prophetic prediction in matters concerning both science and society. His paper in 1967 on the baryon asymmetry of the universe relating it to the baryon instability, CP-violation, and thermodynamic non-equilibrium, was a very long shot. In view of subsequent theoretical developments in grand unified theories of elementary particle physics and cosmology, where the Sakharov conditions can be accommodated, this paper represents indeed a very fine example of scientific genius and prophecy. His political judgement, exemplified by his visionary essay Progress, Coexistence, and Intellectual Freedom, written in 1968, was equally stunning. Among other topics Sakharov was also very much interested in physics of the heavy quarks. In this paper we review theoretical predictions about an interesting aspect of heavy quark physics, namely rare phenomena in the decays of B-meson involving flavor changing neutral current (FCNC) processes

  3. Highlights of meson spectroscopy: an experimental overview

    International Nuclear Information System (INIS)

    Gianotti, Paola


    Quantum Chromodynamics is the theory of the strong interaction, but the properties of hadrons cannot be directly calculated from the QCD Lagrangian. Alternative approaches are then used: Lattice QCD, Effective Field Theories, Quark Models. To test these different approaches, precise measurements of hadron properties are needed. This is the main motivation of the hadron spectroscopy program carried out since many years with different probes in different environments. Recently, the majority of the new results have been obtained using e + e - colliders by experiments like BaBar, Belle, BES, CLEO. These, on one hand, have determined big progresses in the field, while, on the other hand, have discovered a large number of states with properties that cannot be easily and exhaustively explained by any theory. In this review, I will make an excursus through the recent experimental results in the meson spectroscopy sector, showing which are the best successes of the theory, and pointing out where we have still some problems. Hints on future perspectives, offered by the forthcoming experimental programs, will be also given.

  4. Photoproduction of Mesons off Light Nuclei

    International Nuclear Information System (INIS)

    Keshelashvili, Irakli


    During the last few years, a series of experiments has been done at the ELSA accelerator in Bonn with the Crystal Barrel/TAPS setup and at the MAMI accelerator in Mainz with the Crystal Ball/TAPS setup. Photoproduction of light mesons off the deuteron and 3 He-nuclei has been studied in detail. We will report some of the most interesting results.A completely unexpected finding, is the pronounced structure in the excitation function of the γn → nη reaction around 1 GeV, which has no counterpart for the proton. Recent measurements at GRAAL, Sendai, ELSA [1] and MAMI estimate it's width below 50 MeV, which would be extremely narrow for a nucleon resonance at this excitation energy. In the experiment with the 3 He target, special attention was given to the threshold behavior of the γHe 3 reactions in view of possible indications for the formation of (quasi-)bound η-nucleus states, so-called η-mesic nuclei. A very strong threshold enhancement of coherent η-photoproduction off 3 He was found. In a new experiment, this reaction was measured with much better statistical accuracy compared to an earlier experiment at MAMI-B using the TAPS detector [2].

  5. New results on mesons containing strange quarks

    International Nuclear Information System (INIS)

    Aston, D.; Awaji, N.; Bienz, T.


    Recent results of strange and strangeonium mesons are presented. The data come from a high sensitivity study (4.1 ev/nb) of K - p interactions at 11 GeV/c using the LASS spectrometer at SLAC. The complete leading orbitally-excited K* series up through J/sup P/ = 5 - and a substantial number of the expected underlying states are observed decaying into K - π + , anti K 3 0 π + π - , and K eta final states, and new measurements are made of their masses, widths, and branching ratios. Production of strangeonium states via hypercharge exchange is observed into K 3 0 K 3 0 , K - K + , and K 3 0 K +- π -+ final states. The leading orbitally-excited phi series through J/sup P/ = 3 - is clearly seen and evidence is presented for additional high spin structure in the 2.2 GeV/c 2 region. No f 2 (1720) is observed. The K 3 0 K +- π -+ spectrum is dominated by 1 + (K* anti K + anti K* K) production in the region below 1.6 GeV/c 2 . These results are compared with data on the same systems produced by different production mechanisms. 12 refs., 28 figs

  6. Radiative decays of B mesons at LHCb

    CERN Document Server

    Soomro, Fatima; Golutvin, Andrei


    This thesis is dedicated to the study of radiative decays of $B$ mesons at LHC$b$. At quark level, such decays are a $b\\to s\\gamma$ transition and take place via a penguin loop and are sensitive to virtual contribution of New Physics, which can be indicated by an increase in the decay rates. These decays also offer the possibility to test the V-A structure of the Standard Model coupling in the processes mediated by loop penguin diagrams. In the decay $B_s \\to \\phi\\gamma$, New Physics contribution can be probed by measuring the polarization of the photon in this decay. Systematic effects in the proper time reconstruction of the $B_s$ in $B_s \\to \\phi\\gamma$ can bias the photon polarization measurement in this decay, which will reduce the sensitivity on the relevant New Physics parameter. The author studied those effects and developed ideas to calibrate them using $B_d\\to K^{*}\\gamma$ and $B_s\\to J/\\psi\\phi$ decays as control channels. These studies are mostly Monte Carlo based due to a relatively small data ...

  7. Analysis of orbitally excited B-mesons

    CERN Document Server

    Albrecht, Zoltan; Quast, Gunter


    This thesis reports on the study of orbitally excited B** mesons in DELPHI b-events taken in the years 1994 to 2000 with the DELPHI detector at the LEP collider. The analyses presented represent the result of applying much improved and extended techniques of spectroscopy since the first DELPHI publication in 1995. A major improvement has occurred in the area of particle identification, where a neural network approach has been implemented in the DELPHI software package. Developments in the area of neural networks have led to much improved enrichment of the excited B states. The Bˆ{**} neural networks identify, on a track-by-track basis, the decay pion/kaon originating from the Bˆ{**} decay, suppressing background and keeping signal events in an efficient way. To improve detector resolution, a further application of neural networks has been applied to reconstruct the underlying Q-value. The corresponding network gives a correction on existing measurements of the Q-value in the form of a probability density fu...

  8. Phi meson production in pion proton interaction

    International Nuclear Information System (INIS)

    Makdisi, Y.I.


    The production of the phi meson and its decay mode into K + K - was investigated in a π - p → phi n reaction using a double arm effective mass spectrometer. Multiwire proportional chambers were deployed as particle detectors and a magnet provided momentum identification. Total cross sections were measured to be 18.5 +- 6, 24.1 +- 7, 25.1 +- 8.2 and 21.3 +- 7 μb for pion beam momenta of 1.6, 1.7, 1.8, and 2.0 GeV√c respectively and an upper limit of 15 μb was set for the 2.2 GeV/c point. These results coupled with other experiments done at higher energies show a strong energy dependence for this production process. Differential cross sections dsigma/dΩ were measured and cos THETA distributions in the center of mass system were consistent with isotropic production implying a flat differential cross section with respect to t. Although the statistics were quite an improvement on previous data they did not permit a thorough investigation of the decay density matrix elements. However, decay angular distributions in the Gottfried-Jackson frame were also presented

  9. Recent status of meson spectroscopy experiment

    International Nuclear Information System (INIS)

    Tsuru, Tsuneaki


    Recent meson spectroscopy experiments are reviewed centering on glueballs and it is insisted as follows. Something may lie near 750 MeV. Scalar glueball at 750 - 1000 MeV should be studied. The G(1590) is to be investigated. Multiquark states need to be studied to establish the scalar nonet. We have some tensor glueball candidates, θ, 3 g T 's and ζ, which are to be further examined. Pseudoscalar states include many interesting physics. Some puzzles were solved. However, many problems remain unsolved and new puzzles appeared. Whether the E and l are the same state or not, and whether the E/l is a glueball or not are the major interests at present. Systematical experimental and theoretical works are required. In an experimental field, radial excitations, especially a radial excitation of η', should be confirmed. In general higher statistics data are necessary to perform a complete partial wave analysis. A 1 ++ isoscalar member, a partner of D(1280), is missing and required to be confirmed as soon as possible. A confirmation of this state will serve to solve the E/l puzzle. The state will be probably an (santi s) state. 1 +- H', a partner of H(1190), is required to be confirmed. Multiquark states are to be investigated. ''Oddballs'' are to be challenged. Recent experiments require high statistics data enough to perform a model-independent partial wave analysis. The (qanti q) - (gg) mixing and hybrids are to be further studied in experimental and theoretical fields. (Nogami, K.)

  10. Decays of mesons containing heavy quarks

    International Nuclear Information System (INIS)

    Jagannathan, K.


    We find that the spectator model fails to describe the non-leptonic decays satisfactorily because the hadronization of the two quark-antiquark pairs in the final state is not treated properly. A final state q anti q pair, in this model, can be in both color-singlet and color-octet states; however a color-octet q anti q state cannot evolve into ordinary (color-singlet) hadrons without exchanging color with the other color-octet q anti q pair. Such interactions are ignored in the usual treatment. We propose an alternative model - called the color singlet model - where we consider the final state to be made up of jets of only color-singlet (q anti q) states, and the interactions leading to this configuration are described by an effective Hamiltonian. In our model, any final state of the type anti q 1 q 2 anti q 3 q 4 will form two different color-singlet jet configurations vis. (anti q 1 q 2 )(anti q 3 q 4 )(anti q 1 q 4 )(anti q 3 q 2 ). We show that these considerations lead naturally to a difference in the lifetimes of the D 0 and D - mesons. An alternative model discussed in the literature for explaining the difference in D 0 and D + lifetimes is also outlined and a critical account of the differences in the predictions of the two models is presented

  11. Bc meson weak decays and CP violation

    International Nuclear Information System (INIS)

    Liu, J.; Chao, K.


    The form factors for B c transitions are calculated with a relativistic constituent quark model based on the Bethe-Salpeter formalism. The rates for some semileptonic and nonleptonic B c weak decays and CP-violating asymmetries for two-body hardonic B c decays are estimated as well. The calculated widths are compared with those predicted in other quark models of mesons. For the most promising signatures for the discovery of B c : B c →ψlν→(l '+ l '- )lν and B c →ψπ→(l '+ l '- )π (with l ' =e or μ), the combined branching ratios are, respectively, estimated to be 1.06x10 -3 and 4.8a 1 2 x10 -5 for τ B c =0.5 ps and as large as 2.56x10 -3 and 1.15a 1 2 x10 -4 for τ B c =1.2 ps. There are large CP-violating effects in some B c decay modes, and the rates for some of these (e.g., B c →ψD * ,η c D, and η c D * , etc.) are large too. copyright 1997 The American Physical Society

  12. Electromagnetic Studies of Mesons, Nucleons, and Nuclei

    Energy Technology Data Exchange (ETDEWEB)

    Baker, Oliver K.


    Professor Baker was a faculty member at Hampton University in Hampton, Virginia, and, jointly, a Staff Physicist at Jefferson Lab in nearby Newport News from September 1989 to July 2006. The Department of Energy (DOE) funded the grant DE-FG02-97ER41035 Electromagnetic Studies of Mesons, Nucleons, and Nuclei, while Baker was in this joint appointment. Baker sent a closeout report on these activities to Hampton University’s Sponsored Research Office some years ago, shortly after joining Yale University in 2006. In the period around 2001, the research grant with Baker as the Principal Investigator (PI) was put under the supervision of Professor Liguang Tang at Hampton University. Baker continued to pursue the research while in this join appointment, however the administrative responsibilities with the DOE and with Hampton University rested with Professor Tang after 2001, to my recollection. What is written in this document is from Baker’s memory of the research activities, which he has not pursued since joining the Yale University faculty.

  13. Search for quasi bound η mesons

    International Nuclear Information System (INIS)

    Machner, H


    The search for a quasi bound η meson in atomic nuclei is reviewed. This tentative state is studied theoretically as well as experimentally. The theory starts from elastic η nucleon scattering which is derived from production data within some models. From this interaction the η nucleus interaction is derived. Model calculations predict binding energies and widths of the quasi bound state. Another method is to derive the η nucleus interaction from excitation functions of η production experiments. The s wave interaction is extracted from such data via final state interaction (FSI) theorem. We give the derivation of s wave amplitudes in partial wave expansion and in helicity amplitudes and their relation to observables. Different experiments extracting the FSI are discussed as are production experiments. So far only three experiments give evidence for the existence of the quasi bound state: a pion double charge exchange experiment, an effective mass measurement, and a transfer reaction at recoil free kinematics with observation of the decay of the state. (topical review)

  14. Determination of the D mesons lifetimes

    International Nuclear Information System (INIS)

    Josa Mutuberria, M.I.


    The results from the experiment NA27, performed in the North Area of the Super Proton Synchrotron at CERN are presented. The experimental set up was the small, high resolution, rapid cyling bubble chamber LEBC coupled with the European Hybrid Spectrometer (EHS). More than 2 millions pictures were taken, with 1015000 in teractions in hydrogen. The stastistical sensitivity of the experiment was 38.5 events/μb. A clean sample of 700 charm particle decays was obtained. Estimators with minimal systematic and statistical errors are developed for the determination of the lifetimes of short-lived particles whose individual momenta are unknown. These estimators make use of the measured decay lengths and the a priori known production characteristics. In this way, it is possible to include identified but not fully reconstructed charm decays in the sample to determine their lifetime. The properties of these estimators were extensively studied by means of Montecarlo simulation. The detection of the short-lived particles through the impact parameter of their charged decay products leads to additional complications which are taken into account. The biases and statistical errors inherent in using simpler approximate lifetime estimators are also discussed. These estimators are applied to determine the lifetime of the D o and D +- mesons using the charm data sample from NA27. (Author)

  15. Precision for B-meson matrix elements

    International Nuclear Information System (INIS)

    Guazzini, D.; Sommer, R.; Tantalo, N.


    We demonstrate how HQET and the Step Scaling Method for B-physics, pioneered by the Tor Vergata group, can be combined to reach a further improved precision. The observables considered are the mass of the b-quark and the B s -meson decay constant. The demonstration is carried out in quenched lattice QCD. We start from a small volume, where one can use a standard O(a)-improved relativistic action for the b-quark, and compute two step scaling functions which relate the observables to the large volume ones. In all steps we extrapolate to the continuum limit, separately in HQET and in QCD for masses below m b . The physical point m b is then reached by an interpolation of the continuum results in 1/m. The essential, expected and verified, feature is that the step scaling functions have a weak mass-dependence resulting in an easy interpolation to the physical point. With r 0 =0.5 fm and the experimental B s and K masses as input, we find F B s =191(6) MeV and the renormalization group invariant mass M b =6.88(10) GeV, translating into anti m b (anti m b )=4.42(6) GeV in the MS scheme. This approach seems very promising for full QCD. (orig.)

  16. Heavy mesons spectroscopy and new quarks

    International Nuclear Information System (INIS)

    Carvalho, H.F. de.


    The spectroscopy of new heavy mesons with masses above 2.8 GeV in the context of the asymptoticallty free gauge theories is analysed. To this end a power -law confinement potential is chosen. It is shown that the charmonium spectroscopy is best described by a potential where the exponent is around 0.5. It is observed that the spin-spin interaction is problematic. A possible interpretation of the γ resonances in the neighbourhood of 10 GeV is also discussed. The possible consequences of the existence of heavy quarks beyond charm with special reference to the processes initiated by neutral currents is also discussed. The present results on processes initiated by neutral current effects does not require introduction of right-handed heavy quarks beyond charm. Inclusion of the sea-quark contribution improves the agreements of the results of the Salam-Weinberg model with the recently observed results from CERN where 'ν anomaly' was not seen. The recently discovered γ resonances probably indicate the existence of heavy quarks probably with left handed coupling. Some preliminary study of this possibility was also carried out. (Author) [pt

  17. Relative rates of B meson decays into psi(2S) and J/psi mesons


    Abazov, V. M.; Abbott, B.; Abolins, M.; Acharya, B. S.; Adams, M.; Adams, T.; Aguilo, E.; Ahn, S. H.; Ahsan, M.; Alexeev, G. D.; Alkhazov, G.; Alton, A.; Alverson, G.; Alves, G. A.; Anastasoaie, M.


    We report on a study of the relative rates of B meson decays into ψ(2S) and J/ψ mesons using 1.3  fb-1 of pp̅ collisions at √s=1.96  TeV recorded by the D0 detector operating at the Fermilab Tevatron Collider. We observe the channels Bs0→ψ(2S)ϕ, Bs0→J/ψϕ, B±→ψ(2S)K±, and B±→J/ψK± and we measure the relative branching fractions for these channels to be B(Bs0→ψ(2S)ϕ)/B(Bs0→J/ψϕ)=0.53±0.10(stat)±0.07(syst)±0.06(B), B(B±→ψ(2S)K±)/B(B±→J/ψK±)=0.63±0.05(stat)±0.03(syst)±0.07(B),where the final erro...

  18. Investigation of Semileptonic {ital B} Meson Decays to {ital p} -Wave Charm Mesons

    Energy Technology Data Exchange (ETDEWEB)

    Anastassov, A.; Duboscq, J.E.; Fujino, D.; Gan, K.K.; Hart, T.; Honscheid, K.; Kagan, H.; Kass, R.; Lee, J.; Spencer, M.B.; Sung, M.; Undrus, A.; Wanke, R.; Wolf, A.; Zoeller, M.M. [Ohio State University, Columbus, Ohio 43210 (United States); Nemati, B.; Richichi, S.J.; Ross, W.R.; Skubic, P. [University of Oklahoma, Norman, Oklahoma 73019 (United States); Bishai, M.; Fast, J.; Hinson, J.W.; Menon, N.; Miller, D.H.; Shibata, E.I.; Shipsey, I.P.; Yurko, M. [Purdue University, West Lafayette, Indiana 47907 (United States); Glenn, S.; Johnson, S.D.; Kwon, Y.; Roberts, S.; Thorndike, E.H. [University of Rochester, Rochester, New York 14627 (United States); Jessop, C.P.; Lingel, K.; Marsiske, H.; Perl, M.L.; Savinov, V.; Ugolini, D.; Wang, R.; Zhou, X. [Stanford Linear Accelerator Center, Stanford University, Stanford, California 94309 (United States); Coan, T.E.; Fadeyev, V.; Korolkov, I.; Maravin, Y.; Narsky, I.; Shelkov, V.; Staeck, J.; Stroynowski, R.; Volobouev, I.; Ye, J. [Southern Methodist University, Dallas, Texas 75275 (United States); Artuso, M.; Efimov, A.; Goldberg, M.; He, D.; Kopp, S.; Moneti, G.C.; Mountain, R.; Schuh, S.; Skwarnicki, T.; Stone, S.; Viehhauser, G.; Xing, X. [Syracuse University, Syracuse, New York 13244 (United States); Bartelt, J.; Csorna, S.E.; Jain, V.; McLean, K.W.; Marka, S. [Vanderbilt University, Nashville, Tennessee 37235 (United States); Godang, R.; Kinoshita, K.; Lai, I.C.; Pomianowski, P.; Schrenk, S. [Virginia Polytechnic Institute and State University, Blacksburg, Virginia 24061 (United States); Bonvicini, G.; Cinabro, D.; Greene, R.; Perera, L.P.; Zhou, G.J. [Wayne State University, Detroit, Michigan 48202 (United States); Barish, B.; Chadha, M.; Chan, S.; Eigen, G.; Miller, J.S.; OGrady, C.; Schmidtler, M.; Urheim, J.; Weinstein, A.J.; Wuerthwein, F. [California Institute of Technology, Pasadena, California 91125 (United States); Bliss, D.W.; Masek, G.; Paar, H.P.; Prell, S.; Sharma, V. and others


    We have studied semileptonic B meson decays with a p -wave charm meson in the final state using 3.29{times}10{sup 6} B{ovr B} events collected with the CLEOII detector at the Cornell Electron-Positron Storage Ring. We find a value for the exclusive semileptonic product branching fraction B(B{sup {minus}}{r_arrow}D{sup 0}{sub 1} {ell}{sup {minus}}{ovr {nu}}{sub {ell}}) B(D{sup 0}{sub 1}{r_arrow}D{sup {asterisk}+} {pi}{sup {minus}})=(0.373{plus_minus}0.085{plus_minus} 0.052{plus_minus}0.024){percent} and an upper limit for B(B{sup {minus}}{r_arrow}D{sup {asterisk}0}{sub 2} {ell}{sup {minus}}{ovr {nu}}{sub {ell}}) B(D{sup {asterisk}0}{sub 2}{r_arrow}D{sup {asterisk}+ }{pi}{sup {minus}}){lt}0.16{percent} (90{percent} C.L.). Furthermore, we present the first measurement of the q{sup 2} spectrum for B{sup {minus}}{r_arrow}D{sup 0}{sub 1}{ell}{sup {minus}} {ovr {nu}}{sub {ell}} . {copyright} {ital 1998} {ital The American Physical Society}

  19. Identification of sigma and chi phases in duplex stainless steels

    Energy Technology Data Exchange (ETDEWEB)

    Llorca-Isern, Núria, E-mail: [Departament de Ciència dels Materials i Enginyeria Metallurgica, Facultat de Química, Universitat de Barcelona, Marti-Franqués 1, 08028 Barcelona (Spain); López-Luque, Héctor, E-mail: [Departament de Ciència dels Materials i Enginyeria Metallurgica, Facultat de Química, Universitat de Barcelona, Marti-Franqués 1, 08028 Barcelona (Spain); López-Jiménez, Isabel, E-mail: [Departament de Ciència dels Materials i Enginyeria Metallurgica, Facultat de Química, Universitat de Barcelona, Marti-Franqués 1, 08028 Barcelona (Spain); Biezma, Maria Victoria, E-mail: [Department of Earth, Materials Science and Engineering, University of Cantabria - UC, Gamazo, 1, 39004 Santander (Spain)


    The aim of this work is to find out the most suitable method for detecting and analyzing accurately the formation conditions of secondary phases, particularly Sigma-phase (σ-phase) and Chi-phase (χ-phase) in duplex stainless steels (UNS S32205 and UNS S32750). The microstructure was characterized after a solution annealing at 1080 °C followed by an isothermal heating at 830 °C for different time ranges, ranging from 1 min to 9 h, in order to enlighten the controversial point concerning the mechanism of χ-phase nucleation in relation with the σ-phase. Etched samples were observed using optical microscopy (MO), and scanning electron microscopy (FESEM) with a backscattered electron detector (BSE) was used on unetched samples. Compositional microanalysis (EDS) was carried out for identifying the different phases present in the steels. Sigma phase was easily observed using different etching procedures, whereas χ-phase was only clearly detected with FESEM–BSE on unetched samples. The compositional analyses showed that the molybdenum content in χ-phase almost doubles the content of this element in σ-phase, and as a result the kinetics of nucleation and growth were also found to be remarkably faster when the alloy content in the steel is higher. In addition, chromium nitrides and carbides were also observed to precipitate as a result of the heat treatments and, in the case of the chromium nitrides, they act as a favorable site for the nucleation of σ-phase and χ-phase. - Highlights: • Microscopy was used on heat treated duplex steels for microstructure identification. • FESEM–BSE observation on unetched samples provided the best contrast between phases. • Analyses of carbides, nitrides, chi and sigma phases were possible by EDS and WDS. • Chromium nitrides act as favorable site for the nucleation of chi and sigma phases. • Secondary phases nucleation kinetics are faster in superduplex than in duplex steels.

  20. chi2 analyses of data on relativistic anomalous projectile fragments

    International Nuclear Information System (INIS)

    MacGregor, M.H.


    Nuclear emulsion data from four experimental groups are now available on the interactions of p relativistic anomalous projectile fragments. In the present paper we systematically combine these data together to form several different data sets, which are used to carry out a series of chi 2 parameter studies. The anomalous particle fragment component in the relativistic nuclear beam has been characterized previously in terms of the parameters f and lambda, where f is the anomalous particle fragment fraction in the secondary beam and lambda is the average anomalous particle fragment mean free path in the emulsion. We extend this result here by setting lambda = lambda 0 (2Z)/sup -beta/, where Z is the nuclear charge of the anomalous particle fragment, so that we can investigate the Z dependence of lambda. We also investigate isotopic effects in the equations used to describe ''normal'' secondary beam nuclei, and we examine the problem of optimizing the bin sizes used to represent the data. A series of (f,lambda 0 ,#betta#) parameter studies leads to the conclusion that the ''anomalous particle fragment effect'' exists for all Z values in the range Z = 3--26 included in the chi 2 analyses. These chi 2 analyses also indicate that #betta#>0, so that the anomalous particle fragment lambda's are Z dependent, but the data are not sufficient to pin down a definite value of #betta#. In order to assess the physical content of these results, we define a domain within which nuclear mean free paths can be accounted for by conventional nuclear forces (but not necessarily by conventional nuclear structure). The Z-dependent anomalous particle fragment mean free paths lie approximately on the boundary of this domain

  1. Hybrid mesons (Q anti Qg) in N anti N annihilation

    International Nuclear Information System (INIS)

    Dover, C.B.; Gutsche, T.; Faessler, A.


    N anti N annihilation reactions provide exciting possibilities to study mesonic resonances beyond the usual Q anti Q spectrum. Particularly the search for Q anti Qg mesons containing an explicit dynamical excitation of the gluon field is not promising, since hybrids are predicted to display unique features: exotic quantum numbers (J πC ) and dynamical selection rules for their decay modes. The authors have investigated the possibility of producing hybrids from p anti p atomic states in reactions of the type N anti N(L= 0,1) → π + Q anti Qg. Production rates for hybrid mesons are found to display a strong dependence on the quantum numbers and kinematical factors associated with the transition. The dependence on the orbital angular momentum L of the p anti p atomic state, accessible in p anti p annihilation at rest, would provide a striking signature for the production of hybrids. In estimating branching ratios for the formation of Q anti Qg hybrid mesons in N anti N annihilation reactions at rest, the authors have employed a microscopic model with constituent quarks and gluons in analogy to the annihilation model for the production of Q anti Q mesons

  2. Recent results on D meson decays from the MARK III

    International Nuclear Information System (INIS)

    Coward, D.H.


    The MARK III Collaboration recently completed the analysis of a number of decay modes of charged and neutral D mesons produced in electron-positron collisions near the peak of the psi(3770) resonance at SLAC's SPEAR storage ring. The mesons were produced nearly at rest in pairs, either D + D - or D 0 anti D 0 , at a center-of-mass energy below the threshold for DD production. The unique kinematics of the production allow us to isolate the charmed meson signal clearly and unambiguously. The data were collected with the MARK III Spectrometer, a large solid angle magnetic detector. Our data sample corresponds to an integrated luminosity of approximately 9.3 inverse picobarns. New results will be presented on the absolute branching ratios of D mesons into hadronic final states, branching ratios for three body decays via pseudoscalar-vector intermediate states, and branching ratios for Cabibbo allowed and Cabibbo suppressed decays. Inclusive and exclusive branching ratios for the semi-leptonic decays of D mesons will be presented, as well as the first measurement of the vector form factor in the decay D 0 → K - e + nu, evidence for interference in D + decays, and new information on the contributions of W exchange diagrams to D 0 decays

  3. DS Mesons in Asymmetric Hot and Dense Hadronic Matter

    Directory of Open Access Journals (Sweden)

    Divakar Pathak


    Full Text Available The in-medium properties of DS mesons are investigated within the framework of an effective hadronic model, which is a generalization of a chiral SU(3 model, to SU(4, in order to study the interactions of the charmed hadrons. In the present work, the DS mesons are observed to experience net attractive interactions in a dense hadronic medium, hence reducing the masses of the DS+ and DS- mesons from the vacuum values. While this conclusion holds in both nuclear and hyperonic media, the magnitude of the mass drop is observed to intensify with the inclusion of strangeness in the medium. Additionally, in hyperonic medium, the mass degeneracy of the DS mesons is observed to be broken, due to opposite signs of the Weinberg-Tomozawa interaction term in the Lagrangian density. Along with the magnitude of the mass drops, the mass splitting between DS+ and DS- mesons is also observed to grow with an increase in baryonic density and strangeness content of the medium. However, all medium effects analyzed are found to be weakly dependent on isospin asymmetry and temperature. We discuss the possible implications emanating from this analysis, which are all expected to make a significant difference to observables in heavy ion collision experiments, especially the upcoming Compressed Baryonic Matter (CBM experiment at the future Facility for Antiproton and Ion Research (FAIR, GSI, where matter at high baryonic densities is planned to be produced.

  4. Magnetic monopole interactions: shell structure of meson and baryon states

    International Nuclear Information System (INIS)

    Akers, D.


    It is suggested that a low-mass magnetic monopole of Dirac charge g = (137/2)e may be interacting with a c-quark's magnetic dipole moment to produce Zeeman splitting of meson states. The mass M 0 = 2397 MeV of the monopole is in contrast to the 10 16 -GeV monopoles of grand unification theories (GUT). It is shown that shell structure of energy E/sub n/ = M 0 + 1/4nM 0 ... exists for meson states. The presence of symmetric meson states leads to the identification of the shell structure. The possible existence of the 2397-MeV magnetic monopole is shown to quantize quark masses in agreement with calculations of quantum chromodynamics (QCD). From the shell structure of meson states, the existence of two new mesons is predicted: eta(1814 +/- 50 MeV) with I/sup G/(J/sup PC/) = 0 + (0 -+ ) and eta/sub c/ (3907 +/- 100 MeV) with J/sup PC/ = 0 -+ . The presence of shell structure for baryon states is shown

  5. Scalar meson field and many-body forces. Chapter 23

    International Nuclear Information System (INIS)

    Nyman, E.M.


    In applications of field theory to the theory of the nuclear forces, one has frequently assumed that there is a scalar meson. It will then be responsible for most of the medium-range attraction between the nucleons. According to current ideas, however, it is possible to account for the medium-range attraction without an elementary sigma meson. This approach requires a careful treatment of the exchange of interacting pairs of π mesons, such as to include those ππ interactions which are responsible for the formation and decay of the sigma meson. Recently, the scalar field in the nuclear many-body problem has begun to receive more attention. There are two reasons for this change of philosophy. One reason is the discovery of neutron stars. In neutron stars, the nucleon number density can be much higher than in nuclei. One therefore wants to derive the equation of state from a relativistic many-body theory. This forces one to deal explicitly with a set of mesons, such that in the non-relativistic limit one recovers the one-boson-exchange potential. (Auth.)

  6. Rapidity resummation for B-meson wave functions

    Directory of Open Access Journals (Sweden)

    Shen Yue-Long


    Full Text Available Transverse-momentum dependent (TMD hadronic wave functions develop light-cone divergences under QCD corrections, which are commonly regularized by the rapidity ζ of gauge vector defining the non-light-like Wilson lines. The yielding rapidity logarithms from infrared enhancement need to be resummed for both hadronic wave functions and short-distance functions, to achieve scheme-independent calculations of physical quantities. We briefly review the recent progress on the rapidity resummation for B-meson wave functions which are the key ingredients of TMD factorization formulae for radiative-leptonic, semi-leptonic and non-leptonic B-meson decays. The crucial observation is that rapidity resummation induces a strong suppression of B-meson wave functions at small light-quark momentum, strengthening the applicability of TMD factorization in exclusive B-meson decays. The phenomenological consequence of rapidity-resummation improved B-meson wave functions is further discussed in the context of B → π transition form factors at large hadronic recoil.

  7. Properties of rho and eta mesons in nuclear matter

    International Nuclear Information System (INIS)

    Herrmann, M.; Sauermann, C.; Friman, B.L.; Technische Hochschule Darmstadt; Noerenberg, W.; Technische Hochschule Darmstadt


    The properties of ρ- and η-mesons in nuclear matter are studied within the scope of hadronic models. Unknown model parameters are obtained from fits to scattering data. - The treatment of the ρ-meson includes the coupling to two pions which, in matter, are strongly mixed with delta-particle-nucleon-hole states. The ρ-meson self-energy is evaluated in a current conserving approximation with in-medium pion propagators and vertex corrections. While the position of the original peak in the spectral function remains almost unchanged, its width grows rapidly with increasing density. Consequently, the ρ-meson strength function is strongly dispersed at high densities. Due to vertex corrections a new peak at a mass around 3m π emerges with increasing density, while the spectral function around the two-pion threshold is found to be smooth at all densities. The η-meson is strongly mixed with N * (1535)-particle-nucleon-hole states in nuclear matter. The corresponding dispersion relations with an upper and a lower branch look similar to those of the (π, ΔN -1 )-modes. However, since the N * is an S-wave resonance in the ηN-channel, the repulsion of the two branches survives at zero momentum. (orig.)

  8. Molecular components in P-wave charmed-strange mesons

    CERN Document Server

    Ortega, Pablo G.


    Results obtained by various experiments show that the $D_{s0}^{\\ast}(2317)$ and $D_{s1}(2460)$ mesons are very narrow states located below the $DK$ and $D^{\\ast}K$ thresholds, respectively. This is markedly in contrast with the expectations of naive quark models and heavy quark symmetry. Motivated by a recent lattice study which addresses the mass shifts of the $c\\bar{s}$ ground states with quantum numbers $J^{P}=0^{+}$ ($D_{s0}^{\\ast}(2317)$) and $J^{P}=1^{+}$ ($D_{s1}(2460)$) due to their coupling with $S$-wave $D^{(\\ast)}K$ thresholds, we perform a similar analysis within a nonrelativistic constituent quark model in which quark-antiquark and meson-meson degrees of freedom are incorporated. The quark model has been applied to a wide range of hadronic observables and thus the model parameters are completely constrained. The coupling between quark-antiquark and meson-meson Fock components is done using a modified version of the $^{3}P_{0}$ decay model. We observe that the coupling of the $0^{+}$ $(1^{+})$ mes...

  9. CHI '13 Extended Abstracts on Human Factors in Computing Systems

    DEFF Research Database (Denmark)

    also deeply appreciate the huge amount of time donated to this process by the 211-member program committee, who paid their own way to attend the face-to-face program committee meeting, an event larger than the average ACM conference. We are proud of the work of the CHI 2013 program committee and hope...... a tremendous amount of work from all areas of the human-computer interaction community. As co-chairs of the process, we are amazed at the ability of the community to organize itself to accomplish this task. We would like to thank the 2680 individual reviewers for their careful consideration of these papers. We...

  10. Decay properties of charm and bottom mesons in a quantum isotonic nonlinear oscillator potential model

    Energy Technology Data Exchange (ETDEWEB)

    Rahmani, S.; Hassanabadi, H. [Shahrood University of Technology, Physics Department, Shahrood (Iran, Islamic Republic of)


    Employing generalized quantum isotonic oscillator potential we determine wave function for mesonic system in nonrelativistic formalism. Then we investigate branching ratios of leptonic decays for heavy-light mesons including a charm quark. Next, by applying the Isgur-Wise function we obtain branching ratios of semileptonic decays for mesons including a bottom quark. The weak decay of the B{sub c} meson is also analyzed to study the life time. Comparison with other available theoretical approaches is presented. (orig.)

  11. Ground reaction force characteristics of Tai Chi push hand. (United States)

    Chang, Yao-Ting; Chang, Jia-Hao; Huang, Chen-Fu


    Push Hand is an advanced training technique for the Yang-style old frame 108 forms Tai Chi Chuan. It is performed by two practitioners. To clarify how people use forces during Push Hand training, it is important to review the ground reaction force (GRF). Here, we quantify the characteristics of the GRF during Push Hand training. Kinematic data and GRF data from 10 Tai Chi Chuan practitioners (29.9 ± 7.87 years) were synchronously recorded using a three-dimensional motion analysis system (200 frames · s(-1)) and three-dimensional force plates (1000 Hz). The resultant GRF for both feet for the 0%, 50% and 100% phases of attack and defence were compared to body weight using a paired-samples t-test. The differences in the resultant GRF between the 0%, 50% and 100% phases of attack and defence were tested by one-way repeated-measures ANOVA. The significance level was set to 0.05. The total resultant GRF was almost equal to the participant's body weight in push hand. This result was consistent throughout the entire push hand process. Our results revealed that the GRF was comparable to the body weight, implying that practitioners do not push or resist their opponents during the push hand process.

  12. A phenomenological analysis of non-resonant charm meson decays

    International Nuclear Information System (INIS)

    Bediaga, I.; Goebel, C.; Mendez-Galain, R.


    We analyse the consequences of the usual assumption of a constant function to fit non-resonant decays from experimental Dalitz plot describing charmed meson decays. We first show, using the D + -> K 0 π + π 0 decay channel as an example, how an inadequate extraction of the non-resonant contribution could yield incorrect measurements for the resonant channels. We analyse how the correct study of this decay will provide a test for the validity of factorization in D meson decays. Finally, we show how form factors that can be measured from the D + s -> π - π + π + decay. We emphasize its relevance for the study of the decay τ -> v t 3π and the extraction of the α 1 meson width. (author)

  13. A phenomenological analysis of non-resonant charm meson decays

    Energy Technology Data Exchange (ETDEWEB)

    Bediaga, I.; Goebel, C. [Centro Brasileiro de Pesquisas Fisicas (CBPF), Rio de Janeiro, RJ (Brazil); Mendez-Galain, R. [Montevideo Univ. (Uruguay). Facultad de Ingenieria


    We analyse the consequences of the usual assumption of a constant function to fit non-resonant decays from experimental Dalitz plot describing charmed meson decays. We first show, using the D{sup +} -> K{sup 0} {pi}{sup +} {pi}{sup 0} decay channel as an example, how an inadequate extraction of the non-resonant contribution could yield incorrect measurements for the resonant channels. We analyse how the correct study of this decay will provide a test for the validity of factorization in D meson decays. Finally, we show how form factors that can be measured from the D{sup +}{sub s} -> {pi}{sup -} {pi}{sup +} {pi}{sup +} decay. We emphasize its relevance for the study of the decay {tau} -> v{sub t} 3{pi} and the extraction of the {alpha}{sub 1} meson width. (author) 26 refs., 6 figs.

  14. Quasi two-body decays of D0 meson

    International Nuclear Information System (INIS)

    Terasaki, K.; Oneda, S.


    Quasi two-body decays of D 0 -meson are studied from an algebraic approach, using a hard meson extrapolation. In this innovation of old current algebra with new perspective, a reasonable unified description of K sub(S) → 2π and D 0 → K-barπ decays has been obtained previously, keeping only the contribution of ground state mesons to the now surviving surface term. In this paper, it is shown that quasi two-body decays can also be accomodated reasonably well in the same scheme. A distinctive feature of our result is that GAMMA(D 0 → phi K-bar 0 ) is sizable, while D 0 → rho 0 K-bar 0 is relatively suppressed. (author)

  15. A survey of E/iota meson in hadroproduction

    International Nuclear Information System (INIS)

    Chung, S.U.


    The E(1420) meson has been around with us since 1963, when its observation was first reported by R. Armenteros et al. With the discovery of the iota(1460) in the same decay channel from J/ψ radiative decays in 1980, there has been a resurgence of interest in this meson because it may turn out to be a pseudoscalar glueball. This review covers the E/iota states seen in hadroproduction, while an update of the iota meson from J/ψ radiative decays is covered by D. Hitlin in this volume. The present review represents an updated version of the previous reviews given by the author at Lund, Leipzig, and Santander

  16. Mesonic and baryonic Regge trajectories with quantized masses

    International Nuclear Information System (INIS)

    Hothi, N.; Bisht, S.


    We have constructed some Regge trajectories for mesons and baryons by taking the 70 MeV spinless mass quanta as the ultimate building block for the light hadrons. In order to make masses integral multiples of seventy, small changes in masses has been made with due explanation. We have shown how a linear relationship between J and M 2 is maintained by considering quantized hadron masses, which is a direct consequence of the string model and gives a strong clue for quark confinement. It has also been established that mesons and baryons have different slopes and the slopes of baryons is less than the slope of the mesons. This clearly defies the concept of universality of slopes (α ≅ 1.1 GeV 2 ) of hadrons, which can only be achieved if the strings joining the quarks have constant string tension α 1/(2πω) (where ω is the string tension). (author)

  17. Exclusive semileptonic decays of charmed and b-flavored mesons

    International Nuclear Information System (INIS)

    Barik, N.; Tripathy, S.K.; Kar, S.; Dash, P.C.


    We investigate the exclusive semileptonic decays of (B,B s ;D,D s ) mesons into less heavy as well as light mesons in a field-theoretic framework based on the independent quark model with a confining potential in scalar-vector-harmonic form. With the recoil effect properly taken into account, the present model describes consistently the semileptonic decays of charmed and b-flavored mesons, agreeing well with the experimental data. The transition form factors in the heavy to heavy decays, in particular, comply with the heavy quark symmetry relations expected from HQET. The CKM parameters extracted in this formalism are close to the existing data. The model prediction also satisfies the Isgur-Wise relation connecting the form factors of the semileptonic (B→ρeν) and that of rare radiative decay (B→ργ). copyright 1997 The American Physical Society

  18. General characteristics of Bc-mesons. Production mechanisms and decays

    International Nuclear Information System (INIS)

    Gershtein, S.S.; Likhoded, A.K.; Slabospitsky, S.R.


    Using Martin potential, independent of b- and c-quark flavour, the mass spectrum of B c (bc-bar)-mesons and widths of electromagnetic transition between them are calculated. The estimations of the production cross section at e + e - colliders, in hadronic and neutrino interactions are obtained. A real possibility to observed B c mesons at LEP and also at hadron colliders (σ(B c )/σ(bb-bar)∼10 -3 ) has been pointed out. The importance of observing the annihilation decay channels of B c -mesons: B c →τν τ (Br(B c →τν τ )=1.5-2%), and B c →ΦD s , B C →DK etc, has been emphasized. 25 refs.; 16 figs.; 5 tabs

  19. Zero sound velocity in π, ρ mesons at different temperatures

    International Nuclear Information System (INIS)

    Dey, J.; Dey, M.; Tomio, L.; Araujo, C.F. de Jr.


    Sharp transitions are perhaps absent in QCD, so that one looks for physical quantities which may reflect the phase change. One such quantity is the sound velocity which was shown in lattice theory to become zero at the transition point for pure glue. We show that even in a simple bag model the sound velocity goes to zero at temperature T=T ν ≠ 0 and that the numerical value of this T ν depends on the nature of the meson. The average thermal energy of mesons go linearly with T near T ν , with much smaller slope for the pion. The T ν - s can be connected with the Boltzmann temperatures obtained from transverse momentum spectrum of these mesons in heavy ion collision at mid-rapidity. It would be interesting to check the presence of different T ν - s in present day finite T lattice theory. (author). 22 refs, 1 fig., 2 tabs

  20. High statistics inclusive phi-meson production at SPS energies

    International Nuclear Information System (INIS)

    Dijkstra, H.B.


    This thesis describes an experiment studying the inclusive reaction hadron + Be → phi + anything → K + + K - + anything in 100 GeV/c, 120 GeV/c and 200 GeV/c hadron interactions. A total of 8x10 6 events were recorded using both positively and negatively charged unseparated hadron beams supplied by the CERN SPS. The experiment made use of an intelligent on-line event selection system based on micro-processors (FAMPs) in conjunction with a system of large MWPCs to increase the number of phi-events recorded per unit time. In 32 days of data taking over 600,000 phi-mesons were recorded onto magnetic tape. The physics motivation for collecting a large statistics sample of inclusive phi-mesons was the investigation of the inclusive phi-meson production mechanism and phi-spectroscopy. (Auth.)

  1. On exotic hybrid meson production in γ*γ collisions

    International Nuclear Information System (INIS)

    Anikin, I.V.; Teryaev, O.V.; Pire, B.; Szymanowski, L.; Universite de Liege; Paris-11 Univ., 91 - Orsay; Wallon, S.


    We present a theoretical study of exotic hybrid meson (J PC =1 -+ ) production in photon-photon collisions where one of the photons is deeply virtual, including twist two and twist three contributions. We calculate the cross section of this process, which turns out to be large enough to imply sizeable counting rates in the present high luminosity electron-positron colliders. We emphasize the importance of the πη decay channel for the detection of the hybrid meson candidate π 1 (1400) and calculate the cross section and the angular distribution for πη pair production in the unpolarized case. This angular distribution is a useful tool for disentangling the hybrid meson signal from the background. Finally, we calculate the single spin asymmetry associated with one initial longitudinally polarized lepton. (orig.)

  2. Charmless decays of the B-meson in perturbative QCD

    International Nuclear Information System (INIS)

    Libo Guo; Dongsheng Du; Lianshou Liu


    Using the perturbative QCD method and Chau's six-quark-graph scheme, we report a theoretical calculation of exclusive nonleptonic decays of the B meson into two light pseudoscalar mesons in the context of the low-energy effective Hamiltonian. The contributions from both tree-level and one-loop diagrams are taken into account. Under the approximation of neglecting light quark and light meson masses, we find that (i) within perturbative QCD there is no singularity which exists in the computation of spacelike penguin diagrams when the BSW model is used; (ii) the contributions from spacelike-type (W-annihilation, W-exchange, spacelike penguin and penguin-annihilation) graphs are strongly suppressed relative to those from timelike-type (external W-emission, internal W-emission and timelike penguin) ones; (iii) our results are well below the experimental upper limits but lower than the BSW ones. (author)

  3. Thermal Properties of Light Tensor Mesons via QCD Sum Rules

    Directory of Open Access Journals (Sweden)

    K. Azizi


    Full Text Available The thermal properties of f2(1270, a2(1320, and K2*(1430 light tensor mesons are investigated in the framework of QCD sum rules at finite temperature. In particular, the masses and decay constants of the light tensor mesons are calculated taking into account the new operators appearing at finite temperature. The numerical results show that, at the point at which the temperature-dependent continuum threshold vanishes, the decay constants decrease with amount of (70–85% compared to their vacuum values, while the masses diminish about (60–72% depending on the kinds of the mesons under consideration. The results obtained at zero temperature are in good consistency with the experimental data as well as the existing theoretical predictions.

  4. Measurement of the B+ and B0 meson lifetimes

    International Nuclear Information System (INIS)

    Abe, F.; Albrow, M.; Amidei, D.; Anway-Wiese, C.; Apollinari, G.; Areti, H.; Auchincloss, P.; Azfar, F.; Azzi, P.; Bacchetta, N.; Badgett, W.; Bailey, M.W.; Bao, J.; de Barbaro, P.; Barbaro-Galtieri, A.; Barnes, V.E.; Barnett, B.A.; Bartalini, P.; Bauer, G.; Baumann, T.; Bedeschi, F.; Behrends, S.; Belforte, S.; Bellettini, G.; Bellinger, J.; Benjamin, D.; Benlloch, J.; Benton, D.; Beretvas, A.; Berge, J.P.; Bertolucci, S.; Bhatti, A.; Biery, K.; Binkley, M.; Bird, F.; Bisello, D.; Blair, R.E.; Blocker, C.; Bodek, A.; Bolognesi, V.; Bortoletto, D.; Boswell, C.; Boulos, T.; Brandenburg, G.; Buckley-Geer, E.; Budd, H.S.; Burkett, K.; Busetto, G.; Byon-Wagner, A.; Byrum, K.L.; Campagnari, C.; Campbell, M.; Caner, A.; Carithers, W.; Carlsmith, D.; Castro, A.; Cen, Y.; Cervelli, F.; Chapman, J.; Chiarelli, G.; Chikamatsu, T.; Cihangir, S.; Clark, A.G.; Cobal, M.; Contreras, M.; Cooper, J.; Cordelli, M.; Coupal, D.P.; Crane, D.; Cunningham, J.D.; Daniels, T.; DeJongh, F.; Dell'Agnello, S.; Dell'Orso, M.; Demortier, L.; Denby, B.; Deninno, M.; Derwent, P.F.; Devlin, T.; Dickson, M.; Donati, S.; Done, J.P.; Drucker, R.B.; Dunn, A.; Einsweiler, K.; Elias, J.E.; Ely, R.; Engels, E. Jr.; Eno, S.; Errede, D.; Errede, S.; Etchegoyen, A.; Fan, Q.; Farhat, B.; Fiori, I.; Flaugher, B.; Foster, G.W.; Franklin, M.; Frautschi, M.; Freeman, J.; Friedman, J.; Frisch, H.; Fry, A.; Fuess, T.A.; Fukui, Y.; Funaki, S.; Gagliardi, G.; Gallinaro, M.; Garfinkel, A.F.; Geer, S.; Gerdes, D.W.; Giannetti, P.; Giokaris, N.; Giromini, P.; Gladney, L.; Glenzinski, D.; Gold, M.; Gonzalez, J.; Gordon, A.; Goshaw, A.T.; Goulianos, K.; Grassmann, H.; Grewal, A.; Grieco, G.; Groer, L.; Grosso-Pilcher, C.; Haber, C.; Hahn, S.R.; Hamilton, R.; Handler, R.; Hans, R.M.; Hara, K.; Harral, B.; Harris, R.M.; Hauger, S.A.; Hauser, J.; Hawk, C.; Heinrich, J.; Hennessy, D.; Hollebeek, R.; Holloway, L.; Hoelscher, A.; Hong, S.; Houk, G.; Hu, P.; Huffman, B.T.; Hughes, R.; Hurst, P.; Huston, J.; Huth, J.


    The lifetimes of the B + and B 0 mesons have been measured using fully reconstructed decays. In a sample of ∼49 600J/ψ→μ + μ - decays recorded with the Collider Detector at Fermilab, 148±16 B + and 121±16B 0 mesons have been reconstructed using the silicon vertex detector. Unbinned likelihood fits to the proper lifetime distributions of these B mesons give τ + =1.61±0.16 (stat)±0.05 (syst) ps, τ 0 =1.57±0.18 (stat) ±0.08 (syst) ps, and τ + /τ 0 =1.02±0.16 (stat) ±0.05 (syst)

  5. Color transparency in incoherent electroproduction of ρ mesons off nuclei

    International Nuclear Information System (INIS)

    Nemchik, J.; Kopeliovich, B. Z.; Potashnikova, I. K.


    Color transparency (CT) phenomena in elastic electroproduction of vector mesons off nuclei are usually infected by the onset of coherence length (CL) effects. However, at low energies corresponding to the CLAS experiment at Jefferson Lab (JLab), one can study practically the net CT effects, since CL is much shorter than the nuclear radius. We investigate various manifestations of CT effects using rigorous quantum mechanical approach based on the path integral technique. We include also the effects of ρ meson decay inside the nucleus leading to a rise of the nuclear suppression towards small values of Q 2 . Motivated by the last CLAS data we predict the A, Q 2 and l c dependence of nuclear transparency for ρ 0 mesons produced incoherently off nuclei. We also perform predictions for expected signal of CT corresponding to the planned JLab upgrade to 12 GeV electron beam.

  6. B meson physics with polarized electron beams at the SLC

    International Nuclear Information System (INIS)

    Atwood, W.B.


    The expected large cross-section for e + e - → Z 0 and subsequent decay to b/bar b/ quarks makes the Z 0 an attractive place to pursue B meson physics. In addition, the big Electroweak asymmetries, thought to exist in Z 0 decays to b/bar b/ quarks with polarized electron beams, provide an outstanding handle for observation of such effects as B 0 -/bar B/ 0 mixing. In this paper, the feasibility of such measurements is investigated and, with relatively small samples of Z 0 's (a few hundred thousand), both B/sub d/ and B/sub s/ meson mixing are shown to be measurable. The subject of CP violation in neutral B mesons is discussed last, but presently such measurements seem to be out of reach. 7 refs., 6 figs., 3 tabs

  7. Importance of Nonperturbative QCD Parameters for Bottom Mesons

    Directory of Open Access Journals (Sweden)

    A. Upadhyay


    Full Text Available The importance of nonperturbative quantum chromodynamics (QCD parameters is discussed in context to the predicting power for bottom meson masses and isospin splitting. In the framework of heavy quark effective theory, the work presented here focuses on the different allowed values of the two nonperturbative QCD parameters used in heavy quark effective theory formula, and using the best fitted parameter, masses of the excited bottom meson states in jp=1/2+ doublet in strange and nonstrange sectors are calculated here. The calculated masses are found to be matching well with experiments and other phenomenological models. The mass splitting and hyperfine splitting have also been analyzed for both strange and nonstrange heavy mesons with respect to spin and flavor symmetries.

  8. The QCD model of hadron cores of the meson theory

    International Nuclear Information System (INIS)

    Pokrovskii, Y.E.


    It was shown that in the previously proposed QCD model of hadron cores the exchange and self-energy contributions of the virtual quark-antiquark-gluon cloud on the outside of a bag which radius coincides with the hardon core radius of the meson theory (∼ 0.4 Fm) have been taken into account at the phenomenological level. Simulation of this cloud by the meson field results in realistic estimations of the nucleon's electroweak properties, moment fractions carried by gluons, quarks, antiquarks and hadron-hadron interaction cross-sections within a wide range of energies. The authors note that the QCD hadron core model proposed earlier not only realistically reflects the hadron masses, but reflects self-consistently main elements of the structure and interaction of hadrons at the quark-gluon bag radius (R - 0.4Fm) being close to the meson theory core radius

  9. Current status of high energy nucleon-meson transport code

    Energy Technology Data Exchange (ETDEWEB)

    Takada, Hiroshi; Sasa, Toshinobu [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment


    Current status of design code of accelerator (NMTC/JAERI code), outline of physical model and evaluation of accuracy of code were reported. To evaluate the nuclear performance of accelerator and strong spallation neutron origin, the nuclear reaction between high energy proton and target nuclide and behaviors of various produced particles are necessary. The nuclear design of spallation neutron system used a calculation code system connected the high energy nucleon{center_dot}meson transport code and the neutron{center_dot}photon transport code. NMTC/JAERI is described by the particle evaporation process under consideration of competition reaction of intranuclear cascade and fission process. Particle transport calculation was carried out for proton, neutron, {pi}- and {mu}-meson. To verify and improve accuracy of high energy nucleon-meson transport code, data of spallation and spallation neutron fragment by the integral experiment were collected. (S.Y.)

  10. Color transparency in incoherent electroproduction of {rho} mesons off nuclei

    Energy Technology Data Exchange (ETDEWEB)

    Nemchik, J. [Institute of Experimental Physics SAS, Watsonova 47, 04001 Kosice, Slovakia and Czech Technical University, FNSPE, Brehova 7, 11519 Praque (Czech Republic); Kopeliovich, B. Z.; Potashnikova, I. K. [Departamento de Fisica y Centro de Estudios Subatomicos, Universidad Tecnica Federico Santa Maria, Casilla 110-V, Valparaiso (Chile)


    Color transparency (CT) phenomena in elastic electroproduction of vector mesons off nuclei are usually infected by the onset of coherence length (CL) effects. However, at low energies corresponding to the CLAS experiment at Jefferson Lab (JLab), one can study practically the net CT effects, since CL is much shorter than the nuclear radius. We investigate various manifestations of CT effects using rigorous quantum mechanical approach based on the path integral technique. We include also the effects of {rho} meson decay inside the nucleus leading to a rise of the nuclear suppression towards small values of Q{sup 2}. Motivated by the last CLAS data we predict the A, Q{sup 2} and l{sub c} dependence of nuclear transparency for {rho}{sup 0} mesons produced incoherently off nuclei. We also perform predictions for expected signal of CT corresponding to the planned JLab upgrade to 12 GeV electron beam.

  11. Baryon and meson phenomenology in the extended Linear Sigma Model

    Energy Technology Data Exchange (ETDEWEB)

    Giacosa, Francesco; Habersetzer, Anja; Teilab, Khaled; Eshraim, Walaa; Divotgey, Florian; Olbrich, Lisa; Gallas, Susanna; Wolkanowski, Thomas; Janowski, Stanislaus; Heinz, Achim; Deinet, Werner; Rischke, Dirk H. [Institute for Theoretical Physics, J. W. Goethe University, Max-von-Laue-Str. 1, 60438 Frankfurt am Main (Germany); Kovacs, Peter; Wolf, Gyuri [Institute for Particle and Nuclear Physics, Wigner Research Center for Physics, Hungarian Academy of Sciences, H-1525 Budapest (Hungary); Parganlija, Denis [Institute for Theoretical Physics, Vienna University of Technology, Wiedner Hauptstr. 8-10, A-1040 Vienna (Austria)


    The vacuum phenomenology obtained within the so-called extended Linear Sigma Model (eLSM) is presented. The eLSM Lagrangian is constructed by including from the very beginning vector and axial-vector d.o.f., and by requiring dilatation invariance and chiral symmetry. After a general introduction of the approach, particular attention is devoted to the latest results. In the mesonic sector the strong decays of the scalar and the pseudoscalar glueballs, the weak decays of the tau lepton into vector and axial-vector mesons, and the description of masses and decays of charmed mesons are shown. In the baryonic sector the omega production in proton-proton scattering and the inclusion of baryons with strangeness are described.

  12. Proposal for the systematic naming of mesons and baryons

    International Nuclear Information System (INIS)

    Porter, F.C.; Hernandez, J.J.; Montanet, L.


    Twenty years ago, the Particle Data Group adopted a systematic naming convention for baryons: the symbols N, Δ, Λ, Σ, Ψ, and Ω were to identify the isospin and strangeness, The mesons, by contrast, have become an alphabet soup of uninformative names - theta, iota, xi, zeta, g/sub T/, g/sub s/, H, E, delta, h, g, r, kappa, etc. -, and in some cases identical names are used for mesons with different quantum numbers (A, B, and D). Furthermore, experimentalists are now discovering baryons that contain heavy quarks. It is therefore timely to consider systematic naming conventions both for mesons and for baryons with heavy quarks. The Particle Data Group is circulating this proposal in the hope of generating feedback, and we attach a sheet for responses. It should be emphasized that the Particle Tables would show both the old and new names for some time

  13. Vector mesons in meson-baryon scattering and large-N{sub c} quantum chromodynamics

    Energy Technology Data Exchange (ETDEWEB)

    Fuhrmann, Hans-Friedrich


    We examined strong interactions in the low-energy regime in terms of two complementary non-perturbative approaches: the interplay of large-N{sub c} QCD and chiral perturbation theory was studied. While the expansion in the parameter 1/N{sub c} is based on quark and gluon degrees of freedom, chiral perturbation theory uses hadrons as effective degrees of freedom. The focus of our work was the investigation of mesons and baryons composed from up-, down- and strange quarks. We used the chiral SU(3) Lagrangian with (J{sup P}=(1)/(2){sup +})- and (J{sup P}=(3)/(2){sup +})-baryon ground states as building blocks. In the SU(3)-flavour limit the latter form an octet and a decuplet, respectively. Studies in chiral perturbation theory hold a challenge: the chiral Lagrangian consists of an infinite number of terms. The treatment of low-energy QCD physics via a perturbation theory requires the ordering of these terms according to their relevance. We used the interplay between large-N{sub c} QCD and chiral perturbation theory to shed light on the structure of the chiral Lagrangian. In the limit of large-N{sub c} the low-energy parameters of the chiral Lagrangian are correlated. For instance the masses of the two baryon multiplets turn degenerate in the SU(3)-flavour limit. This serves as the starting point of our investigations. In this work we analysed the time-ordered product of two scalar and two vector currents in the baryon ground state. The examination of these matrix elements at large-N{sub c} was compared to corresponding results derived in chiral perturbation theory. From this we obtained sum rules for some low-energy parameters of the chiral Lagrangian. The results for the vector correlation function were used to constrain a phenomenological interaction of light vector mesons with the baryon ground states. In the second part of this thesis we addressed a formal problem which arises in a partial wave decomposition of reaction amplitudes for particles with non

  14. Vector mesons in meson-baryon scattering and large-N_c quantum chromodynamics

    International Nuclear Information System (INIS)

    Fuhrmann, Hans-Friedrich


    We examined strong interactions in the low-energy regime in terms of two complementary non-perturbative approaches: the interplay of large-N_c QCD and chiral perturbation theory was studied. While the expansion in the parameter 1/N_c is based on quark and gluon degrees of freedom, chiral perturbation theory uses hadrons as effective degrees of freedom. The focus of our work was the investigation of mesons and baryons composed from up-, down- and strange quarks. We used the chiral SU(3) Lagrangian with (J"P=(1)/(2)"+)- and (J"P=(3)/(2)"+)-baryon ground states as building blocks. In the SU(3)-flavour limit the latter form an octet and a decuplet, respectively. Studies in chiral perturbation theory hold a challenge: the chiral Lagrangian consists of an infinite number of terms. The treatment of low-energy QCD physics via a perturbation theory requires the ordering of these terms according to their relevance. We used the interplay between large-N_c QCD and chiral perturbation theory to shed light on the structure of the chiral Lagrangian. In the limit of large-N_c the low-energy parameters of the chiral Lagrangian are correlated. For instance the masses of the two baryon multiplets turn degenerate in the SU(3)-flavour limit. This serves as the starting point of our investigations. In this work we analysed the time-ordered product of two scalar and two vector currents in the baryon ground state. The examination of these matrix elements at large-N_c was compared to corresponding results derived in chiral perturbation theory. From this we obtained sum rules for some low-energy parameters of the chiral Lagrangian. The results for the vector correlation function were used to constrain a phenomenological interaction of light vector mesons with the baryon ground states. In the second part of this thesis we addressed a formal problem which arises in a partial wave decomposition of reaction amplitudes for particles with non-vanishing spin. In particular we considered the vector

  15. Observation of a New Narrow Axial-Vector Meson alpha(1)(1420)

    Czech Academy of Sciences Publication Activity Database

    Adolph, C.; Akhunzyanov, R.; Alexeev, M.; Alexeev, G. D.; Amoroso, A.; Andrieux, V.; Anosov, V.; Austregesilo, A.; Azevedo, C.; Badelek, B.; Balestra, F.; Barth, J.; Beck, R.; Bedfer, Y.; Bernhard, J.; Bicker, K.; Bielert, E. R.; Birsa, R.; Bisplinghoff, J.; Bodlák, M.; Boer, M.; Bordalo, P.; Bradamante, F.; Braun, C.; Bressan, A.; Büchele, M.; Burtin, E.; Chang, W.-C.; Chiosso, M.; Choi, I.; Chung, S. U.; Cicuttin, A.; Crespo, M.; Curiel, Q.; Dalla Torre, S.; Dasgupta, S. S.; Dasgupta, S.; Denisov, O.; Dhara, L.; Donskov, S. V.; Doshita, N.; Duic, V.; Dunnweber, W.; Dziewiecki, M.; Efremov, A.; Eversheim, P.D.; Eyrich, W.; Faessler, M.; Ferrero, A.; Finger, M.; Finger jr., M.; Fischer, H.; Franco, C.; Fresne von Hohenesche, N.; Friedrich, J. M.; Frolov, V.; Gautheron, F.; Gavrichtchouk, O. P.; Gerassimov, S.; Gnesi, I.; Gorzellik, M.; Grabmüller, S.; Grasso, A.; Grosse-Perdekapm, M.; Grube, B.; Grussenmeyer, T.; Guskov, A.; Haas, F.; von Harrach, D.; Hahne, D.; Hashimoto, R.; Heinsius, F. H.; Herrmann, E.; Hinterberger, F.; Horikawa, N.; d´Hose, N.; Hsieh, C.-Yu.; Huber, S.; Ishimoto, S.; Ivanov, A.; Ivanshin, Yu.; Iwata, T.; Jahn, R.; Jarý, V.; Jörg, P.; Joosten, R.; Kabuss, E.; Ketzer, B.; Khaustov, G. V.; Khokhlov, Yu. A.; Kisselev, Y.; Klein, F.; Klimaszewski, K.; Koivuniemi, J. H.; Kolosov, V. N.; Kondo, K.; Königsmann, K.; Konorov, I.; Konstantinov, V. F.; Kotzinian, A. M.; Kouznetsov, O.; Krämer, M.; Kremser, P.; Krinner, F.; Kroumchtein, Z. V.; Kuchinski, N.; Kunne, F.; Kurek, K.; Kurjata, R. P.; Lednev, A. A.; Lehmann, A.; Levillain, M.; Levorato, S.; Lichtenstadt, J.; Maggiora, A.; Magnon, A.; Makins, N.; Makke, N.; Mallot, G.; Marchand, C.; Martin, A.; Marzec, J.; Matoušek, J.; Matsuda, H.; Matsuda, T.; Meshcheryakov, G.; Meyer, W.; Michigami, T.; Mikhailov, Yu. V.; Miyachi, Y.; Nagaytsev, A.; Nagel, T.; Nerling, F.; Neyret, D.; Nikolaenko, V. I.; Nový, J.; Nowak, W. D.; Nunes, A.S.; Olshevsky, A. G.; Orlov, I.; Ostrick, M.; Panzieri, D.; Parsamyan, B.; Paul, S.; Peng, J.-C.; Pereira, F.; Pešek, M.; Peshekhonov, D. V.; Platchkov, S.; Pochodzalla, J.; Polyakov, V.; Pretz, J.; Quaresma, M.; Quintans, C.; Ramos, S.; Regali, C.; Reicherz, G.; Riedl, C.; Rocco, E.; Rossiyskaya, N. S.; Ryabchikov, D.; Rychter, A.; Samoylenko, V. D.; Sandacz, A.; Santos, C.; Sarkar, S.; Savin, I. A.; Sbrizzai, G.; Schiavon, P.; Schmeing, S.; Schmidt, K.; Schlüter, T.; Selyunin, A.; Schmieden, H.; Schönning, K.; Schopferer, S.; Shevchenko, O. Yu.; Silva, L.; Sinha, L.; Sirtl, S.; Slunecka, M.; Sozzi, F.; Srnka, Aleš; Stolarski, M.; Šulc, M.; Suzuki, H.; Szabelski, A.; Szameitat, T.; Sznajder, P.; Takekawa, S.; Ter Wolbeek, J.; Tessaro, S.; Tessarotto, F.; Thibaud, F.; Tskhay, V.; Uhl, S.; Veloso, J.; Virius, M.; Wallner, S.; Weisrock, T.; Wilfert, M.; Zaremba, K.; Zavertyaev, M.; Zemlyanichkina, E.; Ziembicki, M.; Zink, A.


    Roč. 115, č. 8 (2015), 082001:1-6 ISSN 0031-9007 R&D Projects: GA MŠk(CZ) LO1212 Institutional support: RVO:68081731 Keywords : COMPASS * pion-nucleon scattering * hadron spectroscopy * light-meson spectrum * axial-vector mesons * exotic mesons Subject RIV: BH - Optics, Masers, Lasers Impact factor: 7.645, year: 2015

  16. About direct CP violation in the system of K0 mesons

    International Nuclear Information System (INIS)

    Beshtoev, Kh.M.


    This work is devoted to computation of the parameter of direct CP violation by the weak interactions in the system of K 0 mesons at K 1 0 -, K 2 0 -meson mixings and oscillations via K S -, K L -meson states

  17. A lattice QCD calculation of the transverse decay constant of the b1(1235) meson

    International Nuclear Information System (INIS)

    Jansen, K.; McNeile, C.; Michael, C.; Urbach, C.


    We review various B meson decays that require knowledge of the transverse decay constant of the b 1 (1235) meson. We report on an exploratory lattice QCD calculation of the transverse decay constant of the b 1 meson. The lattice QCD calculations used unquenched gauge configurations, at two lattice spacings, generated with two flavours of sea quarks. The twisted mass formalism is used. (orig.)

  18. Vector mesons in reactions with colliding electron-positron beams

    International Nuclear Information System (INIS)

    Rekalo, M.P.; Gakh, G.I.


    Polarization phenomena in the processes of vector meson production in reactions with colliding electron-positron beams e + e - → V+X, where V is a vector meson, X is a nondetected set of particles are investigated. For the one-photon mechanism of the process, where V and X are hadrons, the mutually unambiguous correspondence between the structural functions is found. The dependence of the e + e - → VX differential cross section upon the electron and positron polarizations is calculated using the virtual photon density matrix in the helicity basis. This formalism permits to take explicitly into account the P-invariance consequences for the angular distribution of the V-meson decay products. For the processes e + e - → πA 1 , and e + e - → rho + rho - the structural functions are calculated in terms of the corresponding electromagnetic form factors. It is noted that six functions out ten real structural functions describing the e + e - → VX reaction can be determined by means of investigation of the angular distribution of the V-meson decay products which is produced in collisions of unpolarized leptons. To study the collision of polarized leptons one more structural function can be determined. The formation of the X system with definite values of parity and spin is characterized by seven structural functions, five of which can be found while studying the angular distribution of the V-meson decay products produced in e + e - collisions with unpolarized (polarized) particles. If the spin of the X state is 1, in experiments with polarized beams all structural functions can be determined while investigating the angular distribution of the V-meson decay products

  19. Evidence for the Production of Neutral Mesons by Photons

    CERN Document Server

    Steinberger, J; Panofsky, Wolfgang Kurt Hermann


    In the bombardment of nuclei by 330-Mev x-rays, multiple gamma-rays are emitted. From their angular correlation it is deduced that they are emitted in pairs in the disintegration of neutral particles moving with relativistic velocities and therefore of intermediate mass. The neutral mesons are produced with cross sections similar to those for the charged mesons and with an angular distribution peaked more in the forward direction. The production cross section in hydrogen and the production cross section per nucleon in C and Be are comparable.

  20. Charmed meson production and decay properties at the psi(3770)

    Energy Technology Data Exchange (ETDEWEB)


    A remeasurement of the resonance near E/sub cm/ = 3.77 GeV in the e/sup +/e/sup -/ annihilation is presented. The properties of the resonance are used to deduce branching fractions of charmed mesons into hadronic final states. Several previously unseen decay modes are reported. Decays into Cabibbo suppressed final states are observed. The inclusive properties of D meson decays are studied, including strangeness and charged particle multiplicity. The semileptonic branching fractions for D/sup 0/ and D/sup -+/ are measured, providing a determination of the relative lifetimes of these particles.

  1. Tensor force and debye screening in quarkonium-type mesons

    International Nuclear Information System (INIS)

    Kovacs, L.B.; Kovacs, T.G.; Lovas, I.


    We use a non-relativistic quantum-mechanical model to investigate the effect of a screening plasma on two quarkonium-type mesons: the charmonium and bottonium. The stability of these mesons in the plasma is estimated in two cases: including the tensor and spin-orbit term in the potential and without these terms. It turns out that while the bottonium is somewhat stabilized by the tensor force, the charmonium becomes less stabil due to this modification of the potential. Thus the charmonium seems to be a more sensitive probe of the quark-gluon plasma formation than it was thought to be without including the tensor force. (Authors)

  2. Analytic structure of ρ meson propagator at finite temperature

    International Nuclear Information System (INIS)

    Ghosh, Sabyasachi; Sarkar, Sourav; Mallik, S.


    We analyse the structure of one-loop self-energy graphs for the ρ meson in real time formulation of finite temperature field theory. We find the discontinuities of these graphs across the unitary and the Landau cuts. These contributions are identified with different sources of medium modification discussed in the literature. We also calculate numerically the imaginary and the real parts of the self-energies and construct the spectral function of the ρ meson, which are compared with an earlier determination. A significant contribution arises from the unitary cut of the πω loop, that was ignored so far in the literature. (orig.)

  3. Measurement of the inclusive decay properties of charmed mesons

    Energy Technology Data Exchange (ETDEWEB)

    Coffman, D; DeJongh, F; Dubois, G; Eigen, G; Hitlin, D G; Matthews, C G; Mincer, A; Richman, J D; Wisniewski, W J; Zhu, Y [California Inst. of Tech., Pasadena, CA (United States); Bai, Z; Burchell, M; Dorfan, D E; Drinkard, J D; Gatto, C; Heusch, C A; Lockman, W S; Partridge, R; Sadrozinski, H F.W.; Scarlatella, M; Schalk, T L; Seiden, A; Weinstein, A J; Weseler, S; Xu, R [Univ. of California, Santa Cruz, CA (United States); Brown, J S; Eisenstein, B I; Freese, T; Gladding, G; Izen, J M; Simopoulos, C; Stockdale, I E; Tripsas, B [Univ. of Illinois, Urbana-Champaign, IL (United States); Mallik, U; Wang, M Z [Univ. of Iowa, Iowa City, IA (United States); Bolten, T; Browder, T E; Bunnell, K O; Cassell, R E; Coward, D H; Dado, S; Grab, C; Kim, P C; Labs, J; Odian, A; Pitman, D; Schindler, R H; Toki, W; Villa, F; Wasserbaech, S; Wisinski, D [Stanford Linear Accelerator Center, Stanford Univ., CA (United States); Burnett, T H; Cook,; MARK III Collaboration


    We report a high statistics study of the inclusive decay properties of the charmed D{sup 0} and D{sup +} mesons, and the first inclusive study of the charmed D{sub s}{sup +}. The data are collected at {radical}s = 3.77 GeV and {radical}s = 4.14 GeV with the Mark III detector at the e{sup +}e{sup -} storage ring SPEAR. For each charmed meson species, the charged-particle multiplicity, the strangeness content of the final state, and the average {pi}{sup 0} multiplicity are determined. (orig.).

  4. Configurational entropy and ρ and ϕ mesons production in QCD (United States)

    Karapetyan, G.


    In the present work the electroproduction for diffractive ρ and ϕ mesons by considering AdS/QCD correspondence and Color Glass Condensate (CGC) approximation are studied with respect to the associated dipole cross section, whose parameters are studied and analysed in the framework of the configurational entropy. Our results suggest different quantum states of the nuclear matter, showing that the extremal points of the nuclear configurational entropy is able to reflect a true description of the ρ and ϕ mesons production, using current data concerning light quark masses. During the computations parameters, obtained in fitting procedure, coincide to the experimental within ∼ 0.1%.

  5. Phenomenological study of the isovector tensor meson family (United States)

    Pang, Cheng-Qun; He, Li-Ping; Liu, Xiang; Matsuki, Takayuki


    In this work, we study all the observed a2 states and group them into the a2 meson family, where their total and two-body Okubo-Zweig-Iizuka allowed strong decay partial widths are calculated via the quark pair creation model. Taking into account the present experimental data, we further give the corresponding phenomenological analysis, which is valuable to test whether each a2 state can be assigned into the a2 meson family. What is more important is that the prediction of their decay behaviors will be helpful for future experimental study of the a2 states.

  6. Nucleon quark structure and strong meson-nucleon form factors

    International Nuclear Information System (INIS)

    Efimov, G.V.; Ivanov, M.A.


    The nucleon is considered as a three-quark system in virton-quark model. The main statistic properties of proton and neutron are calculated: magnetic moments, electromagnetic radii, G A /G V ratio in weak neutron decay. Strong meson-nucleon form factors which determine nucleon-nucleon potential are obtained as a function of squared transfer momentum of mesons. The results are compared with phenomenological form factors used for description of phases of NN-scattering in the one-boson-, exchange model

  7. B-meson factories: Physics, machines and detectors

    International Nuclear Information System (INIS)

    Kolanoski, H.


    This report gives a short survey of the present status of B-meson factory plans and discussions at different laboratories. The physics motivation for an e + e - machine running with the highest possible luminosity in the Γ(4S) energy region is outlined emphasizing the possibility to observe CP violation in the B-meson system. The technical concepts for such machines together with the basic luminosity limitations are discussed. Finally, the requirements on a detector which is able to cover the rich physics program are presented. (orig.)

  8. The meson spectroscopy program with CLAS12 at Jefferson Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Rizzo, Alessandro [Univ. of Rome Tor Vergata (Italy)


    The study of the hadronic spectrum is one of the most powerful tools to investigate the mechanism at the basis of quark confinement within hadrons. A precise determination of the spectrum allows not only to assess the properties of the hadrons in their fundamental and excited states, but also to investigate the existence of states resulting from alternative configurations of quarks and gluons, such as the glue-balls, hybrid hadrons and many-quarks configurations. The study of the mesonic part of the spectrum can play a central role in this investigation thanks to the strong signature that the hybrid mesons are expected to have: the presence of explicit gluonic degrees of freedom in such states may result in JPC configurations not allowed for the standard q ¯ q states. From the experimental side the expected high-multiplicity decays of the hybrid mesons require an apparatus with high performances in terms of rate-capability, resolution and acceptance. The CLAS12 experiment (formally MesonEx) is one of new-generation experiments at Thomas Jefferson National Laboratory (JLAB) for which an unprecedented statistics of events, with fully reconstructed kinematics for large particle multiplicity decays, will be available. A wide scientific program that will start in 2016 has been deployed for meson spectrum investigation with the CLAS12 apparatus in Hall B at energies up to 11 GeV. One of the main parts of the program is based on the use of the Forward Tagger apparatus, which will allow CLAS12 experiment to extend the study of meson electro-production to the quasi-real photo-production kinematical region (very low Q2), where the production of hybrid mesons is expected to be favoured. The data analysis which is required to extract the signal from hybrid states should go beyond the standard partial wave analysis techniques and a new analysis framework is being set up through the international network Haspect. The Haspect Network gathers people involved into theoretical and

  9. Studies of phi meson radiative decays with KLOE

    International Nuclear Information System (INIS)

    Aloisio, A.; Ambrosino, F.; Antonelli, A.; Antonelli, M.; Bacci, C.; Bencivenni, G.; Bertolucci, S.; Bini, C.; Bloise, C.; Bocci, V.; Bossi, F.; Branchini, P.; Bulychjov, S.A.; Caloi, R.; Campana, P.; Capon, G.; Carboni, G.; Casarsa, M.; Casavola, V.; Cataldi, G.; Ceradini, F.; Cervelli, F.; Cevenini, F.; Chiefari, G.; Ciambrone, P.; Conetti, S.; De Lucia, E.; De Robertis, G.; De Simone, P.; De Zorzi, G.; Dell'Agnello, S.; Denig, A.; Di Domenico, A.; Di Donato, C.; Di Falco, S.; Doria, A.; Dreucci, M.; Erriquez, O.; Farilla, A.; Felici, G.; Ferrari, A.; Ferrer, M.L.; Finocchiaro, G.; Forti, C.; Franceschi, A.; Franzini, P.; Gatt, C.; Gauzzi, P.; Giovannella, S.; Gorini, E.; Grancagnolo, F.; Graziani, E.; Han, S.W.; Incagli, M.; Ingrosso, L.; Kluge, W.; Kuo, C.; Kulikov, V.; Lacava, F.; Lanfranchi, G.; Lee-Franzini, J.; Leone, D.; Lu, F.; Martemianov, M.; Matsyuk, M.; Mei, W.; Merola, L.; Messi, R.; Miscetti, S.; Moulson, M.; Mueller, S.; Murtas, F.; Napolitano, M.; Nedosekin, A.; Nguyen, F.; Palutan, M.; Pasqualucci, E.; Passalacqua, L.; Passeri, A.; Patera, V.; Petrolo, E.; Pontecorvo, L.; Primavera, M.; Ruggieri, F.; Santangelo, P.; Santovetti, E.; Saracino, G.; Schamberger, R.D.; Sciascia, B.; Sciubba, A.; Scuri, F.; Sfiligoi, I.; Spadaro, T.; Spiriti, E.; Tong, G.L.; Tortora, L.; Valente, E.; Valente, P.; Valeriani, B.; Vernanzoni, G.; Veneziano, S.; Ventura, A.; Xu, G.; Yu, G.W.


    A sample of 5.3 x 10 7 phi mesons, produced at the Frascati phi-factory DAPHINE, has been used by the KLOE Collaboration to study the phi radiative decays. The decays phi → ηπ 0 γ and phi → π o π o γ have been exploited to study the scalar mesons a o (980) and f o (980). Furthermore a new determination of the η - η' mixing angle has been obtained from the measurement of the ratio of the decay rates of phi → η'γ to phi → ηγ to phi → ηγ

  10. D meson hadronic decays at CLEO-c

    Energy Technology Data Exchange (ETDEWEB)

    Yang, Fan; /Fermilab


    The recent CLEO-c results on hadronic decays of D and D{sub s} mesons are presented. First the absolute branching fractions for D and D{sub s} mesons using a double tag technique are discussed, then are the Cabibbo suppressed decays and doubly Cabibbo suppressed decays. Finally, I present the inclusive and rare decay modes and other measurements from CLEO-c. These decays illuminate a wide range of physics. A brief theoretical introduction is given before the corresponding discussion on measurement.

  11. Charged-particle multiplicities in B-meson decay

    International Nuclear Information System (INIS)

    Alam, M.S.; Csorna, S.E.; Fridman, A.; Hicks, R.G.; Panvini, R.S.; Andrews, D.; Avery, P.; Berkelman, K.; Cabenda, R.; Cassel, D.G.; DeWire, J.W.; Ehrlich, R.; Ferguson, T.; Gilchriese, M.G.D.; Gittelman, B.; Hartill, D.L.; Herrup, D.; Herzlinger, M.; Holzner, S.; Kandaswamy, J.; Kreinick, D.L.; Mistry, N.B.; Morrow, F.; Nordberg, E.; Perchonok, R.; Plunkett, R.; Silverman, A.; Stein, P.C.; Stone, S.; Weber, D.; Wilcke, R.; Sadoff, A.J.; Bebek, C.; Haggerty, J.; Hempstead, M.; Izen, J.M.; Loomis, W.A.; MacKay, W.W.; Pipkin, F.M.; Rohlf, J.; Tanenbaum, W.; Wilson, R.; Chadwick, K.; Chauveau, J.; Ganci, P.; Gentile, T.; Kagan, H.; Kass, R.; Melissinos, A.C.; Olsen, S.L.; Poling, R.; Rosenfeld, C.; Rucinski, G.; Thorndike, E.H.; Green, J.; Sannes, F.; Skubic, P.; Snyder, A.; Stone, R.; Brody, A.; Chen, A.; Goldberg, M.; Horwitz, N.; Lipari, P.; Kooy, H.; Moneti, G.C.; Pistilli, P.


    The charged multiplicity has been measured at the UPSILON(4S) and a value of 5.75 +- 0.1 +- 0.2 has been obtained for the mean charged multiplicity in B-meson decay. Combining this result with the measurement of prompt letpons from B decay, the values 4.1 +- 0.35 +- 0.2 and 6.3 +- 0.2 +- 0.2 are found for the semileptonic and nonleptonic charged multiplicities, respectively. If b→c dominance is assumed for the weak decay of the B meson, then the semileptonic multiplicity is consistent with the recoil mass determined from the lepton momentum spectrum

  12. Charmed meson decay constants in three-flavor lattice QCD

    Energy Technology Data Exchange (ETDEWEB)

    Aubin, C.; Bernard, C.; DeTar, C.; Di Pierro, M.; Freeland, Elizabeth D.; Gottlieb, Steven; Heller, U.M.; Hetrick, J.E.; El-Khadra, Aida X.; Kronfeld, Andreas S.; Levkova, L.; Mackenzie, P.B.; Menscher, D.; Maresca, F.; Nobes, M.; Okamoto, M.; Renner, D.B.; Simone, J.; Sugar, R.; Toussaint, D.; Trottier, H.D.; /Art Inst. of Chicago /Columbia


    The authors present the first lattice QCD calculation with realistic sea quark content of the D{sup +}-meson decay constant f{sub D+}. They use the MILC Collaboration's publicly available ensembles of lattice gauge fields, which have a quark sea with two flavors (up and down) much lighter than a third (strange). They obtain f{sub D+} = 201 {+-} 3 {+-} 17 MeV, where the errors are statistical and a combination of systematic errors. They also obtain f{sub D{sub s}} = 249 {+-} 3 {+-} 16 MeV for the D{sub s} meson.

  13. Compton scattering by mesons in nuclei: Experiment on 208Pb

    International Nuclear Information System (INIS)

    Fuhrberg, K.; Martin, G.; Haeger, D.; Ludwig, M.; Schumacher, M.; Andersson, B.E.; Blomqvist, K.I.; Ruijter, H.; Sandell, A.; Schroeder, B.; Hayward, E.; Nilsson, L.; Zorro, R.


    Using 58 and 73 MeV tagged photons and scattering angles from 60deg to 150deg, it is shown that is possible to observe Compton scattering by 'mesons in nuclei ' through an incomplete cancellation of the mesonic (exchange- current) seagull amplitude by parts of the nuclear resonance amplitude related to the giant-dipole resonance of 208 Pb. This phenomenon is a property of an extended nucleus and , therefore, cannot be dtudied on the deuteron. Predictions of the exchange form factor which determines the angular distribution of the exchange seagull amplitude are compared with experimental data. (orig.)

  14. Compton scattering, meson exchange, and the polarizabilities of bound nucleons

    International Nuclear Information System (INIS)

    Feldman, G.; Mellendorf, K.E.; Eisenstein, R.A.; Federspiel, F.J.; Garino, G.; Igarashi, R.; Kolb, N.R.; Lucas, M.A.; MacGibbon, B.E.; Mize, W.K.; Nathan, A.M.; Pywell, R.E.; Wells, D.P.


    Elastic photon scattering cross sections on 16 O have been measured in the energy range 27 endash 108 MeV. These data are inconsistent with a conventional interpretation in which the electric and magnetic polarizabilities of the bound nucleon are unchanged from the free values and the meson-exchange seagull amplitude is taken in the zero-energy limit. Agreement with the data can be achieved by invoking either strongly modified polarizabilities or a substantial energy dependence to the meson-exchange seagull amplitude. It is argued that these seemingly different explanations are experimentally indistinguishable and probably physically equivalent. copyright 1996 The American Physical Society

  15. Are narrow mesons, baryons and dibaryons evidence for multiquark states?

    International Nuclear Information System (INIS)

    Tatischeff, B.; Yonnet, J.


    Several narrow structures have been progressively observed since the last fifteen years, in di-baryonic invariant mass spectra or in missing mass spectra. More recently, narrow structures were observed in baryonic and now in mesonic mass spectra. Since these small peaks appear at fixed masses, independently of the experiment, they are associated with real states. There is no room to explain these states within classical nuclear physics taking into account baryonic and mesonic degrees of freedom. An interpretation is proposed, which associate these narrow structures with two coloured quark clusters. (authors)

  16. Lattice results for low moments of light meson distribution amplitudes

    Energy Technology Data Exchange (ETDEWEB)

    Arthur, R.; Boyle, P.A. [Edinburgh Univ. (United Kingdom). SUPA, School of Physics; Broemmel, D.; Flynn, J.M.; Rae, T.D.; Sachrajda, C.T.C. [Southampton Univ. (United Kingdom). School of Physics and Astronomy; Donnellan, M.A. [NIC/DESY Zeuthen (Germany); Juettner, A. [CERN, Geneva (Switzerland). Physics Dept.


    As part of the UKQCD and RBC collaborations' N{sub f} = 2+1 domain-wall fermion phenomenology programme, we calculate the first two moments of the light-cone distribution amplitudes of the pseudoscalar mesons {pi} and K and the (longitudinally-polarised) vector mesons {rho}, K{sup *} and {phi}. We obtain the desired quantities with good precision and are able to discern the expected quark-mass dependence of SU(3)-flavour breaking effects. An important ingredient of the calculation is the nonperturbative renormalisation of lattice operators using the RI{sup '}/MOM technique. (orig.)

  17. A precise measurement of the $B^0$ meson oscillation frequency

    CERN Document Server

    Aaij, Roel; Adeva, Bernardo; Adinolfi, Marco; Affolder, Anthony; Ajaltouni, Ziad; Akar, Simon; Albrecht, Johannes; Alessio, Federico; Alexander, Michael; Ali, Suvayu; Alkhazov, Georgy; Alvarez Cartelle, Paula; Alves Jr, Antonio Augusto; Amato, Sandra; Amerio, Silvia; Amhis, Yasmine; An, Liupan; Anderlini, Lucio; Anderson, Jonathan; Andreassi, Guido; Andreotti, Mirco; Andrews, Jason; Appleby, Robert; Aquines Gutierrez, Osvaldo; Archilli, Flavio; d'Argent, Philippe; Artamonov, Alexander; Artuso, Marina; Aslanides, Elie; Auriemma, Giulio; Baalouch, Marouen; Bachmann, Sebastian; Back, John; Badalov, Alexey; Baesso, Clarissa; Baldini, Wander; Barlow, Roger; Barschel, Colin; Barsuk, Sergey; Barter, William; Batozskaya, Varvara; Battista, Vincenzo; Bay, Aurelio; Beaucourt, Leo; Beddow, John; Bedeschi, Franco; Bediaga, Ignacio; Bel, Lennaert; Bellee, Violaine; Belloli, Nicoletta; Belyaev, Ivan; Ben-Haim, Eli; Bencivenni, Giovanni; Benson, Sean; Benton, Jack; Berezhnoy, Alexander; Bernet, Roland; Bertolin, Alessandro; Bettler, Marc-Olivier; van Beuzekom, Martinus; Bien, Alexander; Bifani, Simone; Billoir, Pierre; Bird, Thomas; Birnkraut, Alex; Bizzeti, Andrea; Blake, Thomas; Blanc, Frédéric; Blouw, Johan; Blusk, Steven; Bocci, Valerio; Bondar, Alexander; Bondar, Nikolay; Bonivento, Walter; Borghi, Silvia; Borsato, Martino; Bowcock, Themistocles; Bowen, Espen Eie; Bozzi, Concezio; Braun, Svende; Britsch, Markward; Britton, Thomas; Brodzicka, Jolanta; Brook, Nicholas; Buchanan, Emma; Bursche, Albert; Buytaert, Jan; Cadeddu, Sandro; Calabrese, Roberto; Calvi, Marta; Calvo Gomez, Miriam; Campana, Pierluigi; Campora Perez, Daniel; Capriotti, Lorenzo; Carbone, Angelo; Carboni, Giovanni; Cardinale, Roberta; Cardini, Alessandro; Carniti, Paolo; Carson, Laurence; Carvalho Akiba, Kazuyoshi; Casse, Gianluigi; Cassina, Lorenzo; Castillo Garcia, Lucia; Cattaneo, Marco; Cauet, Christophe; Cavallero, Giovanni; Cenci, Riccardo; Charles, Matthew; Charpentier, Philippe; Chefdeville, Maximilien; Chen, Shanzhen; Cheung, Shu-Faye; Chiapolini, Nicola; Chrzaszcz, Marcin; Cid Vidal, Xabier; Ciezarek, Gregory; Clarke, Peter; Clemencic, Marco; Cliff, Harry; Closier, Joel; Coco, Victor; Cogan, Julien; Cogneras, Eric; Cogoni, Violetta; Cojocariu, Lucian; Collazuol, Gianmaria; Collins, Paula; Comerma-Montells, Albert; Contu, Andrea; Cook, Andrew; Coombes, Matthew; Coquereau, Samuel; Corti, Gloria; Corvo, Marco; Couturier, Benjamin; Cowan, Greig; Craik, Daniel Charles; Crocombe, Andrew; Cruz Torres, Melissa Maria; Cunliffe, Samuel; Currie, Robert; D'Ambrosio, Carmelo; Dall'Occo, Elena; Dalseno, Jeremy; David, Pieter; Davis, Adam; De Aguiar Francisco, Oscar; De Bruyn, Kristof; De Capua, Stefano; De Cian, Michel; De Miranda, Jussara; De Paula, Leandro; De Simone, Patrizia; Dean, Cameron Thomas; Decamp, Daniel; Deckenhoff, Mirko; Del Buono, Luigi; Déléage, Nicolas; Demmer, Moritz; Derkach, Denis; Deschamps, Olivier; Dettori, Francesco; Dey, Biplab; Di Canto, Angelo; Di Ruscio, Francesco; Dijkstra, Hans; Donleavy, Stephanie; Dordei, Francesca; Dorigo, Mirco; Dosil Suárez, Alvaro; Dossett, David; Dovbnya, Anatoliy; Dreimanis, Karlis; Dufour, Laurent; Dujany, Giulio; Dupertuis, Frederic; Durante, Paolo; Dzhelyadin, Rustem; Dziurda, Agnieszka; Dzyuba, Alexey; Easo, Sajan; Egede, Ulrik; Egorychev, Victor; Eidelman, Semen; Eisenhardt, Stephan; Eitschberger, Ulrich; Ekelhof, Robert; Eklund, Lars; El Rifai, Ibrahim; Elsasser, Christian; Ely, Scott; Esen, Sevda; Evans, Hannah Mary; Evans, Timothy; Falabella, Antonio; Färber, Christian; Farley, Nathanael; Farry, Stephen; Fay, Robert; Ferguson, Dianne; Fernandez Albor, Victor; Ferrari, Fabio; Ferreira Rodrigues, Fernando; Ferro-Luzzi, Massimiliano; Filippov, Sergey; Fiore, Marco; Fiorini, Massimiliano; Firlej, Miroslaw; Fitzpatrick, Conor; Fiutowski, Tomasz; Fohl, Klaus; Fol, Philip; Fontana, Marianna; Fontanelli, Flavio; Forshaw, Dean Charles; Forty, Roger; Frank, Markus; Frei, Christoph; Frosini, Maddalena; Fu, Jinlin; Furfaro, Emiliano; Gallas Torreira, Abraham; Galli, Domenico; Gallorini, Stefano; Gambetta, Silvia; Gandelman, Miriam; Gandini, Paolo; Gao, Yuanning; García Pardiñas, Julián; Garra Tico, Jordi; Garrido, Lluis; Gascon, David; Gaspar, Clara; Gauld, Rhorry; Gavardi, Laura; Gazzoni, Giulio; Gerick, David; Gersabeck, Evelina; Gersabeck, Marco; Gershon, Timothy; Ghez, Philippe; Gianì, Sebastiana; Gibson, Valerie; Girard, Olivier Göran; Giubega, Lavinia-Helena; Gligorov, V.V.; Göbel, Carla; Golubkov, Dmitry; Golutvin, Andrey; Gomes, Alvaro; Gotti, Claudio; Grabalosa Gándara, Marc; Graciani Diaz, Ricardo; Granado Cardoso, Luis Alberto; Graugés, Eugeni; Graverini, Elena; Graziani, Giacomo; Grecu, Alexandru; Greening, Edward; Gregson, Sam; Griffith, Peter; Grillo, Lucia; Grünberg, Oliver; Gui, Bin; Gushchin, Evgeny; Guz, Yury; Gys, Thierry; Hadavizadeh, Thomas; Hadjivasiliou, Christos; Haefeli, Guido; Haen, Christophe; Haines, Susan; Hall, Samuel; Hamilton, Brian; Han, Xiaoxue; Hansmann-Menzemer, Stephanie; Harnew, Neville; Harnew, Samuel; Harrison, Jonathan; He, Jibo; Head, Timothy; Heijne, Veerle; Heister, Arno; Hennessy, Karol; Henrard, Pierre; Henry, Louis; Hernando Morata, Jose Angel; van Herwijnen, Eric; Heß, Miriam; Hicheur, Adlène; Hill, Donal; Hoballah, Mostafa; Hombach, Christoph; Hulsbergen, Wouter; Humair, Thibaud; Hussain, Nazim; Hutchcroft, David; Hynds, Daniel; Idzik, Marek; Ilten, Philip; Jacobsson, Richard; Jaeger, Andreas; Jalocha, Pawel; Jans, Eddy; Jawahery, Abolhassan; Jing, Fanfan; John, Malcolm; Johnson, Daniel; Jones, Christopher; Joram, Christian; Jost, Beat; Jurik, Nathan; Kandybei, Sergii; Kanso, Walaa; Karacson, Matthias; Karbach, Moritz; Karodia, Sarah; Kecke, Matthieu; Kelsey, Matthew; Kenyon, Ian; Kenzie, Matthew; Ketel, Tjeerd; Khanji, Basem; Khurewathanakul, Chitsanu; Kirn, Thomas; Klaver, Suzanne; Klimaszewski, Konrad; Kochebina, Olga; Kolpin, Michael; Komarov, Ilya; Koopman, Rose; Koppenburg, Patrick; Kozeiha, Mohamad; Kravchuk, Leonid; Kreplin, Katharina; Kreps, Michal; Krocker, Georg; Krokovny, Pavel; Kruse, Florian; Krzemien, Wojciech; Kucewicz, Wojciech; Kucharczyk, Marcin; Kudryavtsev, Vasily; Kuonen, Axel Kevin; Kurek, Krzysztof; Kvaratskheliya, Tengiz; Lacarrere, Daniel; Lafferty, George; Lai, Adriano; Lambert, Dean; Lanfranchi, Gaia; Langenbruch, Christoph; Langhans, Benedikt; Latham, Thomas; Lazzeroni, Cristina; Le Gac, Renaud; van Leerdam, Jeroen; Lees, Jean-Pierre; Lefèvre, Regis; Leflat, Alexander; Lefrançois, Jacques; Lemos Cid, Edgar; Leroy, Olivier; Lesiak, Tadeusz; Leverington, Blake; Li, Yiming; Likhomanenko, Tatiana; Liles, Myfanwy; Lindner, Rolf; Linn, Christian; Lionetto, Federica; Liu, Bo; Liu, Xuesong; Loh, David; Longstaff, Iain; Lopes, Jose; Lucchesi, Donatella; Lucio Martinez, Miriam; Luo, Haofei; Lupato, Anna; Luppi, Eleonora; Lupton, Oliver; Lusardi, Nicola; Lusiani, Alberto; Machefert, Frederic; Maciuc, Florin; Maev, Oleg; Maguire, Kevin; Malde, Sneha; Malinin, Alexander; Manca, Giulia; Mancinelli, Giampiero; Manning, Peter Michael; Mapelli, Alessandro; Maratas, Jan; Marchand, Jean François; Marconi, Umberto; Marin Benito, Carla; Marino, Pietro; Marks, Jörg; Martellotti, Giuseppe; Martin, Morgan; Martinelli, Maurizio; Martinez Santos, Diego; Martinez Vidal, Fernando; Martins Tostes, Danielle; Massafferri, André; Matev, Rosen; Mathad, Abhijit; Mathe, Zoltan; Matteuzzi, Clara; Mauri, Andrea; Maurin, Brice; Mazurov, Alexander; McCann, Michael; McCarthy, James; McNab, Andrew; McNulty, Ronan; Meadows, Brian; Meier, Frank; Meissner, Marco; Melnychuk, Dmytro; Merk, Marcel; Michielin, Emanuele; Milanes, Diego Alejandro; Minard, Marie-Noelle; Mitzel, Dominik Stefan; Molina Rodriguez, Josue; Monroy, Ignacio Alberto; Monteil, Stephane; Morandin, Mauro; Morawski, Piotr; Mordà, Alessandro; Morello, Michael Joseph; Moron, Jakub; Morris, Adam Benjamin; Mountain, Raymond; Muheim, Franz; Müller, Dominik; Müller, Janine; Müller, Katharina; Müller, Vanessa; Mussini, Manuel; Muster, Bastien; Naik, Paras; Nakada, Tatsuya; Nandakumar, Raja; Nandi, Anita; Nasteva, Irina; Needham, Matthew; Neri, Nicola; Neubert, Sebastian; Neufeld, Niko; Neuner, Max; Nguyen, Anh Duc; Nguyen, Thi-Dung; Nguyen-Mau, Chung; Niess, Valentin; Niet, Ramon; Nikitin, Nikolay; Nikodem, Thomas; Novoselov, Alexey; O'Hanlon, Daniel Patrick; Oblakowska-Mucha, Agnieszka; Obraztsov, Vladimir; Ogilvy, Stephen; Okhrimenko, Oleksandr; Oldeman, Rudolf; Onderwater, Gerco; Osorio Rodrigues, Bruno; Otalora Goicochea, Juan Martin; Otto, Adam; Owen, Patrick; Oyanguren, Maria Aranzazu; Palano, Antimo; Palombo, Fernando; Palutan, Matteo; Panman, Jacob; Papanestis, Antonios; Pappagallo, Marco; Pappalardo, Luciano; Pappenheimer, Cheryl; Parkes, Christopher; Passaleva, Giovanni; Patel, Girish; Patel, Mitesh; Patrignani, Claudia; Pearce, Alex; Pellegrino, Antonio; Penso, Gianni; Pepe Altarelli, Monica; Perazzini, Stefano; Perret, Pascal; Pescatore, Luca; Petridis, Konstantinos; Petrolini, Alessandro; Petruzzo, Marco; Picatoste Olloqui, Eduardo; Pietrzyk, Boleslaw; Pilař, Tomas; Pinci, Davide; Pistone, Alessandro; Piucci, Alessio; Playfer, Stephen; Plo Casasus, Maximo; Poikela, Tuomas; Polci, Francesco; Poluektov, Anton; Polyakov, Ivan; Polycarpo, Erica; Popov, Alexander; Popov, Dmitry; Popovici, Bogdan; Potterat, Cédric; Price, Eugenia; Price, Joseph David; Prisciandaro, Jessica; Pritchard, Adrian; Prouve, Claire; Pugatch, Valery; Puig Navarro, Albert; Punzi, Giovanni; Qian, Wenbin; Quagliani, Renato; Rachwal, Bartolomiej; Rademacker, Jonas; Rama, Matteo; Rangel, Murilo; Raniuk, Iurii; Rauschmayr, Nathalie; Raven, Gerhard; Redi, Federico; Reichert, Stefanie; Reid, Matthew; dos Reis, Alberto; Ricciardi, Stefania; Richards, Sophie; Rihl, Mariana; Rinnert, Kurt; Rives Molina, Vincente; Robbe, Patrick; Rodrigues, Ana Barbara; Rodrigues, Eduardo; Rodriguez Lopez, Jairo Alexis; Rodriguez Perez, Pablo; Roiser, Stefan; Romanovsky, Vladimir; Romero Vidal, Antonio; Ronayne, John William; Rotondo, Marcello; Rouvinet, Julien; Ruf, Thomas; Ruiz Valls, Pablo; Saborido Silva, Juan Jose; Sagidova, Naylya; Sail, Paul; Saitta, Biagio; Salustino Guimaraes, Valdir; Sanchez Mayordomo, Carlos; Sanmartin Sedes, Brais; Santacesaria, Roberta; Santamarina Rios, Cibran; Santimaria, Marco; Santovetti, Emanuele; Sarti, Alessio; Satriano, Celestina; Satta, Alessia; Saunders, Daniel Martin; Savrina, Darya; Schael, Stefan; Schiller, Manuel; Schindler, Heinrich; Schlupp, Maximilian; Schmelling, Michael; Schmelzer, Timon; Schmidt, Burkhard; Schneider, Olivier; Schopper, Andreas; Schubiger, Maxime; Schune, Marie Helene; Schwemmer, Rainer; Sciascia, Barbara; Sciubba, Adalberto; Semennikov, Alexander; Sergi, Antonino; Serra, Nicola; Serrano, Justine; Sestini, Lorenzo; Seyfert, Paul; Shapkin, Mikhail; Shapoval, Illya; Shcheglov, Yury; Shears, Tara; Shekhtman, Lev; Shevchenko, Vladimir; Shires, Alexander; Siddi, Benedetto Gianluca; Silva Coutinho, Rafael; Silva de Oliveira, Luiz Gustavo; Simi, Gabriele; Sirendi, Marek; Skidmore, Nicola; Skwarnicki, Tomasz; Smith, Edmund; Smith, Eluned; Smith, Iwan Thomas; Smith, Jackson; Smith, Mark; Snoek, Hella; Sokoloff, Michael; Soler, Paul; Soomro, Fatima; Souza, Daniel; Souza De Paula, Bruno; Spaan, Bernhard; Spradlin, Patrick; Sridharan, Srikanth; Stagni, Federico; Stahl, Marian; Stahl, Sascha; Stefkova, Slavomira; Steinkamp, Olaf; Stenyakin, Oleg; Stevenson, Scott; Stoica, Sabin; Stone, Sheldon; Storaci, Barbara; Stracka, Simone; Straticiuc, Mihai; Straumann, Ulrich; Sun, Liang; Sutcliffe, William; Swientek, Krzysztof; Swientek, Stefan; Syropoulos, Vasileios; Szczekowski, Marek; Szczypka, Paul; Szumlak, Tomasz; T'Jampens, Stephane; Tayduganov, Andrey; Tekampe, Tobias; Teklishyn, Maksym; Tellarini, Giulia; Teubert, Frederic; Thomas, Christopher; Thomas, Eric; van Tilburg, Jeroen; Tisserand, Vincent; Tobin, Mark; Todd, Jacob; Tolk, Siim; Tomassetti, Luca; Tonelli, Diego; Topp-Joergensen, Stig; Torr, Nicholas; Tournefier, Edwige; Tourneur, Stephane; Trabelsi, Karim; Tran, Minh Tâm; Tresch, Marco; Trisovic, Ana; Tsaregorodtsev, Andrei; Tsopelas, Panagiotis; Tuning, Niels; Ukleja, Artur; Ustyuzhanin, Andrey; Uwer, Ulrich; Vacca, Claudia; Vagnoni, Vincenzo; Valenti, Giovanni; Vallier, Alexis; Vazquez Gomez, Ricardo; Vazquez Regueiro, Pablo; Vázquez Sierra, Carlos; Vecchi, Stefania; van Veghel, Maarten; Velthuis, Jaap; Veltri, Michele; Veneziano, Giovanni; Vesterinen, Mika; Viaud, Benoit; Vieira, Daniel; Vieites Diaz, Maria; Vilasis-Cardona, Xavier; Vollhardt, Achim; Volyanskyy, Dmytro; Voong, David; Vorobyev, Alexey; Vorobyev, Vitaly; Voß, Christian; de Vries, Jacco; Waldi, Roland; Wallace, Charlotte; Wallace, Ronan; Walsh, John; Wandernoth, Sebastian; Wang, Jianchun; Ward, David; Watson, Nigel; Websdale, David; Weiden, Andreas; Whitehead, Mark; Wilkinson, Guy; Wilkinson, Michael; Williams, Mark Richard James; Williams, Matthew; Williams, Mike; Williams, Timothy; Wilson, Fergus; Wimberley, Jack; Wishahi, Julian; Wislicki, Wojciech; Witek, Mariusz; Wormser, Guy; Wotton, Stephen; Wright, Simon; Wyllie, Kenneth; Xie, Yuehong; Xu, Zhirui; Yang, Zhenwei; Yu, Jiesheng; Yuan, Xuhao; Yushchenko, Oleg; Zangoli, Maria; Zavertyaev, Mikhail; Zhang, Liming; Zhang, Yanxi; Zhelezov, Alexey; Zhokhov, Anatoly; Zhong, Liang; Zhukov, Valery; Zucchelli, Stefano


    The oscillation frequency, $\\Delta m_d$, of $B^0$ mesons is measured using semileptonic decays with a $D^-$ or $D^{*-}$ meson in the final state, in a data sample of $pp$ collisions collected by the LHCb detector corresponding to an integrated luminosity of 3.0$\\mbox{fb}^{-1}$. A combination of the two decay modes gives $\\Delta m_d = (505.0 \\pm 2.1 \\pm 1.0) \\rm \\,ns^{-1}$, where the first uncertainty is statistical and the second is systematic. This is the most precise single measurement of this parameter. It is compatible with the current world average and has similar precision.

  18. Medium dependence of vector meson properties in heavy ion collisions

    International Nuclear Information System (INIS)

    Faessler, Amand; Fuchs, Christian


    Heavy ion collisions produce dense and hot nuclear matter. Dileptons give information about this hot and dense phase. The dileptons are produced by vector mesons. Theoretical calculation of dilepton production in the DLS (Berkeley), the HADES (GSI) experiments and the CERES, HELIOS and NA60 data from CERN give information about possible modifications of the vector meson properties in hot and dense nuclear matter. Here the description in relativistic quantum molecular dynamics of heavy ion collisions and dilepton production are presented and compared with data. (authors) Key words: heavy ion collisions; dense and hot nuclear matter; dileptons; medium dependence

  19. Search for Bc+ decays to two charm mesons

    Directory of Open Access Journals (Sweden)

    R. Aaij


    Full Text Available A search for decays of Bc+ mesons to two charm mesons is performed for the first time using data corresponding to an integrated luminosity of 3.0fb−1, collected by the LHCb experiment in pp collisions at centre-of-mass energies of 7 and 8 TeV. The decays considered are Bc+→D(s(⁎+D‾(⁎0 and Bc+→D(s(⁎+D(⁎0, which are normalised to high-yield B+→D(s+D‾0 decays. No evidence for a signal is found and limits are set on twelve Bc+ decay modes.

  20. The role of meson dynamics in nuclear matter saturation

    International Nuclear Information System (INIS)

    Goncalves, E.


    The problem of the saturation of nuclea matter in the non-relativistic limit of the model proposed by J.D. Walecka is studied. In the original context nuclear matter saturation is obtained as a direct consequence of relativistic effects and both scalar and vector mesons are treated statically. In the present work we investigate the effect of the meson dynamics for the saturation using a Born-Oppenheimer approximation for the ground state. An upper limit for the saturation curve of nuclear matter and are able to decide now essential is the relativistic treatment of the nucleons for this problem, is obtained. (author) [pt