WorldWideScience

Sample records for chez rhodobacter sphaeroides

  1. The architecture of Rhodobacter sphaeroides chromatophores.

    Science.gov (United States)

    Scheuring, Simon; Nevo, Reinat; Liu, Lu-Ning; Mangenot, Stéphanie; Charuvi, Dana; Boudier, Thomas; Prima, Valerie; Hubert, Pierre; Sturgis, James N; Reich, Ziv

    2014-08-01

    The chromatophores of Rhodobacter (Rb.) sphaeroides represent a minimal bio-energetic system, which efficiently converts light energy into usable chemical energy. Despite extensive studies, several issues pertaining to the morphology and molecular architecture of this elemental energy conversion system remain controversial or unknown. To tackle these issues, we combined electron microscope tomography, immuno-electron microscopy and atomic force microscopy. We found that the intracellular Rb. sphaeroides chromatophores form a continuous reticulum rather than existing as discrete vesicles. We also found that the cytochrome bc1 complex localizes to fragile chromatophore regions, which most likely constitute the tubular structures that interconnect the vesicles in the reticulum. In contrast, the peripheral light-harvesting complex 2 (LH2) is preferentially hexagonally packed within the convex vesicular regions of the membrane network. Based on these observations, we propose that the bc1 complexes are in the inter-vesicular regions and surrounded by reaction center (RC) core complexes, which in turn are bounded by arrays of peripheral antenna complexes. This arrangement affords rapid cycling of electrons between the core and bc1 complexes while maintaining efficient excitation energy transfer from LH2 domains to the RCs.

  2. Bioremediation of lead contaminated soil with Rhodobacter sphaeroides.

    Science.gov (United States)

    Li, Xiaomin; Peng, Weihua; Jia, Yingying; Lu, Lin; Fan, Wenhong

    2016-08-01

    Bioremediation with microorganisms is a promising technique for heavy metal contaminated soil. Rhodobacter sphaeroides was previously isolated from oil field injection water and used for bioremediation of lead (Pb) contaminated soil in the present study. Based on the investigation of the optimum culturing conditions and the tolerance to Pb, we employed the microorganism for the remediation of Pb contaminated soil simulated at different contamination levels. It was found that the optimum temperature, pH, and inoculum size for R. sphaeroides is 30-35 °C, 7, and 2 × 10(8) mL(-1), respectively. Rhodobacter sphaeroides did not remove the Pb from soil but did change its speciation. During the bioremediation process, more available fractions were transformed to less accessible and inert fractions; in particular, the exchangeable phase was dramatically decreased while the residual phase was substantially increased. A wheat seedling growing experiment showed that Pb phytoavailability was reduced in amended soils. Results inferred that the main mechanism by which R. sphaeroides treats Pb contaminated soil is the precipitation formation of inert compounds, including lead sulfate and lead sulfide. Although the Pb bioremediation efficiency on wheat was not very high (14.78% root and 24.01% in leaf), R. sphaeroides remains a promising alternative for Pb remediation in contaminated soil.

  3. Hydrogen production by Rhodobacter sphaeroides DSM 158 under intense irradiation.

    Science.gov (United States)

    Krujatz, Felix; Härtel, Paul; Helbig, Karsten; Haufe, Nora; Thierfelder, Simone; Bley, Thomas; Weber, Jost

    2015-01-01

    To identify optimal hydrogen production conditions using growing cultures of Rhodobacter sphaeroides DSM 158 the effects of varying the reactor's volumetric power input (0.01-1.4kWm(-3)) and irradiation intensity (5-2500Wm(-2)) were investigated in batch and continuous production modes. Irradiation intensity had a greater effect on hydrogen production than volumetric power input. Hydrogen production and photofermentative biomass formation were maximized by irradiation at 2250Wm(-2) with a volumetric power input of 0.55kWm(-3). The bacterial dry weight (2.64gL(-1)) and rate of hydrogen production (195mLL(-1)h(-1)) achieved under these conditions were greater than any that have previously been reported for batch-mode hydrogen production by R. sphaeroides. Continuous mode experiments (D=0.1h(-1)) yielded a bacterial dry weight, hydrogen production rate, productivity and hydrogen yield of 2.35±0.18gL(-1), 165±6.2mLL(-1)h(-1), 3.96LL(-1)d(-1) and 36.6%, respectively.

  4. Hydrogen production by co-cultures of Lactobacillus and a photosynthetic bacterium, Rhodobacter sphaeroides RV

    Energy Technology Data Exchange (ETDEWEB)

    Asada, Yasuo; Ishimi, Katsuhiro [Department of General Education, College of Science and Technology, Nihon University, Narashinodai, Chiba 274-8501 (Japan); Tokumoto, Masaru; Aihara, Yasuyuki; Oku, Masayo; Kohno, Hideki [Department of Applied Molecular Chemistry, College of Industrial Technology, Nihon University, Izumi-cho, Chiba 275-8575 (Japan); Wakayama, Tatsuki; Miyake, Jun [Research Institute for Cell Engineering, National Institute of Advanced Industrial Science and Technology, Nakoji, Amagasaki, Hyogo 661-0974 (Japan); Tomiyama, Masamitsu [Genetic Diversity Department, National Institute of Agrobiological Science, Tsukuba, Ibaraki 305-8602 (Japan)

    2006-09-15

    Hydrogen production with glucose by using co-immobilized cultures of a lactic acid bacterium, Lactobacillus delbrueckii NBRC13953, and a photosynthetic bacterium, Rhodobacter sphaeroides RV, in agar gels was studied. Glucose was converted to hydrogen gas in a yield of 7.1mol of hydrogen per mole of glucose at a maximum under illuminated conditions. (author)

  5. SPECTRAL IDENTIFICATION OF THE ELECTROCHROMICALLY ACTIVE CAROTENOIDS OF RHODOBACTER-SPHAEROIDES IN CHROMATOPHORES AND RECONSTITUTED LIPOSOMES

    NARCIS (Netherlands)

    CRIELAARD, W; VANMOURIK, F; VANGRONDELLE, R; KONINGS, WN; HELLINGWERF, KJ

    1992-01-01

    Reaction centers with both light harvesting complexes I and II (B875 and B800/850; i.e., RCLH(I)LH(II) complexes) have been isolated from Rhodobacter sphaeroides. These complexes have been incorporated into liposomes made from lipids purified from Escherichia coli. The electrochromic bandshift of ca

  6. Hydrogen Production by Co-cultures of Rhizopus oryzae and a Photosynthetic Bacterium, Rhodobacter sphaeroides RV

    Science.gov (United States)

    Asada, Yasuo; Ishimi, Katsuhiro; Nagata, Yoko; Wakayama, Tatsuki; Miyake, Jun; Kohno, Hideki

    Hydrogen production with glucose by using co-immobilized cultures of a fungus, Rhizopus oryzae NBRC5384, and a photosynthetic bacterium, Rhodobacter sphaeroides RV, in agar gels was studied. The co-immobilized cultures converted glucose to hydrogen via lactate in a high molar yield of about 8moles of hydrogen per glucose at a maximum under illuminated conditions.

  7. CHARACTERIZATION OF A BINDING PROTEIN-DEPENDENT GLUTAMATE TRANSPORT-SYSTEM OF RHODOBACTER-SPHAEROIDES

    NARCIS (Netherlands)

    Jacobs, M.H J; Driessen, A.J.M.; Konings, W.N

    1995-01-01

    The mechanism of L-glutamate uptake was studied in Rhodobacter sphaeroides. Uptake of L-glutamate is mediated by a high-affinity (K-t of 1.2 mu M), shock-sensitive transport system that is inhibited by vanadate and dependent on the internal pH. From the shock fluid, an L-glutamate-binding protein wa

  8. Characterization of a Binding Protein-Dependent Glutamate Transport System of Rhodobacter sphaeroides

    NARCIS (Netherlands)

    Jacobs, Mariken H.J.; Driessen, Arnold J.M.; Konings, Wil N.

    1995-01-01

    The mechanism of L-glutamate uptake was studied in Rhodobacter sphaeroides. Uptake of L-glutamate is mediated by a high-affinity (Kt of 1.2 µM), shock-sensitive transport system that is inhibited by vanadate and dependent on the internal pH. From the shock fluid, an L-glutamate-binding protein was i

  9. Color-Sensitive Motility and Methanol Release Responses in Rhodobacter sphaeroides

    OpenAIRE

    Kort, Remco; Crielaard, Wim; Spudich, John L.; Hellingwerf, Klaas J.

    2000-01-01

    Blue-light-induced repellent and demethylation responses, characteristic of behavioral adaptation, were observed in Rhodobacter sphaeroides. They were analyzed by computer-assisted motion analysis and through the release of volatile tritiated compounds from [methyl-3H]methionine-labeled cells, respectively. Increases in the stop frequency and the rate of methanol release were induced by exposure of cells to repellent light signals, such as an increase in blue- and a decrease in infrared-light...

  10. Feasibility of biohydrogen production from tofu wastewater with glutamine auxotrophic mutant of Rhodobacter sphaeroides

    Energy Technology Data Exchange (ETDEWEB)

    Zheng, G.H.; Wang, L.; Kang, Z.H. [School of Environmental Science and Engineering, State Key Laboratory of Pollution Control and Resource Reuse, Tongji University, 1239 Siping road, Shanghai 200092 (China)

    2010-12-15

    NH{sub 4}{sup +}, which is normally the integrant in organic wastewater, such as Tofu wastewater, is an inhibitor to hydrogen production by anoxygenic phototrophic bacterium. In order to release inhibition of NH{sub 4}{sup +} to biohydrogen generation by Rhodobacter sphaeroides, a glutamine auxotrophic mutant R. sphaeroides TJ-0803 was obtained by mutagenizing with ethyl methane sulfonate. The mutant could generate biohydrogen efficiently in the medium with high NH{sub 4}{sup +} concentration, because the inhibition of NH{sub 4}{sup +} to nitrogenase was released. Under suitable conditions, TJ-0803 could effectively produce biohydrogen from tofu wastewater, which commonly containing 50-60 mg L{sup -1} NH{sub 4}{sup +}, and the generation rate was increased by more than 100% compared with that from wild-type R. sphaeroides. (author)

  11. Gene co-expression network analysis in Rhodobacter capsulatus and application to comparative expression analysis of Rhodobacter sphaeroides

    Energy Technology Data Exchange (ETDEWEB)

    Pena-Castillo, Lourdes; Mercer, Ryan; Gurinovich, Anastasia; Callister, Stephen J.; Wright, Aaron T.; Westbye, Alexander; Beatty, J. T.; Lang, Andrew S.

    2014-08-28

    The genus Rhodobacter contains purple nonsulfur bacteria found mostly in freshwater environments. Representative strains of two Rhodobacter species, R. capsulatus and R. sphaeroides, have had their genomes fully sequenced and both have been the subject of transcriptional profiling studies. Gene co-expression networks can be used to identify modules of genes with similar expression profiles. Functional analysis of gene modules can then associate co-expressed genes with biological pathways, and network statistics can determine the degree of module preservation in related networks. In this paper, we constructed an R. capsulatus gene co-expression network, performed functional analysis of identified gene modules, and investigated preservation of these modules in R. capsulatus proteomics data and in R. sphaeroides transcriptomics data. Results: The analysis identified 40 gene co-expression modules in R. capsulatus. Investigation of the module gene contents and expression profiles revealed patterns that were validated based on previous studies supporting the biological relevance of these modules. We identified two R. capsulatus gene modules preserved in the protein abundance data. We also identified several gene modules preserved between both Rhodobacter species, which indicate that these cellular processes are conserved between the species and are candidates for functional information transfer between species. Many gene modules were non-preserved, providing insight into processes that differentiate the two species. In addition, using Local Network Similarity (LNS), a recently proposed metric for expression divergence, we assessed the expression conservation of between-species pairs of orthologs, and within-species gene-protein expression profiles. Conclusions: Our analyses provide new sources of information for functional annotation in R. capsulatus because uncharacterized genes in modules are now connected with groups of genes that constitute a joint functional

  12. Isolation, Identification of Bacillus Thuringiensis/Cereus and Its Enhancement on Protein Wastewater Treatment by Rhodobacter Sphaeroides

    Institute of Scientific and Technical Information of China (English)

    Shuli Liu; Guangming Zhang; Jie Zhang

    2016-01-01

    In order to enhance the degrading protein capability of purple non⁃sulfur bacteria ( PNSB), an effective strain, L2, was used to co⁃culture with Rhodobacter sphaeroides ATCC17023. The effects of added strain on protein removal of R. sphaeroides were investigated. Results showed that strain L2, being identified as Bacillus thuringiensis/cereus, had a high potential for producing protease with a production of 295 U/mL. The optimal B. thuringiensis/cereus ( 40 μL ) could significantly increase protein degradation of R. sphaeroides. Protein removal and biomass production were improved by 483% and 67%, respectively. R. sphaeroides/total biomass production was more than 95%. Theoretical analysis revealed that R. sphaeroides syntrophically interacted with B. thuringiensis/cereus. Protein degradation of B. thuringiensis/cereus provided small molecule substrates ( VFAs) for R. sphaeroides growth and cells materials synthesis.

  13. Brominated lipids identify lipid binding sites on the surface of the reaction center from Rhodobacter sphaeroides.

    Science.gov (United States)

    Roszak, Aleksander W; Gardiner, Alastair T; Isaacs, Neil W; Cogdell, Richard J

    2007-03-20

    This study describes the use of brominated phospholipids to distinguish between lipid and detergent binding sites on the surface of a typical alpha-helical membrane protein. Reaction centers isolated from Rhodobacter sphaeroides were cocrystallized with added brominated phospholipids. X-ray structural analysis of these crystals has revealed the presence of two lipid binding sites from the characteristic strong X-ray scattering from the bromine atoms. These results demonstrate the usefulness of this approach to mapping lipid binding sites at the surface of membrane proteins.

  14. Oxygen-insensitive synthesis of the photosynthetic membranes of Rhodobacter sphaeroides: a mutant histidine kinase.

    OpenAIRE

    Eraso, J M; Kaplan, S

    1995-01-01

    Two new loci, prrB and prrC, involved in the positive regulation of photosynthesis gene expression in response to anaerobiosis, have been identified in Rhodobacter sphaeroides. prrB encodes a sensor histidine kinase that is responsive to the removal of oxygen and functions through the response regulator PrrA. Inactivation of prrB results in a substantial reduction of photosynthetic spectral complexes as well as in the inability of cells to grow photosynthetically at low to medium light intens...

  15. Effect of Photo-Oxidation on Energy Transfer in Light Harvesting Complex (LH2) from Rhodobacter Sphaeroides 601

    Institute of Scientific and Technical Information of China (English)

    LIU Kang-Jun; LIU Wei-Min; YAN Yong-Li; DONG Zhi-Wei; LIU Yuan; XU Chun-He; QIAN Shi-Xiong

    2006-01-01

    @@ We study the photo-oxidation of bacteriochlorophylls (BChls) in peripheral light harvesting complexes (LH2) from rhodobacter sphaeroides by using the steady absorption and the femtosecond pump-probe measurement, to realize the detailed dynamics of LH2 in the presence of photo-oxidation.

  16. Transient dynamic phenotypes as criteria for model discrimination: fold-change detection in Rhodobacter sphaeroides chemotaxis.

    Science.gov (United States)

    Hamadeh, Abdullah; Ingalls, Brian; Sontag, Eduardo

    2013-03-01

    The chemotaxis pathway of the bacterium Rhodobacter sphaeroides shares many similarities with that of Escherichia coli. It exhibits robust adaptation and has several homologues of the latter's chemotaxis proteins. Recent theoretical results have correctly predicted that the E. coli output behaviour is unchanged under scaling of its ligand input signal; this property is known as fold-change detection (FCD). In the light of recent experimental results suggesting that R. sphaeroides may also show FCD, we present theoretical assumptions on the R. sphaeroides chemosensory dynamics that can be shown to yield FCD behaviour. Furthermore, it is shown that these assumptions make FCD a property of this system that is robust to structural and parametric variations in the chemotaxis pathway, in agreement with experimental results. We construct and examine models of the full chemotaxis pathway that satisfy these assumptions and reproduce experimental time-series data from earlier studies. We then propose experiments in which models satisfying our theoretical assumptions predict robust FCD behaviour where earlier models do not. In this way, we illustrate how transient dynamic phenotypes such as FCD can be used for the purposes of discriminating between models that reproduce the same experimental time-series data.

  17. Advancing Rhodobacter sphaeroides as a platform for expression of functional membrane proteins.

    Science.gov (United States)

    Erbakan, Mustafa; Curtis, Brandon S; Nixon, B Tracy; Kumar, Manish; Curtis, Wayne R

    2015-11-01

    Membrane protein overexpression is often hindered by toxic effects on the expression host, limiting achievable volumetric productivity. Moreover, protein structure and function may be impaired due to inclusion body formation and proteolytic degradation. To address these challenges, we employed the photosynthetic bacterium, Rhodobacter sphaeroides for expression of challenging membrane proteins including human aquaporin 9 (hAQP9), human tight junction protein occludin (Occ), Escherichia coli toxin peptide GhoT, cellulose synthase enzyme complex (BcsAB) of R. sphaeroides and cytochrome-cy (Cyt-cy) from Rhodobacter capsulatus. Titers of 47 mg/L for Cyt-cy, 7.5 mg/L for Occ, 1.5 mg/L for BcsAB and 0.5 mg/L for hAQP9 were achieved from affinity purification. While purification of GhoT was not successful, transformants displayed a distinct growth phenotype that correlated with GhoT expression. We also evaluated the functionality of these proteins by performing water transport studies for hAQP9, peroxidase activity for cytochrome-cy, and in vitro cellulose synthesis activity assay for BcsAB. While previous studies with Rhodobacter have utilized oxygen-limited semi-aerobic growth for membrane protein expression, substantial titer improvements are achieved as a result of a 3-fold increase in biomass yield using the anaerobic photoheterotrophic growth regime, which utilizes the strong native puc promoter. This versatile platform is shown to enable recovery of a wide variety of difficult-to-express membrane proteins in functional form.

  18. Effect of changes in the composition of cellular fatty acids on membrane fluidity of Rhodobacter sphaeroides.

    Science.gov (United States)

    Kim, Eui-Jin; Lee, Jeong K

    2015-02-01

    The cellular fatty acid composition is important for metabolic plasticity in Rhodobacter sphaeroides. We explored the effects of changing the cellular ratio of unsaturated fatty acids (UFAs) to saturated fatty acids (SFAs) in R. sphaeroides by overexpressing several key fatty acid biosynthetic enzymes through the use of expression plasmid pRK415. Bacteria containing the plasmid pRKfabI1 with the fabI1 gene that encodes enoyl-acyl carrier protein (ACP) reductase showed a reduction in the cellular UFA to SFA ratio from 4 (80% UFA) to 2 (65% UFA) and had decreased membrane fluidity and reduced cell growth. Additionally, the ratio of UFA to SFA of the chromatophore vesicles from pRKfabI1 -containing cells was similarly lowered, and the cell had decreased levels of light-harvesting complexes, but no change in intracytoplasmic membrane (ICM) content or photosynthetic (PS) gene expression. Both inhibition of enoyl- ACP reductase with diazaborine and addition of exogenous UFA restored membrane fluidity, cell growth, and the UFA to SFA ratio to wild-type levels in this strain. R. sphaeroides containing the pRKfabB plasmid with the fabB gene that encodes the enzyme β-ketoacyl-ACP synthase I exhibited an increased UFA to SFA ratio from 4 (80% UFA) to 9 (90% UFA), but showed no change in membrane fluidity or growth rate relative to control cells. Thus, membrane fluidity in R. sphaeroides remains fairly unchanged when membrane UFA levels are between 80% and 90%, whereas membrane fluidity, cell growth, and cellular composition are affected when UFA levels are below 80%.

  19. Expression of the gltP gene of Escherichia coli in a glutamate transport-deficient mutant of Rhodobacter sphaeroides restores chemotaxis to glutamate

    NARCIS (Netherlands)

    Jacobs, M.H J; van der Heide, T.; Tolner, B; Driessen, A.J.M.; Konings, W.N

    1995-01-01

    Rhodobacter sphaeroides is chemotactic to glutamate and most other amino acids. In Escherichia coli, chemotaxis involves a membrane-bound sensor that either binds the amino acid directly or interacts with the binding protein loaded with the amino acid. In R. sphaeroides, chemotaxis is thought to req

  20. Kinetics of biological hydrogen production by the photosynthetic bacterium Rhodobacter sphaeroides O.U. 001

    Energy Technology Data Exchange (ETDEWEB)

    Koku, Harun; Eroglu, I. [Middle East Technical Univ., Ankara (Turkey). Dept. of Chemical Engineering; Gunduz, U.; Yucel, M. [Middle East Technical Univ., Ankara (Turkey). Dept. of Biology; Turker, L. [Middle East Technical Univ., Ankara (Turkey). Dept. of Chemistry

    2003-04-01

    The kinetics and the effects of various parameters on hydrogen production by Rhodobacter sphaeroides O.U. 001 were investigated in a batch column photobioreactor. In particular, the effect of the inoculum age and the implementation of a light-dark cycle illumination scheme for emulating natural sunlight have been investigated in detail. The possibility of using yeast extract to replace the rather expensive vitamin mixture in the medium was also studied. The results show that hydrogen production is decreased when the initially inoculated bacteria have a high culture age. Exposure of the bacterial culture to light-dark cycles increased the amount of hydrogen compared to continuous illumination, all other parameters remaining the same. Similarly, the use of yeast extract to replace the vitamins increased the growth and hydrogen production rates, however, with a slight reduction in the total amount of gas produced and the hydrogen fraction in the evolved gas. (Author)

  1. Influence of pigment substitution on the electrochemical properties of Rhodobacter sphaeroides 601 reaction centers

    Institute of Scientific and Technical Information of China (English)

    ZOU; YOnglong(

    2001-01-01

    [1]Deisenhofer. J., Epp, O.. Miki, K. et al., Structure of the protein subunits in the photosynthetic reaction center of Rhodopseudomonas viridis at 3A resolution, Nature, 1985, 318: 618-624.[2]Marcus, R. A., Election transfer reaction in chemistry: Theory and experiment (Nobel lecture), Angewandte Chemie, 1993,32: 1111-1121.[3]Woodbury, N. W., Becker, M., Middendorf, D. et al., Picosecond kinetics of the initial photochemical electron-transfer reaction in bacterial photosynthetic reaction centers, Biochemistry, 1985, 24 (26): 7516-7521.[4]Scheer, H., Struck, A., Bacterial reaction centers with modified tetrapyrrole chromophores, in The Photosynthetic Reaction Center (Ⅰ) (eds. Deisenhofer, J., Norris, J.), San Diego: Academic Press, 1993, 157-192.[5]Meyer, M., Scheer, H., Reaction centers of Rhodobacter sphaeroides R26 containing C-3 acetyl and vinyl (bacterio)pheophytines at sites HA,B, Photosynth. Res., 1995, 44: 55-65.[6]Schmidt, S., Arlt, T., Hamm, P. et al., Energetics of the primary electron transfer reaction revealed by ultrafast spectroscopy on modified bacterial reaction centers, Chem. Phys. Lett., 1994, 223: 116-120.[7]Kennis, J. T. M., Shkuropatov, A. Y., Van Stokkum, I. H. M. et al., Formation of a long-lived P+BA- state in plant pheophytin-exchanged reaction centers of Rhodobacter sphaeroides R26 at low temperature, Biochemistry, 1997, 36:16231-16238.[8]Tasayco, M. L., Carey, J., Ordered self-assembly of polypeptide fragments to form native like dimeric trp repressor, Science. 1992, 255: 594-597.[9]Kong, J. L., Lu, Z. Q., Lvov, Y. M. et al., Direct electrochemistry of cofactor redox sites in a bacterial photosynthetic reaction center protein, J. Am. Chem. Soc., 1998, 120 (29): 7371-7372.[10]Nassar, A. E. F., Bobbitt, J. M., Stuart, J. M. et al., Catalytic reduction of organohalide pollutants by myoglobin in a biomembrane-like surfactant film, J. Am. Chem. Soc., 1995, 117: 10986-10993.[11]Zeng, X. H., Wu, Y

  2. Comparison of aerobic and photosynthetic Rhodobacter sphaeroides 2.4.1 proteomes

    Energy Technology Data Exchange (ETDEWEB)

    Callister, Stephen J.; Nicora, Carrie D.; Zeng, Xiaohua; Roh, Jung Hyeob; Dominguez, Migual; Tavano, Christine; Monroe, Matthew E.; Kaplan, Samuel; Donohue, Timothy; Smith, Richard D.; Lipton, Mary S.

    2006-07-05

    Proteomes from aerobic and photosynthetic grown Rhodobacter sphaeroides 2.4.1 cell cultures were characterized using liquid chromatography-mass spectrometry in conjunction with an accurate mass and elution time (AMT) tag approach. Roughly 8000 high quality peptides were detected that represented 1,445 gene products and 34% of the predicted proteins. The identified proteins corresponded primarily to open reading frames (ORFs) contained within the two chromosomal elements of this bacterium, but a significant number were also observed from ORFs associated with 5 naturally occurring plasmids. Data mining of peptides revealed a number of proteins uniquely detected within the photosynthetic cell culture. Proteins observed in both aerobic respiratory and photosynthetic grown cultures were analyzed semi-quantitatively by comparing their estimated abundances to provide insights into bioenergetic models for aerobic respiration and photosynthesis. Additional emphasis was placed on gene products annotated as hypothetical to gain information as to their potential roles within these two growth conditions. Where possible, transcriptome data for R. sphaeroides obtained under the same culture conditions were compared with these results. This comparative study demonstrated the applicability of the AMT tag approach for high-throughput proteomic analyses of pathways associated with the photosynthetic lifestyle.

  3. Role of the Irr protein in the regulation of iron metabolism in Rhodobacter sphaeroides.

    Directory of Open Access Journals (Sweden)

    Verena Peuser

    Full Text Available In Rhizobia the Irr protein is an important regulator for iron-dependent gene expression. We studied the role of the Irr homolog RSP_3179 in the photosynthetic alpha-proteobacterium Rhodobacter sphaeroides. While Irr had little effect on growth under iron-limiting or non-limiting conditions its deletion resulted in increased resistance to hydrogen peroxide and singlet oxygen. This correlates with an elevated expression of katE for catalase in the Irr mutant compared to the wild type under non-stress conditions. Transcriptome studies revealed that Irr affects the expression of genes for iron metabolism, but also has some influence on genes involved in stress response, citric acid cycle, oxidative phosphorylation, transport, and photosynthesis. Most genes showed higher expression levels in the wild type than in the mutant under normal growth conditions indicating an activator function of Irr. Irr was however not required to activate genes of the iron metabolism in response to iron limitation, which showed even stronger induction in the absence of Irr. This was also true for genes mbfA and ccpA, which were verified as direct targets for Irr. Our results suggest that in R. sphaeroides Irr diminishes the strong induction of genes for iron metabolism under iron starvation.

  4. Proteomic characterization of the Rhodobacter sphaeroides 2.4.1 photosynthetic membrane: Identification of New Proteins

    Energy Technology Data Exchange (ETDEWEB)

    Zeng, Xiaohua; Roh, Jung Hyeob; Callister, Stephen J.; Tavano, Christine; Donohue, Timothy; Lipton, Mary S.; Kaplan, Samuel

    2007-10-01

    The intracytoplasmic membrane (ICM) system develops, upon induction, as a structure dedicated to the major events of bacterial photosynthesis, including harvesting light energy, primary charge separation, and electron transport. In this study, multi-chromatographic methods coupled with fourier transform ion cyclotron resonance (FTICR) mass spectrometer, combined with subcellular fractionation, was applied to an investigation of the supramolecular composition of the native photosynthetic membrane of Rhodobacter sphaeroides 2.4.1. A complete proteomic profile of the intracytoplasmic membranes was obtained and the results showed that the intracytoplasmic membranes are mainly composed of four photosynthetic membrane protein complexes, including light harvesting complexes I and II, the reaction center and cytochrome bc1, as well as two new membrane protein components, an unknown protein (RSP1760) and a possible alkane hydroxylase. Proteins necessary for various cellular functions, such as ATP synthesis, respiratory components, ABC transporters, protein translocation, and other proteins with unknown functions were also identified in association with the intracytoplasmic membranes. This study opens a new perspective on the characterization and understanding of the photosynthetic supramolecular complexes of R. sphaeroides, and their internal interactions as well as interactions with other proteins inside or outside the intracytoplasmic membranes.

  5. Assembly of functional photosystem complexes in Rhodobacter sphaeroides incorporating carotenoids from the spirilloxanthin pathway.

    Science.gov (United States)

    Chi, Shuang C; Mothersole, David J; Dilbeck, Preston; Niedzwiedzki, Dariusz M; Zhang, Hao; Qian, Pu; Vasilev, Cvetelin; Grayson, Katie J; Jackson, Philip J; Martin, Elizabeth C; Li, Ying; Holten, Dewey; Neil Hunter, C

    2015-02-01

    Carotenoids protect the photosynthetic apparatus against harmful radicals arising from the presence of both light and oxygen. They also act as accessory pigments for harvesting solar energy, and are required for stable assembly of many light-harvesting complexes. In the phototrophic bacterium Rhodobacter (Rba.) sphaeroides phytoene desaturase (CrtI) catalyses three sequential desaturations of the colourless carotenoid phytoene, extending the number of conjugated carbon-carbon double bonds, N, from three to nine and producing the yellow carotenoid neurosporene; subsequent modifications produce the yellow/red carotenoids spheroidene/spheroidenone (N=10/11). Genomic crtI replacements were used to swap the native three-step Rba. sphaeroides CrtI for the four-step Pantoea agglomerans enzyme, which re-routed carotenoid biosynthesis and culminated in the production of 2,2'-diketo-spirilloxanthin under semi-aerobic conditions. The new carotenoid pathway was elucidated using a combination of HPLC and mass spectrometry. Premature termination of this new pathway by inactivating crtC or crtD produced strains with lycopene or rhodopin as major carotenoids. All of the spirilloxanthin series carotenoids are accepted by the assembly pathways for LH2 and RC-LH1-PufX complexes. The efficiency of carotenoid-to-bacteriochlorophyll energy transfer for 2,2'-diketo-spirilloxanthin (15 conjugated CC bonds; N=15) in LH2 complexes is low, at 35%. High energy transfer efficiencies were obtained for neurosporene (N=9; 94%), spheroidene (N=10; 96%) and spheroidenone (N=11; 95%), whereas intermediate values were measured for lycopene (N=11; 64%), rhodopin (N=11; 62%) and spirilloxanthin (N=13; 39%). The variety and stability of these novel Rba. sphaeroides antenna complexes make them useful experimental models for investigating the energy transfer dynamics of carotenoids in bacterial photosynthesis.

  6. Hydrogen gas production by combined systems of Rhodobacter sphaeroides O.U.001 and Halobacterium salinarum in a photobioreactor

    Energy Technology Data Exchange (ETDEWEB)

    Zabut, Baker; El-Kahlout, Kamal [Department of Biochemistry, School of Science, IUG, Gaza (PS); Yuecel, Meral [Department of Biology, Middle East Technical University, 06531 Ankara (Turkey); Guenduez, Ufuk; Tuerker, Lemi [Department of Chemistry, Middle East Technical University, 06531 Ankara (Turkey); Eroglu, Inci [Department of Chemical Engineering, Middle East Technical University, 06531 Ankara (Turkey)

    2006-09-15

    Rhodobacter sphaeroides O.U.001 is a photosynthetic non-sulfur bacterium which produces hydrogen from organic compounds under anaerobic conditions. Halobacterium salinarum is an archaeon and lives under extremely halophilic conditions (4M NaCl). H. salinarum contains a retinal protein bacteriorhodopsin in its purple membrane which acts as a light-driven proton pump. In this study the Rhodobacter sphaeroides O.U.001 culture was combined with different amounts of packed cells of H. salinarum S9 or isolated purple membrane fragments in order to increase the photofermentative hydrogen gas production. The packed cells of H. salinarum have the ability to pump protons upon illumination due to the presence of bacteriorhodopsin. The proton gradient produced may be used for the formation of ATP or protons may be used for H{sub 2} production by R. sphaeroides. Similar to intact cells purple membrane fragments may also form vesicles around certain ions and may act like closed systems. The hydrogen production experiments were carried out using 400ml water-jacketed-glass column stirred photobioreactors. In combined systems 10-200nmol of bacteriorhodopsin was used. Hydrogen gas production was enhanced by four- to sixfold in combined systems of H. salinarum packed cells with R. sphaeroides O.U.001 cell. Stirring both increased the total gas produced and enhanced the rate of hydrogen production. The light energy conversion efficiency was increased from 0.6% to 2.25% in combined systems. (author)

  7. 5-Aminolevulinate production by Escherichia coli containing the Rhodobacter sphaeroides hemA gene

    Energy Technology Data Exchange (ETDEWEB)

    Van Der Werf, M.J. [Michigan State Univ., East Lansing, MI (United States); Zeikus, J.G. [Michigan State Univ., East Lansing, MI (United States)]|[MBI International, Lansing, MI (United States)

    1996-10-01

    The Rhodobacter sphaeroides hemA gene codes for 5-aminolevulinate (ALA) synthase. This enzyme catalyzes the pyridoxal phosphate-dependent condensation of succinyl coenzyme A and glycine-forming ALA. The R. sphaeroides hemA gene in the pUC18/19 vector system was transformed into Escherichia coli. The effects of both genetic and physiological factors on the expression of ALA synthase and the production of ALA were studied. ALA synthase activity levels were maximal when hemA had the same transcription direction as the lac promoter. The distance between the lac promoter and hemA affected the expression of ALA synthase on different growth substrates. The E. coli host strain used had an enormous effect on the ALA synthase activity level and on the production of ALA, with E. coli DH1 being best suited. The ALA synthase activity level was also dependent on the carbon source. Succinate, L-malate, fumarate, and L-aspartate gave the highest levels of ALA synthase activity, while the use of lactose as a carbon source resulted in a repression of ALA synthase. After growth on succinate, ALA synthase represented {approx}5% of total cellular protein. The ALA synthase activity level was also dependent on the pH of the medium, with maximal activity occurring at pH 6.5. ALA production by whole cells was limited by the availability of glycine, and the addition of 2 g of glycine per liter to the growth medium increased the production of ALA fivefold, to 2.25 mM. In recombinant E. coli extracts, up to 22 mM ALA was produced from succinate, glycine, and ATP. 58 refs., 4 figs., 7 tabs.

  8. Influence of pigment substitution on the electrochemical properties of Rhodobacter sphaeroides 601 reaction centers

    Institute of Scientific and Technical Information of China (English)

    邹永龙; 赵杰权; 陈志龙; 孔继烈; 曾小华; 徐春和

    2001-01-01

    With the help of pigment substitution, self-assembled monolayer film and square wave voltammetry, the influence of pigment substitution on the electrochemical properties of Rhodobacter sphaeroides 601 reaction centers was investigated. Results showed that the charge separation could also be driven by externally electric field, similar to the primary photochemical reaction in purple bacterial reaction center. On the surface of Au electrode, a self-assembled monolayer film (the RC-PDDA-DMSA film) was made up of 2,3-dimercaptosuccinic acid (DMSA), poly-dimeth-yldiallylammonium chloride (PDDA) and reaction center (RC). When square wave voltammetry was used to study the RC-PDDA-DMSA film, four redox pairs in the photochemical reaction of RC were observed by changing frequency. With nonlinear fitting, the standard potential of P/P+ and the corresponding electrode reaction rate constant were determined to be 0.522 V and 13.04 S-1, respectively. It was found that the redox peak at -0.02 V changed greatly when bacteriopheophytin was substituted by plant pheophytin in the reaction center. Further studies indicated that this change resulted from the decrease in electron transfer rate between Bphe-/Bphe (Phe-/Phe) and QA-/QA after pigment substitution. After investigations of spectra and electrochemical properties of different RCs and comparisons of different function groups of pigments, it was indicated that the phytyl tail, similar to other substituted groups of pheophytin, affected the efficiencies of pigment substitution.

  9. Replacement of bacteriopheophytin in reaction centers from Rhodobacter sphaeroides RS601 with plant pheophytin

    Institute of Scientific and Technical Information of China (English)

    2000-01-01

    In the presence of acetone and an excess of exogenous plant pheophytins,bacteriopheophytins in the reaction centers from Rhodobacter sphaeroides RS601 were replaced by pheophytins at sites HA and HB,when incubated at 43.5℃ for more than 15 min.The substitution of bacteriopheophytins in the reaction centers was 50% and 71% with incubation of 15 and 60 min,respectively.In the absorption spectra of pheophytin-replaced reaction centers (Phe RCs),bands assigned to the transition moments QX (537 nm) and QY (758 nm) of bacteriopheophytin disappeared,and three distinct bands assigned to the transition moments QX (509/542 nm) and QY (674 nm) of pheophytin appeared instead.Compared to that of the control reaction centers,the photochemical activities of Phe RCs are 78% and 71% of control,with the incubation time of 15 and 60 min.Differences might exist between the redox properties of Phe RC and of native reaction centers,but the substitution is significant,and the new system is available for further studies.

  10. Replacement of bacteriopheophytin in reaction centers from Rhodobacter sphaeroides RS601 with plant pheophytin

    Institute of Scientific and Technical Information of China (English)

    曾小华; 吴永强; 沈允钢; 徐春和

    2000-01-01

    In the presence of acetone and an excess of exogenous plant pheophytins, bacterio-pheophytins in the reaction centers from Rhodobacter sphaeroides RS601 were replaced by pheophytins at sites HA and HB, when incubated at 43.5℃ for more than 15 min. The substitution of bacteriopheophytins in the reaction centers was 50% and 71% with incubation of 15 and 60 min, respectively. In the absorption spectra of pheophytin-replaced reaction centers (Phe RCs), bands assigned to the transition moments Qx (537 nm) and QY (758 nm) of bacteriopheophytin disappeared, and three distinct bands assigned to the transition moments Qx (509/542 nm) and QY (674 nm) of pheophytin appeared instead. Compared to that of the control reaction centers, the photochemical activities of Phe RCs are 78% and 71% of control, with the incubation time of 15 and 60 min. Differences might exist between the redox properties of Phe RC and of native reaction centers, but the substitution is significant, and the new system is available for further

  11. Transient grating spectroscopy in photosynthetic purple bacteria Rhodobacter sphaeroides 2.4.1

    Energy Technology Data Exchange (ETDEWEB)

    Sugisaki, Mitsuru, E-mail: mitsuru@sci.osaka-cu.ac.j [CREST-JST and Graduate School of Science, Osaka City University, 3-3-138 Sugimoto, Sumiyoshi, Osaka 558-8585 (Japan); Fujiwara, Masazumi; Fujii, Ritsuko [CREST-JST and Graduate School of Science, Osaka City University, 3-3-138 Sugimoto, Sumiyoshi, Osaka 558-8585 (Japan); Nakagawa, Katsunori; Nango, Mamoru [CREST-JST and Graduate School of Engineering, Nagoya Institute of Technology, Gokiso, Showa, Nagoya 466-8555 (Japan); Cogdell, Richard J. [Glasgow Biomedical Research Centre, IBLS, University of Glasgow, 126 University Place, Glasgow G12 8TA, Scotland (United Kingdom); Hashimoto, Hideki [CREST-JST and Graduate School of Science, Osaka City University, 3-3-138 Sugimoto, Sumiyoshi, Osaka 558-8585 (Japan)

    2009-12-15

    The vibronic coherence of photosynthetic pigment-protein complexes has been investigated by means of transient grating spectroscopy using sub 20 fs optical pulses. In the present work, we focus our attention on the LH2 antenna complexes from Rhodobacter sphaeroides 2.4.1 because the information about their structure investigated by the electron and atomic force microscopy is available and the electric levels of pigments are well resolved, resulting in clear absorption spectrum. The vibronic coherent oscillations with a period of a few tens of femtoseconds have been clearly observed. We found that the temporal change of the coherent oscillations reflects the vibrational relaxation in the ground state. Calculations based on the Brownian oscillator model were performed under the impulsive excitation limit. The spectral density has been determined from the Raman measurement of spheroidene. Good agreement between the calculation and the experimental results has been achieved in the linear absorption spectrum and transient grating signal, which strongly supports the validity of our model.

  12. An Extract of Rhodobacter sphaeroides Reduces Cisplatin-Induced Nephrotoxicity in Mice

    Directory of Open Access Journals (Sweden)

    Wen-Wei Chang

    2013-11-01

    Full Text Available Cisplatin is used as a treatment for various types of solid tumors. Renal injury severely limits the use of cisplatin. Renal cell apoptosis, oxidative stress, and inflammation contribute to cisplatin-induced nephrotoxicity. Previously, we found that an extract of Rhodobacter sphaeroides (Lycogen™ inhibited proinflammatory cytokines and the production of nitric oxide in activated macrophages in a dextran sodium sulfate (DSS-induced colitis model. Here, we evaluated the effect of Lycogen™, a potent anti-inflammatory agent, in mice with cisplatin-induced renal injury. We found that attenuated renal injury correlated with decreased apoptosis due to a reduction in caspase-3 expression in renal cells. Oral administration of Lycogen™ significantly reduced the expression of tumor necrosis factor-α and interleukin-1β in mice with renal injury. Lycogen™ reduces renal dysfunction in mice with cisplatin-induced renal injury. The protective effects of the treatment included blockage of the cisplatin-induced elevation in serum urea nitrogen and creatinine. Meanwhile, Lycogen™ attenuated body weight loss and significantly prolonged the survival of mice with renal injury. We propose that Lycogen™ exerts anti-inflammatory activities that represent a promising strategy for the treatment of cisplatin-induced renal injury.

  13. Brewery wastewaters in photobiological hydrogen generation in presence of Rhodobacter sphaeroides O.U. 001

    Energy Technology Data Exchange (ETDEWEB)

    Seifert, K.; Waligorska, M.; Laniecki, M. [Faculty of Chemistry, A. Mickiewicz University, Grunwaldzka 6, 60-780 Poznan (Poland)

    2010-05-15

    Rhodobacter sphaeroides O.U. 001 (concentration of inoculum-0.36 g dry wt/l) and brewery wastewaters were applied in photobiogeneration of hydrogen under illumination of 116 W/m{sup 2}. The best results were obtained with filtered wastewaters sterilized at 120 C for 20 min and maximal concentration of waste in medium equal 10% v/v. The main product in generated biogas was hydrogen (90%). After sterilization the amount of generated hydrogen was tripled (from 0.76 to 2.2 l H{sub 2}/l medium), whereas waste concentration of 10% v/v resulted in the best substrate yield (0.22 l H{sub 2}/l of waste). Under these conditions the amount of generated hydrogen was 2.24 l H{sub 2}/l medium and light conversion efficiency reached value of 1.7%. The modified Gompertz equations served in modeling of the kinetics of the studied process. (author)

  14. Modification of galactitol dehydrogenase from Rhodobacter sphaeroides D for immobilization on polycrystalline gold surfaces.

    Science.gov (United States)

    Kornberger, P; Gajdzik, J; Natter, H; Wenz, G; Giffhorn, F; Kohring, G W; Hempelmann, R

    2009-10-20

    Galactitol dehydrogenase (GatDH) from Rhodobacter sphaeroides is a multifunctional enzyme that catalyzes in the presence of oxidized beta-nicotinamide adenine dinucleotide (NAD(+)) the interconversion of various multivalent aliphatic alcohols to the corresponding ketones. The recombinant GatDH was provided with an N-terminal His(6)-tag to which distally up to three cysteine residues were attached. This protein construct maintained nearly full enzymatic activity, and it could be covalently immobilized via thiol bonds onto the surface of a gold electrode. Binding of GatDH onto the gold electrode was verified by SPR measurements, and residual enzyme activity was measured by cyclic voltammetry using 1,2-hexanediol as substrate, the cofactor NAD(+) and the redox mediator CTFM (4-carboxy-2,5,7-trinitrofluorenyliden-malonnitrile) in solute form. The results demonstrate the possibility of a directed functional immobilization of proteins on gold surfaces, which represents a proof-of-concept for the development of reactors for electrochemical synthon preparation using dehydrogenases.

  15. Acquirement and characterization of a carotenoid mutant (GM309) of Rhodobacter sphaeroides 601

    Institute of Scientific and Technical Information of China (English)

    LIU Yuan; ZHANG Wei; WU Yongqiang; XU Chunhe

    2004-01-01

    A green mutant was obtained among the chemically induced mutants of Rhodobacter sphaeroides 601 (RS601) and named GM309. A blue shift of 20 nm of the carotenoid absorption spectrum was found in the light-harvesting complex II (LH2) of GM309. Different from LH2 of RS601, it was found that the carotenoids in GM309-LH2 changed to be neurosporene by mutation. Neurosporene lacks a conjugate double bond, compared with the spheroidene in RS601-LH2 which has ten conjugate double bonds. As shown by absorption and circular dichroism spectroscopy, the overall structure of GM309-LH2 is little affected by this change. From fluorescence emission spectra, it is found that GM309-LH2 can transfer energy from carotenoids to Bchl-B850 without any change in efficiency. But the efficiency of energy transfer from B800 to B850 in GM309-LH2 is decreased to be 42% of that of the native. This work would provide a novel method to investigate the mechanism of excitation energy transfer in LH2.

  16. In vitro assessment of gastrointestinal viability of two photosynthetic bacteria, Rhodopseudomonas palustris and Rhodobacter sphaeroides

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    The objectives of this study were to assess the potential of two photosynthetic bacteria (PSB), Rhodopseudomonas palustris HZ0301 and Rhodobacter sphaeroides HZ0302, as probiotics in aquaculture. The viability of HZ0301 and HZ0302 in simulated gastric transit conditions (pH 2.0, pH 3.0 and pH 4.0 gastric juices) and in simulated small intestinal transit conditions (pH 8.0, with or without 0.3% bile salts) was tested. The effects of HZ0301 and HZ0302 on the viability and permeability of intestinal epithelial cell in primary culture of tilapias, Oreochromis nilotica, were also detected. All the treatments were determined with three replicates. The simulated gastric transit tolerance of HZ0301 and HZ0302 strains was pH-dependent and correspondingly showed lower viability at pH 2.0 after 180 min compared with pH 3.0 and pH 4.0. Both HZ0301 and HZ0302 were tolerant to simulated small intestine transit with or without bile salts in our research. Moreover, there was no significant difference (P>0.05) among three treatments including the control and the groups treated with HZ0301 or HZ0302 both in intestinal epithelial cell viability and membrane permeability, showing no cell damage. In summary, this study demonstrated that HZ0301 and HZ0302 had high capacity of upper gastrointestinal transit tolerance and were relatively safe for intestinal epithelial cells of tilapias.

  17. Bioremediation of petroleum hydrocarbon contaminated soil by Rhodobacter sphaeroides biofertilizer and plants.

    Science.gov (United States)

    Jiao, Haihua; Luo, Jinxue; Zhang, Yiming; Xu, Shengjun; Bai, Zhihui; Huang, Zhanbin

    2015-09-01

    Bio-augmentation is a promising technique for remediation of polluted soils. This study aimed to evaluate the bio-augmentation effect of Rhodobacter sphaeroides biofertilizer (RBF) on the bioremediation of total petroleum hydrocarbons (TPH) contaminated soil. A greenhouse pot experiment was conducted over a period of 120 days, three methods for enhancing bio-augmentation were tested on TPH contaminated soils, including single addition RBF, planting, and combining of RBF and three crop species, such as wheat (W), cabbage (C) and spinach (S), respectively. The results demonstrated that the best removal of TPH from contaminated soil in the RBF bio-augmentation rhizosphere soils was found to be 46.2%, 65.4%, 67.5% for W+RBF, C+RBF, S+RBF rhizosphere soils respectively. RBF supply impacted on the microbial community diversity (phospholipid fatty acids, PLFA) and the activity of soil enzymes, such as dehydrogenase (DH), alkaline phosphatase (AP) and urease (UR). There were significant difference among the soil only containing crude oil (CK), W, C and S rhizosphere soils and RBF bio-augmentation soils. Moreover, the changes were significantly distinct depended on crops species. It was concluded that the RBF is a valuable material for improving effect of remediation of TPH polluted soils.

  18. The Extract of Rhodobacter sphaeroides Inhibits Melanogenesis through the MEK/ERK Signaling Pathway

    Directory of Open Access Journals (Sweden)

    Chen-Hsun Liu

    2013-06-01

    Full Text Available Reducing hyperpigmentation has been a big issue for years. Even though pigmentation is a normal mechanism protecting skin from UV-causing DNA damage and oxidative stress, it is still an aesthetic problem for many people. Bacteria can produce some compounds in response to their environment. These compounds are widely used in cosmetic and pharmaceutical applications. Some probiotics have immunomodulatory activities and modulate the symptoms of several diseases. Previously, we found that the extracts of Rhodobacter sphaeroides (Lycogen™ inhibited nitric oxide production and inducible nitric-oxide synthase expression in activated macrophages. In this study, we sought to investigate an anti-melanogenic signaling pathway in α-melanocyte stimulating hormone (α-MSH-treated B16F10 melanoma cells and zebrafish. Treatment with Lycogen™ inhibited the cellular melanin contents and expression of melanogenesis-related protein, including microphthalmia-associated transcription factor (MITF and tyrosinase in B16F10 cells. Moreover, Lycogen™ reduced phosphorylation of MEK/ERK without affecting phosphorylation of p38. Meanwhile, Lycogen™ decreased zebrafish melanin expression in a dose-dependent manner. These findings establish Lycogen™ as a new target in melanogenesis and suggest a mechanism of action through the ERK signaling pathway. Our results suggested that Lycogen™ may have potential cosmetic usage in the future.

  19. Transcriptional Activation of the Rhodobacter sphaeroides Cytochrome c2 Gene P2 Promoter by the Response Regulator PrrA

    OpenAIRE

    Comolli, James C; Carl, Audrey J.; Hall, Christine; Donohue, Timothy

    2002-01-01

    Anoxygenic photosynthetic growth of Rhodobacter sphaeroides, a member of the α subclass of the class Proteobacteria, requires the response regulator PrrA. PrrA and the sensor kinase PrrB are part of a two-component signaling pathway that influences a wide range of processes under oxygen-limited conditions. In this work we characterized the pathway of transcription activation by PrrB and PrrA by purifying these proteins, analyzing them in vitro, and characterizing a mutant PrrA protein in vivo...

  20. Mutational analysis of the C-terminal domain of the Rhodobacter sphaeroides response regulator PrrA

    OpenAIRE

    Jones, Denise F.; Stenzel, Rachelle A.; Donohue, Timothy J.

    2005-01-01

    The Rhodobacter sphaeroides response regulator PrrA directly activates transcription of genes necessary for energy conservation at low O2 tensions and under anaerobic conditions. It is proposed that PrrA homologues contain a C-terminal DNA-binding domain (PrrA-CTD) that lacks significant amino acid sequence similarity to those found in other response regulators. To test this hypothesis, single amino acid substitutions were created at 12 residues in the PrrA-CTD. These mutant PrrA proteins wer...

  1. Multi-PAS domain-mediated protein oligomerization of PpsR from Rhodobacter sphaeroides

    Energy Technology Data Exchange (ETDEWEB)

    Heintz, Udo; Meinhart, Anton; Winkler, Andreas, E-mail: andreas.winkler@mpimf-heidelberg.mpg.de [Max Planck Institute for Medical Research, Heidelberg (Germany)

    2014-03-01

    Crystal structures of two truncated variants of the transcription factor PpsR from R. sphaeroides are presented that enabled the phasing of a triple PAS domain construct. Together, these structures reveal the importance of α-helical PAS extensions for multi-PAS domain-mediated protein oligomerization and function. Per–ARNT–Sim (PAS) domains are essential modules of many multi-domain signalling proteins that mediate protein interaction and/or sense environmental stimuli. Frequently, multiple PAS domains are present within single polypeptide chains, where their interplay is required for protein function. Although many isolated PAS domain structures have been reported over the last decades, only a few structures of multi-PAS proteins are known. Therefore, the molecular mechanism of multi-PAS domain-mediated protein oligomerization and function is poorly understood. The transcription factor PpsR from Rhodobacter sphaeroides is such a multi-PAS domain protein that, in addition to its three PAS domains, contains a glutamine-rich linker and a C-terminal helix–turn–helix DNA-binding motif. Here, crystal structures of two N-terminally and C-terminally truncated PpsR variants that comprise a single (PpsR{sub Q-PAS1}) and two (PpsR{sub N-Q-PAS1}) PAS domains, respectively, are presented and the multi-step strategy required for the phasing of a triple PAS domain construct (PpsR{sub ΔHTH}) is illustrated. While parts of the biologically relevant dimerization interface can already be observed in the two shorter constructs, the PpsR{sub ΔHTH} structure reveals how three PAS domains enable the formation of multiple oligomeric states (dimer, tetramer and octamer), highlighting that not only the PAS cores but also their α-helical extensions are essential for protein oligomerization. The results demonstrate that the long helical glutamine-rich linker of PpsR results from a direct fusion of the N-cap of the PAS1 domain with the C-terminal extension of the N-domain that

  2. Identification of key residues that confer Rhodobacter sphaeroides LPS activity at horse TLR4/MD-2.

    Directory of Open Access Journals (Sweden)

    Katherine L Irvine

    Full Text Available The molecular determinants underpinning how hexaacylated lipid A and tetraacylated precursor lipid IVa activate Toll-like receptor 4 (TLR4 are well understood, but how activation is induced by other lipid A species is less clear. Species specificity studies have clarified how TLR4/MD-2 recognises different lipid A structures, for example tetraacylated lipid IVa requires direct electrostatic interactions for agonism. In this study, we examine how pentaacylated lipopolysaccharide from Rhodobacter sphaeroides (RSLPS antagonises human TLR4/MD-2 and activates the horse receptor complex using a computational approach and cross-species mutagenesis. At a functional level, we show that RSLPS is a partial agonist at horse TLR4/MD-2 with greater efficacy than lipid IVa. These data suggest the importance of the additional acyl chain in RSLPS signalling. Based on docking analysis, we propose a model for positioning of the RSLPS lipid A moiety (RSLA within the MD-2 cavity at the TLR4 dimer interface, which allows activity at the horse receptor complex. As for lipid IVa, RSLPS agonism requires species-specific contacts with MD-2 and TLR4, but the R2 chain of RSLA protrudes from the MD-2 pocket to contact the TLR4 dimer in the vicinity of proline 442. Our model explains why RSLPS is only partially dependent on horse TLR4 residue R385, unlike lipid IVa. Mutagenesis of proline 442 into a serine residue, as found in human TLR4, uncovers the importance of this site in RSLPS signalling; horse TLR4 R385G/P442S double mutation completely abolishes RSLPS activity without its counterpart, human TLR4 G384R/S441P, being able to restore it. Our data highlight the importance of subtle changes in ligand positioning, and suggest that TLR4 and MD-2 residues that may not participate directly in ligand binding can determine the signalling outcome of a given ligand. This indicates a cooperative binding mechanism within the receptor complex, which is becoming increasingly

  3. Direct Visualization of Exciton Reequilibration in the LH1 and LH2 Complexes of Rhodobacter sphaeroides by Multipulse Spectroscopy

    Science.gov (United States)

    Cohen Stuart, Thomas A.; Vengris, Mikas; Novoderezhkin, Vladimir I.; Cogdell, Richard J.; Hunter, C. Neil; van Grondelle, Rienk

    2011-01-01

    The dynamics of the excited states of the light-harvesting complexes LH1 and LH2 of Rhodobacter sphaeroides are governed, mainly, by the excitonic nature of these ring-systems. In a pump-dump-probe experiment, the first pulse promotes LH1 or LH2 to its excited state and the second pulse dumps a portion of the excited state. By selective dumping, we can disentangle the dynamics normally hidden in the excited-state manifold. We find that by using this multiple-excitation technique we can visualize a 400-fs reequilibration reflecting relaxation between the two lowest exciton states that cannot be directly explored by conventional pump-probe. An oscillatory feature is observed within the exciton reequilibration, which is attributed to a coherent motion of a vibrational wavepacket with a period of ∼150 fs. Our disordered exciton model allows a quantitative interpretation of the observed reequilibration processes occurring in these antennas. PMID:21539791

  4. Direct Visualization of Exciton Reequilibration in the LH1 and LH2 Complexes of Rhodobacter sphaeroides by Multipulse Spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Stuart, Thomas A. Cohen [Free Univ. of Amsterdam (Netherlands); Vengris, Mikas [Vilnius Univ. (Lithuania); Novoderezhkin, Vladimir I. [A.N. Belozersky Inst. of Physico-Chemical Biology, Moscow State Univ. (Russia); Cogdell, Richard J. [Microbial Photosynthesis Laboratory, Glasgow Biomedical Research Centre, Univ. of Glasgow (United Kingdom); Hunter, C. Neil [Department of Molecular Biology and Biotechnology, Univ. of Sheffield, (United Kingdom); van Grondelle, Rienk [Free Univ. of Amsterdam (Netherlands)

    2011-01-01

    The dynamics of the excited states of the light-harvesting complexes LH1 and LH2 of Rhodobacter sphaeroides are governed, mainly, by the excitonic nature of these ring-systems. In a pump-dump-probe experiment, the first pulse promotes LH1 or LH2 to its excited state and the second pulse dumps a portion of the excited state. By selective dumping, we can disentangle the dynamics normally hidden in the excited-state manifold. We find that by using this multiple-excitation technique we can visualize a 400-fs reequilibration reflecting relaxation between the two lowest exciton states that cannot be directly explored by conventional pump-probe. An oscillatory feature is observed within the exciton reequilibration, which is attributed to a coherent motion of a vibrational wavepacket with a period of ~150 fs. Our disordered exciton model allows a quantitative interpretation of the observed reequilibration processes occurring in these antennas.

  5. Biohydrogen and polyhydroxyalkanoate co-production by Enterobacter aerogenes and Rhodobacter sphaeroides from Calophyllum inophyllum oil cake.

    Science.gov (United States)

    Arumugam, A; Sandhya, M; Ponnusami, V

    2014-07-01

    The feasibility of coupled biohydrogen and polyhydroxyalkanoate production by Enterobacter aerogenes and Rhodobacter sphaeroides using Calophyllum inophyllum oil cake was studied under dark and photo fermentation conditions. The utilization of a non-edible acidic oil cake (C. inophyllum), and exploitation of a modified minimal salt media led to reduction in the cost of media. Cost of fermentation is reduced by implementation of alternate dark-photo fermentative periods and through the use of a co-culture consisting of a dark fermentative (E. aerogenes) and a photo fermentative (R. sphaeroides) bacterium. The biohydrogen and polyhydroxyalkanoate produced were 7.95 L H2/L media and 10.73 g/L media, respectively, under alternate dark and photo fermentation and were 3.23 L H2/L media and 5.6g/L media, respectively under complete dark fermentation. The characteristics of the oil cake and alternate dark (16 h) and photo (8h) fermentative conditions were found to be supportive in producing high biohydrogen and polyhydroxyalkanoate (PHA) yield.

  6. Experimental measurements of the radiation characteristics of Anabaena variabilis ATCC 29413-U and Rhodobacter sphaeroides ATCC 49419

    Energy Technology Data Exchange (ETDEWEB)

    Berberoglu, Halil; Pilon, Laurent [Mechanical and Aerospace Engineering Department, Henry Samueli School of Engineering and Applied Science, University of California Los Angeles, Los Angeles, CA 90095 (United States)

    2007-12-15

    The objective of this study is to experimentally measure the radiation characteristics of hydrogen producing microorganisms. Special attention is paid to the filamentous cyanobacteria Anabaena variabilis ATCC 29413-U and the unicellular purple bacteria Rhodobacter sphaeroides ATCC 49419 two of the widely studied photobiological hydrogen producers. The extinction and absorption coefficients are measured in the spectral range from 300 to 1300 nm using a spectrophotometer with and without an integrating sphere. Moreover, a nephelometer has been constructed to measure the scattering phase function of the microorganisms at 632.8 nm. The data are used to recover the mass specific absorption, scattering, and extinction cross-sections, the single scattering albedo, and the scattering phase function of the microorganisms. The scattering phase functions of both microorganisms were peaked strongly in the forward direction as expected from their size parameter and shape. The results reported in this study can be used with the radiative transport equation (RTE) to accurately predict and optimize light transport in photobioreactors for photobiological hydrogen production. Finally, the results show that absorption cross-sections of A. variabilis and R. sphaeroides have peaks that do not overlap but rather enlarge the spectral width of the absorption cross-section of a potential symbiotic culture promising more efficient utilization of solar radiation from light transfer point of view. (author)

  7. Local electrostatic field induced by the carotenoid bound to the reaction center of the purple photosynthetic bacterium Rhodobacter sphaeroides.

    Science.gov (United States)

    Yanagi, Kazuhiro; Shimizu, Madoka; Hashimoto, Hideki; Gardiner, Alastair T; Roszak, Aleksander W; Cogdell, Richard J

    2005-01-20

    Electroabsorption (EA) spectra were recorded in the region of the reaction center (RC) Qy absorption bands of bacteriochlorophyll (Bchl) and bacteriopheophytin, to investigate the effect of carotenoid (Car) on the electrostatic environment of the RCs of the purple bacterium Rhodobacter (Rb.) sphaeroides. Two different RCs were prepared from Rb. sphaeroides strain R26.1 (R26.1-RC); R26.1 RC lacking Car and a reconstituted RC (R26.1-RC+ Car) prepared by incorporating a synthetic Car (3,4-dihydrospheroidene). Although there were no detectable differences between these two RCs in their near infrared (NIR) absorption spectra at 79 and 293 K, or in their EA spectra at 79 K, significant differences were detected in their EA spectra at 293 K. Three nonlinear optical parameters of each RC were determined in order to evaluate quantitatively these differences; transition dipole-moment polarizability and hyperpolarizability (D factor), the change in polarizability upon photoexcitation (Deltaalpha), and the change in dipole-moment upon photoexcitation (Deltamu). The value of D or Deltaalpha determined for each absorption band of the two RC samples showed similar values at 77 or 293 K. However, the Deltamu values of the special pair Bchls (P) and the monomer Bchls absorption bands showed significant differences between the two RCs at 293 K. X-ray crystallography of the two RCs has revealed that a single molecule of the solubilizing detergent LDAO occupies part of the carotenoid binding site in the absence of a carotenoid. The difference in the value of Deltamu therefore represents the differential effect of the detergent LDAO and the carotenoid on P. The change of electrostatic field around P induced by the presence of Car was determined to be 1.7 x 10(5) [V/cm], corresponding to a approximately 10% change in the electrostatic field around P.

  8. Coenzyme Q10 production in a 150-l reactor by a mutant strain of Rhodobacter sphaeroides.

    Science.gov (United States)

    Kien, Nguyen Ba; Kong, In-Soo; Lee, Min-Gyu; Kim, Joong Kyun

    2010-05-01

    For the commercial production of CoQ(10), batch-type fermentations were attempted in a 150-l fermenter using a mutant strain of R. sphaeroides. Optimum temperature and initial aeration rate were found to be 30 degrees C and 2 vvm, respectively. Under optimum fermentation conditions, the maximum value of specific CoQ(10) content was achieved reproducibly as 6.34 mg/g DCW after 24 h, with 3.02 g/l of DCW. During the fermentation, aeration shift (from the adequate aeration at the early growth phase to the limited aeration in active cellular metabolism) was a key factor in CoQ(10) production for scale-up. A higher value of the specific CoQ(10) content (8.12 mg/g DCW) was achieved in fed-batch fermentation and comparable to those produced by the pilot-scale fed-batch fermentations of A. tumefaciens, which indicated that the mutant strain of R. sphaeroides used in this study was a potential high CoQ(10) producer. This is the first detailed study to demonstrate a pilot-scale production of CoQ(10) using a mutant strain of R. sphaeroides.

  9. Orientation of the Q{sub y} optical transition moment of bacteriopheophytin in Rhodobacter sphaeroides reaction centers

    Energy Technology Data Exchange (ETDEWEB)

    Klenina, I.B.; Borovykh, I.V.; Shkuropatov, A.Ya.; Gast, P.; Proskuryakov, I.I

    2003-11-01

    Time-resolved cw EPR measurements of the Rhodobacter (Rb) sphaeroides R-26 reaction center primary donor triplet state excited with plane-polarised light are reported. The pigment composition of the reaction center was chemically modified, so that the bacteriopheophytin molecule in the cofactor branch which is inactive towards electron transfer was replaced by plant pheophytin a. This enabled selective excitation of the bacteriopheophytin and pheophytin molecules, and provided conditions for a high-quality magnetophotoselection study. For the first time, orientation of the Q{sub y} optical transition dipole moment relative to the molecular frame of the bacteriopheophytin in the active cofactor branch is determined. Of the four orientations allowed by magnetophotoselection, one was chosen as the most plausible. The corresponding Q{sub y} vector is tilted from the bacteriopheophytin tetrapyrrole plane by 15 deg. , and projects onto this plane almost on the y-molecular axis. It is suggested that the deviation of the vector from the molecular plane results from an interaction of bacteriopheophytin with the neighbouring molecule of accessory bacteriochlorophyll.

  10. Optimization of Biomass and 5-Aminolevulinic Acid Production by Rhodobacter sphaeroides ATCC17023 via Response Surface Methodology.

    Science.gov (United States)

    Liu, Shuli; Zhang, Guangming; Li, Jianzheng; Li, Xiangkun; Zhang, Jie

    2016-06-01

    Microbial 5-aminolevulinic acid (ALA) produced from wastewater is considered as potential renewable energy. However, many hurdles are needed to be overcome such as the regulation of key influencing factors on ALA yield. Biomass and ALA production by Rhodobacter sphaeroides was optimized using response surface methodology. The culturing medium was artificial volatile fatty acids wastewater. Three additives were optimized, namely succinate and glycine that are precursors of ALA biosynthesis, and D-glucose that is an inhibitor of ALA dehydratase. The optimal conditions were achieved by analyzing the response surface plots. Statistical analysis showed that succinate at 8.56 mmol/L, glycine at 5.06 mmol/L, and D-glucose at 7.82 mmol/L were the best conditions. Under these optimal conditions, the highest biomass production and ALA yield of 3.55 g/L and 5.49 mg/g-biomass were achieved. Subsequent verification experiments at optimal values had the maximum biomass production of 3.41 ± 0.002 g/L and ALA yield of 5.78 ± 0.08 mg/g-biomass.

  11. Modeling the light- and redox-dependent interaction of PpsR/AppA in Rhodobacter sphaeroides.

    Science.gov (United States)

    Pandey, Rakesh; Flockerzi, Dietrich; Hauser, Marcus J B; Straube, Ronny

    2011-05-18

    Facultative photosynthetic bacteria switch their energy generation mechanism from respiration to photosynthesis depending on oxygen tension and light. Part of this transition is mediated by the aerobic transcriptional repressor PpsR. In Rhodobacter sphaeroides, the repressive action of PpsR is antagonized by the redox- and blue-light-sensitive flavoprotein AppA which results in a unique phenotype: the repression of photosynthesis genes at intermediate oxygen levels and high light intensity, which is believed to reduce the risk of photooxidative stress. To analyze the underlying mechanism we developed a simple mathematical model based on the AppA-dependent reduction of a disulfide bond in PpsR and the light-sensitive complex formation between the reduced forms of AppA and PpsR. A steady-state analysis shows that high light repression can indeed occur at intermediate oxygen levels if PpsR is reduced on a faster timescale than AppA and if the electron transfer from AppA to PpsR is effectively irreversible. The model further predicts that if AppA copy numbers exceed those of PpsR by at least a factor of two, the transition from aerobic to anaerobic growth mode can occur via a bistable regime. We provide necessary conditions for the emergence of bistability and discuss possible experimental verifications.

  12. Concomitant biohydrogen and poly-β-hydroxybutyrate production from dark fermentation effluents by adapted Rhodobacter sphaeroides and mixed photofermentative cultures.

    Science.gov (United States)

    Ghimire, Anish; Valentino, Serena; Frunzo, Luigi; Pirozzi, Francesco; Lens, Piet N L; Esposito, Giovanni

    2016-10-01

    This work aimed at investigating concomitant production of biohydrogen and poly-β-hydroxybutyrate (PHB) by photofermentation (PF) using dark fermentation effluents (DFE). An adapted culture of Rhodobacter sphaeroides AV1b (pH 6.5, 24±2°C) achieved H2 and PHB yields of 256 (±2) NmLH2/g Chemical Oxygen Demand (COD) and 273.8mgPHB/gCOD (32.5±3% of the dry cells weight (DCW)), respectively. When a diluted (1:2) DFE medium was applied to the adapted pure and mixed photofermentative culture, the respective H2 yields were 164.0 (±12) and 71.3 (±6) NmLH2/gCOD and the PHB yields were 212.1 (±105.2) and 50.7 (±2.7) mgPHB/gCOD added, corresponding to 24 (±0.7) and 6.3 (±0) % DCW, respectively. The concomitant H2 and PHB production from the PF process gave a good DFE post treatment achieving up to 80% COD removal from the initial DFE.

  13. Augmenting light coverage for photosynthesis through YFP-enhanced charge separation at the Rhodobacter sphaeroides reaction centre

    Science.gov (United States)

    Grayson, Katie J.; Faries, Kaitlyn M.; Huang, Xia; Qian, Pu; Dilbeck, Preston; Martin, Elizabeth C.; Hitchcock, Andrew; Vasilev, Cvetelin; Yuen, Jonathan M.; Niedzwiedzki, Dariusz M.; Leggett, Graham J.; Holten, Dewey; Kirmaier, Christine; Neil Hunter, C.

    2017-01-01

    Photosynthesis uses a limited range of the solar spectrum, so enhancing spectral coverage could improve the efficiency of light capture. Here, we show that a hybrid reaction centre (RC)/yellow fluorescent protein (YFP) complex accelerates photosynthetic growth in the bacterium Rhodobacter sphaeroides. The structure of the RC/YFP-light-harvesting 1 (LH1) complex shows the position of YFP attachment to the RC-H subunit, on the cytoplasmic side of the RC complex. Fluorescence lifetime microscopy of whole cells and ultrafast transient absorption spectroscopy of purified RC/YFP complexes show that the YFP-RC intermolecular distance and spectral overlap between the emission of YFP and the visible-region (QX) absorption bands of the RC allow energy transfer via a Förster mechanism, with an efficiency of 40+/-10%. This proof-of-principle study demonstrates the feasibility of increasing spectral coverage for harvesting light using non-native genetically-encoded light-absorbers, thereby augmenting energy transfer and trapping in photosynthesis.

  14. Probing energy transfer events in the light harvesting complex 2 (LH2) of Rhodobacter sphaeroides with two-dimensional spectroscopy.

    Science.gov (United States)

    Fidler, Andrew F; Singh, Ved P; Long, Phillip D; Dahlberg, Peter D; Engel, Gregory S

    2013-10-21

    Excitation energy transfer events in the photosynthetic light harvesting complex 2 (LH2) of Rhodobacter sphaeroides are investigated with polarization controlled two-dimensional electronic spectroscopy. A spectrally broadened pulse allows simultaneous measurement of the energy transfer within and between the two absorption bands at 800 nm and 850 nm. The phased all-parallel polarization two-dimensional spectra resolve the initial events of energy transfer by separating the intra-band and inter-band relaxation processes across the two-dimensional map. The internal dynamics of the 800 nm region of the spectra are resolved as a cross peak that grows in on an ultrafast time scale, reflecting energy transfer between higher lying excitations of the B850 chromophores into the B800 states. We utilize a polarization sequence designed to highlight the initial excited state dynamics which uncovers an ultrafast transfer component between the two bands that was not observed in the all-parallel polarization data. We attribute the ultrafast transfer component to energy transfer from higher energy exciton states to lower energy states of the strongly coupled B850 chromophores. Connecting the spectroscopic signature to the molecular structure, we reveal multiple relaxation pathways including a cyclic transfer of energy between the two rings of the complex.

  15. Characterization of ‘Pinky’ Strain Grown in Culture of Rhodobacter sphaeroides R26.1

    Institute of Scientific and Technical Information of China (English)

    PAN Yan; XIE Jing; KOYAMA Yasushi; LI Shi-hao; WANG En-si; HOU A-li

    2013-01-01

    In the process of cultivating Rhodobater sphaeroides R26.1,some of which turned from blue to pink due to the irradiation of a beam of leaking white light.The mutant strains were named ‘pinky’ strains,which were cultivated in the red light and in the dark for a comparative study.It turned out that the strains did not grow in the dark,so they might be photosynthetic bacteria.The electronic absorption spectrum of the ‘pinky’ strains was measured,which shows they contained two main photosynthetic pigments,carotenoids(Cars) and bacteriochlorophylls(BChls).And then they were extracted and analyzed.It proves that Bchls included Bchl a and Bchl a'.Nuclear magnetic resonance (NMR) spectra were exploited to determine the chemical structure of Cars.The results indicate that there were seven kinds of Cars,including lycopene,rhodopin,anhydrorhodovibrin,3,4-dihydroanhydrorhodovibrin,3,3,4-dihydrospirilloxanthin,3,4,3',4'-tetrahydrospirilloxanthin and spirilloxanthin.Based on the above results,it was found that most identified Cars formed via spirilloxanthin biosynthesis pathway.The analyzed results of 16S rRNA gene show that the homology of ‘pinky’ strains with Rhodopseudomonas palusteris was 99%.Rhodopseudomonas palusteris has been cultivated in our laboratory.Because of its strong vitality,it did not become extinct with so many years passing.When Rhodobater sphaeroides R26.1 was cultivated,it got rejuvenated under the appropriate conditions and caused Rhodobater sphaeroides R26.1 to be contaminated.

  16. Acetate-dependent photoheterotrophic growth and the differential requirement for the Calvin-Benson-Bassham reductive pentose phosphate cycle in Rhodobacter sphaeroides and Rhodopseudomonas palustris.

    Science.gov (United States)

    Laguna, Rick; Tabita, F Robert; Alber, Birgit E

    2011-02-01

    Rhodobacter sphaeroides ribulose-1,5-bisphosphate carboxylase/oxygenase (RubisCO)-deletion strain 16 was capable of photoheterotrophic growth with acetate, while Rhodopseudomonas palustris RubisCO-deletion strain 2040 could not grow under these conditions. The reason for this difference lies in the fact that Rba. sphaeroides and Rps. palustris use different pathways for acetate assimilation, the ethylmalonyl-CoA pathway, and glyoxylate-bypass cycle, respectively. The ethylmalonyl-CoA pathway is distinct from the glyoxylate cycle as one molecule of CO(2) and one molecule of HCO(3) (-) per three molecules of acetyl-CoA are co-assimilated to form two malate molecules. The glyoxylate cycle directly converts two acetyl-CoA molecules to malate. Each pathway, therefore, also dictates at what point, CO(2) and reductant are consumed, thereby determining the requirement for the Calvin-Benson-Bassham reductive pentose phosphate cycle.

  17. Whole-genome shotgun optical mapping of Rhodobacter sphaeroides strain 2.4. 1 and its use for whole-genome shotgun sequence assembly

    Energy Technology Data Exchange (ETDEWEB)

    Shou, S. [Univ. Wisc.-Madison; Kvikstad, E. [Univ. Wisc.-Madison; Kile, A. [Univ. Wisc.-Madison; Severin, J. [Whole-genome shotgun optical mapping of Rhodobacter sphaeroides strain 2.4. 1 and its use for whole-genome shotgun sequence assembly; Forrest, D. [Univ. Wisc.-Madison; Runnheim, R. [Univ. Wisc.-Madison; Churas, C. [Univ. Wisc.-Madison; Hickman, J. W. [Univ. Wisc.-Madison; Mackenzie, C. [University of Texas–Houston Medical School; Choudhary, M. [University of Texas–Houston Medical School; Donohue, T. [Univ. Wisc.-Madison; Kaplan, S. [University of Texas–Houston Medical School; Schwartz, D. C. [Univ. Wisc.-Madison

    2003-09-01

    Rhodobacter sphaeroides 2.4.1 is a facultative photoheterotrophic bacterium with tremendous metabolic diversity, which has significantly contributed to our understanding of the molecular genetics of photosynthesis, photoheterotrophy, nitrogen fixation, hydrogen metabolism, carbon dioxide fixation, taxis, and tetrapyrrole biosynthesis. To further understand this remarkable bacterium, and to accelerate an ongoing sequencing project, two whole-genome restriction maps (EcoRI and HindIII) of R. sphaeroides strain 2.4.1 were constructed using shotgun optical mapping. The approach directly mapped genomic DNA by the random mapping of single molecules. The two maps were used to facilitate sequence assembly by providing an optical scaffold for high-resolution alignment and verification of sequence contigs. Our results show that such maps facilitated the closure of sequence gaps by the early detection of nascent sequence contigs during the course of the whole-genome shotgun sequencing process.

  18. PucC and LhaA direct efficient assembly of the light-harvesting complexes in Rhodobacter sphaeroides

    DEFF Research Database (Denmark)

    Mothersole, David; Jackson, Philip J.; Vasilev, Cvetelin

    2016-01-01

    interactions between pigments newly arriving from BchG and nascent proteins within the SecYEG-SecDF-YajC-YidC assembly machinery, thereby co-ordinating pigment delivery, the co-translational insertion of LH polypeptides and their folding and assembly to form photosynthetic complexes.......The mature architecture of the photosynthetic membrane of the purple phototroph Rhodobacter sphaeroides has been characterised to a level where an atomic-level membrane model is available, but the roles of the putative assembly proteins LhaA and PucC in establishing this architecture are unknown...

  19. Effect of the mutation of carotenoids on the dynamics of energy transfer in light- harvesting complexes (LH2) from Rhodobacter sphaeroides 601 at room temperature

    Institute of Scientific and Technical Information of China (English)

    Liu Wei-Min; Liu Yuan; Liu Rang-Jun; Yan Yong-Li; Guo Li-Jun; Xu Chun-He; Qian Shi-Xiong

    2006-01-01

    Energy transfers in two kinds of peripheral light-harvesting complexes (LH2) of Rhodobacter sphaeroides (RS) 601 are studied by using femtosecond pump-probe spectroscopy with tunable laser wavelength at room temperature. These two complexes are native LH2 (RS601) and green carotenoid mutated LH2 (GM309). The obtained results demonstrate that, compared with spheroidenes with ten conjugated double bonds in native RS601, carotenoid in GM309 containing neurosporenes with nine conjugated double bonds can lead to a reduction in energy transfer rate in the B800-to-B850 band and the disturbance in the energy relaxation processes within the excitonic B850 band.

  20. Role of phospholipids of subunit III in the regulation of structural rearrangements in cytochrome c oxidase of Rhodobacter sphaeroides.

    Science.gov (United States)

    Alnajjar, Khadijeh S; Cvetkov, Teresa; Prochaska, Lawrence

    2015-02-03

    Subunit III of cytochrome c oxidase possesses structural domains that contain conserved phospholipid binding sites. Mutations within these domains induce a loss of phospholipid binding, coinciding with decreased electron transfer activity. Functional and structural roles for phospholipids in the enzyme from Rhodobacter sphaeroides have been investigated. Upon the removal of intrinsic lipids using phospholipase A2, electron transfer activity was decreased 30-50%. Moreover, the delipidated enzyme exhibited turnover-induced, suicide inactivation, which was reversed by the addition of exogenous lipids, most specifically by cardiolipin. Cardiolipin exhibited two sites of interaction with the delipidated enzyme, a high-affinity site (Km = 0.14 μM) and a low-affinity site (Km = 26 μM). Subunit I of the delipidated enzyme exhibited a faster digestion rate when it was treated with α-chymotrypsin compared to that of the wild-type enzyme, suggesting that lipid removal induces a conformational change to expose the digestion sites further. Upon reaction of subunit III of the enzyme with a fluorophore (AEDANS), fluorescence anisotropy showed an increased rotational rate of the fluorophore in the absence of lipids, indicating increased flexibility of subunit III within the enzyme's tertiary structure. Additionally, Förster resonance energy transfer between AEDANS and a fluorescently labeled cardiolipin revealed that cardiolipin binds in the v-shaped cleft of subunit III in the delipidated enzyme and that it moves closer to the active site in subunit I upon a change in the redox state of the enzyme. In conclusion, these results show that the phospholipids regulate events occurring during electron transfer activity by maintaining the structural integrity of the enzyme at the active site.

  1. New insights into the photochemistry of carotenoid spheroidenone in light-harvesting complex 2 from the purple bacterium Rhodobacter sphaeroides.

    Science.gov (United States)

    Niedzwiedzki, Dariusz M; Dilbeck, Preston L; Tang, Qun; Martin, Elizabeth C; Bocian, David F; Hunter, C Neil; Holten, Dewey

    2017-03-01

    Light-harvesting complex 2 (LH2) from the semi-aerobically grown purple phototrophic bacterium Rhodobacter sphaeroides was studied using optical (static and time-resolved) and resonance Raman spectroscopies. This antenna complex comprises bacteriochlorophyll (BChl) a and the carotenoid spheroidenone, a ketolated derivative of spheroidene. The results indicate that the spheroidenone-LH2 complex contains two spectral forms of the carotenoid: (1) a minor, "blue" form with an S2 (1(1)B u(+) ) spectral origin band at 522 nm, shifted from the position in organic media simply by the high polarizability of the binding site, and (2) the major, "red" form with the origin band at 562 nm that is associated with a pool of pigments that more strongly interact with protein residues, most likely via hydrogen bonding. Application of targeted modeling of excited-state decay pathways after carotenoid excitation suggests that the high (92%) carotenoid-to-BChl energy transfer efficiency in this LH2 system, relative to LH2 complexes binding carotenoids with comparable double-bond conjugation lengths, derives mainly from resonance energy transfer from spheroidenone S2 (1(1)B u(+) ) state to BChl a via the Qx state of the latter, accounting for 60% of the total transfer. The elevated S2 (1(1)B u(+) ) → Qx transfer efficiency is apparently associated with substantially decreased energy gap (increased spectral overlap) between the virtual S2 (1(1)B u(+) ) → S0 (1(1)A g(-) ) carotenoid emission and Qx absorption of BChl a. This reduced energetic gap is the ultimate consequence of strong carotenoid-protein interactions, including the inferred hydrogen bonding.

  2. Genome-enabled analysis of the utilization of taurine as sole source of carbon or of nitrogen by Rhodobacter sphaeroides 2.4.1.

    Science.gov (United States)

    Denger, Karin; Smits, Theo H M; Cook, Alasdair M

    2006-11-01

    A degradative pathway for taurine (2-aminoethanesulfonate) in Rhodobacter sphaeroides 2.4.1 was proposed by Brüggemann et al. (2004) (Microbiology 150, 805-816) on the basis of a partial genome sequence. In the present study, R. sphaeroides 2.4.1 was found to grow exponentially with taurine as the sole source of carbon and energy for growth. When taurine was the sole source of nitrogen in succinate-salts medium, the taurine was rapidly degraded, and most of the organic nitrogen was excreted as the ammonium ion, which was then utilized for growth. Most of the enzymes involved in dissimilation, taurine dehydrogenase (TDH), sulfoacetaldehyde acetyltransferase (Xsc) and phosphate acetyltransferase (Pta), were found to be inducible, and evidence for transcription of the corresponding genes (tauXY, xsc and pta), as well as of tauKLM, encoding the postulated TRAP transporter for taurine, and of tauZ, encoding the sulfate exporter, was obtained by reverse-transcription PCR. An additional branch of the pathway, observed by Novak et al. (2004) (Microbiology 150, 1881-1891) in R. sphaeroides TAU3, involves taurine : pyruvate aminotransferase (Tpa) and a presumptive ABC transporter (NsbABC). No evidence for a significant role of this pathway, or of the corresponding alanine dehydrogenase (Ald), was obtained for R. sphaeroides 2.4.1. The anaplerotic pathway needed under these conditions in R. sphaeroides 2.4.1 seems to involve malyl-CoA lyase, which was synthesized inducibly, and not malate synthase (GlcB), whose presumed gene was not transcribed under these conditions.

  3. Cardiolipin Deficiency in Rhodobacter sphaeroides Alters the Lipid Profile of Membranes and of Crystallized Cytochrome Oxidase, but Structure and Function Are Maintained

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Xi; Tamot, Banita; Hiser, Carrie; Reid, Gavin E.; Benning, Christoph; Ferguson-Miller, Shelagh (MSU)

    2012-05-08

    Many recent studies highlight the importance of lipids in membrane proteins, including in the formation of well-ordered crystals. To examine the effect of changes in one lipid, cardiolipin, on the lipid profile and the production, function, and crystallization of an intrinsic membrane protein, cytochrome c oxidase, we mutated the cardiolipin synthase (cls) gene of Rhodobacter sphaeroides, causing a >90% reduction in cardiolipin content in vivo and selective changes in the abundances of other lipids. Under these conditions, a fully native cytochrome c oxidase (CcO) was produced, as indicated by its activity, spectral properties, and crystal characteristics. Analysis by MALDI tandem mass spectrometry (MS/MS) revealed that the cardiolipin level in CcO crystals, as in the membranes, was greatly decreased. Lipid species present in the crystals were directly analyzed for the first time using MS/MS, documenting their identities and fatty acid chain composition. The fatty acid content of cardiolipin in R. sphaeroides CcO (predominantly 18:1) differs from that in mammalian CcO (18:2). In contrast to the cardiolipin dependence of mammalian CcO activity, major depletion of cardiolipin in R. sphaeroides did not impact any aspect of CcO structure or behavior, suggesting a greater tolerance of interchange of cardiolipin with other lipids in this bacterial system.

  4. Quenching Capabilities of Long-Chain Carotenoids in Light-Harvesting-2 Complexes from Rhodobacter sphaeroides with an Engineered Carotenoid Synthesis Pathway.

    Science.gov (United States)

    Dilbeck, Preston L; Tang, Qun; Mothersole, David J; Martin, Elizabeth C; Hunter, C Neil; Bocian, David F; Holten, Dewey; Niedzwiedzki, Dariusz M

    2016-06-23

    Six light-harvesting-2 complexes (LH2) from genetically modified strains of the purple photosynthetic bacterium Rhodobacter (Rb.) sphaeroides were studied using static and ultrafast optical methods and resonance Raman spectroscopy. These strains were engineered to incorporate carotenoids for which the number of conjugated groups (N = NC═C + NC═O) varies from 9 to 15. The Rb. sphaeroides strains incorporate their native carotenoids spheroidene (N = 10) and spheroidenone (N = 11), as well as longer-chain analogues including spirilloxanthin (N = 13) and diketospirilloxantion (N = 15) normally found in Rhodospirillum rubrum. Measurements of the properties of the carotenoid first singlet excited state (S1) in antennas from the Rb. sphaeroides set show that carotenoid-bacteriochlorophyll a (BChl a) interactions are similar to those in LH2 complexes from various other bacterial species and thus are not significantly impacted by differences in polypeptide composition. Instead, variations in carotenoid-to-BChl a energy transfer are primarily regulated by the N-determined energy of the carotenoid S1 excited state, which for long-chain (N ≥ 13) carotenoids is not involved in energy transfer. Furthermore, the role of the long-chain carotenoids switches from a light-harvesting supporter (via energy transfer to BChl a) to a quencher of the BChl a S1 excited state B850*. This quenching is manifested as a substantial (∼2-fold) reduction of the B850* lifetime and the B850* fluorescence quantum yield for LH2 housing the longest carotenoids.

  5. Growth characteristics and hydrogen production by Rhodobacter sphaeroides using various amino acids as nitrogen sources and their combinations with carbon sources

    Energy Technology Data Exchange (ETDEWEB)

    Gabrielyan, Lilit; Torgomyan, Heghine; Trchounian, Armen [Department of Biophysics, Biological Faculty, Yerevan State University, 0025 Yerevan (Armenia)

    2010-11-15

    Some amino acids (alanine, asparagine, glutamate, glycine, proline, and tyrosine) were used as nitrogen sources in combination with carbon sources (succinate and malate) to study growth properties and H{sub 2} production by purple non-sulfur bacterium Rhodobacter sphaeroides strains A-10 and D-3. Both strains produced H{sub 2} in succinate-glutamate and malate-glutamate media. Succinate was a better carbon source than malate. In comparison with strain D-3, strain A-10 was able to utilize proline, alanine or tyrosine as nitrogen sources in succinate medium and to produce H{sub 2}. Both strains were unable to produce H{sub 2} in the presence of asparagine or glycine as nitrogen sources. N,N'-dicyclohexylcarbodiimide, the F{sub 0}F{sub 1}-ATPase inhibitor, led to marked inhibition of H{sub 2} production activity of R. sphaeroides. The results suggest that the R. sphaeroides cells growth can be achieved by the use of a large diversity of substrates but only some of them can increase the H{sub 2} production rate. (author)

  6. Light-harvesting complex 1 stabilizes P+QB- charge separation in reaction centers of Rhodobacter sphaeroides.

    Science.gov (United States)

    Francia, Francesco; Dezi, Manuela; Rebecchi, Alberto; Mallardi, Antonia; Palazzo, Gerardo; Melandri, Bruno Andrea; Venturoli, Giovanni

    2004-11-09

    The kinetics of charge recombination following photoexcitation by a laser pulse have been analyzed in the reaction center-light harvesting complex 1 (RC-LH1) purified from the photosynthetic bacterium Rhodobacter sphaeroides. In RC-LH1 core complexes isolated from photosynthetically grown cells P(+)Q(B)(-) recombines with an average rate constant, k approximately 0.3 s(-1), more than three times smaller than that measured in RC deprived of the LH1 (k approximately 1 s(-1)). A comparable, slowed recombination kinetics is observed in RC-LH1 complexes purified from a pufX-deleted strain. Slowing of the charge recombination kinetics is even more pronounced in RC-LH1 complexes isolated from wild-type semiaerobically grown cells (k approximately 0.2 s(-1)). Since the kinetics of P(+)Q(A)(-) recombination is unaffected by the presence of the antenna, the P(+)Q(B)(-) state appears to be energetically stabilized in core complexes. Determinations of the ubiquinone-10 (UQ(10)) complement associated with the purified RC-LH1 complexes always yield UQ(10)/RC ratios larger than 10. These quinone molecules are functionally coupled to the RC-LH1 complex, as judged from the extent of exogenous cytochrome c(2) rapidly oxidized under continuous light excitation. Analysis of P(+)Q(B)(-) recombination, based on a kinetic model which considers fast quinone equilibrium at the Q(B) binding site, indicates that the slowing down of charge recombination kinetics observed in RC-LH1 complexes cannot be explained solely by a quinone concentration effect and suggests that stabilization of the light-induced charge separation is predominantly due to interaction of the Q(B) site with the LH1 complex. The high UQ(10) complements detected in RC-LH1 core complexes, but not in purified light-harvesting complex 2 and in RC, are proposed to reflect an in vivo heterogeneity in the distribution of the quinone pool within the chromatophore bilayer.

  7. Femtosecond Dynamics of Energy Transfer in Native B800-B850 and B800-Released LH2 Complexes of Rhodobacter Sphaeroides

    Institute of Scientific and Technical Information of China (English)

    刘伟民; 朱荣毅; 夏辰安; 刘源; 徐春和; 钱士雄

    2003-01-01

    Two kinds of antenna complexes LH2 of Rhodobacter sphaeroides, wild type RS601 and the removal of B800 pigments (B800-released), were used in our experiment. These two LH2 complexes show quite different behaviour in absorption and femtosecond dynamics. By using the femtosecond pump-probe technique, the energy transfer processes occurring in two complexes were studied. Because of removing the B800 pigment from the LH2 in B800-released LH2 complex, the energy transfer between the B800 to B850 pigment was completely eliminated,while the pure internal energy transfer within the exciton states of B850 pigment could be carefully investigated.The results show that, at B800 absorption band, B800-released LH2 obviously shows a dominated transient absorption different from the photobleaching observed in RS601; while at the B850 band, these two complexes show similar photobleaching behaviour.

  8. The nature of the lower excited state of the special pair of bacterial photosynthetic reaction center of Rhodobacter Sphaeroides and the dynamics of primary charge separation

    Science.gov (United States)

    Ivashin, N. V.; Shchupak, E. E.

    2016-08-01

    Quantum-chemical calculations of the structure in the ground and lower singlet excited states and the vibrations (in the ground state) of special pair P of photosynthetic reaction center of purple bacteria (RCPb) Rhodobacter Sphaeroides, consisting of two bacteriochlorophyll molecules PA and PB, have been carried out. It is shown that excitation of the special pair is followed by fast relaxation dynamics, accompanied by the transformation of the initial P* state into the P A δ+ P B δ- state (δ ~ 0.5) with charge separation. This behavior is due to the presence of several nonplanar vibrations with participation of the acetyl group of macrocycle PB in the nuclear wave packet on the potential surface of the P* state; these vibrations facilitate destabilization of the lowest unoccupied molecular orbital (LUMO) and highest occupied molecular orbital (HOMO) of the macrocycle PA and formation of the P A δ+ P B δ- state. The structural transformations in the P* state are due to its linking character in the contact region of the acetyl group-containing pyrrole rings of PA and PB. The transition from the P* state to specifically the P A δ+ P B δ- state is related to the fact that the acetyl group PA is involved in the intermolecular hydrogen bond with amino acid residue HisL168; for this reason, this group and the pyrrole ring linked with it can hardly participate in structural transformations. The electronic matrix element H12 of the electron transfer from the special pair in the P A δ+ P B δ- state to a molecule of accessory bacteriochlorophyll BA greatly exceeds that for the transfer to BB. This circumstance and the fact that the P A δ+ P B δ- state is energetically more favorable than the P* state facilitate the preferred directionality of the electron transfer in RCPb Rhodobacter Sphaeroides with participation of the cofactors located in its subunit L.

  9. Enhancement of phototrophic hydrogen production by Rhodobacter sphaeroides ZX-5 using a novel strategy - shaking and extra-light supplementation approach

    Energy Technology Data Exchange (ETDEWEB)

    Li, Xu; Wang, Yong-Hong; Zhang, Si-Liang; Chu, Ju; Zhang, Ming; Huang, Ming-Zhi; Zhuang, Ying-Ping [State Key Laboratory of Bioreactor Engineering, P.O. Box 329, East China University of Science and Technology, 130 Meilong Road, Shanghai 200237 (China)

    2009-12-15

    Biohydrogen has gained attention due to its potential as a sustainable alternative to conventional methods for hydrogen production. In this study, the effect of light intensity as well as cultivation method (standing- and shaking-culture) on the cell growth and hydrogen production of Rhodobacter sphaeroides ZX-5 were investigated in 38-ml anaerobic photobioreactor with RCVBN medium. Thus, a novel shaking and extra-light supplementation (SELS) approach was developed to enhance the phototrophic H{sub 2} production by R. sphaeroides ZX-5 using malate as the sole carbon source. The optimum illumination condition for shaking-culture by strain ZX-5 increased to 7000-8000 lux, markedly higher than that for standing-culture (4000-5000 lux). Under shaking and elevated illumination (7000-8000 lux), the culture was effective in promoting photo-H{sub 2} production, resulting in a 59% and 56% increase of the maximum and average hydrogen production rate, respectively, in comparison with the culture under standing and 4000-5000 lux conditions. The highest hydrogen-producing rate of 165.9 ml H{sub 2}/l h was observed under the application of SELS approach. To our knowledge, this record is currently the highest hydrogen production rate of non-immobilized purple non-sulphur (PNS) bacteria. This optimal performance of photo-H{sub 2} production using SELS approach is a favorable choice of sustainable and economically feasible strategy to improve phototrophic H{sub 2} production efficiency. (author)

  10. Functional characteristics of spirilloxanthin and keto-bearing Analogues in light-harvesting LH2 complexes from Rhodobacter sphaeroides with a genetically modified carotenoid synthesis pathway.

    Science.gov (United States)

    Niedzwiedzki, Dariusz M; Dilbeck, Preston L; Tang, Qun; Mothersole, David J; Martin, Elizabeth C; Bocian, David F; Holten, Dewey; Hunter, C Neil

    2015-01-01

    Light-harvesting 2 (LH2) complexes from a genetically modified strain of the purple photosynthetic bacterium Rhodobacter (Rba.) sphaeroides were studied using static and ultrafast optical methods and resonance Raman spectroscopy. Carotenoid synthesis in the Rba. sphaeroides strain was engineered to redirect carotenoid production away from spheroidene into the spirilloxanthin synthesis pathway. The strain assembles LH2 antennas with substantial amounts of spirilloxanthin (total double-bond conjugation length N=13) if grown anaerobically and of keto-bearing long-chain analogs [2-ketoanhydrorhodovibrin (N=13), 2-ketospirilloxanthin (N=14) and 2,2'-diketospirilloxanthin (N=15)] if grown semi-aerobically (with ratios that depend on growth conditions). We present the photophysical, electronic, and vibrational properties of these carotenoids, both isolated in organic media and assembled within LH2 complexes. Measurements of excited-state energy transfer to the array of excitonically coupled bacteriochlorophyll a molecules (B850) show that the mean lifetime of the first singlet excited state (S1) of the long-chain (N≥13) carotenoids does not change appreciably between organic media and the protein environment. In each case, the S1 state appears to lie lower in energy than that of B850. The energy-transfer yield is ~0.4 in LH2 (from the strain grown aerobically or semi-aerobically), which is less than half that achieved for LH2 that contains short-chain (N≤11) analogues. Collectively, the results suggest that the S1 excited state of the long-chain (N≥13) carotenoids participates little if at all in carotenoid-to-BChl a energy transfer, which occurs predominantly via the carotenoid S2 excited state in these antennas.

  11. Functional assembly of the foreign carotenoid lycopene into the photosynthetic apparatus of Rhodobacter sphaeroides, achieved by replacement of the native 3-step phytoene desaturase with its 4-step counterpart from Erwinia herbicola.

    Science.gov (United States)

    Garcia-Asua, Guillermo; Cogdell, Richard J; Hunter, C Neil

    2002-04-01

    Photosynthetic organisms synthesize a diverse range of carotenoids. These pigments are important for the assembly, function and stability of photosynthetic pigment-protein complexes, and they are used to quench harmful radicals. The photosynthetic bacterium Rhodobacter sphaeroides was used as a model system to explore the origin of carotenoid diversity. Replacing the native 3-step phytoene desaturase (CrtI) with the 4-step enzyme from Erwinia herbicola results in significant flux down the spirilloxanthin pathway for the first time in Rb. sphaeroides. In Rb. sphaeroides, the completion of four desaturations to lycopene by the Erwinia CrtI appears to require the absence of CrtC and, in a crtC background, even the native 3-step enzyme can synthesize a significant amount (13%) of lycopene, in addition to the expected neurosporene. We suggest that the CrtC hydroxylase can intervene in the sequence of reactions catalyzed by phytoene desaturase. We investigated the properties of the lycopene-synthesizing strain of Rb. sphaeroides. In the LH2 light-harvesting complex, lycopene transfers absorbed light energy to the bacteriochlorophylls with an efficiency of 54%, which compares favourably with other LH2 complexes that contain carotenoids with 11 conjugated double bonds. Thus, lycopene can join the assembly pathway for photosynthetic complexes in Rb. sphaeroides, and can perform its role as an energy donor to bacteriochlorophylls.

  12. Effects of ammonium ion, acetate and aerobic conditions on hydrogen production and expression levels of nitrogenase genes in Rhodobacter sphaeroides O.U.001

    Energy Technology Data Exchange (ETDEWEB)

    Akkoese, Sevilay; Guenduez, Ufuk; Yuecel, Meral [Middle East Technical University, Department of Biological Sciences, 06531 Ankara (Turkey); Eroglu, Inci [Middle East Technical University, Department of Chemical Engineering, 06531 Ankara (Turkey)

    2009-11-15

    In the present study, expression levels of nitrogenase encoding nifH and control genes nifA and prrA were examined at different physiological conditions in Rhodobacter sphaeroides O.U.001. In addition to variations in expression levels, changes in hydrogen production and growth were also investigated in response to different concentrations of ammonium source, acetate and aerobic conditions. In the present study, increasing concentration of ammonium chloride was found to be caused decrease in hydrogen production. Glutamate containing medium had the capacity for higher hydrogen production. Hydrogen production was observed even in aerobic conditions. The expression levels of nifH and nifA genes decreased with the increasing concentrations of ammonium chloride. Although the expression of nifA was present in the highest concentrations of NH{sub 4}Cl under anaerobic conditions, no expression was observed under aerobic conditions of the same culture conditions. This was likely due to transcriptional level inhibition of nitrogenase in the presence of ammonium ion. Negative correlation was observed between the expression levels of prrA gene and its target, nifA gene. (author)

  13. Effects of the cryptochrome CryB from Rhodobacter sphaeroides on global gene expression in the dark or blue light or in the presence of singlet oxygen.

    Directory of Open Access Journals (Sweden)

    Sebastian Frühwirth

    Full Text Available Several regulators are controlling the formation of the photosynthetic apparatus in the facultatively photosynthetic bacterium Rhodobacter sphaeroides. Among the proteins affecting photosynthesis gene expression is the blue light photoreceptor cryptochrome CryB. This study addresses the effect of CryB on global gene expression. The data reveal that CryB does not only influence photosynthesis gene expression but also genes for the non-photosynthetic energy metabolism like citric acid cycle and oxidative phosphorylation. In addition several genes involved in RNA processing and in transcriptional regulation are affected by a cryB deletion. Although CryB was shown to undergo a photocycle it does not only affect gene expression in response to blue light illumination but also in response to singlet oxygen stress conditions. While there is a large overlap in these responses, some CryB-dependent effects are specific for blue-light or photooxidative stress. In addition to protein-coding genes some genes for sRNAs show CryB-dependent expression. These findings give new insight into the function of bacterial cryptochromes and demonstrate for the first time a function in the oxidative stress response.

  14. Chronic Exposure to Rhodobacter Sphaeroides Extract Lycogen™ Prevents UVA-Induced Malondialdehyde Accumulation and Procollagen I Down-Regulation in Human Dermal Fibroblasts

    Directory of Open Access Journals (Sweden)

    Tsai-Hsiu Yang

    2014-01-01

    Full Text Available UVA contributes to the pathogenesis of skin aging by downregulation of procollagen I content and induction of matrix metalloproteinase (MMP-associated responses. Application of antioxidants such as lycopene has been demonstrated as a convenient way to achieve protection against skin aging. Lycogen™, derived from the extracts of Rhodobacter sphaeroides, exerts several biological effects similar to that of lycopene whereas most of its anti-aging efficacy remains uncertain. In this study, we attempted to examine whether Lycogen™ could suppress malondialdehyde (MDA accumulation and restore downregulated procollagen I expression induced by UVA exposure. In human dermal fibroblasts Hs68 cells, UVA repressed cell viability and decreased procollagen I protein content accompanied with the induction of MMP-1 and MDA accumulation. Remarkably, incubation with 50 µM Lycogen™ for 24 h ameliorated UVA-induced cell death and restored UVA-induced downregulation of procollagen in a dose-related manner. Lycogen™ treatment also prevented the UVA-induced MMP-1 upregulation and intracellular MDA generation in Hs68 cells. Activation of NFκB levels, one of the downstream events induced by UVA irradiation and MMP-1 induction, were also prevented by Lycogen™ administration. Taken together, our findings demonstrate that Lycogen™ may be an alternative agent that prevents UVA-induced skin aging and could be used in cosmetic and pharmaceutical applications.

  15. Eukaryotic behaviour of a prokaryotic energy-transducing membrane: fully detached vesicular organelles arise by budding from the Rhodobacter sphaeroides intracytoplasmic photosynthetic membrane.

    Science.gov (United States)

    Niederman, Robert A

    2010-05-01

    A major feature that distinguishes prokaryotic organisms from eukaryotes is their less complex internal structure, in which all membrane-associated functions are thought to be present within a continuous lipid-protein bilayer, rather than with distinct organelles. Contrary to this notion, as described by Tucker and co-workers in this issue of Molecular Microbiology, the application of cryo-electron tomography to the purple bacterium Rhodobacter sphaeroides has demonstrated a heretofore unrecognized ultrastructural complexity within the intracytoplasmic membrane (ICM) housing the photosynthetic apparatus. In addition to distinguishing invaginations of the cytoplasmic membrane (CM) and interconnected vesicular structures still attached to the CM, a eukaryote-like ICM budding process was revealed, which results in the formation of fully detached vesicular structures. These bacterial organelles are able to carry out both the light-harvesting and light-driven energy transduction activities necessary for the cells to assume a photosynthetic lifestyle. Their formation is shown to represent the final stage in a membrane invagination and growth process, originating with small CM indentations, which after cell disruption give rise to a membrane fraction that can be separated from mature ICM vesicles by rate-zone sedimentation.

  16. Light induced EPR spectra of reaction centers from Rhodobacter sphaeroides at 80K: Evidence for reduction of QB by B-branch electron transfer in native reaction centers.

    Science.gov (United States)

    Paddock, M. L; Isaacson, R. A.; Abresch, E. C.; Okamura, M. Y.

    2006-01-01

    Photosynthetic reaction centers (RCs) from Rhodobacter sphaeroides capture solar energy by electron transfer from primary donor, D, to quinone acceptor, QB, through the active A-branch of electron acceptors, but not the inactive B-branch. The light induced EPR spectrum from native RCs that had Fe2+ replaced by Zn2+ was investigated at cryogenic temperature (80K, 35 GHz). In addition to the light induced signal due to formation of D+•QA−• observed previously, a small fraction (~5%) of the signal displayed very different characteristics: (1) The signal was absent in RCs in which the QB was displaced by the inhibitor stigmatellin. (2) Its decay time (τ=6 s) was the same as observed for D+•QB−• in mutant RCs lacking QA, which is significantly slower than for D+•QA−• (τ=30 ms). (3) Its EPR spectrum was identical to that of D+•QB−•. (4) The quantum efficiency for forming the major component of the signal was the same as that found for mutant RCs lacking QA (Φ =0.2%) and was temperature independent. These results are explained by direct photochemical reduction of QB via B-branch electron transfer in a small fraction of native RCs. PMID:18163156

  17. Comparison of H{sub 2} accumulation by Rhodobacter sphaeroides KD131 and its uptake hydrogenase and PHB synthase deficient mutant

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Mi-Sun; Baek, Jin-Sook [Biomass Research Center, Korea Institute of Energy Research, 71-2 Jang-dong, Yuseong-gu, Daejeon 305-343 (Korea, Republic of); Lee, Jeong K. [Department of Life Science, Sogang University, Shinsu-dong, Mapo-gu, Seoul 121-742 (Korea, Republic of)

    2006-01-15

    Rhodobacter sphaeroides KD131 and its mutant strain lacking uptake hydrogenase (Hup{sup -}) and PHB synthase (Phb{sup -}) have been studied on H{sub 2} production and cell growth under different culture conditions. Both strains started producing H{sub 2} from the middle of the logarithmic growth phase and continued until the cell concentration leveled out. The rates of H{sub 2} production were 1.32 and 3.34ml H{sub 2}/mg-dcw for the wild-type and Hup{sup -}/Phb{sup -} mutant strain, respectively, at the optimum conditions. Malate and lactate were better carbon sources than starch, sucrose or glycerol. Approximately 60% of acetic acid was degraded in 48h by the wild-type strain and pH increased to 9.4. However, the Hup{sup -}/Phb{sup -} mutant strain did not grow well and degraded only 19% of acetic acid. The pH ranges of 7.0 were the optimum for the cell growth and pH 7.5 for the H{sub 2} production. Both strains grew and produced hydrogen under the irradiance of 12-120W/m{sup 2}, but cell growth was inhibited over 400W/m{sup 2}. (author)

  18. Effects of the cryptochrome CryB from Rhodobacter sphaeroides on global gene expression in the dark or blue light or in the presence of singlet oxygen.

    Science.gov (United States)

    Frühwirth, Sebastian; Teich, Kristin; Klug, Gabriele

    2012-01-01

    Several regulators are controlling the formation of the photosynthetic apparatus in the facultatively photosynthetic bacterium Rhodobacter sphaeroides. Among the proteins affecting photosynthesis gene expression is the blue light photoreceptor cryptochrome CryB. This study addresses the effect of CryB on global gene expression. The data reveal that CryB does not only influence photosynthesis gene expression but also genes for the non-photosynthetic energy metabolism like citric acid cycle and oxidative phosphorylation. In addition several genes involved in RNA processing and in transcriptional regulation are affected by a cryB deletion. Although CryB was shown to undergo a photocycle it does not only affect gene expression in response to blue light illumination but also in response to singlet oxygen stress conditions. While there is a large overlap in these responses, some CryB-dependent effects are specific for blue-light or photooxidative stress. In addition to protein-coding genes some genes for sRNAs show CryB-dependent expression. These findings give new insight into the function of bacterial cryptochromes and demonstrate for the first time a function in the oxidative stress response.

  19. Electron-Transfer Secondary Reaction Matrices for MALDI MS Analysis of Bacteriochlorophyll a in Rhodobacter sphaeroides and Its Zinc and Copper Analogue Pigments.

    Science.gov (United States)

    Calvano, Cosima Damiana; Ventura, Giovanni; Trotta, Massimo; Bianco, Giuliana; Cataldi, Tommaso R I; Palmisano, Francesco

    2017-01-01

    Bacteriochlorophyll a (BChl a), a photosynthetic pigment performing the same functions of chlorophylls in plants, features a bacteriochlorin macrocycle ring (18 π electrons) with two reduced pyrrole rings along with a hydrophobic terpenoid side chain (i.e., the phytol residue). Chlorophylls analysis by matrix-assisted laser desorption/ionization mass spectrometry (MALDI MS) is not so straightforward since pheophytinization (i.e., release of the central metal ion) and cleavage of the phytol-ester linkage are invariably observed by employing protonating matrices such as 2,5-dihydroxybenzoic acid, sinapinic acid, and α-cyano-4-hydroxycinnamic acid. Using BChl a from Rhodobacter sphaeroides R26 strain as a model system, different electron-transfer (ET) secondary reaction matrices, leading to the formation of almost stable radical ions in both positive ([M](+•)) and negative ([M](-•)) ionization modes at m/z 910.55, were evaluated. Compared with ET matrices such as trans-2-[3-(4-t-butyl-phenyl)-2-methyl-2-propenylidene]malononitrile (DCTB), 2,2':5',2''-terthiophene (TER), anthracene (ANT), and 9,10-diphenylanthracene (DP-ANT), 1,5-diaminonaphthalene (DAN) was found to provide the highest ionization yield with a negligible fragmentation. DAN also displayed excellent ionization properties for two metal ion-substituted bacteriochlorophylls, (i.e., Zn- and Cu-BChl a at m/z 950.49 and 949.49), respectively. MALDI MS/MS of both radical charged molecular species provide complementary information, thus making analyte identification more straightforward. Graphical Abstract ᅟ.

  20. Electron-Transfer Secondary Reaction Matrices for MALDI MS Analysis of Bacteriochlorophyll a in Rhodobacter sphaeroides and Its Zinc and Copper Analogue Pigments

    Science.gov (United States)

    Calvano, Cosima Damiana; Ventura, Giovanni; Trotta, Massimo; Bianco, Giuliana; Cataldi, Tommaso R. I.; Palmisano, Francesco

    2017-01-01

    Bacteriochlorophyll a ( BChl a), a photosynthetic pigment performing the same functions of chlorophylls in plants, features a bacteriochlorin macrocycle ring (18 π electrons) with two reduced pyrrole rings along with a hydrophobic terpenoid side chain (i.e., the phytol residue). Chlorophylls analysis by matrix-assisted laser desorption/ionization mass spectrometry (MALDI MS) is not so straightforward since pheophytinization (i.e., release of the central metal ion) and cleavage of the phytol-ester linkage are invariably observed by employing protonating matrices such as 2,5-dihydroxybenzoic acid, sinapinic acid, and α-cyano-4-hydroxycinnamic acid. Using BChl a from Rhodobacter sphaeroides R26 strain as a model system, different electron-transfer (ET) secondary reaction matrices, leading to the formation of almost stable radical ions in both positive ([M]+•) and negative ([M]-•) ionization modes at m/z 910.55, were evaluated. Compared with ET matrices such as trans-2-[3-(4-t-butyl-phenyl)-2-methyl-2-propenylidene]malononitrile (DCTB), 2,2':5',2''-terthiophene (TER), anthracene (ANT), and 9,10-diphenylanthracene (DP-ANT), 1,5-diaminonaphthalene (DAN) was found to provide the highest ionization yield with a negligible fragmentation. DAN also displayed excellent ionization properties for two metal ion-substituted bacteriochlorophylls, (i.e., Zn- and Cu-BChl a at m/z 950.49 and 949.49), respectively. MALDI MS/MS of both radical charged molecular species provide complementary information, thus making analyte identification more straightforward.

  1. Quinone (QB) reduction by B-branch electron transfer in mutant bacterial reaction centers from Rhodobacter sphaeroides: quantum efficiency and X-ray structure.

    Science.gov (United States)

    Paddock, M L; Chang, C; Xu, Q; Abresch, E C; Axelrod, H L; Feher, G; Okamura, M Y

    2005-05-10

    The photosynthetic reaction center (RC) from purple bacteria converts light into chemical energy. Although the RC shows two nearly structurally symmetric branches, A and B, light-induced electron transfer in the native RC occurs almost exclusively along the A-branch to a primary quinone electron acceptor Q(A). Subsequent electron and proton transfer to a mobile quinone molecule Q(B) converts it to a quinol, Q(B)H(2). We report the construction and characterization of a series of mutants in Rhodobacter sphaeroides designed to reduce Q(B) via the B-branch. The quantum efficiency to Q(B) via the B-branch Phi(B) ranged from 0.4% in an RC containing the single mutation Ala-M260 --> Trp to 5% in a quintuple mutant which includes in addition three mutations to inhibit transfer along the A-branch (Gly-M203 --> Asp, Tyr-M210 --> Phe, Leu-M214 --> His) and one to promote transfer along the B-branch (Phe-L181 --> Tyr). Comparing the value of 0.4% for Phi(B) obtained in the AW(M260) mutant, which lacks Q(A), to the 100% quantum efficiency for Phi(A) along the A-branch in the native RC, we obtain a ratio for A-branch to B-branch electron transfer of 250:1. We determined the structure of the most effective (quintuple) mutant RC at 2.25 A (R-factor = 19.6%). The Q(A) site did not contain a quinone but was occupied by the side chain of Trp-M260 and a Cl(-). In this structure a nonfunctional quinone was found to occupy a new site near M258 and M268. The implications of this work to trap intermediate states are discussed.

  2. Trapped Conformational States of Semiquinone (D+•QB−•) Formed by B-Branch Electron Transfer at Low Temperature in Rhodobacter sphaeroides Reaction Centers‡

    Science.gov (United States)

    Paddock, M. L.; Flores, M.; Isaacson, R.; Chang, C.; Abresch, E. C.; Selvaduray, P.; Okamura, M.Y.

    2006-01-01

    The reaction center (RC) from Rhodobacter sphaeroides captures light energy by electron transfer between quinones QA and QB, involving a conformational gating step. In this work, conformational states of D+•QB−• were trapped (80K) and studied using EPR spectroscopy in mutant RCs that lack QA in which QB was reduced by the bacteriopheophytin along the B-branch. In mutant RCs frozen in the dark, a light induced EPR signal due to D+•QB−• formed in 30% of the sample with low quantum yield (0.2%–20%) and decayed in 6 s. A small signal with similar characteristics was also observed in native RCs. In contrast, the EPR signal due to D+QB− in mutant RCs illuminated while freezing formed in ~ 95% of the sample that did not decay (τ >107s) at 80K. In all samples, the observed g-values were the same (g=2.0026) indicating that all active QB−• was located in a proximal conformation coupled with the non-heme Fe2+. We propose that before electron transfer at 80K, the majority (~70%) of QB, structurally located in the distal site, cannot be stably reduced, while the minor (~30%) active configurations are in the proximal site. The large difference in the lifetimes of the un-relaxed and relaxed D+•QB−• states is attributed to relaxation of protein residues and internal water molecules that stabilize D+•QB−•. These results demonstrate energetically significant conformational changes involved in stabilizing the D+•QB−• state. The unrelaxed and relaxed states can be considered to be the initial and final states along the reaction coordinate for conformationally-gated electron transfer. PMID:17115698

  3. An isotope-edited FTIR investigation of the role of Ser-L223 in binding quinone (QB) and semiquinone (QB-) in the reaction center from Rhodobacter sphaeroides.

    Science.gov (United States)

    Nabedryk, Eliane; Paddock, Mark L; Okamura, Melvin Y; Breton, Jacques

    2005-11-08

    In the photosynthetic reaction center (RC) from the purple bacterium Rhodobacter sphaeroides, proton-coupled electron-transfer reactions occur at the secondary quinone (Q(B)) site. Several nearby residues are important for both binding and redox chemistry involved in the light-induced conversion from Q(B) to quinol Q(B)H(2). Ser-L223 is one of the functionally important residues located near Q(B). To obtain information on the interaction between Ser-L223 and Q(B) and Q(B)(-), isotope-edited Q(B)(-)/Q(B) FTIR difference spectra were measured in a mutant RC in which Ser-L223 is replaced with Ala and compared to the native RC. The isotope-edited IR fingerprint spectra for the C=O [see text] and C=C [see text] modes of Q(B) (Q(B)(-)) in the mutant are essentially the same as those of the native RC. These findings indicate that highly equivalent interactions of Q(B) and Q(B)(-) with the protein occur in both native and mutant RCs. The simplest explanation of these results is that Ser-L223 is not hydrogen bonded to Q(B) or Q(B)(-) but presumably forms a hydrogen bond to a nearby acid group, preferentially Asp-L213. The rotation of the Ser OH proton from Asp-L213 to Q(B)(-) is expected to be an important step in the proton transfer to the reduced quinone. In addition, the reduced quinone remains firmly bound, indicating that other distinct hydrogen bonds are more important for stabilizing Q(B)(-). Implications on the design features of the Q(B) binding site are discussed.

  4. Conformational gating of the electron transfer reaction QA−⋅QB → QAQB−⋅ in bacterial reaction centers of Rhodobacter sphaeroides determined by a driving force assay

    Science.gov (United States)

    Graige, M. S.; Feher, G.; Okamura, M. Y.

    1998-01-01

    The mechanism of the electron transfer reaction, QA−⋅QB → QAQB−⋅, was studied in isolated reaction centers from the photosynthetic bacterium Rhodobacter sphaeroides by replacing the native Q10 in the QA binding site with quinones having different redox potentials. These substitutions are expected to change the intrinsic electron transfer rate by changing the redox free energy (i.e., driving force) for electron transfer without affecting other events that may be associated with the electron transfer (e.g., protein dynamics or protonation). The electron transfer from QA−⋅ to QB was measured by three independent methods: a functional assay involving cytochrome c2 to measure the rate of QA−⋅ oxidation, optical kinetic spectroscopy to measure changes in semiquinone absorption, and kinetic near-IR spectroscopy to measure electrochromic shifts that occur in response to electron transfer. The results show that the rate of the observed electron transfer from QA−⋅ to QB does not change as the redox free energy for electron transfer is varied over a range of 150 meV. The strong temperature dependence of the observed rate rules out the possibility that the reaction is activationless. We conclude, therefore, that the independence of the observed rate on the driving force for electron transfer is due to conformational gating, that is, the rate limiting step is a conformational change required before electron transfer. This change is proposed to be the movement, controlled kinetically either by protein dynamics or intermolecular interactions, of QB by ≈5 Å as observed in the x-ray studies of Stowell et al. [Stowell, M. H. B., McPhillips, T. M., Rees, D. C., Soltis, S. M., Abresch, E. & Feher, G. (1997) Science 276, 812–816]. PMID:9751725

  5. Trapped conformational states of semiquinone (D+*QB-*) formed by B-branch electron transfer at low temperature in Rhodobacter sphaeroides reaction centers.

    Science.gov (United States)

    Paddock, M L; Flores, M; Isaacson, R; Chang, C; Abresch, E C; Selvaduray, P; Okamura, M Y

    2006-11-28

    The reaction center (RC) from Rhodobacter sphaeroides captures light energy by electron transfer between quinones QA and QB, involving a conformational gating step. In this work, conformational states of D+*QB-* were trapped (80 K) and studied using EPR spectroscopy in native and mutant RCs that lack QA in which QB was reduced by the bacteriopheophytin along the B-branch. In mutant RCs frozen in the dark, a light induced EPR signal due to D+*QB-* formed in 30% of the sample with low quantum yield (0.2%-20%) and decayed in 6 s. A small signal with similar characteristics was also observed in native RCs. In contrast, the EPR signal due to D+*QB-* in mutant RCs illuminated while freezing formed in approximately 95% of the sample did not decay (tau >107 s) at 80 K (also observed in the native RC). In all samples, the observed g-values were the same (g = 2.0026), indicating that all active QB-*'s were located in a proximal conformation coupled with the nonheme Fe2+. We propose that before electron transfer at 80 K, the majority (approximately 70%) of QB, structurally located in the distal site, was not stably reducible, whereas the minority (approximately 30%) of active configurations was in the proximal site. The large difference in the lifetimes of the unrelaxed and relaxed D+*QB-* states is attributed to the relaxation of protein residues and internal water molecules that stabilize D+*QB-*. These results demonstrate energetically significant conformational changes involved in stabilizing the D+*QB-* state. The unrelaxed and relaxed states can be considered to be the initial and final states along the reaction coordinate for conformationally gated electron transfer.

  6. Role of the global transcriptional regulator PrrA in Rhodobacter sphaeroides 2.4.1: combined transcriptome and proteome analysis

    Energy Technology Data Exchange (ETDEWEB)

    Eraso, Jesus M.; Roh, Jung Hyeob; Zeng, Xiaohua; Callister, Stephen J.; Lipton, Mary S.; Kaplan, Samuel

    2008-07-01

    The PrrBA two-component regulatory system is a major global regulator in Rhodobacter sphaeroides 2.4.1. In this study we have compared the transcriptome and proteome profiles of the wild type (WT) and mutant PrrA2 cells grown anaerobically, in the dark, with DMSO as electron acceptor. Approximately 25% of the genes present in the genome are PrrA-regulated, at the transcriptional level, either directly or indirectly, by ≥ 2-fold relative to wild type. The genes affected are widespread throughout all COG functional categories, with previously unsuspected “metabolic” genes affected when in the PrrA mutant background. PrrA was found to act both as an activator and a repressor of transcription, with more genes being repressed in the presence of PrrA (9:5 ratio). An analysis of the genes encoding the 1,536 peptides detected through our chromatographic study, which corresponds to 36% coverage of the genome, revealed that approximately 20% of the genes encoding these proteins were positively regulated, whereas approximately 32% were negatively regulated by PrrA, which is in excellent agreement with the percentages obtained for the whole genomic transcriptome profile. In addition, comparison of the transcriptome and proteome mean parameter values chosen between WT and PrrA2 showed good qualitative agreement, indicating that transcript regulation paralleled the corresponding protein abundance, although not one for one. The microarray analysis was validated by direct mRNA measurement of randomly selected, both positively and negatively regulated genes. lacZ transcriptional and kan translational fusions enabled us to map putative PrrA binding sites, as well as revealing potential gene targets for indirect regulation by PrrA.

  7. Partial steps of charge translocation in the nonpumping N139L mutant of Rhodobacter sphaeroides cytochrome c oxidase with a blocked D-channel.

    Science.gov (United States)

    Siletsky, Sergey A; Zhu, Jiapeng; Gennis, Robert B; Konstantinov, Alexander A

    2010-04-13

    The N139L substitution in the D-channel of cytochrome oxidase from Rhodobacter sphaeroides results in an approximately 15-fold decrease in the turnover number and a loss of proton pumping. Time-resolved absorption and electrometric assays of the F --> O transition in the N139L mutant oxidase result in three major findings. (1) Oxidation of the reduced enzyme by O(2) shows approximately 200-fold inhibition of the F --> O step (k approximately 2 s(-1) at pH 8) which is not compatible with enzyme turnover ( approximately 30 s(-1)). Presumably, an abnormal intermediate F(deprotonated) is formed under these conditions, one proton-deficient relative to a normal F state. In contrast, the F --> O transition in N139L oxidase induced by single-electron photoreduction of intermediate F, generated by reaction of the oxidized enzyme with H(2)O(2), decelerates to an extent compatible with enzyme turnover. (2) In the N139L mutant, the protonic phase of Deltapsi generation coupled to the flash-induced F --> O transition greatly decreases in rate and magnitude and can be assigned to the movement of a proton from E286 to the binuclear site, required for reduction of heme a(3) from the Fe(4+) horizontal lineO(2-) state to the Fe(3+)-OH(-) state. Electrogenic reprotonation of E286 from the inner aqueous phase is missing from the F --> O step in the mutant. (3) In the N139L mutant, the KCN-insensitive rapid electrogenic phase may be composed of two components with lifetimes of approximately 10 and approximately 40 mus and a magnitude ratio of approximately 3:2. The 10 mus phase matches vectorial electron transfer from Cu(A) to heme a, whereas the 40 mus component is assigned to intraprotein proton displacement across approximately 20% of the membrane dielectric thickness. This proton displacement might be triggered by rotation of the charged K362 side chain coupled to heme a reduction. The two components of the rapid electrogenic phase have been resolved subsequently with other D

  8. 浑球红细菌(Rhodobacter sphaeroides)中氢化酶正调节基因hupR的克隆及功能分析%Isolation and Analysis of hupR Gene Required for the Expression of Hydrogenase in Rhodobacter sphaeroides

    Institute of Scientific and Technical Information of China (English)

    徐冬青; 吴永强

    2001-01-01

    Cosmid 1 containing the hup genes isolated from the photosynthetic b acterium Rhodobacter sphaeroides was studied. The hupR gene from cosmid 1 was cl oned and sequenced (EMBL accession number AJ243734). It encoded a 54.031 kD prot ein homologous to transcriptional regulators belonging to the superfamily of two -component regulatory systems. The HupR protein was overexpressed in Escheric hia coli in the form of His6-tagged HupR. The cloned hupR gene could res tore hydrog enase activity in R. Sphaeroides hupR mutants and activate hupSL gene transcription.%从光合细菌Rhodobacter sphaeroides基因文库中分离出含有氢化酶基因簇(hup)的粘粒cosmid 1后, 亚克隆了R. sphaeroides的氢化酶调节基因hupR, 测定了hupR的核苷酸序列, 并完成了氢化酶基因簇的部分物理图谱. 实验结果表明, hupR基因全长1 476 bp, 编码的HupR蛋白分子量约为54.031 kD (EMBL接受号: AJ243734). 与R. capsulatus中HupR相比, 同源性高达73%. 同源性比较结果表明, 它属于双组分调节系统中受体蛋白. hupR基因在E. coli中进行了体外表达, 纯化后测定得到的HupR蛋白的分子量大小与hupR基因推测的分子量大小一致. 通过双交换, 将卡那霉素抗性基因插入hupR基因, 获得丧失氢化酶活性的hupR-的突变株, KR5和KR7. hupS∷lacZ融合基因在野生型中的转录表达量是在该突变株中的7~9倍. 将hupR基因置于弱启动子pfru下游, 构建了质粒pNRC3, 并将其导入hupR-的突变株, 可使突变株重新获得氢化酶活性. 以上结果说明, HupR蛋白对氢化酶的转录表达起着正调节作用. 在HupR蛋白的磷酸化区域进行定点和缺失突变, 不影响HupR激活氢化酶基因的表达, 推测HupR蛋白是在非磷酸化的状态下起调节作用的.

  9. Formation of charge separated state P+OA- and triplet state 3P at low temperature in Rhodobacter sphaeroides (R-26) reaction centers in which bacteriopheophytin a is replaced by plant pheophytin a.

    Science.gov (United States)

    Shkuropatov Aya; Proskuryakov, I I; Shkuropatova, V A; Zvereva, M G; Shuvalov, V A

    1994-09-05

    Low temperature optical and photochemical properties of Rhodobacter sphaeroides (R-26) reaction centers, in which bacteriopheophytin a has been replaced by plant pheophytin a, are reported. Modified reaction centers preserve the ability for photoinduced electron transfer from the primary electron donor P to the primary quinone acceptor QA at 80K. The triplet state ESR signal of modified reaction centers with prereduced QA at 10K shows an electron spin polarization pattern and ZFS parameters analogous to those for the triplet state 3P in non-treated reaction centers. It was found that at low temperature both P+QA- and 3P states are formed via a precursor radical pair P+I- in which I is the introduced plant pheophytin molecule. This shows that acceptor systems of bacterial and plant (photosystem II) reaction centers are mutually replacable in structural and functional aspects.

  10. Relationship of proton motive force and the F(0)F (1)-ATPase with bio-hydrogen production activity of Rhodobacter sphaeroides: effects of diphenylene iodonium, hydrogenase inhibitor, and its solvent dimethylsulphoxide.

    Science.gov (United States)

    Hakobyan, Lilit; Gabrielyan, Lilit; Trchounian, Armen

    2012-08-01

    Rhodobacter sphaeroides MDC 6521 was able to produce bio-hydrogen (H(2)) in anaerobic conditions under illumination. In this study the effects of the hydrogenase inhibitor-diphenylene iodonium (Ph(2)I) and its solvent dimethylsulphoxide (DMSO) on growth characteristics and H(2) production by R. sphaeroides were investigated. The results point out the concentration dependent DMSO effect: in the presence of 10 mM DMSO H(2) yield was ~6 fold lower than that of the control. The bacterium was unable to produce H(2) in the presence of Ph(2)I. In order to examine the mediatory role of proton motive force (∆p) or the F(0)F(1)-ATPase in H(2) production by R. sphaeroides, the effects of Ph(2)I and DMSO on ∆p and its components (membrane potential (∆ψ) and transmembrane pH gradient), and ATPase activity were determined. In these conditions ∆ψ was of -98 mV and the reversed ∆pH was +30 mV, resulting in ∆p of -68 mV. Ph(2)I decreased ∆ψ in concentrations of 20 μM and higher; lower concentrations of Ph(2)I as DMSO had no valuable effect on ∆ψ. The R. sphaeroides membrane vesicles demonstrated significant ATPase activity sensitive to N,N'-dicyclohexylcarbodiimide. The 10-20 μM Ph(2)I did not affect the ATPase activity, whereas 40 μM Ph(2)I caused a marked inhibition (~2 fold) in ATPase activity. The obtained results provide novel evidence on the involvement of hydrogenase and the F(0)F(1)-ATPase in H(2) production by R. sphaeroides. Moreover, these data indicate the role of hydrogenase and the F(0)F(1)-ATPase in ∆p generation. In addition, DMSO might increase an interaction of nitrogenase with CO(2), decreasing nitrogenase activity and affecting H(2) production.

  11. Effect of co-substrate on production of poly-β- hydroxybutyrate (PHB and copolymer PHBV from newly identified mutant Rhodobacter sphaeroides U7 cultivated under aerobic-dark condition

    Directory of Open Access Journals (Sweden)

    Kemarajt Kemavongse

    2007-07-01

    Full Text Available Photosynthetic bacterial mutant strain U7 was identified using both classical and molecular (16S rDNA techniques to be Rhodobacter sphaeroides. The glutamate-acetate (GA medium containing sodium acetate and sodium glutamate as carbon and nitrogen sources was used for production of poly-β-hydroxybutyrate (PHB from R. sphaeroides U7 cultivated under aerobic-dark condition (200 rpm at 37oC. Effect of auxiliary carbon sources (propionate and valerate and concentrations (molar ratio of 40/0, 40/20, 40/40 and 40/80 on copolymer production were studied. Both combinations of acetate with valerate and acetate with propionate were found to induce the accumulation of poly-β-hydroxybutyrate-co-β-hydroxyvalerate (PHBV within the cell. Acetate with propionate in the molar ratio of 40/40 gave the highest poly-β-hydroxyalkanoates (PHA content (77.68%, followed by acetate with valerate at the same molar ratio (77.42%. Although their polymer contents were similar, the presence of 40 mM valerate gave more than 4 times higher hydroxyvalerate (HV fraction (84.77% than in the presence of 40 mM propionate (19.12% HV fraction.

  12. Oligomerization and enzyme activity analysis on inorganic pyrophosphatase from Rhodobacter sphaeroides%球形红细菌无机焦磷酸酶的寡聚化及酶活性分析

    Institute of Scientific and Technical Information of China (English)

    陈果果; 孙梅好

    2016-01-01

    球形红细菌(Rhodobacter sphaeroides)是一种重要的微生物资源,其无机焦磷酸酶(PPase)属于Ⅱ型可溶性焦磷酸酶.通过原核表达和纯化,得到了正常型RsPPase和突变型RsPPasemono,进一步进行了寡聚化和酶活性分析.结果表明:突变型RsPPasemono为单聚体,在钴离子存在条件下会导致谷胱甘肽S-转移酶(glutathione sulfotransferase,GST)标签进行蛋白酶切,且去标签后的RsPPasemono催化效率较高(Kcat/Km(PPi)=12.64L·μmol-1·min-1),相对于RsPPase-GST提高了12倍;在无钴离子存在条件下仍能进行蛋白酶切,且保持催化效率(Kcat/Km(PPi) =0.34 L·μmol-1·min-1).

  13. Application of the Accurate Mass and Time Tag Approach to the Proteome Analysis of Sub-cellular Fractions Obtained from Rhodobacter sphaeroides 2.4.1 Aerobic and Photosynthetic Cell Cultures

    Energy Technology Data Exchange (ETDEWEB)

    Callister, Stephen J.; Dominguez, Migual; Nicora, Carrie D.; Zeng, Xiaohua; Tavano, Christine; Kaplan, Samuel; Donohue, Timothy; Smith, Richard D.; Lipton, Mary S.

    2006-08-04

    Abstract The high-throughput accurate mass and time tag (AMT) proteomic approach was utilized to characterize the proteomes for cytoplasm, cytoplasmic membrane, periplasm, and outer membrane fractions from aerobic and photosynthetic cultures of the gram-nagtive bacterium Rhodobacter sphaeroides 2.4.1. In addition, we analyzed the proteins within purified chromatophore fractions that house the photosynthetic apparatus from photosynthetically grown cells. In total, 8300 peptides were identified with high confidence from at least one sub-cellular fraction from either cell culture. These peptides were derived from 1514 genes or 35% percent of proteins predicted to be encoded by the genome. A significant number of these proteins were detected within a single sub-cellular fraction and their localization was compared to in-silico predictions. However, the majority of proteins were observed in multiple sub-cellular fractions, and the most likely sub-cellular localization for these proteins was investigated using a Z-score analysis of peptide abundance along with clustering techniques. Good (81%) agreement was observed between the experimental results and in-silico predictions. The AMT tag approach provides localization evidence for those proteins that have no predicted localization information, those annotated as putative proteins, and/or for those proteins annotated as hypothetical and conserved hypothetical.

  14. Prokaryotic Expression, Purification and Preliminary Analysis on Inorganic Pyrophosphatase from Rhodobacter sphaeroides%球形红细菌无机焦磷酸酶的原核表达、纯化及初步分析

    Institute of Scientific and Technical Information of China (English)

    黄园波; 王艳兴; 戴梦瑶; 马建辉; 孙梅好

    2013-01-01

    无机焦磷酸酶(inorganic pyrophosphatase,PPase)水解在许多生物大分子的生物合成过程中产生焦磷酸并释放能量,形成的热力学拉力可促进合成反应的进行.球形红细菌(Rhodobacter sphaeroides 2.4.1)无机焦磷酸酶(RsPPase)属于Ⅱ型可溶性焦磷酸酶,钴离子对于其活性的维持具有重要的功能,而其活性调控及其表达对细菌生长的影响尚未报道.研究克隆、原核表达纯化RsPPase.结果发现,钴离子会导致谷胱甘肽S-转移酶(glutathione sulfotransferase,GST)标签不能进行蛋白酶切,且融合蛋白GST-PPase水解焦磷酸的催化效率较低(Km/kcat=2.0×104 mol/(L·s));在球形红细菌胞内表达大肠杆菌焦磷酸酶(Km/kcat=5.5×107 mol/(L·s))没有影响细菌的生长,暗示球形红细菌胞内PPase活性足够高.通过对其结构的模拟推测,在钴离子存在的情况下为闭合构象,GST标签的存在可能影响PPase羧基端结构域的运动,而影响其结合底物和释放产物的能力;在钴离子不存在的情况下为开放构象,GST标签具有较大的自由度,可暴露蛋白酶识别位点酶切产生无标签RsPPase.

  15. Steady-state FTIR spectra of the photoreduction of QA and QB in Rhodobacter sphaeroides reaction centers provide evidence against the presence of a proposed transient electron acceptor X between the two quinones.

    Science.gov (United States)

    Breton, Jacques

    2007-04-17

    In the reaction center (RC) of the photosynthetic bacterium Rhodobacter sphaeroides, two ubiquinone molecules, QA and QB, play a pivotal role in the conversion of light energy into chemical free energy by coupling electron transfer to proton uptake. In native RCs, the transfer of an electron from QA to QB takes place in the time range of 5-200 micros. On the basis of time-resolved FTIR step-scan measurements in native RCs, a new and unconventional mechanism has been proposed in which QB- formation precedes QA- oxidation [Remy, A., and Gerwert, K. (2003) Nat. Struct. Biol. 10, 637-644]. The IR signature of the proposed transient intermediary electron acceptor (denoted X) operating between QA and QB has been recently measured by the rapid-scan technique in the DN(L210) mutant RCs, in which the QA to QB electron transfer is slowed 8-fold compared to that in native RCs. This IR signature has been reported as a difference spectrum involving states X+, X, QA, and QA- [Hermes, S., et al. (2006) Biochemistry 45, 13741-13749]. Here, we report the steady-state FTIR difference spectra of the photoreduction of either QA or QB measured in both native and DN(L210) mutant RCs in the presence of potassium ferrocyanide. In these spectra, the CN stretching marker modes of ferrocyanide and ferricyanide allow the extent of the redox reactions to be quantitatively compared and are used for a precise normalization of the QA-/QA and QB-/QB difference spectra. The calculated QA- QB/QA QB- double-difference spectrum in DN(L210) mutant RCs is closely equivalent to the reported QA- X+/QA X spectrum in the rapid-scan measurement. We therefore conclude that species X+ and X are spectrally indistinguishable from QB and QB-, respectively. Further comparison of the QA- QB/QA QB- double-difference spectra in native and DN(L210) RCs also allows the possibility that QB- formation precedes QA- reoxidation to be ruled out for native RCs.

  16. Rhodobacter megalophilus sp. nov., a phototroph from the Indian Himalayas possessing a wide temperature range for growth.

    Science.gov (United States)

    Arunasri, K; Venkata Ramana, V; Spröer, C; Sasikala, Ch; Ramana, Ch V

    2008-08-01

    Two strains of phototrophic, purple non-sulfur bacteria capable of growing at low temperatures (5 degrees C) were isolated from the Himalayas. The two strains showed positive phototaxis and grew over a relatively wide temperature range (5-40 degrees C). Phylogenetic analysis based on 16S rRNA gene sequences showed that strain JA194T clustered with members of the genus Rhodobacter. Strain JA194T showed highest 16S rRNA gene sequence similarity with Rhodobacter sphaeroides DSM 158T (99 %). However, DNA-DNA hybridization experiments between Rba. sphaeroides DSM 158T and strain JA194T revealed a level of relatedness of only 67 %. The DNA base composition of strain JA194T was 66.67 mol% G+C (by HPLC). Based on 16S rRNA gene sequence analysis, morphological, physiological, Fourier transform infrared fingerprinting and DNA-DNA hybridization studies, strain JA194T (=KCTC 5602T =JCM 14598T) is sufficiently different from other Rhodobacter species to merit its description as the type strain of a novel species, for which the name Rhodobacter megalophilus sp. nov. is proposed.

  17. Kinetics of cytochrome c oxidase from R. sphaeroides initiated by direct electron transfer followed by tr-SEIRAS.

    Science.gov (United States)

    Steininger, Christoph; Reiner-Rozman, Ciril; Schwaighofer, Andreas; Knoll, Wolfgang; Naumann, Renate L C

    2016-12-01

    Time-resolved surface-enhanced IR-absorption spectroscopy (tr-SEIRAS) has been performed on cytochrome c oxidase from Rhodobacter sphaeroides. The enzyme was converted electrochemically into the fully reduced state. Thereafter, in the presence of oxygen, the potential was switched to open circuit potential (OCP). Under these conditions, the enzyme is free to undergo enzymatic oxidation in the absence of an external electric field. Tr-SEIRAS was performed using the step-scan technique, triggered by periodic potential pulses switching between - 800mV and OCP. Single bands were resolved in a broad band in the amide I region using phase sensitive detection. Amplitudes of these bands were analyzed as a function of time. Time constants in the ms time scale were considered in terms of conformational changes of the protein secondary structures associated with the enzymatic turnover of the protein.

  18. Complete Genome Sequences of Five Bacteriophages That Infect Rhodobacter capsulatus.

    Science.gov (United States)

    Bollivar, David W; Bernardoni, Brooke; Bockman, Matthew R; Miller, Brenda M; Russell, Daniel A; Delesalle, Veronique A; Krukonis, Gregory P; Hatfull, Graham F; Cross, Madeline R; Szewczyk, Marlena M; Eppurath, Atul

    2016-05-26

    Five bacteriophages that infect the Rhodobacter capsulatus strain YW1 were isolated from stream water near Bloomington, Illinois, USA. Two distinct genome types are represented in the newly isolated bacteriophages. These genomes are different from other bacteriophage genomes previously described.

  19. DU COTÉ DE CHEZ SOI

    OpenAIRE

    Marc Smeets

    2013-01-01

    Le voyage en Hollande, au XIXe siècle, s'inscrit dans une longue tradition où résonnent les notions de liberté, tolérance et commerce, mais il acquiert aussi une spécificité étant donné l’importance que prend la figure du « chez soi » : les Pays-Bas, terre d'agrément où le voyageur français se sent à l'aise et où il aimerait, si possible, vivre. Proust, de ce point de vue-là, ne fait rien de neuf quand il rêve dans la Recherche d'une « vie domestique » en terre batave. Les Pays-Bas, pour le v...

  20. Cytochrome c2-independent respiratory growth of Rhodobacter capsulatus.

    OpenAIRE

    Daldal, F

    1988-01-01

    To assess the role of cytochrome c2 as a respiratory electron carrier, we obtained a double mutant of Rhodobacter capsulatus defective in cytochrome c2 and in the quinol oxidase260. This mutant was able to grow chemoheterotrophically, indicating that an electron pathway independent of cytochrome c2 was functional between the ubiquinol:cytochrome c2 oxidoreductase and the cytochrome oxidase410.

  1. The Conserved Dcw Gene Cluster of R. sphaeroides Is Preceded by an Uncommonly Extended 5' Leader Featuring the sRNA UpsM.

    Science.gov (United States)

    Weber, Lennart; Thoelken, Clemens; Volk, Marcel; Remes, Bernhard; Lechner, Marcus; Klug, Gabriele

    2016-01-01

    Cell division and cell wall synthesis mechanisms are similarly conserved among bacteria. Consequently some bacterial species have comparable sets of genes organized in the dcw (division and cell wall) gene cluster. Dcw genes, their regulation and their relative order within the cluster are outstandingly conserved among rod shaped and gram negative bacteria to ensure an efficient coordination of growth and division. A well studied representative is the dcw gene cluster of E. coli. The first promoter of the gene cluster (mraZ1p) gives rise to polycistronic transcripts containing a 38 nt long 5' UTR followed by the first gene mraZ. Despite reported conservation we present evidence for a much longer 5' UTR in the gram negative and rod shaped bacterium Rhodobacter sphaeroides and in the family of Rhodobacteraceae. This extended 268 nt long 5' UTR comprises a Rho independent terminator, which in case of termination gives rise to a non-coding RNA (UpsM). This sRNA is conditionally cleaved by RNase E under stress conditions in an Hfq- and very likely target mRNA-dependent manner, implying its function in trans. These results raise the question for the regulatory function of this extended 5' UTR. It might represent the rarely described case of a trans acting sRNA derived from a riboswitch with exclusive presence in the family of Rhodobacteraceae.

  2. The Conserved Dcw Gene Cluster of R. sphaeroides Is Preceded by an Uncommonly Extended 5’ Leader Featuring the sRNA UpsM

    Science.gov (United States)

    Weber, Lennart; Thoelken, Clemens; Volk, Marcel; Remes, Bernhard; Lechner, Marcus; Klug, Gabriele

    2016-01-01

    Cell division and cell wall synthesis mechanisms are similarly conserved among bacteria. Consequently some bacterial species have comparable sets of genes organized in the dcw (division and cell wall) gene cluster. Dcw genes, their regulation and their relative order within the cluster are outstandingly conserved among rod shaped and gram negative bacteria to ensure an efficient coordination of growth and division. A well studied representative is the dcw gene cluster of E. coli. The first promoter of the gene cluster (mraZ1p) gives rise to polycistronic transcripts containing a 38 nt long 5’ UTR followed by the first gene mraZ. Despite reported conservation we present evidence for a much longer 5’ UTR in the gram negative and rod shaped bacterium Rhodobacter sphaeroides and in the family of Rhodobacteraceae. This extended 268 nt long 5’ UTR comprises a Rho independent terminator, which in case of termination gives rise to a non-coding RNA (UpsM). This sRNA is conditionally cleaved by RNase E under stress conditions in an Hfq- and very likely target mRNA-dependent manner, implying its function in trans. These results raise the question for the regulatory function of this extended 5’ UTR. It might represent the rarely described case of a trans acting sRNA derived from a riboswitch with exclusive presence in the family of Rhodobacteraceae. PMID:27802301

  3. DU COTÉ DE CHEZ SOI

    Directory of Open Access Journals (Sweden)

    Marc Smeets

    2013-12-01

    Full Text Available Le voyage en Hollande, au XIXe siècle, s'inscrit dans une longue tradition où résonnent les notions de liberté, tolérance et commerce, mais il acquiert aussi une spécificité étant donné l’importance que prend la figure du « chez soi » : les Pays-Bas, terre d'agrément où le voyageur français se sent à l'aise et où il aimerait, si possible, vivre. Proust, de ce point de vue-là, ne fait rien de neuf quand il rêve dans la Recherche d'une « vie domestique » en terre batave. Les Pays-Bas, pour le voyageur français au XIXe, c'est le home sweet home.

  4. Lipides et comportement alimentaire chez les enfants

    Directory of Open Access Journals (Sweden)

    Nicklaus Sophie

    2016-05-01

    Full Text Available Cet article analyse la place des lipides dans l’alimentation des jeunes enfants. Premièrement, il montre d’une part la contribution importante que devraient avoir les lipides aux apports énergétiques totaux des enfants de moins de deux ans, en raison de leur intérêt fonctionnel dans le développement neuronal et de leur effet potentiellement protecteur d’une obésité ultérieure; d’autre part, il souligne la faible contribution des lipides aux apports énergétiques totaux chez les enfants français, d’après les estimations disponibles, avec une minorité d’enfants pour lesquels les apports en lipides sont satisfaisants. Deuxièmement, il rapporte les connaissances disponibles concernant le contrôle « sensoriel » de la consommation de lipides. Chez les nouveau-nés et les nourrissons, quelques travaux portent sur les préférences pour les lipides, et indiquent l’absence d’une préférence pour les lipides. Chez les enfants, une teneur augmentée en lipides a parfois (mais pas toujours un effet positif sur l’appréciation d’un aliment, avec souvent une teneur optimale; mais elle n’est pas associée à une consommation plus élevée de l’aliment. Des teneurs élevées en lipides ont deux effets sur les apprentissages alimentaires. Chez des enfants de moins de 3 ans, un triplement de la densité énergétique par l’ajout de lipides est associé à la mise en place d’un rassasiement conditionné pour l’aliment concerné; chez des enfants plus âgés, un doublement de la densité énergétique par l’ajout de lipides, est associé à une augmentation de l’appréciation des flaveurs associées aux versions les plus riches en lipides. Des pistes d’études complémentaires sont discutées.

  5. Hydrogen production from starch by co-culture of Clostridium acetobutylicum and Rhodobacter sphaeroides in one step hybrid dark- and photofermentation in repeated fed-batch reactor.

    Science.gov (United States)

    Zagrodnik, R; Łaniecki, M

    2017-01-01

    Hydrogen production from starch by a co-culture hybrid dark and photofermentation under repeated fed-batch conditions at different organic loading rates (OLR) was studied. Effective cooperation between bacteria in co-culture during initial days was observed at controlled pH 7.0. However, at pH above 6.5 dark fermentation phase was redirected from H2 formation towards production of formic acid, lactic acid and ethanol (which are not coupled with hydrogen production) with simultaneous lower starch removal efficiency. This resulted in decrease in the hydrogen production rate. The highest H2 production in co-culture process (3.23LH2/Lmedium - after 11days) was achieved at OLR of 1.5gstarch/L/day, and it was twofold higher than for dark fermentation process (1.59LH2/Lmedium). The highest H2 yield in the co-culture (2.62molH2/molhexose) was obtained at the OLR of 0.375gstarch/L/day. Different pH requirements of bacteria were proven to be a key limitation in co-culture system.

  6. Proton transfer from the bulk to the bound ubiquinone QB of the reaction center in chromatophores of Rhodobacter sphaeroides: Retarded conveyance by neutral water

    Science.gov (United States)

    Gopta, Oksana A.; Cherepanov, Dmitry A.; Junge, Wolfgang; Mulkidjanian, Armen Y.

    1999-01-01

    The mechanism of proton transfer from the bulk into the membrane protein interior was studied. The light-induced reduction of a bound ubiquinone molecule QB by the photosynthetic reaction center is accompanied by proton trapping. We used kinetic spectroscopy to measure (i) the electron transfer to QB (at 450 nm), (ii) the electrogenic proton delivery from the surface to the QB site (by electrochromic carotenoid response at 524 nm), and (iii) the disappearance of protons from the bulk solution (by pH indicators). The electron transfer to QB− and the proton-related electrogenesis proceeded with the same time constant of ≈100 μs (at pH 6.2), whereas the alkalinization in the bulk was distinctly delayed (τ ≈ 400 μs). We investigated the latter reaction as a function of the pH indicator concentration, the added pH buffers, and the temperature. The results led us to the following conclusions: (i) proton transfer from the surface-located acidic groups into the QB site followed the reduction of QB without measurable delay; (ii) the reprotonation of these surface groups by pH indicators and hydronium ions was impeded, supposedly, because of their slow diffusion in the surface water layer; and (iii) as a result, the protons were slowly donated by neutral water to refill the proton vacancies at the surface. It is conceivable that the same mechanism accounts for the delayed relaxation of the surface pH changes into the bulk observed previously with bacteriorhodopsin membranes and thylakoids. Concerning the coupling between proton pumps in bioenergetic membranes, our results imply a tendency for the transient confinement of protons at the membrane surface. PMID:10557290

  7. Energy Coupling of Facilitated Transport of Inorganic Ions in Rhodopseudomonas sphaeroides

    NARCIS (Netherlands)

    Hellingwerf, K; Friedberg, Ilan; Lolkema, Juke S.; Michels, Paul A.M.; Konings, Wilhelmus

    1982-01-01

    Within the scope of a study on the effects of changes in medium composition on the proton motive force in Rhodopseudomonas sphaeroides, the energy coupling of sodium, phosphate, and potassium (rubidium) transport was investigated. Sodium was transported via an electroneutral exchange system against

  8. Effects of the Medium Composition on the Components of the Electrochemical Proton Gradient in Rhodopseudomonas sphaeroides

    NARCIS (Netherlands)

    Michels, Paul A.M.; Hellingwerf, K; Lolkema, Juke S.; Friedberg, Ilan; Konings, Wilhelmus

    1981-01-01

    The magnitude and composition of the proton motive force (Δµ~H+) has been measured in chromatophores and whole cells of Rhodopseudomonas sphaeroides as a function of the ionic composition of the buffer in which the energy-transducing membranes are suspended. Measurements with the flow-dialysis techn

  9. Analysis of the puc Operon Promoter from Rhodobacter capsulatus

    Science.gov (United States)

    Nickens, David G.; Bauer, Carl E.

    1998-01-01

    Expression of the Rhodobacter capsulatus puc operon, which codes for structural polypeptides of the light-harvesting-II peripheral antenna complex, is highly regulated in response to alterations in oxygen tension and light intensity. To obtain an understanding of the puc promoter region we report the high-resolution 5′ mapping of the puc mRNA transcriptional start site and DNA sequence analysis of the puc upstream regulatory sequence (pucURS). A ς70-type promoter sequence was identified (pucP1) which has a high degree of sequence similarity with carotenoid and bacteriochlorophyll biosynthesis promoters. Inspection of the DNA sequence also indicated the presence of two CrtJ and four integration host factor (IHF) binding sites. Transcriptional fusions of the pucURS fused to lacZ also confirmed that puc promoter activity is regulated by the transcriptional regulators IHF, CrtJ, and RegA. Gel retardation analysis using cell extracts indicates that mutations in IHF and RegA disrupt protein binding to DNA fragments containing the pucURS. PMID:9696778

  10. Colony development and physiological characterization of the edible blue-green alga, Nostoc sphaeroides (Nostocaceae, Cyanophyta)

    Institute of Scientific and Technical Information of China (English)

    Zhongyang Deng; Qiang Hu; Fan Lu; Guoxiang Liu; Zhengyu Hu

    2008-01-01

    The edible blue-green alga,Nostoc sphaeroides Kützing,is able to form microcolorties and spherical macrocolonies.It has been used as a potent herbal medicine and dietary supplement for centuries because of its nutraceutical and pharmacological benefits.However,lim-ited information is available on the development of the spherical macrocolonies and the environmental factors that affect their structure.This report described the morphogenesis of N.Sphaeroides from single trichomes to macrocolonies.During the process,most structural features of macrocolonies of various sizes were dense maculas,rings,the compact core and the formation of liquid core;and the filaments within the macrocolonies showed different lengths and arrays depending on the sizes of macrocolonies.Meanwhile temperature and light intensity also strongly affected the internal structure of macrocolonies.As microcolonies further increased in size to form 30 mm mac-rocolonies,the colonies differentiated into distinct outer,middle and inner layers.The filaments of the outer layer showed higher max-imum photosynthetic rates,higher light saturation point,and higher photosynthetic efficiency than those of the inner layer;whereas the filaments of the inner layer had a higher content of chlorophyll a and phycobiliproteins than those of the outer layer.The results obtained in this study were important for the mass cultivation of N.Sphaeroides as a nutraceutical product.

  11. Inactivation of Mg Chelatase during Transition from Anaerobic to Aerobic Growth in Rhodobacter capsulatus

    OpenAIRE

    Willows, Robert D.; Lake, Vanessa; Roberts, Thomas Hugh; Beale, Samuel I.

    2003-01-01

    The facultative photosynthetic bacterium Rhodobacter capsulatus can adapt from an anaerobic photosynthetic mode of growth to aerobic heterotrophic metabolism. As this adaptation occurs, the cells must rapidly halt bacteriochlorophyll synthesis to prevent phototoxic tetrapyrroles from accumulating, while still allowing heme synthesis to continue. A likely control point is Mg chelatase, the enzyme that diverts protoporphyrin IX from heme biosynthesis toward the bacteriochlorophyll biosynthetic ...

  12. Electrochemical determination of hydrogen peroxide using Rhodobacter capsulatus cytochrome c peroxidase at a gold electrode

    NARCIS (Netherlands)

    De Wael, K.; Buschop, H.; Heering, H.A.; De Smet, L.; Van Beeumen, J.; Devreese, B.; Adriaens, A.

    2007-01-01

    We describe the redox behaviour of horse heart cytochrome c (HHC) and Rhodobacter capsulatus cytochrome c peroxidase (RcCCP) at a gold electrode modified with 4,4′-bipyridyl. RcCCP shows no additional oxidation or reduction peaks compared to the electrochemistry of only HHC, which indicates that it

  13. Embryonic, Larval, and Early Juvenile Development of the Tropical Sea Urchin, Salmacis sphaeroides (Echinodermata: Echinoidea

    Directory of Open Access Journals (Sweden)

    M. Aminur Rahman

    2012-01-01

    Full Text Available Salmacis sphaeroides (Linnaeus, 1758 is one of the regular echinoids, occuring in the warm Indo-West Pacific, including Johor Straits, between Malaysia and Singapore. In order to investigate the developmental basis of morphological changes in embryos and larvae, we documented the ontogeny of S. sphaeroides in laboratory condition. Gametes were obtained from adult individuals by 0.5 M KCl injection into the coelomic cavity. Fertilization rate at limited sperm concentration (10−5 dilution was 96.6±1.4% and the resulting embryos were reared at 24°C. First cleavage (2-cell, 4-cell, 8-cell, 16-cell, 32-cell, and multicell (Morulla stages were achieved 01.12, 02.03, 02.28, 02.51, 03.12, and 03.32 h postfertilization. Ciliated blastulae with a mean length of 174.72±4.43 μm hatched 08.45 h after sperm entry. The gastrulae formed 16.15 h postfertilization and the archenteron elongated constantly while ectodermal red-pigmented cells migrated synchronously to the apical plate. Pluteus larva started to feed unicellular algae in 2 d, grew continuously, and finally attained metamorphic competence in 35 d after fertilization. Metamorphosis took approximately 1 h 30 min from attachment to the complete resorption of larval tissues and the development of complete juvenile structure with adult spines, extended tubefeet and well-developed pedicellaria, the whole event of which usually took place within 1 d postsettlement. This study represents the first successful investigation on embryonic, larval, and early juvenile development of S. sphaeroides. The findings would greatly be helpful towards the understanding of ontogeny and life-history strategies, which will facilitate us to develop the breeding, seed production, and culture techniques of sea urchins in captive condition.

  14. L’amor humanus chez Marsile Ficin

    Directory of Open Access Journals (Sweden)

    Laurence Boulègue

    2010-12-01

    Full Text Available Les éditions et études du Commentaire sur le Banquet de Platon, ou De amore, de Marsile Ficin ont mis en évidence que la conception de Vamor humanus chez l'humaniste florentin, inspirée certes des définitions du Banquet de Platon, était étroitement liée aux conceptions néoplatoniciennes héritées de Plotin. Néanmoins, l'interprétation du texte de Platon et les développements de ses successeurs ne sauraient à eux seuls rendre compte de la définition ficinienne, notamment dans son lien avec la notion, romaine, de la fascinatio. La philosophie et la poésie romaines des passions offrent une analyse du sentiment amoureux dont les échos sont sensibles dans le texte même du Commentaire. En effet, l'exposé des passions qu'offre le livre IV des Tusculanes a sans aucun doute fourni à Ficin les caractéristiques et la définition du « mauvais amour », dont l'évocation n'est pas étrangère aux motifs poétiques tels qu'on peut les trouver, par exemple, dans la poésie ovidienne à propos du mythe de Narcisse, dont Ficin se souvient. Si Cicéron soulignait, au début du livre IV des Tusculanes, la tension qui existait entre l'anthropologie platonicienne et la théorie des passions stoïcienne, il ne la résolvait pas. Ficin, lui, réalise cette articulation grâce à la hiérarchisation néoplatonicienne des différents amours et peut ainsi affirmer l'existence d'un bon amour. Mais un tel amor humanus, qui est amour philopédique, destiné à l'élévation divine ou voué à s'affaisser jusqu'à la concupiscence bestiale, ne peut être qu'un moment dans le processus proposé par Ficin, un point de fragile équilibre, intenable.

  15. First Insights into the Genome Sequence of the Strictly Anaerobic Homoacetogenic Sporomusa sphaeroides Strain E (DSM 2875)

    Science.gov (United States)

    Villamizar, Genis Andrés Castillo; Daniel, Rolf

    2017-01-01

    ABSTRACT Here, we report the draft genome sequence of Sporomusa sphaeroides strain E (DSM 2875), a strict anaerobic homoacetogenic bacterium. It is able to grow autotrophically on different one-carbon compounds. The strain possesses several genes of the Wood-Ljungdahl pathway. The genome consists of a single chromosome (4.98 Mb). PMID:28336590

  16. Photoregulated or Energy Dependent Process of Hormogonia Differentiation in Nostoc sphaeroides Kützing (Cyanobacterium)

    Institute of Scientific and Technical Information of China (English)

    Dun-Hai LI; Lan-Zhou CHEN; Gen-Bao LI; Gao-Hong WANG; Li-Rong SONG; Yong-Ding LIU

    2005-01-01

    Hormogonium, which was thought to play an important role in the dispersal and survival of these microorganisms in their natural habitats, is a distinguishable developmental stage of heterocystous cyanobacteria. The present study examined the effects of different light conditions and sugars on the of hormogonia was light dependent in the absence of sugar, but that close to 100% of cyanobacteria differentiated to hormogonia in the presence of glucose or sucrose, irrespective of the light conditions. This differentiation was inhibited, even in the presence of sugars, upon application of an inhibitor of respiration.Following the testing of different sugars, the effects of different lights were examined. It was found that 5-10 μmol.m-2.s-1 photon flux density was optimal for hormogonia differentiation. One hundred percent differentiation was obtained with white light irradiation, in contrast with irradiation with green light (80%differentiation) and red light (0-10% differentiation). Although they showed different efficiencies in induc ing hormogonia differentiation in N. sphaeroides, the green and red radiation did not display antagonistic effects. When the additional aspect of time dependence was investigated through the application of different light radiations and an inhibitor of protein synthesis, it was found that the initial 6 h of the differentiation process was crucial for hormogonia differentiation. Taken together, these results show that hormogonia differentiation in N. sphaeroides is either a photoregulated or an energy dependent process.

  17. Rhodobacter changlensis sp. nov., a psychrotolerant, phototrophic alphaproteobacterium from the Himalayas of India.

    Science.gov (United States)

    Anil Kumar, P; Srinivas, T N R; Sasikala, Ch; Ramana, Ch V

    2007-11-01

    A Gram-negative, non-motile, oval to rod-shaped, psychrotolerant, phototrophic, purple non-sulfur bacterium (designated strain JA139T) was isolated from a snow sample from Changla Pass in the Indian Himalayas. Strain JA139T had vesicular-type intracytoplasmic membrane structures and contained bacteriochlorophyll a and most probably spheroidene-like carotenoids. Biotin, niacin and thiamine were required for growth of strain JA139T. Phylogenetic analysis on the basis of 16S rRNA gene sequences showed that the strain clustered with species of the genus Rhodobacter but was distinctly separate from all recognized members of the family Rhodobacteraceae. Based on the genotypic and phenotypic differences observed between strain JA139T and recognized Rhodobacter species, strain JA139T is considered to represent a novel species of the genus, for which the name Rhodobacter changlensis sp. nov. is proposed. The type strain is JA139T (=DSM 18774T=CCUG 53722T=JCM 14338T).

  18. Chosification et déchosification chez Simone de Beauvoir

    Directory of Open Access Journals (Sweden)

    Sylvain Rhéault

    2005-04-01

    Full Text Available En appliquant aux textes de Simone de Beauvoir un modèle d’analyse du combat inspiré des travaux de Martin Buber, la présente étude propose de distinguer les stratégies philosophiques propres à chacun des combats décrits chez Simone de Beauvoir avant de proposer une explication quant à la similitude des stratégies littéraires.

  19. The effect of temperature and light intensity on hydrogen production by Rhodobacter capsulatus

    Energy Technology Data Exchange (ETDEWEB)

    Eroglu, Inci [Middle East Technical Univ., Ankara (Turkey). Dept. of Chemical Engineering; Sevinc, Pelin [Middle East Technical Univ., Ankara (Turkey). Dept. of Biotechnology; Guenduez, Ufuk; Yucel, Meral [Middle East Technical Univ., Ankara (Turkey). Dept. of Biological Sciences

    2010-07-01

    Rhodobacter capsulatus is a purple non-sulfur photosynthetic bacterium which can produce hydrogen by photofermentation on acetate and lactate. Hydrogen productivity depends on several parameters such as medium composition, pH, light intensity and temperature. In the present study, the effects of temperature and light intensity on hydrogen production were investigated. The cell growth curve has been fitted to the logistic model and hydrogen productivity was interpreted by Modified Gompertz Equation. The maximum productivity was obtained at 30 C and light intensity of 4000 lux. (orig.)

  20. Effects of Rhodobacter sphaeroides on Cadmiun Accumulations of Wheat Seedlligs under Cadmium Stress%球形红细菌对镉胁迫下小麦幼苗镉积累的影响

    Institute of Scientific and Technical Information of China (English)

    郭凌; 张肇铭; 张峰; 芦冬涛

    2007-01-01

    为了研究光合细菌球形红细菌菌悬液对镉胁迫下小麦幼苗镉积累的影响.运用三因素交叉分组随机设计,通过水培试验,研究了球形红细菌菌悬液对小麦幼苗生长过程中培养液Cd2+浓度的影响,以及球形红细菌菌悬液与Cd2+复合处理对小麦幼苗茎叶和根系镉积累量的影响.培养液中Cd2+浓度随培养时间的延长而降低,在小麦幼苗生长初期降低幅度较大;茎叶和根系镉积累量既随培养液Cd2+浓度增加而增加,也随培养时间的延长而增加,在第7~10天镉积累量的增长幅度最大,且根系镉积累量>茎叶镉积累量;施用球形红细菌菌悬液后培养液Cd2+浓度以及小麦幼苗茎叶和根系中镉积累量比对照分别降低了1.9%~49.9%、12.3%~58.1%和8.3%~53.9%.该研究为光合细菌的进一步开发利用提供了理论基础.

  1. ENDOR Spectroscopy Reveals A Light Induced Movement of the H-Bond from Ser-L223 Upon Forming the Semiquinone (QB−•) in Reaction Centers from Rhodobacter sphaeroides

    Science.gov (United States)

    Paddock, M. L.; Flores, M.; Isaacson, R.; Chang, C.; Abresch, E. C.; Okamura, M.Y.

    2008-01-01

    Proton ENDOR spectroscopy was used to monitor local conformational changes in bacterial reaction centers (RC) associated with the electron transfer reaction DQB → D+•QB−• using mutant RCs capable of photo-reducing QB at cryogenic temperatures. The charge separated state D+•QB−• was studied in mutant RCs formed by either (i) illuminating at low temperature (77K) a sample frozen in the dark (ground state protein conformation) or (ii) illuminating at room temperature prior to and during the freezing (charge separated state protein conformation). The charge recombination rates from the two states differed greatly (>106 fold) as shown previously, indicating a structural change (Paddock et al (2006) Biochemistry 45, 14032 - 14042). ENDOR spectra of QB−• from both samples (35 GHz, 77K) showed three nearly identical sets of hyperfine couplings due to exchangeable protons that were similar to those for QB−• in native RCs indicating that in all RCs, QB−• was located at the proximal position near the metal site. In contrast, one set of H-bond couplings was observed only in the sample frozen under illumination in which the protein can relax prior to freezing. This H-bond was assigned to an interaction between the Ser-L223 hydroxyl and QB−• based on its absence in Ser L223 → Ala mutant RCs. The Ser-L223 hydroxyl H-bond was also observed in the native RCs frozen under illumination. Thus, part of the protein relaxation in response to light induced charge separation involves the formation of an H-bond between the OH group of Ser-L223 and the anionic semiquinone QB−•. This proton movement serves to stabilize the charge separated state and facilitate proton transfer to reduced QB. PMID:17590017

  2. Ultrafast excitation relaxation in light-harvesting complex LH2 from Rb.sphaeroides 601

    Institute of Scientific and Technical Information of China (English)

    GUO Lijun; LIU Yuan; LIU Weimin; GUO Junhua; XU Chunhe; QIAN Shixiong

    2004-01-01

    The energy relaxation and kinetic evolution of transient spectra of bacteriochloro- phylls (BChls) in light-harvesting complex LH2 from Rb. Sphaeroides 601 were investigated using femtosecond pump-probe technique. Upon 783 nm excitation, the energy at B800 BChls experiences an intramolecular redistribution with 0.35 ps time constant before transferring to B850 BChls. With tuning the excitation wavelength, the dynamical evolution of excited BChls was clearly observed, which indicates an obvious competition between the ground state bleaching and excited state absorption (ESA) of BChls involved and an isosbestic point near 818 nm, and also demonstrates that from the lower electronic excited state of B800 BChls to the higher excitonic state of B850 BChls is an efficient routine for energy transfer. The excitation energy in higher excitonic states of B850 BChls relaxes rapidly to the next lowest excitonic state by interconversion, delocalization to adjacent molecular, populating the lowest excitonic state and the change of molecular conformation.

  3. Ultrafast excitation relaxation in light-harvesting complex LH2 from Rb. sphaeroides 601

    Institute of Scientific and Technical Information of China (English)

    GUO; Lijun; LIU; Yuan; LIU; Weimin; GUO; Junhua; XU; Chunhe

    2004-01-01

    The energy relaxation and kinetic evolution of transient spectra of bacteriochloro- phylls (BChls) in light-harvesting complex LH2 from Rb. Sphaeroides 601 were investigated using femtosecond pump-probe technique. Upon 783 nm excitation, the energy at B800 BChls experiences an intramolecular redistribution with 0.35 ps time constant before transferring to B850 BChls. With tuning the excitation wavelength, the dynamical evolution of excited BChls was clearly observed, which indicates an obvious competition between the ground state bleaching and excited state absorption (ESA) of BChls involved and an isosbestic point near 818 nm, and also demonstrates that from the lower electronic excited state of B800 BChls to the higher excitonic state of B850 BChls is an efficient routine for energy transfer. The excitation energy in higher excitonic states of B850 BChls relaxes rapidly to the next lowest excitonic state by interconversion, delocalization to adjacent molecular, populating the lowest excitonic state and the change of molecular conformation.

  4. Changing cellular location of CheZ predicted by molecular simulations.

    Directory of Open Access Journals (Sweden)

    Karen Lipkow

    2006-04-01

    Full Text Available In the chemotaxis pathway of the bacterium Escherichia coli, signals are carried from a cluster of receptors to the flagellar motors by the diffusion of the protein CheY-phosphate (CheYp through the cytoplasm. A second protein, CheZ, which promotes dephosphorylation of CheYp, partially colocalizes with receptors in the plasma membrane. CheZ is normally dimeric in solution but has been suggested to associate into highly active oligomers in the presence of CheYp. A model is presented here and supported by Brownian dynamics simulations, which accounts for these and other experimental data: A minority component of the receptor cluster (dimers of CheA(short nucleates CheZ oligomerization and CheZ molecules move from the cytoplasm to a bound state at the receptor cluster depending on the current level of cellular stimulation. The corresponding simulations suggest that dynamic CheZ localization will sharpen cellular responses to chemoeffectors, increase the range of detectable ligand concentrations, and make adaptation more precise and robust. The localization and activation of CheZ constitute a negative feedback loop that provides a second tier of adaptation to the system. Subtle adjustments of this kind are likely to be found in many other signaling pathways.

  5. Bioproduction of hydrogen by Rhodobacter capsulatus KU002 isolated from leather industry effluents

    Energy Technology Data Exchange (ETDEWEB)

    Merugu, Ramchander; Girisham, S.; Reddy, S.M. [Department of Biochemistry and Microbiology, Kakatiya University, Warangal (India)

    2010-09-15

    A preliminary study on photoproduction of hydrogen by Rhodobacter capsulatus KU002 isolated from leather industry effluents under different cultural conditions with various carbon and nitrogen sources was investigated. Hydrogen production was measured using a Gas chromatograph. Lactate promoted more amounts of hydrogen production under anaerobic light conditions and aerobic light conditions. Cumulative hydrogen production by the organism was recorded at various time intervals. Incubation period of 120 h was optimum for production of hydrogen. pH 7.0 {+-} 0.2 was optimum for production of hydrogen by growing cells, while pH 7.5 {+-} 0.26 for resting cells. L-cystine was a good nitrogen source for production of hydrogen. Growing cells produced more amount of hydrogen than resting cells. Glutamine was a poor nitrogen source for hydrogen production by Rb. capsulatus. Significance of the above results in the presence of existing literature is discussed. (author)

  6. State estimation of a batch hydrogen production process using the photosynthetic bacteria Rhodobacter capsulatus

    Energy Technology Data Exchange (ETDEWEB)

    Obeid, Jamila; Magnin, Jean-Pierre [Grenoble University, LEPMI, UMR 5631 (CNRS-INPG-UJF), Laboratoire d' Electrochimie et de Physico chimie des Materiaux et Interfaces, BP 75, 38402 St. Martin d' Heres (France); Flaus, Jean-Marie; Adrot, Olivier [Grenoble University, G-SCOP UMR 272 (CNRS-INPG-UJF), Laboratoire des Sciences pour la Conception, l' Optimisation et la Production, 46, avenue Felix Viallet, 38031 Grenoble (France); Willison, John C. [Laboratoire de Chimie et Biologie des Metaux (UMR 5249 CEA-CNRS-UJF), iRTSV/LCBM, CEA-Grenoble, 38054 Grenoble (France)

    2010-10-15

    This paper addresses the problem of estimating the states of an anaerobic photosynthetic process used for biohydrogen production by the photosynthetic bacterium Rhodobacter capsulatus. The process is described by a non-linear, time-discrete model and the state estimation is solved using an observer based on the Moving-Horizon State Estimation Method (MHSE). This approach is based on the minimization of a criterion (a non-linear function), in this case, the difference between the estimated output and the measured output of the system over a considered time horizon, where the solution is computed by using a numerical interval method. The observer was successfully applied to hydrogen production by R. capsulatus strain B10 in a batch process. (author)

  7. Ostéopathie et troubles gastriques chez le chien

    OpenAIRE

    Agneray, François

    2003-01-01

    L'auteur se propose dans cette étude d'évaluer les possibilités thérapeutiques de l'ostéopathie (ou médecine manuelle) en cas de troubles gastriques chez le chien.Pour cela, il étudiera l'estomac et ses pathologies en insistant sur les points nécessaires à la compréhension du mode d'action de l'ostéopathie sur cet organe. L'ostéopathe, en agissant sur la structure, peut jouer sur la fonction : les troubles à dominante fonctionnelle seront donc traitées par ostéopathie avec le plus de profit, ...

  8. Le zona ophtalmique: une dermatose rare chez l'enfant

    Science.gov (United States)

    Zakia, Douhi; Meziane, Marieme; Salim, Gallouj; Zahra, Mernissi Fatima

    2015-01-01

    Le zona est dû a une réactivation du virus varicelle-zona (VZV) qui reste quiescent dans les ganglions sensitifs dorsaux après la varicelle. Le zona de l'enfant est rare et particulièrement la forme ophtalmique, qui peut être responsable de complications oculaires graves nécessitant une prise en charge adéquate et précoce. Il est parfois associé à des douleurs post-zostériennes dont le traitement est difficile. L'aciclovir per os administré dans les 72 heures après l’éruption a prouvé son efficacité dans la prévention des complications oculaires. Nous en rapportant un nouveaux cas chez un garçon immunocompétent de 9 ans, sans notion de varicelle antérieure. PMID:26955408

  9. Structural and phylogenetic analysis of Rhodobacter capsulatus NifF: uncovering general features of nitrogen-fixation (nif)-flavodoxins.

    Science.gov (United States)

    Pérez-Dorado, Inmaculada; Bortolotti, Ana; Cortez, Néstor; Hermoso, Juan A

    2013-01-09

    Analysis of the crystal structure of NifF from Rhodobacter capsulatus and its homologues reported so far reflects the existence of unique structural features in nif flavodoxins: a leucine at the re face of the isoalloxazine, an eight-residue insertion at the C-terminus of the 50's loop and a remarkable difference in the electrostatic potential surface with respect to non-nif flavodoxins. A phylogenetic study on 64 sequences from 52 bacterial species revealed four clusters, including different functional prototypes, correlating the previously defined as "short-chain" with the firmicutes flavodoxins and the "long-chain" with gram-negative species. The comparison of Rhodobacter NifF structure with other bacterial flavodoxin prototypes discloses the concurrence of specific features of these functional electron donors to nitrogenase.

  10. Structural and Phylogenetic Analysis of Rhodobacter capsulatus NifF: Uncovering General Features of Nitrogen-fixation (nif-Flavodoxins

    Directory of Open Access Journals (Sweden)

    Inmaculada Pérez-Dorado

    2013-01-01

    Full Text Available Analysis of the crystal structure of NifF from Rhodobacter capsulatus and its homologues reported so far reflects the existence of unique structural features in nif flavodoxins: a leucine at the re face of the isoalloxazine, an eight-residue insertion at the C-terminus of the 50’s loop and a remarkable difference in the electrostatic potential surface with respect to non-nif flavodoxins. A phylogenetic study on 64 sequences from 52 bacterial species revealed four clusters, including different functional prototypes, correlating the previously defined as “short-chain” with the firmicutes flavodoxins and the “long-chain” with gram-negative species. The comparison of Rhodobacter NifF structure with other bacterial flavodoxin prototypes discloses the concurrence of specific features of these functional electron donors to nitrogenase.

  11. The phosphoenolpyruvate-dependent fructose-specific phosphotransferase system in Rhodopseudomonas sphaeroides : Energetics of the phosphoryl group transfer from phosphoenolpyruvate to fructose

    NARCIS (Netherlands)

    Lolkema, Juke S.; Hoeve-Duurkens, Ria H. ten; Robillard, George T.

    1986-01-01

    Energy coupling to fructose transport in Rhodopseudomonas sphaeroides is achieved by phosphorylation of the membrane-spanning fructose-specific carrier protein, EIIFru. The phosphoryl group of phosphoenolpyruvate is transferred to EIIFru via the cytoplasmic component SF (soluble factor). The standar

  12. The Transmembrane Electrical Potential in Rhodopseudomonas sphaeroides Determined from the Distribution of Tetraphenylphosphonium after Correction for Its Binding to Cell Components

    NARCIS (Netherlands)

    Lolkema, Juke S.; Abbing, Arend; Hellingwerf, K; Konings, Wilhelmus

    1983-01-01

    The membrane potential was determined in intact cells of Rhodopseudomonas sphaeroides from the distribution of the lipophilic cation tetraphenylphosphonium (Ph4P+) after correction for probe binding to cell components. The concentration of Ph4P+ in the external medium of the cells was recorded with

  13. La volonté chez Bergson et Schopenhauer.

    Directory of Open Access Journals (Sweden)

    Arnaud François

    2004-04-01

    Full Text Available Les philosophies de Schopenhauer et de Bergson, comme d’ailleurs celle de Nietzsche, parlent d’une réalité qui se trouverait derrière des apparences utiles à la pratique. Dans les trois cas, cette réalité est désignée en termes de volonté. On aurait donc affaire, chez Schopenhauer et chez Bergson, à deux « ontologies de la volonté ». Mais il reste à savoir ce que les deux auteurs entendent par « volonté ». Deux différences majeures doivent être signalées : pour Schopenhauer, la volonté est la chose en soi. Bergson refuse la distinction kantienne entre phénomènes et chose en soi. D’autre part, pour Schopenhauer, l’expérience de la volonté est souffrance. Bergson, en revanche, la caractérise comme joie. Dans ces conditions, l’ontologie de la volonté prend une figure différente dans les deux cas. Ce sont ces deux figures que nous tentons de déterminer.The philosophy of Schopenhauer, that of Bergson and, by the way, that of Nietzsche, deal with a reality that is supposed to stand behind practically useful appearances. In the three cases, that reality is designated as a will. One could find therefore, in the works of Schopenhauer and Bergson, two “ontologies of will”. But one must still specify what the two authors mean by the word “will”. Two major differences must be notified: for Schopenhauer, will is the thing in itself. Bergson refuses the Kantian distinction between phenomena and thing in itself. Secondly, for Schopenhauer, the experience of will is suffering. Bergson, on the contrary, characterizes that experience as joy. For those reasons, the ontology of will takes a different shape in each case. We try to determine those two shapes.

  14. Envenimation mortelle par morsure de serpent chez une femme enceinte

    Directory of Open Access Journals (Sweden)

    Abdelkarim Shimi

    2011-02-01

    Full Text Available En Afrique, la prise en charge des envenimations vipérines demeure un problème majeur de santé publique avec un taux de mortalité qui reste élevé.La survenue d’une envenimation vipérine au cours de la grossesse est un événement rare, et grave du fait des conséquences maternelles et fatales qui en découlent. Les auteurs rapportent un cas de morsure de serpent au niveau de la face chez une femme enceinte, dont l’évolution a été marquée par l’installation d’un œdème cervico-facial nécessitant une trachéotomie en urgence, et une mort fatale in utero avec troubles de l’hémostase responsable du décès maternel dans un tableau de choc hémorragique.

  15. Néphrocalcinose compliquant une miliaire tuberculeuse chez un nourrisson

    Science.gov (United States)

    El Maghraoui, Jaouad; Souilmi, Fatima Zahrae; Hbibi, Mohamed; Houssaini, Tarik Sqalli; Hida, Mustapha

    2015-01-01

    La néphrocalcinose se définit par la présence anormale dans le parenchyme rénal de dépôts calciques pouvant résulter de différentes affections. Nous rapportons le cas d'un nourrisson de 7 mois chez qui nous avons diagnostiqué une hypercalcémie compliquée par une néphrocalcinose secondaire à une tuberculose miliaire aggravée par l'intoxication à la vitamine D améliorée sous hyperhydratation, furosémide et glucocorticoïdes. A travers ce travail, nous insistons sur l'intérêt de la recherche d'une hypercalcémie devant toute infection tuberculeuse, de la prise en charge rapide et adaptée sans oublié d'interrompre la supplémentation en vitamine D. PMID:26309458

  16. A Rhodobacter capsulatus member of a universal permease family imports molybdate and other oxyanions.

    Science.gov (United States)

    Gisin, Jonathan; Müller, Alexandra; Pfänder, Yvonne; Leimkühler, Silke; Narberhaus, Franz; Masepohl, Bernd

    2010-11-01

    Molybdenum (Mo) is an important trace element that is toxic at high concentrations. To resolve the mechanisms underlying Mo toxicity, Rhodobacter capsulatus mutants tolerant to high Mo concentrations were isolated by random transposon Tn5 mutagenesis. The insertion sites of six independent isolates mapped within the same gene predicted to code for a permease of unknown function located in the cytoplasmic membrane. During growth under Mo-replete conditions, the wild-type strain accumulated considerably more Mo than the permease mutant. For mutants defective for the permease, the high-affinity molybdate importer ModABC, or both transporters, in vivo Mo-dependent nitrogenase (Mo-nitrogenase) activities at different Mo concentrations suggested that ModABC and the permease import molybdate in nanomolar and micromolar ranges, respectively. Like the permease mutants, a mutant defective for ATP sulfurylase tolerated high Mo concentrations, suggesting that ATP sulfurylase is the main target of Mo inhibition in R. capsulatus. Sulfate-dependent growth of a double mutant defective for the permease and the high-affinity sulfate importer CysTWA was reduced compared to those of the single mutants, implying that the permease plays an important role in sulfate uptake. In addition, permease mutants tolerated higher tungstate and vanadate concentrations than the wild type, suggesting that the permease acts as a general oxyanion importer. We propose to call this permease PerO (for oxyanion permease). It is the first reported bacterial molybdate transporter outside the ABC transporter family.

  17. Improving the hydrogen production capacity of Rhodobacter capsulatus by genetically modifying redox balancing pathways

    Energy Technology Data Exchange (ETDEWEB)

    Oeztuerk, Yavuz [TUEBITAK Research Institute for Genetic Engineering and Biotechnology, Gebze Kocaeli (Turkey); Goekce, Abdulmecit [Istanbul Technical Univ. (Turkey). Dept. of Molecular Biology and Genetics; Guergan, Muazzez; Yuecel, Meral [Middle East Technical Univ., Ankara (Turkey). Dept. of Biology

    2010-07-01

    In Rhodobacter capsulatus, balancing the oxidation-reduction potential (redox-balance) is maintained via a number of inter-dependent regulatory mechanisms that enable these organisms to accommodate divergent growth modes. In order to maintain redox homeostasis, this bacterium possesses regulatory mechanisms functioning as electron sinks affecting the oxidation-reduction state of the ubiquinone pool. Under the photoheterotrophic growth conditions with reduced carbon sources, the excess reducing equivalents are primarily consumed via the reduction of CO{sub 2} through the Calvin-Benson-Bassham (CBB) pathway or by the reduction of protons into hydrogen with the use of dinitrogenase enzyme system. In this study, our aim was to develop strategies to funnel the excess reducing equivalents to nitrogenase-dependent hydrogen production by blocking the carbon-fixation pathway. To realize this purpose, CO{sub 2} fixation was blocked by inactivating the Phosphoribulokinase (PRK) of CBB pathway in wild type (MT1131), uptake-hydrogenase (YO3) and cyt cbb{sub 3} oxidase deficient (YO4) strains. The hydrogen production capacity of newly generated strains deficient in the Calvin-Benson-Bassham pathway were analyzed and compared with wild type strains. The results indicated that, the hydrogen production efficiency and capacity of R. capsulatus was further improved by directing the excess reducing equivalents to dinitrogenase-dependent hydrogen production. (orig.)

  18. Potential use of thermophilic dark fermentation effluents in photofermentative hydrogen production by Rhodobacter capsulatus

    Energy Technology Data Exchange (ETDEWEB)

    Ozgura, E.; Afsar, N.; Eroglu, I. [Middle East Technical University, Department of Chemical Engineering, 06531 Ankara (Turkey); De Vrije, T.; Claassen, P.A.M. [Wageningen UR, Agrotechnology and Food Sciences Group, Wageningen UR, P.O. Box 17, 6700 AA Wageningen (Netherlands); Yucel, M.; Gunduz, U. [Middle East Technical University, Department of Biology, 06531 Ankara (Turkey)

    2010-12-15

    Biological hydrogen production by a sequential operation of dark and photofermentation is a promising route to produce hydrogen. The possibility of using renewable resources, like biomass and agro-industrial wastes, provides a dual effect of sustainability in biohydrogen production and simultaneous waste removal. In this study, photofermentative hydrogen production on effluents of thermophilic dark fermentations on glucose, potato steam peels (PSP) hydrolysate and molasses was investigated in indoor, batch operated bioreactors. An extreme thermophile Caldicellulosiruptor saccharolyticus was used in the dark fermentation step, and Rhodobacter capsulatus (DSM1710) was used in the photofermentation step. Addition of buffer, Fe and Mo to dark fermentor effluents (DFEs) improved the overall efficiency of hydrogen production. The initial acetate concentration in the DFE needed to be adjusted to 30-40 mM by dilution to increase the yield of hydrogen in batch light-supported fermentations. The thermophilic DFEs are suitable for photofermentative hydrogen production, provided that they are supplemented with buffer and nutrients. The overall hydrogen yield of the two-step fermentations was higher than the yield of single step dark fermentations.

  19. Dynamics of Antagonistic Potency of Rhodobacter capsulatus PG Lipopolysaccharide against Endotoxin-Induced Effects.

    Science.gov (United States)

    Kabanov, D S; Serov, D A; Zubova, S V; Grachev, S V; Prokhorenko, I R

    2016-03-01

    The dynamics of antagonistic potency of lipopolysaccharide (LPS) isolated from Rhodobacter capsulatus PG on the synthesis of proinflammatory (TNF-α, IL-1β, IL-8, IL-6, IFN-γ) and antiinflammatory (IL-10, IL-1Ra) cytokines induced by highly stimulatory endotoxins from Escherichia coli or Salmonella enterica have been studied. Using human whole blood, we have shown that R. capsulatus PG LPS inhibited most pronouncedly the endotoxin-induced synthesis of TNF-α, IL-1β, IL-8, and IL-6 during the first 6 h after endotoxin challenge. Similarly, the endotoxin-induced release of IFN-γ was abolished by R. capsulatus PG LPS as well (24 h). In contrast to the above-mentioned cytokines, the relatively weak antagonistic activity of R. capsulatus PG LPS against endotoxin-triggered production of IL-6 and IL-8 was revealed. Since R. capsulatus PG LPS displays more potent antagonistic activity against deleterious effects of S. enterica LPS than those of E. coli LPS in the cases of such cytokines as IL-1β (6 and 24 h), IL-6 and IL-8 (4 h), we conclude that the effectiveness of protective action of antagonist is mostly determined by the primary lipid A structure of the employed agonist.

  20. Transcriptional Profiling of Hydrogen Production Metabolism of Rhodobacter capsulatus under Temperature Stress by Microarray Analysis

    Directory of Open Access Journals (Sweden)

    Muazzez Gürgan

    2015-06-01

    Full Text Available Biohydrogen is a clean and renewable form of hydrogen, which can be produced by photosynthetic bacteria in outdoor large-scale photobioreactors using sunlight. In this study, the transcriptional response of Rhodobacter capsulatus to cold (4 °C and heat (42 °C stress was studied using microarrays. Bacteria were grown in 30/2 acetate/glutamate medium at 30 °C for 48 h under continuous illumination. Then, cold and heat stresses were applied for two and six hours. Growth and hydrogen production were impaired under both stress conditions. Microarray chips for R. capsulatus were custom designed by Affymetrix (GeneChip®. TR_RCH2a520699F. The numbers of significantly changed genes were 328 and 293 out of 3685 genes under cold and heat stress, respectively. Our results indicate that temperature stress greatly affects the hydrogen production metabolisms of R. capsulatus. Specifically, the expression of genes that participate in nitrogen metabolism, photosynthesis and the electron transport system were induced by cold stress, while decreased by heat stress. Heat stress also resulted in down regulation of genes related to cell envelope, transporter and binding proteins. Transcriptome analysis and physiological results were consistent with each other. The results presented here may aid clarification of the genetic mechanisms for hydrogen production in purple non-sulfur (PNS bacteria under temperature stress.

  1. Modelling of hydrogen production in batch cultures of the photosynthetic bacterium Rhodobacter capsulatus

    Energy Technology Data Exchange (ETDEWEB)

    Obeid, Jamila; Magnin, Jean-Pierre [Grenoble Institute of Technology, LEPMI, UMR 5631 (CNRS-INPG-UJF), BP 75, 38402 St Martin d' Heres (France); Flaus, Jean-Marie; Adrot, Olivier [Grenoble Institute of Technology, Laboratoire des sciences pour la conception, l' optimisation et la production, 46, avenue Felix Viallet, 38031 Grenoble (France); Willison, John C. [Laboratoire de Chimie et Biologie des Metaux (UMR 5249 CEA-CNRS-UJF), iRTSV/LCBM, CEA-Grenoble, 38054 Grenoble (France); Zlatev, Roumen [Autonomous University of Baja California, Institute of Engineering, Mexicali, Baja California (Mexico)

    2009-01-15

    The photosynthetic bacterium, Rhodobacter capsulatus, produces hydrogen under nitrogen-limited, anaerobic, photosynthetic culture conditions, using various carbon substrates. In the present study, the relationship between light intensity and hydrogen production has been modelled in order to predict both the rate of hydrogen production and the amount of hydrogen produced at a given time during batch cultures of R. capsulatus. The experimental data were obtained by investigating the effect of different light intensities (6000-50,000 lux) on hydrogen-producing cultures of R. capsulatus grown in a batch photobioreactor, using lactate as carbon and hydrogen source. The rate of hydrogen production increased with increasing light intensity in a manner that was described by a static Baly model, modified to include the square of the light intensity. In agreement with previous studies, the kinetics of substrate utilization and growth of R. capsulatus was represented by the classical Monod or Michaelis-Menten model. When combined with a dynamic Leudekong-Piret model, the amount of hydrogen produced as a function of time was effectively predicted. These results will be useful for the automatization and control of bioprocesses for the photoproduction of hydrogen. (author)

  2. Purification and activities of the Rhodobacter capsulatus RpoN (sigma N) protein.

    Science.gov (United States)

    Cannon, W; Missailidis, S; Austin, S; Moore, M; Drake, A; Buck, M

    1996-07-01

    The rpoN-encoded sigma factors (sigma N) are a distinct class of bacterial sigma factors, with no obvious homology to the major sigma 70 class. The sigma N-containing RNA polymerase holoenzyme functions in enhancer-dependent transcription to allow expression of positively controlled genes. We have purified the Rhodobacter capsulatus sigma N protein, which is distinctive in lacking an acidic region implicated in the melting of promoter DNA by the Escherichia coll sigma N holoenzyme, and may represent a minor subclass of sigma N proteins. Assays of promoter recognition and holoenzyme formation and function showed that the purified R. capsulatus sigma N protein is distinct in activity compared to the enteric proteins, but retains the broad functions described for these proteins. As first described for the Klebsiella pneumoniae protein, promoter recognition in the absence of core RNA polymerase was detected, but contact of certain promoter bases by the R. capsulatus sigma N protein and its response to core RNA polymerase was clearly different from that determined for the K. pneumoniae and E. coli proteins. Results are discussed in the context of a requirement to modulate the activity of the DNA-binding surfaces of sigma N to regulate sigma N function. Circular dichroism was used to evaluate the structure of the R. capsulatus protein and revealed differences in the tertiary signals as compared to the K. pneumoniae protein, some of which are attributable to the DNA-binding domain of sigma N.

  3. Le clonage somatique : un état des lieux chez les bovins et les petits ruminants

    OpenAIRE

    Heyman, Yvan; Chavatte-Palmer, Pascale; Vignon, Xavier; Richard, Christophe; Renard, Jean Paul

    2005-01-01

    Parmi les récentes biotechnologies de la reproduction chez les mammifères d’élevage, le clonage par transfert de noyaux somatiques constitue un pas en avant depuis la naissance de la brebis Dolly. Cet article fait le point sur les résultats actuels obtenus dans le monde chez les bovins et les petits ruminants, les limites de la technique et les applications potentielles. L’efficacité globale du clonage (nombre de jeunes nés /nombre d’embryons reconstitués) reste encore faible (≤ 7 %), mais el...

  4. Bases chimiosensorielles du comportement alimentaire chez les poissons

    Directory of Open Access Journals (Sweden)

    SAGLIO Ph.

    1981-07-01

    Full Text Available Le comportement alimentaire, indispensable à la survie de l'individu et donc de l'espèce, occupe à ce titre une position de première importance dans la hiérarchie des comportements fondamentaux qui tous en dépendent très étroitement. Chez les poissons, cette prééminence se trouve illustrée par l'extrême diversité des supports sensoriels impliqués et des expressions comportementales qui leur sont liées. A la suite d'un certain nombre de mises en évidence neurophysiologiques et éthologiques de l'importance du sens chimique (olfaction, gustation dans le comportement alimentaire des poissons, de très importants secteurs d'études électrophysiologiques et d'analyses physico-chimiques visant à en déterminer la nature exacte (en termes de substances actives se sont développés ces vingt dernières années. De tous ces travaux dont les plus avancés sont présentés ici, il ressort que les acides aminés de série L plus ou moins associés à d'autres composés de poids moléculaires < 1000 constituent des composés chimiques jouant un rôle déterminant dans le comportement alimentaire de nombreuses espèces de poissons carnivores.

  5. Identification and mapping of nitrogen fixation genes of Rhodobacter capsulatus: duplication of a nifA-nifB region.

    OpenAIRE

    Klipp, W; Masepohl, B; Pühler, A.

    1988-01-01

    Rhodobacter capsulatus mutants unable to fix nitrogen were isolated by random transposon Tn5 mutagenesis. The Tn5 insertion sites of 30 Nif- mutants were mapped within three unlinked chromosomal regions designated A, B, and C. The majority of Tn5 insertions (21 mutants) map within nif region A, characterized by two ClaI fragments of 2.5 and 25 kilobases (kb). The 17-kb ClaI fragment of nif region B contains six nif::Tn5 insertions, and the three remaining mutations are located on a 32-kb ClaI...

  6. Structural and Phylogenetic Analysis of Rhodobacter capsulatus NifF: Uncovering General Features of Nitrogen-fixation (nif)-Flavodoxins

    OpenAIRE

    Inmaculada Pérez-Dorado; Ana Bortolotti; Néstor Cortez; Hermoso, Juan A.

    2013-01-01

    Analysis of the crystal structure of NifF from Rhodobacter capsulatus and its homologues reported so far reflects the existence of unique structural features in nif flavodoxins: a leucine at the re face of the isoalloxazine, an eight-residue insertion at the C-terminus of the 50’s loop and a remarkable difference in the electrostatic potential surface with respect to non-nif flavodoxins. A phylogenetic study on 64 sequences from 52 bacterial species revealed four clusters, including...

  7. Contribution à la description anatomique du phytomère chez le genre Pistacia de la wilaya de Tlemcen

    OpenAIRE

    BELKHODJA, Yacine Karim

    2015-01-01

    Contribution à la description anatomique du phytomère chez le genre Pistacia de la wilaya de Tlemcen. Le pétiole des pistachiers étudiés présente un arrangement tissulaire composé de l'extérieur vers l'intérieur de la cuticule, de l'épiderme, de Collenchyme, de parenchyme cortical, de sclérenchyme, de phloème et du xylème. La feuille présente des stomates de type Paratétracytique chez Pistacia atiantica et pistachia vera et de type Anisocytique chez pistacia terebinthus. L'o...

  8. Le trouble spécifique du langage oral chez les enfants bilingues

    NARCIS (Netherlands)

    Laloi, A.; Guedin-Dumont, M.; Céleste, B.

    2013-01-01

    Le trouble spécifique du langage oral chez les enfants bilingues De par la mobilité grandissante des populations, la proportion d’enfants grandissant dans un environnement plurilingue augmente en France. En région parisienne par exemple, la proportion d’enfants bilingues est estimée à 25%. Or le dév

  9. Optimizing multi-step B-side charge separation in photosynthetic reaction centers from Rhodobacter capsulatus

    Energy Technology Data Exchange (ETDEWEB)

    Faries, Kaitlyn M. [Washington Univ., St. Louis, MO (United States); Kressel, Lucas L. [Argonne National Lab. (ANL), Argonne, IL (United States); Dylla, Nicholas P. [Argonne National Lab. (ANL), Argonne, IL (United States); Wander, Marc J. [Argonne National Lab. (ANL), Argonne, IL (United States); Hanson, Deborah K. [Argonne National Lab. (ANL), Argonne, IL (United States); Holten, Dewey [Washington Univ., St. Louis, MO (United States); Laible, Philip D. [Argonne National Lab. (ANL), Argonne, IL (United States); Kirmaier, Christine [Washington Univ., St. Louis, MO (United States)

    2016-02-01

    Using high-throughput methods for mutagenesis, protein isolation and charge-separation functionality, we have assayed 40 Rhodobacter capsulatus reaction center (RC) mutants for their P+ QB- yield (P is a dimer of bacteriochlorophylls and Q is a ubiquinone) as produced using the normally inactive B-side cofactors BB and HB (where B is a bacteriochlorophyll and H is a bacteriopheophytin). Two sets of mutants explore all possible residues at M131 (M polypeptide, native residue Val near HB) in tandem with either a fixed His or a fixed Asn at L181 (L polypeptide, native residue Phe near BB). A third set of mutants explores all possible residues at L181 with a fixed Glu at M131 that can form a hydrogen bond to HB. For each set of mutants, the results of a rapid millisecond screening assay that probes the yield of P+ QB- are compared among that set and to the other mutants reported here or previously. For a subset of eight mutants, the rate constants and yields of the individual B-side electron transfer processes are determined via transient absorption measurements spanning 100 fs to 50 μs. The resulting ranking of mutants for their yield of P+ QB- from ultrafast experiments is in good agreement with that obtained from the millisecond screening assay, further validating the efficient, high-throughput screen for B-side transmembrane charge separation. Results from mutants that individually show progress toward optimization of P+ HB- → P+ QB- electron transfer or initial P* → P+ HB- conversion highlight unmet challenges of optimizing both processes simultaneously.

  10. Degradation of p-nitrophenol by the phototrophic bacterium Rhodobacter capsulatus.

    Science.gov (United States)

    Roldán, M D; Blasco, R; Caballero, F J; Castillo, F

    1998-01-01

    The phototrophic bacterium Rhodobacter capsulatus detoxified p-nitrophenol and 4-nitrocatechol. The bacterium tolerated moderate concentrations of p-nitrophenol (up to 0.5 mM) and degraded it under light at an optimal O2 pressure of 20 kPa. The bacterium did not metabolize the xenobiotic in the dark or under strictly anoxic conditions or high O2 pressure. Bacterial growth with acetate in the presence of p-nitrophenol took place with the simultaneous release of nonstoichiometric amounts of 4-nitrocatechol, which can also be degraded by the bacterium. Crude extracts from R. capsulatus produced 4-nitrocatechol from p-nitrophenol upon the addition of NAD(P)H, although at a very low rate. A constitutive catechol 1, 2-dioxygenase activity yielding cis,cis-muconate was also detected in crude extracts of R. capsulatus. Further degradation of 4-nitrocatechol included both nitrite- and CO2-releasing steps since: (1) a strain of R. capsulatus (B10) unable to assimilate nitrate and nitrite released nitrite into the medium when grown with p-nitrophenol or 4-nitrocatechol, and the nitrite concentration was stoichiometric with the 4-nitrocatechol degraded, and (2) cultures of R. capsulatus growing microaerobically produced low amounts of 14CO2 from radiolabeled p-nitrophenol. The radioactivity was also incorporated into cellular compounds from cells grown with uniformly labeled 14C-p-nitrophenol. From these results we concluded that the xenobiotic is used as a carbon source by R. capsulatus, but that only the strain able to assimilate nitrite (E1F1) can use p-nitrophenol as a nitrogen source.

  11. Molecular genetic and molecular evolutionary studies on the bacteriochlorophyll synthesis genes of Rhodobacter capsulatus

    Energy Technology Data Exchange (ETDEWEB)

    Burke-Agueero, D.H.

    1992-08-01

    Rhodobacter capsulatus, purple bacterium capable of either aerobic or photosynthetic growth, has proven to be very useful in genetic studies of photosynthesis. Forty-four genes clustered together within a 46 kilobase region are required to establish photosynthetic ability in R. capsulatus. Approximately twenty of these genes are involved in bacteriochlorophyll synthesis of which eight bch'' genes are the subject of this thesis. Six of these genes were found to code for the two ring reductases. The first converts protochlorophyllide (PChlide) into a chlorin, the immediate precursor to chlorophyll a, and then into a bacteriochlorin. Each reductase is shown to be made up of three subunits. PChlide reductase is coded by the genes bchN, bchB, and bchL. Proteins with amino acid sequences markedly similar to those of bchN and bchL have been shown in other organisms to be required for chlorophyll synthesis; hence, their designation as chlN and chlB. A third chloroplast-encoded gene of heretofore unknown function shares amino acid identities with bchB and is probably the third subunit of the plant PChlide reductase. The bchA locus, which encodes the chlorin reductase, is found to be made up of three separate, translationally coupled genes, referred to as bchX, bchY, and bchZ. Amino acid similarities between bchX, bchL, and the nitrogenase reductase protein nifH suggest that all three classes of proteins share certain three-dimensional structural features, including elements that are central to the enzymatic mechanism of nifH. PChlide reductase and chlorin reductase are clearly derived from a common ancestor. Several lines of analysis suggests the ancestor of both enzyme systems reduced PChlide twice to produce bacteriochlorophyll supporting the concept bacteriochlorophyll as the ancestral reaction center pigment.

  12. Molecular genetic and molecular evolutionary studies on the bacteriochlorophyll synthesis genes of Rhodobacter capsulatus

    Energy Technology Data Exchange (ETDEWEB)

    Burke-Agueero, D.H.

    1992-08-01

    Rhodobacter capsulatus, purple bacterium capable of either aerobic or photosynthetic growth, has proven to be very useful in genetic studies of photosynthesis. Forty-four genes clustered together within a 46 kilobase region are required to establish photosynthetic ability in R. capsulatus. Approximately twenty of these genes are involved in bacteriochlorophyll synthesis of which eight ``bch`` genes are the subject of this thesis. Six of these genes were found to code for the two ring reductases. The first converts protochlorophyllide (PChlide) into a chlorin, the immediate precursor to chlorophyll a, and then into a bacteriochlorin. Each reductase is shown to be made up of three subunits. PChlide reductase is coded by the genes bchN, bchB, and bchL. Proteins with amino acid sequences markedly similar to those of bchN and bchL have been shown in other organisms to be required for chlorophyll synthesis; hence, their designation as chlN and chlB. A third chloroplast-encoded gene of heretofore unknown function shares amino acid identities with bchB and is probably the third subunit of the plant PChlide reductase. The bchA locus, which encodes the chlorin reductase, is found to be made up of three separate, translationally coupled genes, referred to as bchX, bchY, and bchZ. Amino acid similarities between bchX, bchL, and the nitrogenase reductase protein nifH suggest that all three classes of proteins share certain three-dimensional structural features, including elements that are central to the enzymatic mechanism of nifH. PChlide reductase and chlorin reductase are clearly derived from a common ancestor. Several lines of analysis suggests the ancestor of both enzyme systems reduced PChlide twice to produce bacteriochlorophyll supporting the concept bacteriochlorophyll as the ancestral reaction center pigment.

  13. Coordinated, long-range, solid substrate movement of the purple photosynthetic bacterium Rhodobacter capsulatus.

    Directory of Open Access Journals (Sweden)

    Kristopher John Shelswell

    Full Text Available The long-range movement of Rhodobacter capsulatus cells in the glass-agar interstitial region of borosilicate Petri plates was found to be due to a subset of the cells inoculated into plates. The macroscopic appearance of plates indicated that a small group of cells moved in a coordinated manner to form a visible satellite cluster of cells. Satellite clusters were initially separated from the point of inoculation by the absence of visible cell density, but after 20 to 24 hours this space was colonized by cells apparently shed from a group of cells moving away from the point of inoculation. Cell movements consisted of flagellum-independent and flagellum-dependent motility contributions. Flagellum-independent movement occurred at an early stage, such that satellite clusters formed after 12 to 24 hours. Subsequently, after 24 to 32 hours, a flagellum-dependent dispersal of cells became visible, extending laterally outward from a line of flagellum-independent motility. These modes of taxis were found in several environmental isolates and in a variety of mutants, including a strain deficient in the production of the R. capsulatus acyl-homoserine lactone quorum-sensing signal. Although there was great variability in the direction of movement in illuminated plates, cells were predisposed to move toward broad spectrum white light. This predisposition was increased by the use of square plates, and a statistical analysis indicated that R. capsulatus is capable of genuine phototaxis. Therefore, the variability in the direction of cell movement was attributed to optical effects on light waves passing through the plate material and agar medium.

  14. Reduction of chalcogen oxyanions and generation of nanoprecipitates by the photosynthetic bacterium Rhodobacter capsulatus

    Energy Technology Data Exchange (ETDEWEB)

    Borghese, Roberto, E-mail: roberto.borghese@unibo.it [Department of Pharmacy and Biotechnology, University of Bologna (Italy); Baccolini, Chiara; Francia, Francesco [Department of Pharmacy and Biotechnology, University of Bologna (Italy); Sabatino, Piera [Department of Chemistry G. Ciamician, University of Bologna (Italy); Turner, Raymond J. [Department of Biological Sciences, University of Calgary, Calgary, Alberta (Canada); Zannoni, Davide, E-mail: davide.zannoni@unibo.it [Department of Pharmacy and Biotechnology, University of Bologna (Italy)

    2014-03-01

    Graphical abstract: - Highlights: • R. capsulatus cells produce extracellular chalcogens nanoprecipitates when lawsone is present. • Lawsone acts as a redox mediator from reducing equivalents to tellurite and selenite. • Nanoprecipitates production depends on carbon source and requires metabolically active cells. • Te{sup 0} and Se{sup 0} nanoprecipitates are identified by X-ray diffraction (XRD) spectroscopy. - Abstract: The facultative photosynthetic bacterium Rhodobacter capsulatus is characterized in its interaction with the toxic oxyanions tellurite (Te{sup IV}) and selenite (Se{sup IV}) by a highly variable level of resistance that is dependent on the growth mode making this bacterium an ideal organism for the study of the microbial interaction with chalcogens. As we have reported in the past, while the oxyanion tellurite is taken up by R. capsulatus cells via acetate permease and it is reduced to Te{sup 0} in the cytoplasm in the form of splinter-like black intracellular deposits no clear mechanism was described for Se{sup 0} precipitation. Here, we present the first report on the biotransformation of tellurium and selenium oxyanions into extracellular Te{sup 0} and Se{sup 0}nanoprecipitates (NPs) by anaerobic photosynthetically growing cultures of R. capsulatus as a function of exogenously added redox-mediator lawsone, i.e. 2-hydroxy-1,4-naphthoquinone. The NPs formation was dependent on the carbon source used for the bacterial growth and the rate of chalcogen reduction was constant at different lawsone concentrations, in line with a catalytic role for the redox mediator. X-ray diffraction (XRD) analysis demonstrated the Te{sup 0} and Se{sup 0} nature of the nanoparticles.

  15. Difference et Similitude dans le Traitement des Fous et des Femmes Folles Chez Guy de Maupassant

    Directory of Open Access Journals (Sweden)

    Dr. Kalplata

    2016-02-01

    Full Text Available Nous voyons qu’il existe une différence dans le traitement des femmes folles et les hommes fous chez Guy de Maupassant. Les femmes folles ont besoin d’asiles alors que les hommes fous n’ont besoin que de consulter des médecins. Ils gardent le contrôle sur eux-mêmes. Les hommes fous arrivent à poser plusieurs questions sur leur folie mais les femmes folles n’ont aucun lien avec la réalité. Le pouvoir d’expression manque chez elles. Pour tous les deux, l’eau apporte un grand soulagement. Les femmes se trouvent à l’intérieur du cadre crée par les hommes chez Maupassant. Tous les deux souffrent de la nervosité mais la cause de leur nervosité est tout à fait différente. La folie chez Maupassant se définit à travers la peur et l’angoisse. Les fous sont angoissés tandis que les folles ont peur. Quelles solutions présente Maupassant pour les fous et les folles ? Parfois l’angoisse devient insupportable au point que le suicide reste la seule solution pour les folles. Les fous ont encore la capacité de lutter contre leur folie. Dans cette étude nous suivons une approche thématique et politico-historique dans l’espoir de comprendre le phénomène de la folie chez Maupassant.

  16. Exploration of the hydrogen producing potential of Rhodobacter capsulatus chemostat cultures: The application of deceleration-stat and gradient-stat methodology

    NARCIS (Netherlands)

    Hoekema, S.; Breukelen, van F.R.; Janssen, M.G.J.; Tramper, J.; Wijffels, R.H.

    2009-01-01

    In this work, the dependency of the volumetric hydrogen production rate of ammonium-limited Rhodobacter capsulatus chemostat cultures on their imposed biomass concentration and dilution rate was investigated. A deceleration-stat experiment was performed by lowering the dilution rate from 1.0 d-1 to

  17. Draft Genome Sequences of Two Heat-Resistant Mutant Strains (A52 and B41) of the Photosynthetic Hydrogen-Producing Bacterium Rhodobacter capsulatus

    Science.gov (United States)

    Gokce, Abdulmecit; Cakar, Zeynep Petek; Yucel, Meral; Ozcan, Orhan; Sencan, Sevde; Sertdemir, Ibrahim; Erguner, Bekir; Yuceturk, Betul; Sarac, Aydan; Yuksel, Bayram

    2016-01-01

    The draft genome sequences of two heat-resistant mutant strains, A52 and B41, derived from Rhodobacter capsulatus DSM 1710, and with different hydrogen production levels, are reported here. These sequences may help understand the molecular basis of heat resistance and hydrogen production in R. capsulatus. PMID:27284151

  18. Voix-off et silences chez Isabel Coixet

    Directory of Open Access Journals (Sweden)

    Silvina Bénévent González

    2012-07-01

    Full Text Available Le recours presque systématique de la voix-off chez Isabel Coixet laisse présupposer une unité de sens qui reste à démontrer. L'originalité de A los que aman (1997, La vida secreta de las palabras (2005 et El mapa de los sonidos de Tokio (2009apparaît dans leur capacité à montrer une voix qui semble incarner la présence mais renvoie paradoxalement à l’absence. De fait, on pourra s'interroger sur l'acte de parole comme véritable lien entre le corps et le code quand la voix-off complète une confession salvatrice et révèle le sens du vécu. En effet, entre mémoire et prise de conscience, la voix-off dit surtout la douleur de la situation traumatique. Mais est-elle pour autant l'instrument de la catharsis ?El empleo casi sistemático de la voz en off en la obra de Isabel Coixet ofrece una unidad de sentido que incita a buscar más allá. La originalidad de tres películas en concreto - A los que aman (1997, La vida secreta de las palabras (2005 et El mapa de los sonidos de Tokio (2009- emerge de su capacidad a mostrar una voz que parece remitir a una presencia y sin embargo remite paradójicamente a una ausencia. De hecho, cabe interrogarnos sobre este acto de palabra que conlleva una verdadera unión del cuerpo y del código cuando la voz en off completa una confesión que ha de salvar y revela pues el sentido de lo vivido. En efecto entre memoria y toma de conciencia, la voz en off confiesa sobre todo el dolor del trauma. ¿ Apunta entonces tal proceso a la catarsis inadvertida en la confesión ?

  19. Méditation et pratique de soi chez Malebranche.

    Directory of Open Access Journals (Sweden)

    Éric Dubreucq

    2004-04-01

    Full Text Available Une étude des Méditations pour se disposer à l’Humilité et à la pénitence qui les replace dans le cadre des pratiques de son époque, par exemple, chez François de Sales, celles de l’oraison, de la méditation et de la contemplation, permet d’apercevoir que l’une des thèses majeures du malebranchisme, la vision en Dieu, est un effet instauré dans le destinataire par un dispositif textuel. Celui-ci tire sa puissance prescriptive de l’a priori pratique où il s’inscrit. C’est à une opération de production de soi que l’exercice spirituel donne lieu : l’analyse des quatre premières Méditations chrétiennes et métaphysiques, en particulier, montre que c’est une organisation de la substance personnelle que provoque le travail spirituel sur soi. Celui-ci consiste à déterminer le rapport à soi comme relation d’une vision attentive à une activité illuminante, par un décentrement textuel du « je » vers le « tu ».One of the major Malebranche’s assertion, that we see truth in God, is not a mere theoretical thesis. I study first the Méditations pour se disposer à l’Humilité et à la pénitence and compare them with François de Sales’ spiritual exercitations, and show that prayer, meditation and contemplation constitute the practical frameworks of this period. The text of the Méditations is an apparatus which is fit to cause an effect in its target – the self of the reader : the vision in God. The practical a priori of the meditation provides the text with prescriptive power to transform the self. Then I study the Méditations chrétiennes et métaphysiques i-iv : we see that Malebranche set his textual apparatus so that it prescribes its receiver a form of « work-on-one’s-self ». The self is here produced by the organisation of relationship between attentive vision and lighting action, and this structure is built in the self by a movement, induced by the text, which leads the self from

  20. Genetic and biochemical characterization of carotenoid biosynthesis mutants of Rhodobacter capsulatus.

    Science.gov (United States)

    Armstrong, G A; Schmidt, A; Sandmann, G; Hearst, J E

    1990-05-15

    We have used genetic and biochemical techniques to study carotenoid biosynthesis (crt) mutants of Rhodobacter capsulatus, a purple non-sulfur photosynthetic bacterium. All nine identified crt genes are located within the 46-kilobase pair photosynthesis gene cluster, and eight of the crt genes form a subcluster. We have studied the operon structure of the crt gene cluster using transposon Tn5.7 mutants. The Tn5.7 insertion sites in 10 mutants have been mapped to high resolution (25-267 base pairs) by Southern hybridization. Two insertions each map within the coding regions of the crtA, crtC, crtE, and crtF genes, and one insertion lies within the crtI gene. The insertion in crtI is not polar on the downstream crtB gene, suggesting that crtI and crtB may form two separate operons. Another insertion located in the 5' noncoding region between the divergent crtA and crtI genes has no effect on wild-type pigmentation and apparently lies between the promoters for these operons. A Tn5.7 mutation in the 3' region of crtA yields a bacteriochlorophyll-minus phenotype, while a 5' insertion affects only carotenoid biosynthesis. Regulatory signals for transcription of a downstream operon required for bacteriochlorophyll biosynthesis may thus overlap the coding region of crtA. We also present the first evidence for the functions of the crtB, crtE, and crtJ gene products using a new in vitro assay for the incorporation of [14C]isopentenyl pyrophosphate into carotenoid precursors and phytoene in cell-free extracts. Extracts from a crtE mutant accumulate [14C]prephytoene pyrophosphate, while those from crtB and crtJ mutants accumulate [14C]geranylgeranyl pyrophosphate. We therefore propose that CrtE is the phytoene synthetase and that CrtB, and possibly CrtJ, are components of the prephytoene pyrophosphate synthetase.

  1. Bilan de santé chez l’adulte

    Science.gov (United States)

    Ridley, Jane; Ischayek, Amanda; Dubey, Vinita; Iglar, Karl

    2016-01-01

    Résumé Objectif Décrire les mises à jour apportées à Soins préventifs - Fiche de contrôle© pour aider les médecins à se tenir au fait des plus récentes recommandations en matière de soins de santé préventifs. Qualité des données Une recension dans la base de données Ovid MEDLINE a été effectuée à l’aide de mots-clés et d’autres paradigmes pertinents au bilan de santé périodique. Des sources secondaires, comme le Groupe d’étude canadien sur les soins de santé préventifs, l’Agence de la santé publique du Canada, la base de données Trip et l’Infobanque de l’Association médicale canadienne, ont aussi fait l’objet d’une recherche. Nous avons révisé les recommandations relatives aux soins préventifs pour des adultes à risque moyen. Les recommandations de bonne qualité et passables sont présentées respectivement en caractères gras et italiques. Message principal La fiche de contrôle a été mise à jour en fonction des recommandations du Groupe d’étude canadien sur les soins de santé préventif relatives au dépistage de l’obésité (2015), du cancer du col (2013), de la dépression (2013), de l’ostéoporose (2013), de l’hypertension (2012), du diabète (2012, 2013) et du cancer du sein (2011). D’autres mises à jour se fondent sur les recommandations d’autres organisations canadiennes concernant le dépistage du VIH (2013), le dépistage des infections transmises sexuellement (2013), les immunisations (2012 à 2014), le dépistage de la dyslipidémie (2012), le counseling en fertilité chez la femme (2011, 2012) et le dépistage du cancer colorectal (2010). Certaines recommandations antérieures ont été éliminées et d’autres, peu étayées par des données probantes, n’ont pas été incluses. Conclusion Soins préventifs - Fiche de contrôle a été mise à jour pour inclure les recommandations récentes afin de permettre aux médecins de famille d’offrir des soins complets et fondés sur des

  2. Nutrition et programmation fœtale chez les Ruminants (bovins, ovins et caprins) : point bibliographique

    OpenAIRE

    Autourde, Gwendoline

    2016-01-01

    L’objectif de cette thèse est de faire un point bibliographique sur la programmation fœtale par l’alimentation chez les ruminants, c’est-à-dire sur les conséquences à long terme chez le descendant d’une nutrition non optimale de la mère pendant des périodes allant de quelques semaines avant la conception jusqu’au terme. Seuls les critères importants en termes de production animale ont été retenus dans le but d’envisager la faisabilité de l’application de la programmation fœtale par l’alimenta...

  3. Trouble vestibulaire chez l'enfant sourd : quelle influence sur le langage écrit ?

    OpenAIRE

    Gros, Stéphanie

    2016-01-01

    Le but de notre étude est d’analyser l’impact de l’atteinte vestibulaire sur le développement du langage écrit chez l’enfant sourd implanté. Étant donné que la moitié des enfants sourds souffrent d’un trouble vestibulaire, il est important de déterminer si ce facteur entrave leur développement. Certaines répercussions du déficit vestibulaire chez l’enfant sourd ont déjà été démontrées telles qu’un retard du développement psychomoteur ainsi qu’un retard du développement du langage oral. Cepend...

  4. Tuberculose multirésistante chez l'enfant: à propos de deux cas

    Science.gov (United States)

    Slimani, Hajar; Bricha, Myriem; Sqalli, Fatima-Ezzahra; Hammi, Sanaa; Bourkadi, Jamal-Eddine

    2016-01-01

    La tuberculose multirésistante chez l'enfant est une forme grave de la tuberculose, présentant un problème majeur de santé surtout dans les pays en voie de développement. Nous présentons le cas de deux enfants suivis dans notre formation pour tuberculose multirésistante mis sous schéma thérapeutique de deuxième ligne. PMID:27279953

  5. Prévention de la maladie thromboembolique veineuse chez le brûlé

    Science.gov (United States)

    Siah, S.; El Farouki, A.

    2014-01-01

    Summary Les complications thromboemboliques sont considérées comme rares chez le patient brûlé. Leur incidence varie selon les études réalisées. Les patients brûlés présentent de nombreux facteurs de risque favorisant la survenue de ces complications. Le diagnostic clinique de la thrombose veineuse profonde et de l’embolie pulmonaire reste difficile vu leur évolution infraclinique et la non spécificité des signes cliniques. L’échodoppler veineux et l’angioscanner thoracique constituent les éléments clés dans la stratégie diagnostique de la thrombose veineuse profonde et de l’embolie pulmonaire chez les patients brûlés. Le traitement ne diffère pas de celui administré aux autres patients non brûlés et victimes de la thrombose veineuse profonde et de l’embolie pulmonaire. La prophylaxie controversée entre les auteurs, est un sujet d’actualité. Plusieurs praticiens et organismes recommandent son utilisation de routine chez les patients brûlés à risque. Elle reste le seul moyen capable d’empêcher la survenue de la maladie thromboembolique veineuse capable d’engager le pronostic vital chez ces patients. Nous rapportons 6 observations de patients brûlés ayant développé une maladie thromboembolique veineuse. PMID:26170780

  6. La leishmaniose viscérale chez l'adulte à propos de douze cas

    Science.gov (United States)

    Benbella, Imane; Aich, Fatima; Elkhiyat, Majdouline; Khalki, Hanane; Khermach, Assya; Bergui, Imane; Tlemçani, Imane; Hassani, Moncef Amrani

    2016-01-01

    La leishmaniose viscérale est une maladie à transmission vectorielle liée essentiellement, au niveau de pourtour méditerranéen, à l'infection par leishmania infantum. Habituellement rare chez l'adulte, sa prévalence a récemment connu une augmentation y compris chez les sujets immunocompétents. Le but de notre étude est de présenter le profil épidémiologique de la leishmaniose viscérale chez l'adulte ainsi que l'importance du diagnostique biologique dans l'identification de cette maladie. Notre étude s'est étendue sur six ans de Janvier 2009 à Janvier 2014, et a colligé douze patients hospitalisés au Centre Hospitalier Universitaire Hassan II de Fès. L'altération de l’état général et la splénomégalie ont dominé le tableau clinique. Sur le plan biologique, l'anémie a été quasi constante. La confirmation diagnostique a consisté en la mise en évidence du parasite au niveau de la moelle. L’évolution sous traitement a été favorable pour tous nos patients. Ainsi, la recrudescence que connait la leishmaniose viscérale chez l'adulte et son tableau clinique peu spécifique doit la faire évoquer devant toute splénomégalie fébrile, afin de permettre un diagnostic et une prise en charge thérapeutique précoces. PMID:27347283

  7. Elastofibrome à double localisation dorsale et thoracique antérieure chez l'enfant

    Science.gov (United States)

    Mahmoudi, Abdelhalim; Bendahou, Mouhcine; Chater, lamiae; Amarti, Afaf; Bouabdallah, Youssef; Afifi, My Abderrahmane

    2015-01-01

    L’élastofibrome est une pseudotumeur des tissus mous typiquement localisée sous la pointe de l'omoplate. Il est caractérisé par la prolifération de tissus fibreux et adipeux et affecte plus fréquemment les femmes âgées. Nous présentons un cas d’élastofibrome chez une fille de 9 ans. PMID:26175827

  8. Effect of uncoupler on assembly pathway for pigment-binding protein of bacterial photosynthetic membranes. [Rhodobacter capsulatus

    Energy Technology Data Exchange (ETDEWEB)

    Dierstein, R.; Drews, G.

    1986-10-01

    The uncoupler carbonylcyanide m-chlorophenylhydrazone (CCCP) was used to investigate membrane protein assembly in the phototrophic bacterium Rhodobacter capsulatus. As found for Escherichia coli and mitochondrial proteins, assembly across the bacterial photosynthetic membranes was sensitive to CCCP. At uncoupler concentrations which were sufficient to block the export of the periplasmic cytochrome c/sub 2/ and an outer membrane protein, the integration of pigment-binding protein into the photosynthetic apparatus was abolished. The unassembled protein was detected on the inner surface of the intracytoplasmic membrane. After inactivation of CCCP, accumulated protein continued insertion into the membrane. The data suggest that after binding to the cytoplasmic face of the membrane (i), translocation of protein into a transmembrane orientation takes place (ii), which is a prerequisite for the formation of a functional pigment-protein complex (iii).

  9. Les effets neurocognitifs de la vitamine D chez la personne âgée

    Directory of Open Access Journals (Sweden)

    Annweiler Cédric

    2014-05-01

    Full Text Available Une alimentation saine, en particulier la consommation régulière d’aliments riches en vitamine D, est un facteur protecteur contre la survenue de pathologie démentielle chez la personne âgée. Outre ses propriétés traditionnellement reconnues de régulation du métabolisme phosphocalcique, la vitamine D est une hormone neurostéroïde indispensable au fonctionnement neurophysiologique (régulation de neurotransmetteurs et de neurotrophines avec, en plus, une action neuroprotectrice anti-inflammatoire et anti-oxydante. Au contraire son insuffisance, extrêmement prévalente chez la personne âgée, pourrait engendrer des dysfonctionnements du système nerveux central, expliquant en partie les troubles cognitifs rencontrés dans cette population. L’épidémiologie est cohérente avec cette notion et rapporte une association entre hypovitaminose D et trouble cognitif, que ce soit en population âgée générale ou chez le malade Alzheimer. Les essais d’intervention confirment la relation de causalité et quantifient l’efficacité cognitive de la supplémentation vitaminique D chez la personne âgée, ce qui suscite des perspectives en matière de prévention primo-secondaire des troubles cognitifs chez la personne âgée par un apport exogène de vitamine D. En particulier, tandis que les traitements anti-démence symptomatiques actuellement disponibles ne font que ralentir transitoirement le déclin cognitif, les futures possibilités de traitement pourraient reposer sur des combinaisons médicamenteuses luttant contre plusieurs mécanismes neurodégénératifs à la fois. À ce titre, la vitamine D améliore l’efficacité de la mémantine en termes de protection neuronale et de prévention du déclin cognitif au cours de la maladie d’Alzheimer.

  10. Loss of the Response Regulator CtrA Causes Pleiotropic Effects on Gene Expression but Does Not Affect Growth Phase Regulation in Rhodobacter capsulatus

    Energy Technology Data Exchange (ETDEWEB)

    Mercer, Ryan; Callister, Stephen J.; Lipton, Mary S.; Pasa-Tolic, Ljiljana; Strnad, Hynek; Paces, Vaclav; Beatty, J. T.; Lang, Andrew S.

    2010-06-01

    The purple non-sulfur bacterium Rhodobacter capsulatus has been extensively studied for its diverse metabolic capabilities, as well as for its production of a Gene Transfer Agent (RcGTA). Production of RcGTA requires the response regulator protein CtrA. We have used whole genome transcript and whole cell proteome analyses of wild type and ctrA mutant cultures to completely characterize the regulatory role of CtrA in R. capsulatus.

  11. Etude expérimentale de l'ostéotomie de nivellement du plateau tibial chez le chat

    OpenAIRE

    Maleca, David

    2015-01-01

    La rupture du ligament croisé crânial est une affection peu fréquente chez le chat et principalement d’origine traumatique. L’ostéotomie de nivellement du plateau tibial (TPLO) est une technique dite dynamique modifiant la biomécanique du grasset, rendant le ligament croisé crânial inutile. La TPLO semble présenter actuellement les meilleurs résultats chez le chien mais seulement un cas clinique est rapporté à propos de sa réalisation chez le chat, avec de bons résultats. Cette étude expérime...

  12. Uniform designation for genes of the Calvin-Benson-Bassham reductive pentose phosphate pathway of bacteria

    NARCIS (Netherlands)

    Tabita, F. Robert; Gibson, Janet L.; Bowien, Botho; Dijkhuizen, Lubbert; Meijer, Wilhelmus

    1992-01-01

    Structural and regulatory genes encoding enzymes and proteins of the reductive pentose phosphate pathway have been isolated from a number of bacteria recently. In the phototroph Rhodobacter sphaeroides, and in two chemoautotrophic bacteria, Alcaligenes eutrophus and Xanthobacter flavus, these genes

  13. Etude structurale des sites de nodulation et induction des nodules caulinaires chez Sesbania pubescens

    OpenAIRE

    TOMEKPE, Kodjo; Traore, A S; Ndiaye, S.; Spencer-Barreto, M.M.; Détrez, C.

    1992-01-01

    #Sesbania pubescens$ est une légumineuse annuelle voisine de #Sesbania rostrata$ qui se rencontre généralement sur les sols temporairement inondés de l'Afrique de l'Ouest. Des sites de nodulation préformes ont été mis en évidence sur sa tige et ses branches. Ces sites prennent naissance à l'aisselle des cotylédons et des feuilles. Comme chez la plupart des légumineuses à nodules de tige, les sites de nodulation caulinaire de #S. pubescens$ se développent en racines lorsque les tiges sont imme...

  14. Dynamique et enzymologie de la digestion chez l'huitre Crassostrea gigas

    OpenAIRE

    Boucaud, C; Lebesnerais, C; Lubet, P.; Lihrmann, I

    1983-01-01

    Chez Crassostrea gigas (Thunberg) des expériences d'alimentation contrôlée ont permis d'établir les modalités et la chronologie du transit alimentaire. Différentes activités enzymatiques en relation avec la digestion (glycosidases, esterases et peptidases) ont été localisées dans l'appareil digestif et ont permis de préciser les sites de digestion des glucides et des protides et les sites d'absorption. Un schéma explicatif des différentes étapes de la digestion est proposé.

  15. Toxoplasmose oculaire atypique chez une femme congolaise de 72 ans: à propos d'une observation

    Science.gov (United States)

    Bienvenu, Yogolelo Asani; Angel, Musau Nkola; Eric, Kasamba Ilunga; Socrate, Kapalu Mwangala; Sebastien, Mbuyi Musanzayi; Philippe, Cilundika Mulenga; Leon, Kabamba Ngombe; Bruno, Iye Ombamba Kayimba; Gaby, Chenge Borasisi

    2015-01-01

    Les auteurs rapportent un cas de toxoplasmose oculaire binoculaire, rarement décrit dans la littérature, chez une personne âgée de 72 ans, de sexe féminin, à laquelle s'associe une rétinite pigmentaire unilatérale. Cette observation permet d'attirer l'attention de la communauté scientifique sur les autres formes ou variétés de présentation moins courantes, « atypiques », pouvant être rencontrées ou associées à la toxoplasmose oculaire. PMID:26958130

  16. Carotenogenesis gene cluster and phytoene desaturase catalyzing both three- and four-step desaturations from Rhodobacter azotoformans.

    Science.gov (United States)

    Zhang, Jinhua; Lu, Lili; Yin, Lijie; Xie, Shen; Xiao, Min

    2012-08-01

    A carotenogenesis gene cluster from the purple nonsulfur photosynthetic bacterium Rhodobacter azotoformans CGMCC 6086 was cloned. A total of eight carotenogenesis genes ( crtA , crtI , crtB , tspO , crtC , crtD , crtE , and crtF ) were located in two separate regions within the genome, a 4.9 kb region containing four clustered genes of crtAIB - tspO and a 5.3 kb region containing four clustered genes of crtCDEF . The organization was unusual for a carotenogenesis gene cluster in purple photosynthetic bacteria. A gene encoding phytoene desaturase ( CrtI ) from Rba. azotoformans was expressed in Escherichia coli. The recombinant CrtI could catalyze both three- and four-step desaturations of phytoene to produce neurosporene and lycopene, and the relative contents of neurosporene and lycopene formed by CrtI were approximately 23% and 75%, respectively. Even small amounts of five-step desaturated 3,4-didehydrolycopene could be produced by CrtI . This product pattern was novel because CrtI produced only neurosporene leading to spheroidene pathway in the cells of Rba. azotoformans. In the in vitro reaction, the relative content of lycopene in desaturated products increased from 19.6% to 62.5% when phytoene reduced from 2.6 to 0.13 μM. The results revealed that the product pattern of CrtI might be affected by the kinetics.

  17. Hydrogen production by photosynthetic bacteria Rhodobacter capsulatus Hup{sup -} strain on acetate in continuous panel photobioreactors

    Energy Technology Data Exchange (ETDEWEB)

    Deo Androga, Dominic; Ozgur, Ebru; Eroglu, Inci [Middle East Technical Univ., Ankara (Turkey). Dept. of Chemical Engineering; Guenduez, Ufuk [Middle East Technical Univ., Ankara (Turkey). Dept. of Biology

    2010-07-01

    Photobiological hydrogen production from organic acids occurs in the presence of light and under anaerobic conditions. Stable and optimized operation of the photobioreactors is the most challenging task in the photofermentation process. The aim of this study was to achieve a stable and high hydrogen production on acetate, using the photosynthetic bacteria Rhodobacter capsulatus Hup{sup -} (uptake hydrogenase deleted strain) in continuous panel photobioreactors. An indoor experiment with continuous illumination (1500-2500 lux, corresponding to 101-169 W/m{sup 2}) and controlled temperature was carried out in a 8 L panel photobioreactor. A modified form of basal culture media containing 40 mM of acetate and 2 mM of glutamate with a feeding rate of 0.8 L/day was used. Stable hydrogen productivity of 0.7 mmol H{sub 2}/l{sub c}.h was obtained, however, biomass decreased during the continuous operation. Further indoor experiments with a biomass recycle and different feed compositions were carried out to optimise the feed composition for a stable biomass and hydrogen production. The highest hydrogen productivity of 0.8 mmol H{sub 2}/l{sub c}.h and yield of 88% was obtained in the 40 mM/ 4 mM acetate/glutamate continuously fed photobioreactor for a period of 21 days. (orig.)

  18. L’infection bactérienne chez le patient brûlé

    Science.gov (United States)

    Le Floch, R.; Naux, E.; Arnould, J.F.

    2015-01-01

    Summary La mort d’un patient brûlé est le plus souvent causée par une infection, bactérienne dans la grande majorité des cas. La perte de la barrière cutanée, les dispositifs invasifs et l’immunodépression liée à la brûlure sont trois mécanismes concourant à la survenue de ces infections. Chez un patient inflammatoire, les signes infectieux généraux d’infection sont peu discriminants. Du fait de la gravité des infections chez ce patient, leur prévention est un paramètre essentiel de la prise en charge. En raison des particularités pharmacocinétiques des brûlés, les posologies d’antibiotiques doivent être adaptés et les dosages sanguins doivent être systématiques. A l’heure où les résistances deviennent préoccupantes, les recherches sur les thérapeutiques sur les alternatives thérapeutiques parmi lesquels les inhibiteurs de facteurs de virulence, les peptides antimicrobiens, les polyphénols, l’immunothérapie…) deviennent cruciales. L’une des possibilités thérapeutiques les plus prometteuses semble être la phagothérapie. PMID:27252607

  19. Continuous Cultivation of Photosynthetic Bacteria for Fatty Acids Production

    DEFF Research Database (Denmark)

    Kim, Dong-Hoon; Lee, Ji-Hye; Hwang, Yuhoon

    2013-01-01

    In the present work, we introduced a novel approach for microbial fatty acids (FA) production. Photosynthetic bacteria, Rhodobacter sphaeroides KD131, were cultivated in a continuous-flow, stirred-tank reactor (CFSTR) at various substrate (lactate) concentrations.At hydraulic retention time (HRT) 4....... sphaeroides was around 35% of dry cell weight, mainly composed of vaccenic acid (C18:1, omega-7)....

  20. Rhodobacter capsulatus nifA1 Promoter: High-GC −10 Regions in High-GC Bacteria and the Basis for Their Transcription

    OpenAIRE

    Richard, Cynthia L.; Tandon, Animesh; Kranz, Robert G.

    2004-01-01

    It was previously shown that the Rhodobacter capsulatus NtrC enhancer-binding protein activates the R. capsulatus housekeeping RNA polymerase but not the Escherichia coli RNA polymerase at the nifA1 promoter. We have tested the hypothesis that this activity is due to the high G+C content of the −10 sequence. A comparative analysis of R. capsulatus and other α-proteobacterial promoters with known transcription start sites suggests that the G+C content of the −10 region is higher than that for ...

  1. Yeast Two-Hybrid Studies on Interaction of Proteins Involved in Regulation of Nitrogen Fixation in the Phototrophic Bacterium Rhodobacter capsulatus

    OpenAIRE

    Pawlowski, Alice; Riedel, Kai-Uwe; Klipp, Werner; Dreiskemper, Petra; Groß, Silke; Bierhoff, Holger; Drepper, Thomas; Masepohl, Bernd

    2003-01-01

    Rhodobacter capsulatus contains two PII-like proteins, GlnB and GlnK, which play central roles in controlling the synthesis and activity of nitrogenase in response to ammonium availability. Here we used the yeast two-hybrid system to probe interactions between these PII-like proteins and proteins known to be involved in regulating nitrogen fixation. Analysis of defined protein pairs demonstrated the following interactions: GlnB-NtrB, GlnB-NifA1, GlnB-NifA2, GlnB-DraT, GlnK-NifA1, GlnK-NifA2, ...

  2. Die Rolle der P II -Proteine GlnB und GlnK bei der Regulation des Stickstoff-Metabolismus in dem phototrophen Purpurbakterium Rhodobacter capsulatus

    OpenAIRE

    2002-01-01

    Das phototrophe Purpurbakterium Rhodobacter capsulatus ist in der Lage über eine Molybdän-Nitrogenase (nif-codiert) oder eine alternative Heterometall-freie Nitrogenase (anf-codiert) atmosphärischen Stickstoff zu fixieren. Die Expression und die Aktivität beider Nitrogenase-Systeme wird über die Stickstoffverfügbarkeit auf drei Ebenen reguliert. 1. die Regulation der Transkription der nif- und anf-spezifischen Transkriptionsaktivatoren NifA1, NifA2 und AnfA. 2. die Regulation i...

  3. The reductive half-reaction of xanthine dehydrogenase from Rhodobacter capsulatus: the role of Glu232 in catalysis.

    Science.gov (United States)

    Hall, James; Reschke, Stefan; Cao, Hongnan; Leimkühler, Silke; Hille, Russ

    2014-11-14

    The kinetic properties of an E232Q variant of the xanthine dehydrogenase from Rhodobacter capsulatus have been examined to ascertain whether Glu(232) in wild-type enzyme is protonated or unprotonated in the course of catalysis at neutral pH. We find that kred, the limiting rate constant for reduction at high [xanthine], is significantly compromised in the variant, a result that is inconsistent with Glu(232) being neutral in the active site of the wild-type enzyme. A comparison of the pH dependence of both kred and kred/Kd from reductive half-reaction experiments between wild-type and enzyme and the E232Q variant suggests that the ionized Glu(232) of wild-type enzyme plays an important role in catalysis by discriminating against the monoanionic form of substrate, effectively increasing the pKa of substrate by two pH units and ensuring that at physiological pH the neutral form of substrate predominates in the Michaelis complex. A kinetic isotope study of the wild-type R. capsulatus enzyme indicates that, as previously determined for the bovine and chicken enzymes, product release is principally rate-limiting in catalysis. The disparity in rate constants for the chemical step of the reaction and product release, however, is not as great in the bacterial enzyme as compared with the vertebrate forms. The results indicate that the bacterial and bovine enzymes catalyze the chemical step of the reaction to the same degree and that the faster turnover observed with the bacterial enzyme is due to a faster rate constant for product release than is seen with the vertebrate enzyme.

  4. Physiologie et pathologie de la reproduction chez l'âne : étude bibliographique

    OpenAIRE

    2016-01-01

    Alors qu'il existe de nombreuses études traitant de la physiologie et de la pathologie de la reproduction chez la jument, peu de documents sont référencés concernant l'âne. La conduite de la reproduction dans cette espèce a ainsi longtemps été calquée sur le modèle équin avec plus ou moins de succès. L'objet de cette étude est donc de présenter les caractéristiques et les particularités existant dans l'espèce asine. Dans un premier temps, les spécificités anatomiques des appareils reproducte...

  5. Génomique fonctionnelle et marqueurs de qualité chez l'abricot

    OpenAIRE

    Grimplet, Jérôme

    2004-01-01

    En lien avec la sélection assistée par marqueurs de la qualité des fruits chez l'abricotier (Prunus armeniaca), 71 marqueurs moléculaires impliqués dans la régulation hormonale et dans le contrôle de l'acidité, du taux de sucre, de la texture, de la biosynthèse des arômes, et des pigments, ont été mis en évidence par étude conjointe de l'évolution du transcriptome et du protéome au cours de la maturation et entre génotypes contrastés. Une base de données a été construite contenant 5200 unigèn...

  6. Etude comparative des consommables pour le dosage des endotoxines bactériennes chez deux fournisseurs

    OpenAIRE

    Tall, Mamadou-Lamine; Guilli, Taoufik; Renaud, J.; Ducarre, B; Koog, N.; Bador, M.; Diouf, E; Pirot, Fabrice; Pivot, Christine

    2013-01-01

    Les endotoxines bactériennes (EB) sont des pyrogènes, leur recherche est obligatoire pour certains produits pharmaceutiques. La Pharmacie à Usage Intérieur (PUI) réalise en moyenne 3600 dosages des EB par an selon la méthode colorimétrique cinétique. Le temps de réaction enzymatique pour cette méthode cinétique est fortement impacté par la qualité de ces consommables. L'objectif est de comparer l'effet des réactifs sur le dosage des EB chez 2 fournisseurs (A et B) et l'impact financier relati...

  7. La maitrise des cycles sexuels chez les bovins. Le point en 1988

    OpenAIRE

    de Fontaubert, Yves

    1988-01-01

    L’importance économique de la maîtrise de la fécondité chez les bovins n’est plus à démontrer. Elle peut être envisagée par l’utilisation des techniques modernes de reproduction. A condition de bien connaître au préalable le niveau d’activité ovarienne des femelles à traiter, un traitement progestagène complété éventuellement par un apport de prostaglandine et/ou de PMSG permet d’obtenir, sans détection préalable des chaleurs et avec une seule insémination systématique, un taux de fertilité é...

  8. Le système des estérases carboxyliques chez Anopheles stephensi

    OpenAIRE

    Riandey, Marie-France

    1993-01-01

    L'étude des estérases carboxyliques d'#Anopheles stephensi$ a été réalisée par électrophorèse. L'utilisation d'insecticides inhibiteurs des estérases et la modification des conditions opératoires ont permis de mettre en évidence trois classes d'estérases. Un dimorphisme sexuel est observé : dans les deux sexes, on a identifié un gène diallélique codant pour une estérase sensible aux inhibiteurs, mais, chez des mâles uniquement, il existe un autre gène, également diallélique codant pour une au...

  9. Des quartiers chez les Mayas à l’époque classique ?

    OpenAIRE

    Lemonnier, Éva

    2014-01-01

    Des quartiers chez les Mayas à l’époque classique ? En dépit de la richesse des données archéologiques, ethnographiques et ethnohistoriques sur la question des quartiers (ou unités définies comme telles) dans les sociétés mayas postclassiques, historiques et contemporaines, pour la période classique, ce type d’unité de regroupement, intermédiaire entre l’habitat élémentaire (la famille étendue) et l’établissement (la communauté), est loin d’être avéré. Depuis trente ans, ce modèle d’organisat...

  10. Comment mesurer correctement la PA chez les patients hémodialysés?

    OpenAIRE

    VANDERWECKENE, Pauline; Saint-Remy, Annie; Krzesinski, Jean-Marie

    2016-01-01

    Objectifs : Le contrôle de la pression artérielle (PA) chez le patient hémodialysé (HD) est un enjeu majeur en raison des résultats controversés sur les risques cardiovasculaires qui y sont associés. Cependant, la mesure de la PA dans cette population est difficile à appréhender au vu de sa grande variabilité. L’exactitude des mesures péridialytiques (enregistrées dans l’unité d’HD pendant la séance) est souvent remise en question. L’objectif de notre étude est d’établir la contribution et l...

  11. Prise en charge de l’infection gonococcique chez les adultes et les jeunes

    Science.gov (United States)

    Pogany, Lisa; Romanowski, Barbara; Robinson, Joan; Gale-Rowe, Margaret; Latham-Carmanico, Cathy; Weir, Christine; Wong, Tom

    2015-01-01

    Résumé Objectif Présenter des recommandations sur la prise en charge de l’infection gonococcique chez les adultes et les jeunes. Qualité des données Les recommandations thérapeutiques des lignes directrices canadiennes sur les infections transmissibles sexuellement reposent sur une recherche documentaire de même que sur des catégories de recommandations et des niveaux de qualité de données déterminés par au moins 2 évaluateurs. Les recommandations ont été revues par des pairs et sont en instance d’approbation par le groupe de travail d’experts. Message principal Les nouvelles recommandations portant sur la prise en charge de l’infection gonococcique chez les adultes et les jeunes préconisent les cultures à titre d’outil diagnostique lorsqu’elles sont pratiques, le traitement par antibiothérapie combinée (ceftriaxone associée à l’azithromycine) et le signalement sans délai de tous les cas dont le traitement a échoué aux autorités de santé publique. Conclusion Si elles sont suivies, ces nouvelles recommandations pourraient réduire l’échec thérapeutique, contribuer à une surveillance plus étroite des tendances à la résistance de Neisseria gonorrhoeae aux antibiotiques et contribuer à prévenir la transmission de gonorrhée résistante à plusieurs médicaments.

  12. Les Cicatrices Retractiles Post-Brulures Du Membre Inferieur Chez L’Enfant

    Science.gov (United States)

    Sankale, A.A.; Manyacka Ma Nyemb, P.; Coulibaly, N.F.; Ndiaye, A.; Ndoye, M.

    2010-01-01

    Summary Il s'agit d'une étude faisant ressortir les aspects épidémiologiques, cliniques et thérapeutiques des séquelles de brûlures du membre inférieur chez l'enfant, à propos de 42 cas colligés au service de chirurgie infantile de l'Hôpital Aristide Le Dantec (Sénégal). L'âge moyen retrouvé est de 5 ans et 3 mois, et le sex-ratio garçons/filles de 1,8/1. La brûlure thermique est causée par une flamme dans 33% des cas, par un liquide chaud dans 21% des cas, et par des braises dans 21% des cas. Les cicatrices rétractiles intéressent le genou et le creux poplité dans 47% des cas et le pied dans 45% des cas. Elles sont bilatérales dans 21% des cas, et concernent une autre localisation associée dans 21% des cas. Quant aux brides, 21% ont bénéficié d'une chirurgie, avec un délai moyen de 3 ans et 2 mois après la brûlure. Cette procédure chirurgicale consiste en une plastie en Z dans 91% des cas, à laquelle est associée une greffe de peau dans 54% des cas. Une rééducation fonctionnelle est pratiquée chez 54% des opérés. Parallèlement aux données de la littérature, nos résultats montrent que l'optimisation de la prise en charge passe par une meilleure prévention des accidents domestiques et une bonne codification thérapeutique. PMID:21991202

  13. Torsion chronique d'une rate baladeuse chez un adolescent: à propos d'un cas

    Science.gov (United States)

    Dème, Hamidou; Akpo, Léra Géraud; Fall, Seynabou; Badji, Nfally; Ka, Ibrahima; Guèye, Mohamadou Lamine; Touré, Mouhamed Hamine; Niang, El Hadj

    2016-01-01

    La rate baladeuse ou errante est une anomalie rare, qui est le plus souvent décrite chez l'enfant. Ses complications parmi lesquelles figure la torsion de son pédicule sont fréquentes et peuvent engager le pronostic vital du patient. Nous rapportons un cas de torsion chronique du pédicule d'une rate baladeuse chez un patient de 17 ans, au long passé de douleurs épigastriques. Le tableau clinique était marqué par une masse épigastrique spontanément douloureuse, évoluant depuis 48 heures. L’échographie abdominale objectivait une rate ectopique hétérogène, hypertrophiée, en position épigastrique et un hématome sous capsulaire. Au doppler, on notait une torsion du pédicule splénique à deux tours de spires et un petit flux sur l'artère splénique. La tomodensitométrie abdominale avec injection de produit de contraste montrait un défaut de rehaussement parenchymateux d'une grosse rate ectopique épigastrique et un hématome sous capsulaire. Le diagnostic de torsion chronique du pédicule d'une rate baladeuse, compliquée de nécrose et d'hématome sous capsulaire était retenu. Il a été réalisé une splénectomie. Les suites opératoires étaient simples. Nous discutons l'apport de l’échographie et de la TDM dans le diagnostic de la torsion chronique du pédicule d'une rate baladeuse. PMID:27583079

  14. The SOS Response Master Regulator LexA Regulates the Gene Transfer Agent of Rhodobacter capsulatus and Represses Transcription of the Signal Transduction Protein CckA

    Science.gov (United States)

    Kuchinski, Kevin S.; Brimacombe, Cedric A.; Westbye, Alexander B.; Ding, Hao

    2016-01-01

    ABSTRACT The gene transfer agent of Rhodobacter capsulatus (RcGTA) is a genetic exchange element that combines central aspects of bacteriophage-mediated transduction and natural transformation. RcGTA particles resemble a small double-stranded DNA bacteriophage, package random ∼4-kb fragments of the producing cell genome, and are released from a subpopulation (5-fold in the lexA mutant, and a lexA cckA double mutant was found to have the same phenotype as a ΔcckA single mutant in terms of RcGTA production. The data indicate that LexA is required for RcGTA production and maximal recipient capability and that the RcGTA-deficient phenotype of the lexA mutant is largely due to the overexpression of cckA. IMPORTANCE This work describes an unusual phenotype of a lexA mutant of the alphaproteobacterium Rhodobacter capsulatus in respect to the phage transduction-like genetic exchange carried out by the R. capsulatus gene transfer agent (RcGTA). Instead of the expected SOS response characteristic of prophage induction, this lexA mutation not only abolishes the production of RcGTA particles but also impairs the ability of cells to receive RcGTA-borne genes. The data show that, despite an apparent evolutionary relationship to lambdoid phages, the regulation of RcGTA gene expression differs radically. PMID:26833411

  15. Spectral Diffusion and Electron-Phonon Coupling of the B800 BChl a Molecules in LH2 Complexes from Three Different Species of Purple Bacteria

    Science.gov (United States)

    Baier, J.; Gabrielsen, M.; Oellerich, S.; Michel, H.; van Heel, M.; Cogdell, R.J.; Köhler, J.

    2009-01-01

    We have investigated the spectral diffusion and the electron-phonon coupling of B800 bacteriochlorophyll a molecules in the peripheral light-harvesting complex LH2 for three different species of purple bacteria, Rhodobacter sphaeroides, Rhodospirillum molischianum, and Rhodopseudomonas acidophila. We come to the conclusion that B800 binding pockets for Rhodobacter sphaeroides and Rhodopseudomonas acidophila are rather similar with respect to the polarity of the protein environment but that the packaging of the αβ-polypeptides seems to be less tight in Rb. sphaeroides with respect to the other two species. PMID:19883604

  16. Evaluation morphologique des lésions nerveuses induites par un produit chimique : validation chez le rat

    OpenAIRE

    Deviers, Alexandra

    2013-01-01

    Le triméthylétain est connu pour ses effets neurotoxiques chez le rat : troubles comportementaux (agressivité, hyperactivité) associés à des modifications histopathologiques du système nerveux central et périphérique. L’objectif de ce travail a été de caractériser les effets nerveux structuraux induits par le triméthylétain chez le rat Wistar, dans le cadre d’une étude de validation de procédures appliquées à l’évaluation de la neurotoxicité d’un produit chimique. Pour cela, des rats mâles ad...

  17. Utilisation de la mélatonine pour le sommeil chez les enfants en bonne santé

    Science.gov (United States)

    Janjua, Irvin; Goldman, Ran D.

    2016-01-01

    Résumé Question Une maman a amené son garçon de 12 ans me consulter à mon bureau. Elle s’inquiète, car il a de la difficulté à s’endormir presque tous les soirs. Elle travaille par quarts et elle prend elle-même de la mélatonine pour l’aider à s’endormir. Elle m’a demandé si son garçon pouvait aussi prendre de la mélatonine. Quels sont les recommandations et les éléments à considérer avant d’utiliser la mélatonine chez les enfants et les adolescents en bonne santé? Réponse L’insomnie est rapportée chez jusqu’à un quart des enfants en bonne santé et chez les trois quarts des enfants atteints d’une affection psychiatrique ou neurodéveloppementale, ce qui entraîne des conséquences négatives. Pour les enfants atteints du syndrome de retard de phase du sommeil, la mélatonine pourrait s’avérer utile lorsque jumelée à une évaluation de l’insomnie et à un suivi régulier. La mélatonine pourrait être envisagée pour des enfants sans diagnostic d’insomnie qui ont une bonne hygiène du sommeil. Bien qu’elle semble sans danger, il n’existe pas de données probantes en faveur de l’emploi systématique de la mélatonine chez les enfants en bonne santé.

  18. Apport des approches inspirees de la neuropsychologie au diagnostic d?autisme chez l?adulte: une etude de cas

    OpenAIRE

    Weiner, L.; Baratta, A.; Henry, J; Di Santi, C.

    2010-01-01

    Resume Nous allons illustrer a partir d?un cas clinique les procedures diagnostiques des troubles du spectre autistique chez l?adulte, inspirees des theories neurocognitives actuelles. Nous relatons le cas d?un homme de 29 ans recu en consultation psychiatrique. Le diagnostic initialement retenu etait celui de personnalite evitante, compliquee de phobie sociale et d?un trouble depressif intercurrent. Malgre la diminution des symptomes anxieux et depressifs apres l?instauration d?un...

  19. 硫酸酯化修饰葛仙米多糖工艺研究%Sulfation Modification of Polysaccharide Extracted from Nostoc sphaeroides Ktzing

    Institute of Scientific and Technical Information of China (English)

    朱玉婷; 谭姚; 莫开菊

    2011-01-01

    The orthogonal array design method was used to optimize three reaction conditions,including esterification reagent,temperature and reaction time,for the sulfation of crude polysaccharides extracted from Nostoc sphaeroides Ku..tzing by water extraction and subsequent alcohol precipitation.Besides,FTIR spectroscopic analysis was carried out to identify the structural difference of Nostoc sphaeroides Ku..tzing polysaccharides as a result of the sulfation reaction,and a correlation analysis was done between FTIR A1261/A1418 and degree of substitution(DS) of sulfated polysaccharides,as determined by the barium chloride-gelation method.The optimal sulfation reaction conditions were found to be: 1:4 chlorosulfonic acid-pyridine as esterification reagent for 6 h reaction at 70 ℃.Under the optimal sulfation conditions,the DS of the final products was 1.042.Meanwhile,the sulfated polysaccharide obtained revealed typical sulfated functional groups.The correlation coefficient between FTIR A1261/A1418 and DS of sulfated Nostoc sphaeroides Ku..tzing polysaccharides was 0.974.Therefore,infrared spectroscopy can be used to characterize the structural difference of sulfated polysaccharides and quantify the DS of sulfate groups.%采用氯磺酸-吡啶法合成硫酸酯化葛仙米多糖,利用正交设计对酯化试剂比例、反应温度及反应时间进行优化。通过傅里叶红外光谱分析酯化前后的结构差异,氯化钡-明胶比浊法测定取代度,并分析红外光谱法与取代度之间的相关性。结果表明:葛仙米多糖硫酸酯化修饰的最佳条件为V(氯磺酸)与V(吡啶)比例1:4、反应温度70℃、反应时间6h,此条件下取代度达到1.042;红外光谱分析表明,硫酸酯化后的葛仙米多糖具有硫酸酯键的特征吸收峰,其吸光度比值A1261/A1418与化学方法所测得的硫酸酯化取代度的相关系数达到0.974。红外光谱不仅可以表征硫酸酯化多

  20. La métamorphose du célibataire chez Rachilde

    Directory of Open Access Journals (Sweden)

    Vicky Gauthier

    2012-11-01

    Full Text Available Un personnage fort intéressant fait son entrée sur la scène du roman (mais aussi de la société à la fin du dix-neuvième siècle : le célibataire, qui devient peu à peu le héros de prédilection de la littérature fantastique. Écrivant et publiant à cette époque où la misogynie est à son paroxysme, l’écrivaine française Rachilde (1860-1953 semble de prime abord ne pas échapper à cette tendance : son œuvre, comme la littérature décadente, verse dans l’insolite, le morbide, la folie, la névrose, la perversion ; la femme y est considérée comme l’Autre, l’ennemie de l’homme entraînant le mal et la destruction. D’ailleurs, on y retrouve fréquemment ce personnage à la Dorian Gray ou à la Des Esseintes, notamment dans Le Mordu (1889, Les Hors Nature (1897, Refaire l’Amour (1927. Plus encore, et c’est peut-être là la plus grande originalité de Rachilde, une autre figure, plus marginale et peu répandue, émerge au sein de sa fiction ; le célibataire dandy et dilettante – si cher aux décadents – est, chez elle, femme. Également misanthrope désabusée – et peut-être même davantage puisqu’elle est consciente de son « pouvoir » et de ses possibilités d’action dans le monde dans lequel elle vit –, la femme célibataire chez Rachilde devient une force sur-naturelle et inquiétante, dont l’esprit, le corps et les traits en sont les signes prophétiques. Cet article portera sur l’étude de deux de ses romans L’Animale (1893 et La Jongleuse (1900 et s’intéressera tout particulièrement à leurs héroïnes respectives, Laure et Éliante, qui constituent deux profils, deux prototypes, du personnage de la femme célibataire rachildienne.

  1. In vitro and in vivo safety assessment of edible blue-green algae, Nostoc commune var. sphaeroides Kützing and Spirulina plantensis

    Science.gov (United States)

    Yang, Yue; Park, Youngki; Cassada, David A.; Snow, Daniel D.; Rogers, Douglas G.; Lee, Jiyoung

    2011-01-01

    Blue-green algae (BGA) have been consumed as food and herbal medicine for centuries. However, safety for their consumption has not been well investigated. This study was undertaken to evaluate in vitro and in vivo toxicity of cultivated Nostoc commune var. sphaeroides Kützing (NO) and Spirulina platensis (SP). Neither NO nor SP contained detectable levels of microcystin (MC)-LA, MC-RR, MC-LW and MC-LR by LC/MS/MS. Cell viability remained ~70-80% when HepG2 cells were incubated with 0-500 μg/ml of hexane, chloroform, methanol and water-extractable fractions of NO and SP. Four-week-old male and female C57BL/6J mice were fed an AIN-93G/M diet supplemented with 0, 2.5% or 5% of NO and SP (wt/wt) for 6 months. For both genders, BGA-rich diets did not induce noticeable abnormality in weight gain and plasma alanine aminotransferase (ALT) and aspartate aminotransferase concentrations except a significant increase in plasma ALT levels by 2.5% NO supplementation in male mice at 6 month. Histopathological analysis of livers, however, indicated that BGA did not cause significant liver damage compared with controls. In conclusion, our results suggest that NO and SP are free of MC and the long-term dietary supplementation of up to 5% of the BGA may be consumed without evident toxic side-effects. PMID:21473896

  2. Hydrogen production by hup(-) mutant and wild-type strains of Rhodobacter capsulatus from dark fermentation effluent of sugar beet thick juice in batch and continuous photobioreactors.

    Science.gov (United States)

    Uyar, Basar; Gürgan, Muazzez; Özgür, Ebru; Gündüz, Ufuk; Yücel, Meral; Eroglu, Inci

    2015-10-01

    Photofermentative production of hydrogen is a promising and sustainable process; however, it should be coupled to dark fermentation to become cost effective. In order to integrate dark fermentation and photofermentation, the suitability of dark fermenter effluents for the photofermentative hydrogen production must be demonstrated. In this study, thermophilic dark fermenter effluent (DFE) of sugar beet thick juice was used as a substrate in photofermentation process to compare wild-type and uptake hydrogenase-deficient (hup (-)) mutant strains of Rhodobacter capsulatus by means of hydrogen production and biomass growth. The tests were conducted in small-scale (50 mL) batch and large-scale (4 L) continuous photobioreactors in indoor conditions under continuous illumination. In small scale batch conditions, maximum cell concentrations were 0.92 gdcw/L c and 1.50 gdcw/L c, hydrogen yields were 34 % and 31 %, hydrogen productivities were 0.49 mmol/(L c·h) and 0.26 mmol/(Lc·h), for hup (-) and wild-type cells, respectively. In large-scale continuous conditions, maximum cell concentrations were 1.44 gdcw/L c and 1.87 gdcw/L c, hydrogen yields were 48 and 46 %, and hydrogen productivities were 1.01 mmol/(L c·h) and 1.05 mmol/(L c·h), for hup (-) and wild-type cells, respectively. Our results showed that Rhodobacter capsulatus hup (-) cells reached to a lower maximum cell concentration but their hydrogen yield and productivity were in the same range or superior compared to the wild-type cells in both batch and continuous operating modes. The maximum biomass concentration, yield and productivity of hydrogen were higher in continuous mode compared to the batch mode with both bacterial strains.

  3. Amitié, harmonie et paix politique chez Aristote et Jean Bodin

    Directory of Open Access Journals (Sweden)

    Sara Miglietti

    2010-09-01

    Full Text Available La crise politique et religieuse de la seconde moitié du xvie siècle ouvre la voie en France à un débat enflammé concernant les limites du pouvoir souverain et le rôle du peuple au sein de l’État. Dans les Six livres de la République (1576, Jean Bodin développe un programme de réforme éthico-politique envisageant l’amitié entre les citoyens comme pierre angulaire de l’État. Bien que s’inspirant largement des réflexions d’Aristote sur le même sujet (Éthique à Nicomaque, Politique, il remplace toutefois la théorie aristotélicienne de l’amitié-égalité (laquelle entraîne chez le Stagirite une vision égalitariste de la société et un net refus de la monarchie par une nouvelle théorie de l’amitié-harmonie qui lui permet de justifier la nature hiérarchique et monarchique de sa « République bien ordonnée ».

  4. Plurilinguisme, cultures et identités : la construction du savoir-être chez l’enseignant

    OpenAIRE

    Carrasco Perea, Encarnaciòn; Piccardo, Enrica

    2010-01-01

    Cette contribution s’inscrit dans la réflexion autour du développement de compétences plurilingues et pluriculturelles chez les enseignants. Dans ce cadre-là, nous nous sommes interrogées sur les représentations qu’ont les futurs enseignants (du primaire et du secondaire) à propos du plurilinguisme. L’intérêt est d’en dégager les pistes ouvertes pour l’élaboration de dispositifs de formation. Mais de quelles dimensions et ouverture internationales doter cette formation, en vue de la construct...

  5. Quand les morts reviennent… Réflexion sur l’ancestralité chez les Mayas des Basses Terres

    OpenAIRE

    Le Guen, Olivier

    2014-01-01

    Quand les morts reviennent… Réflexion sur l’ancestralité chez les Mayas des Basses Terres. Le culte des ancêtres est souvent évoqué dans la littérature ethnologique amérindienne, sans que soit pourtant établie son existence. Cet article s’attache à montrer que certains groupes mayas des Basses Terres pratiquent un culte familial des ancêtres, dont le jour des morts, ou hanal pixan, apparaît comme la manifestation la plus prégnante. Nous fonderons notre raisonnement sur des critères précis emp...

  6. Musique et sommeil chez la personne âgée: revue de la littérature

    OpenAIRE

    Carruzzo, Frédéric,; Schoepf, Chris

    2016-01-01

    Cette revue de la littérature a pour objectif d’étudier les relations entre musique relaxante et sommeil chez la personne âgée. Nous avons inclus six articles de recherche primaire dans notre étude. La moyenne d’âge des échantillons oscille entre 59 et 76 ans, et les contextes des études sont très variés, allant du domicile aux soins intensifs, en passant par une unité de cardiologie et un laboratoire du sommeil. Nous avons consulté quatre bases de données de novembre 2015 à janvier 2016...

  7. Conséquences du stress sur la fonction immunitaire chez les animaux d'élevage

    OpenAIRE

    Merlot, Elodie

    2004-01-01

    Cet article présente comment des situations de stress aigu (un transport, un regroupement) ou chronique (conditions de logement contraignantes) affectent la fonction immunitaire chez les animaux d’élevage. La réponse de stress est caractérisée par l’activation de l’axe corticotrope, dont les hormones inhibent l’activité des leucocytes, et la libération de nombreuses autres hormones et neuromédiateurs immunoactifs et immunosuppresseurs (hormone de croissance, prolactine, enképhalines…). Ainsi,...

  8. Distances et détours : la séduction à l'oeuvre chez Alessandro Baricco

    OpenAIRE

    gouchan, yannick

    2006-01-01

    International audience; L'article étudie les différentes modalités de la séduction dans les premiers romans d'Alessandro Baricco. On analyse dans un premier temps les formes et les fonctions de la séduction dans quelques rapports amoureux chez Baricco. Dans un second temps il est question de prendre en examen plusieurs éléments narrratifs et stylistiques afin de proposer une étude de la séduction du lecteur par Baricco

  9. Etude morphométrique de l'oreille externe chez les jeunes adultes

    Science.gov (United States)

    Nyemb, Philippe Manyacka Ma; Sankale, Anne-Aurore; Ndiaye, Lamine; NDiaye, Aïnina; Gaye, Magaye

    2014-01-01

    Introduction Connaitre les dimensions normales de l'oreille externe constitue un pré-requis en chirurgie. Le but de ce travail est de déterminer les valeurs moyennes des différentes mesures morphométriques des oreilles gauches et droites dans notre population d’étude. Méthodes Notre groupe d’étude était constitué de 100 sujets adultes jeunes (50 femmes et 50 hommes) âgés de 18 à 25 ans, et exempts de traumatismes ou d'anomalies congénitale de l'oreille externe. Les différentes mesures répertoriées étaient représentées par: la hauteur totale de l'oreille, la largeur totale de l'oreille, la hauteur lobulaire, la largeur lobulaire, la distance tragus - anti-hélix, la distance tragus - hélix, ainsi que la projection de l'oreille. Résultats L’âge moyen de notre population d’étude était de 22 ans. La hauteur totale de l'oreille était respectivement de 61,6 et 60,3 mm chez les sujets de sexe masculin et féminin. La largeur totale retrouvée était respectivement de 32,5 et 30,8 mm. Pour toutes les distances mesurées, nous retrouvions des différences entre hommes et femmes, ainsi que d'un coté à l'autre. Conclusion Pour le clinicien, il est important de prendre en compte les mesures morphométriques de l'oreille externe non seulement dans un but diagnostic, mais également pour reproduire lors de sa reconstruction une oreille anatomiquement correcte. PMID:25932068

  10. Les transformations du jeûne chez les chrétiens d'Orient

    Directory of Open Access Journals (Sweden)

    Bernard Heyberger

    2006-11-01

    Full Text Available Dans le christianisme, les règles du jeûne et de l’abstinence sont extrêmement complexes, dans leur rythme annuel et dans leurs prescriptions alimentaires, ce qui les distingue nettement de la pratique musulmane. C’est peut-être davantage dans l’anthropologie sous-jacente qu’on pourrait déterminer des conceptions communes aux deux religions. Ces règles se sont élaborées progressivement, entre le ive et le xiiie siècle, différenciant les Églises orientales de l’Église romaine, mais introduisant aussi des distinctions entre Églises orientales rivales. Il est assez difficile de se former une opinion claire sur les prescriptions et sur leur application concrète dans chaque groupe de chrétiens.À partir du xviie siècle, les Églises orientales se voient interrogées à propos de leurs pratiques en matière de jeûne et d’abstinence par les missionnaires et les érudits latins, et sommées de définir des règles strictes et définitives. En même temps, l’introduction des références du catholicisme latin fait perdre le sens du jeûne comme oeuvre collective, au profit d’une ascèse personnelle et intériorisée, centrée sur la pratique des sacrements. Les transformations du jeûne deviennent alors symptôme de la « modernisation » en cours chez les chrétiens orientaux.

  11. La représentation de l’artiste chez J.-K.Huysmans

    Directory of Open Access Journals (Sweden)

    Momoko Fukuda

    2012-03-01

    Full Text Available The object of this article is to situate J.-K. Huysmans' En ménage in his work as a whole and more generally in the tradition of the "roman d'art" in 19th Century French literature. "Roman d'art" works, such as the Goncourt brothers' Manette Salomon or Zola's OEuvre, often focus on the incompatibility of the artist's creative force and his love for a woman. Even if a woman appears as a muse at first, she often becomes an obstacle to the vocation of the artist. Even though the artist is very important in Huysmans' novels, he does not directly treat the opposition between love and creation. If a woman brings problems, it is not because of her influence on the creativity of the artist, but due to a particular theme developed by Huysmans: how to assure material comfort without being disturbed by 21 Ibid., p. 474. Fukuda, La représentation de l'artiste chez J.-K.Huysmans Nordlit 28, 2011 62 female presence? This problem is exaggerated by the artistic profession, which involves working at home. Not being capable of doing housework, Huysmans' hero cannot live totally alone. André, the hero of En ménage, leaves his wife who has been unfaithful to begin a single life with a housemaid. In his relationships with his wife, his housemaid and his lover, all he worries about is his work environment. Nevertheless, he ends up creating nothing, not because of a woman, but because of his own mediocrity and laziness. In this "roman d'art" without a muse, André's character is typical of Huysmans' comical but harsh realism, which subverts the myth of the artist torn between love and creation.

  12. Le principe de délicatesse et l'économie libidineuse chez Sade

    Directory of Open Access Journals (Sweden)

    Clara Carnicero de Castro

    2015-06-01

    Full Text Available Dans une lettre à son épouse, Sade fait l'éloge de la bizarrerie et l’élève au rang de catégorie esthétique sous le nom de « principe de délicatesse ». Cela peut sembler paradoxal, comme l'a bien remarqué Michel Delon, que celui qui énonce le devoir de délicatesse est celui-là même dont le nom est devenu synonyme de brutalité. Le terme est en effet ambigu et possède dans l'oeuvre du marquis plusieurs sens: de l'échange de soins entre Juliette et sa maîtresse préférée La Durand, en passant par une simple manie sexuelle, jusqu'à la fantaisie « la plus bizarre et la plus singulière de toutes », celle qui dépend d'une richesse fastueuse et qui ne s'achève que sur un tas de corps baignés de sang. Il s'agit d'abord d'examiner les différents sens du terme chez Sade ; puis d'analyser les interprétations que Roland Barthes, Annie Le Brun et Michel Delon donnent de la délicatesse scélérate ; enfin de mettre en évidence sa spécificité par rapport à la prodigalité luxurieuse.

  13. La poétique de la contradiction chez Nelly Arcan

    Directory of Open Access Journals (Sweden)

    Laurence Gauvreau

    2015-12-01

    Full Text Available L’autofiction chez Nelly Arcan, en plus de mettre en scène l’union atypique, bien que déjà vue, de l’écriture et de la prostitution, donne l’impression d’être tout entier un rassemblement de pensées opposées, incompatibles, en désordre. S’opposer à soi-même peut montrer l’existence d’un esprit critique, en plus de la capacité à pousser celui-ci au-delà du simple débat entre amis. La critique négative et la négativité de la critique pénètrent profondément le processus d’écriture dans les autofictions d’Arcan, Putain et Folle, et cette dernière possède définitivement un esprit critique. Par contre, celui-ci ne semble pas la source des oppositions qui caractérisent sa plume. La poétique de l’auteure semble en effet être fondée sur l’utilisation constante d’une série de contradictions. C’est dans la tension de l’exploration de ces contradictions, de la force de cette dialectique négative, qu’Arcan tente de faire éclater le sens des préjugés, de ce qui a été jugé d’avance sans aucun esprit critique, afin d’atteindre une conception et une compréhension qui seraient plus authentiques.

  14. Après le spectacle : les impacts psychosociaux de consommation de pornographie homosexuelle masculine chez les hommes gais

    Directory of Open Access Journals (Sweden)

    SIMON CORNEAU

    2010-01-01

    Full Text Available Cette recherche qualitative exploratoire vise à mettre à jour les impacts psychosociaux possibles de consommation de pornographie homosexuelle masculine à travers les discours de 20 usagers gais de Toronto (Canada. La consommation de pornographie semble plus acceptée et normalisée chez les hommes gais que chez les hommes hétérosexuels. Une telle consommation peut avoir une incidence sur certains aspects de la santé sexuelle et de la santé mentale. L'analyse thématique du corpus de nos données nous révèle que les impacts peuvent se faire sentir au niveau de l'apprentissage, de l'édification de la fantasmatique, de la validation de la sexualité entre hommes, de l'ingérence dans la vie sexuelle et enfin, sur l'habituation et sur l'image de soi/image corporelle. À l'aide de l’analyse critique de discours, nous avons pu documenter les discours sociaux plus larges en jeu dans les récits des usagers et voir de quelle façon ils se positionnent à l'intérieur de ces mêmes discours.

  15. Brûlure chez l’épileptique: brûlure pas comme les autres

    Science.gov (United States)

    Boukind, S.; Elatiqi, O.K.; Dlimi, M.; Elamrani, D.; Benchamkha, Y.; Ettalbi, S.

    2015-01-01

    Summary L’association brûlure et épilepsie est une constatation fréquente au Maroc. Ces brûlures, souvent itératives, touchent le plus souvent des femmes jeunes de milieu rural. L’accident survient habituellement au domicile, le plus souvent dans la cuisine à la suite d’une chute sur un moyen de cuisson posé au sol. Elles peuvent être inaugurales de la maladie mais surviennent plus souvent chez des patients connus mais au traitement mal suivi. Les conséquences de ces brûlures, toujours profondes, sont souvent dramatiques en termes de séquelles, chez des patients ayant déjà une insertion sociale rendue difficile par l’épilepsie. La prise en charge doit être multidisciplinaire et concerner à la fois la brûlures et l’épilepsie. Des mesures de prévention simples, visant à équilibrer l’épilepsie et éviter au patient de se trouver seul à proximité d’une source de chaleur, doivent être mises en place. PMID:27252613

  16. Effect of light-dark cycles on hydrogen and poly-β-hydroxybutyrate production by a photoheterotrophic culture and Rhodobacter capsulatus using a dark fermentation effluent as substrate.

    Science.gov (United States)

    Montiel Corona, Virginia; Le Borgne, Sylvie; Revah, Sergio; Morales, Marcia

    2017-02-01

    A Rhodobacter capsulatus strain and a photoheterotrophic culture (IZT) were cultivated to produce hydrogen under different light-dark cycles. A dark fermentation effluent (DFE) was used as substrate. It was found that IZT culture had an average cumulative hydrogen production (Paccum H2) of 1300±43mLH2L(-1) under continuous illumination and light-dark cycles of 30 or 60min. In contrast, R. capsulatus reduced its Paccum H2 by 20% under 30:30min light-dark cycles, but tripled its poly-β-hydroxybutyrate (PHB) content (308±2mgPHB gdw(-1)) compared to continuous illumination. The highest PHB content by IZT culture was 178±10mgPHB gdw(-1) under 15:15min light-dark cycles. PCR-DGGE analysis revealed that the IZT culture was mainly composed of Rhodopseudomonas palustris identified with high nucleotide similarity (99%). The evaluated cultures might be used for hydrogen and PHB production. They might provide energy savings by using light-dark cycles and DFE valorization.

  17. Potential of Rhodobacter capsulatus Grown in Anaerobic-Light or Aerobic-Dark Conditions as Bioremediation Agent for Biological Wastewater Treatments

    Directory of Open Access Journals (Sweden)

    Stefania Costa

    2017-02-01

    Full Text Available The use of microorganisms to clean up wastewater provides a cheaper alternative to the conventional treatment plant. The efficiency of this method can be improved by the choice of microorganism with the potential of removing contaminants. One such group is photosynthetic bacteria. Rhodobacter capsulatus is a purple non-sulfur bacterium (PNSB found to be capable of different metabolic activities depending on the environmental conditions. Cell growth in different media and conditions was tested, obtaining a concentration of about 108 CFU/mL under aerobic-dark and 109 CFU/mL under anaerobic-light conditions. The biomass was then used as a bioremediation agent for denitrification and nitrification of municipal wastewater to evaluate the potential to be employed as an additive in biological wastewater treatment. Inoculating a sample of mixed liquor withdrawn from the municipal wastewater treatment plant with R. capsulatus grown in aerobic-dark and anaerobic-light conditions caused a significant decrease of N-NO3 (>95%, N-NH3 (70% and SCOD (soluble chemical oxygen demand (>69%, independent of the growth conditions. A preliminary evaluation of costs indicated that R. capsulatus grown in aerobic-dark conditions could be more convenient for industrial application.

  18. Dietary Karaya Saponin and Rhodobacter capsulatus Exert Hypocholesterolemic Effects by Suppression of Hepatic Cholesterol Synthesis and Promotion of Bile Acid Synthesis in Laying Hens

    Directory of Open Access Journals (Sweden)

    Sadia Afrose

    2010-01-01

    Full Text Available This study was conducted to elucidate the mechanism underlying the hypolipidemic action of karaya saponin or Rhodobacter (R. capsulatus. A total of 40 laying hens (20-week-old were assigned into four dietary treatment groups and fed a basal diet (as a control or basal diets supplemented with either karaya saponin, R. capsulatus, or both for 60 days. The level of serum low-density-lipoprotein cholesterol and the levels of cholesterol and triglycerides in the serum, liver, and egg yolk were reduced by all the supplementations (<.05. Liver bile acid concentration and fecal concentrations of cholesterol, triacylglycerol, and bile acid were simultaneously increased by the supplementation of karaya saponin, R. capsulatus, and the combination of karaya saponin and R. capsulatus (<.05. The supplementation of karaya saponin, R. capsulatus, and the combination of karaya saponin and R. capsulatus suppressed the incorporation of 14C from 1-14C-palmitic acid into the fractions of total lipids, phospholipids, triacylglycerol, and cholesterol in the liver in vitro (<.05. These findings suggest that the hypocholesterolemic effects of karaya saponin and R. capsulatus are caused by the suppression of the cholesterol synthesis and the promotion of cholesterol catabolism in the liver.

  19. The ccoNOQP gene cluster codes for a cb-type cytochrome oxidase that functions in aerobic respiration of Rhodobacter capsulatus.

    Science.gov (United States)

    Thöny-Meyer, L; Beck, C; Preisig, O; Hennecke, H

    1994-11-01

    The genes for a new type of a haem-copper cytochrome oxidase were cloned from Rhodobacter capsulatus strain 37b4, using the Bradyrhizobium japonicum fixNOQP gene region as a hybridizing probe. Four genes, probably organized in an operon (ccoNOQP), were identified; their products share extensive amino acid sequence similarity with the FixN, O, Q and P proteins that have recently been shown to be the subunits of a cb-type oxidase. CcoN is a b-type cytochrome, CcoO and CcoP are membrane-bound mono- and dihaem c-type cytochromes and CcoQ is a small membrane protein of unknown function. Genes for a similar oxidase are also present in other non-rhizobial bacterial species such as Azotobacter vinelandii, Agrobacterium tumefaciens and Pseudomonas aeruginosa, as revealed by polymerase chain reaction analysis. A ccoN mutant was constructed whose phenotype, in combination with the structural information on the gene products, provides evidence that the CcoNOQP oxidase is a cytochrome c oxidase of the cb type, which supports aerobic respiration in R. capsulatus and which is probably identical to the cbb3-type oxidase that was recently purified from a different strain of the same species. Mutant analysis also showed that this oxidase has no influence on photosynthetic growth and nitrogen-fixation activity.

  20. Removal of the effect of ammonium on the regulation of nitrogenase enzyme in Rhodobacter capsulatus DSM1710 for improved hydrogen production

    Energy Technology Data Exchange (ETDEWEB)

    Pekgoez, Guelsah; Guenduez, Ufuk [Middle East Technical Univ. (Turkey). Dept. of Biology; Eroglu, Inci [Middle East Technical Univ. (Turkey). Dept. of Chemical Engineering; Rakhely, Gabor [Szeged Univ. (Hungary). Dept. of Biotechnology

    2010-07-01

    Photofermentative biohydrogen production by purple non-sulfur (PNS) bacteria is a renewable and clean way of producing hydrogen. Hydrogen production by PNS bacteria, Rhodobacter capsulatus, is mediated mainly by nitrogenases, which primarily fix molecular nitrogen to ammonium and produce hydrogen as byproduct. The reaction catalyzed by nitrogenases requires a lot of energy. Hence, there is a complex regulation on nitrogenase enzyme complex, consequently, on hydrogen production. Whenever ammonium, which is the end product of nitrogen fixation reaction, is found in the environment, hydrogen production stops. GlnB and GlnK proteins are the critical regulatory proteins in ammonium dependent regulation of the nitrogenase gene expression. In this study, the aim is to release the ammonium regulation on nitrogenase enzyme by inactivating glnB and glnK genes. For this purpose, relevant recombinant vectors were constructed; R.capsulatus glnB- strain was obtained. The double R.capsulatus glnB{sup -}glnK{sup -} strain, able to produce hydrogen independent of ammonium concentration of the environment is to be obtained. (orig.)

  1. L'encéphalomyélite aiguë disséminée chez l'enfant

    Science.gov (United States)

    Tadmori, Ilham; Chaouki, Sana; Abourazzak, Sana; Zahra, Souilmi Fatima; Benmiloud, Sarra; Idrissi, Mounia Lakhdar; Atmani, Samir; Hida, Moustapha

    2014-01-01

    L'encéphalomyélite aiguë disséminée (ADEM) est une maladie inflammatoire, démyélinisante, multifocale intéressant principalement la substance blanche du système nerveux central. Elle est rare mais non exceptionnelle chez l'enfant. Les auteurs rapportent une étude colligeant 9 cas d'ADEM pris en charge au service de Pédiatrie du CHU Hassan II à Fès, sur une période de 4 ans. Il s'agit de cinq garçons et quatre filles; âgés entre 2 ans et 13 ans. Les antécédents (ATCD) d'infection virale sont notés chez quatre patients. La fièvre est constante. Les convulsions sont présentes dans cinq cas et les troubles de conscience dans cinq cas. L'examen neurologique était anormal. L’étude de liquide céphalo-rachidien a révélé une réaction méningée. On ne notait pas de syndrome inflammatoire biologique. L'imagerie par résonance magnétique (IRM) cérébrale a objectivé des lésions en hyper-signal en T2 et T2 FLAIR chez tous les patients. Pour le traitement, des bolus de corticoïdes intraveineux ont été administrés, relayés par une corticothérapie orale et associés à une kinésithérapie motrice et un traitement antiépileptique pour certains patients. L’évolution de nos malades était favorable globalement et on a déploré le décès d'une patiente. L'ADEM est une affection rare du système nerveux central. Les critères diagnostiques sont fondés sur des éléments cliniques et des données d'imagerie. La prise en charge doit être précoce et multidisciplinaire. PMID:25870735

  2. Le développement de la reconnaissance des images tactiles chez les enfants tout-venant et chez les enfants présentant une déficience visuelle

    OpenAIRE

    Bordoli, Francesca

    2014-01-01

    Les images constituent une part importante dans notre société. Depuis leur naissance, les enfants voyants sont constamment confrontés aux images. Toutefois, la situation pour les enfants avec peu ou pas de vision est très différente puisqu’ils ont des difficultés d’accès à la lecture par manque de livres adaptés. Nous avons choisi de nous intéresser au rôle des caractéristiques de l’image dans la reconnaissance haptique d’images tactiles chez l’enfant voyant travaillant sans voir et l’enfant ...

  3. Analyse du transcriptome lors de l'embryogenèse précoce chez le Tournesol

    OpenAIRE

    2005-01-01

    Chez les végétaux supérieurs, l’embryogenèse est une phase clé du développement au cours de laquelle l’embryon établit les principales structures qui formeront la future plante et synthétise et accumule des réserves définissant le rendement et la qualité nutritionnelle des graines. La compréhension des évènements moléculaires et physiologiques menant à la formation de la graine est donc d’un intérêt agronomique majeur. Le tournesol (Helianthus annuus L.), qui présente une inflorescence portan...

  4. Grossesses extra utérines successives et bilharziose tubaire chez une touriste française

    Science.gov (United States)

    Laroche, Justine; Mottet, Nicolas; Malincenco, Marianna; Gay, Catherine; Royer, Pierre Yves; Riethmuller, Didier

    2016-01-01

    La bilharziose est la seconde endémie parasitaire mondiale et ses atteintes génito urinaires sont bien décrites. Les grossesses ectopiques (GEU) sur obstruction tubaire par les œufs de bilharziose sont rapportées dans les populations africaines. La bilharziose affecte aussi les voyageurs mais l'atteinte de l'appareil génital féminin est plus rare. Nous rapportons un cas exceptionnel de deux GEU successives sur bilharziose tubaire chez une patiente d'origine Française, sept ans après un voyage touristique au Mali, la première découverte sur pièce de salpingectomie et la seconde ayant nécessité une salpingotomie controlatérale avec une injection de méthotrexate, deux mois plus tard. PMID:27200124

  5. Hémothorax spontané révélant une vascularite de Wegener chez une femme enceinte

    Science.gov (United States)

    Serhane, Hind; Yassine, Msougar; Amro, Lamyae

    2016-01-01

    L’hémothorax spontané demeure une pathologie rare. Ses étiologies sont multiples mais restent parfois inconnues. Chez certains patients, la thoracotomie peut être le seul recours pour déterminer son origine. Les vascularites n’ont pas été rapporté comme cause habituelle des hémothorax spontanés. La grossesse ne semble pas avoir d’effet causal, ni aggravant des hémothorax spontanés, ni des vascularites. Nous rapportons une observation assez particulière d’une jeune patiente, présentant au cours de sa grossesse un hémothorax spontané secondaire à une vasularite de type Wegener, diagnostiquée par la biopsie pleurale faite au cours d’une thoracotomie exploratrice et confirmée par le dosage des ANCA. PMID:28154726

  6. “Aunque al seco tronco lo sigan regando” – Reprises du muralisme chez les grupos (1968-1978)

    OpenAIRE

    Tournon, Annabela

    2014-01-01

    Cet article propose de comprendre les modalités d’une reprise, à la fois pratique et théorique, du muralisme chez les grupos (collectifs d’artistes, théoriciens et militants actifs au Mexique dans les années 1970) à travers deux cas d’études : une peinture murale réalisée par le Grupo 65 dans l’après 1968, et une exposition de muralisme organisée en 1978. Ces deux cas d’analyse, subsumant œuvres, discours et événements, permettront d’observer la diversité des appropriations par les grupos de ...

  7. Dynamique temporelle de la sélection alimentaire chez l'abeille domestique (Apis mellifera L.) en paysage agricole

    OpenAIRE

    Requier, Fabrice; Odoux, Jean Francois; Tamic, Thierry; Feuillet, Dalila; Henry, Mickaël; Aupinel, Pierrick; DECOURTYE, Axel; Bretagnolle, Vincent

    2012-01-01

    Lors de la seconde moitié du XXème siècle, les paysages agricoles ont été profondément modifiés en raison de l'intensification de l'agriculture. Des perturbations dans tous les compartiments de la biodiversité ont été observées provoquant un déclin chez de nombreux taxons. L’abeille domestique (Apis mellifera L.) fait partie de ces espèces en déclin or elle fournit un service écosystémique de pollinisation indispensable pour les plantes sauvages et cultivées. La cause de ce déclin est multifa...

  8. Heterologous production of two unusual acyclic carotenoids, 1,1'-dihydroxy-3,4-didehydrolycopene and 1-hydroxy-3,4,3',4'-tetradehydrolycopene by combination of the crtC and crtD genes from Rhodobacter and Rubrivivax.

    Science.gov (United States)

    Steiger, Sabine; Takaichi, Shinichi; Sandmann, Gerhard

    2002-07-17

    Acyclic hydroxy carotenoids were produced from lycopene and 3,4-didehydrolycopene in Escherichia coli by combining different carotenogenic genes including the carotene hydratase gene crtC and the carotene 3,4-desaturase gene crtD. The genes originated either from Rhodobacter species or Rubrivivax gelatinosus. It was shown that the product of crtD from Rubrivivax unlike the one from Rhodobacter is able to convert 1-HO-3,4-didehydrolycopene to 1-HO-3,4,3',4'-tetradehydrolycopene (=3,4,3',4'-tetradehydro-1,2-dihydro-psi,psi-caroten-1-ol). Thus, only when the desaturase from Rubrivivax is expressed can this novel carotenoid be obtained. In the presence of crtC from Rubrivivax, another carotenoid 1,1'-(HO)(2)-3,4-didehydrolycopene (=3,4-didehydrolycopene-1,2,1',2'-tetrahydro-psi,psi-caroten-1,1'-diol) not found in a non-transgenic organism before is formed in E. coli. Its accumulation under these conditions and its absence when crtC from Rubrivivax is replaced by the corresponding gene from Rhodobacter is discussed. The function of the different crtC and crtD genes in the pathway leading to the individual carotenoids is outlined. Since 1,1'-(HO)(2)-3,4-didehydrolycopene could not be produced in substantial amounts and 1-HO-3,4,3',4'-tetradehydrolycopene has not been described before, their structural characteristics were determined for the definite assignment of their identity. This included spectral properties, determination of relative molecular mass as well as the number of hydroxy groups by mass spectroscopy and NMR spectroscopy for 1,1'-(HO)(2)-3,4-didehydrolycopene.

  9. Clonage de l'IGF-I et de son récepteur chez le turbot (Psetta maxima

    Directory of Open Access Journals (Sweden)

    ELIES G.

    1998-07-01

    Full Text Available Les IGF, leurs récepteurs et leurs protéines de liaison constituent une famille moléculaire qui joue un rôle essentiel dans la régulation de la croissance et du développement. Nous nous sommes intéressés à la caractérisation moléculaire de l'IGF-l et de son récepteur (IGF-1R chez le turbot (Psetta maxima, un poisson plat téléostéen. Par RT-PCR, nous avons clone un ADNc codant pour les quatre domaines de l'IGF-l mature. La protéine présente 70 à 96 % d'identité avec les autres IGF-I de vertébrés. Le clonage de la séquence codante entière du récepteur a nécessité la construction d'une banque d'ADNc d'embryons de turbots. Le récepteur est organisé en domaines dont la taille et les caractéristiques sont semblables à celles des autres récepteurs aux IGF de type 1 décrits chez les mammifères et le poulet. La région catalytique est particulièrement conservée. Dans certains domaines, notamment dans la région C-terminale du précurseur, quelques différences qui pourraient avoir une importance fonctionnelle sont cependant observées. Enfin, par RT-PCR, nous avons mis en évidence une régulation ontogénique du statut de polyadénylation des ARNm IGF-1R.

  10. Les dysthyroïdies chez l’hémodialysé chronique

    Directory of Open Access Journals (Sweden)

    Najoua Zbiti

    2010-10-01

    Full Text Available INTRODUCTION: Les dysthyroïdies chez l’hémodialysé chronique sont représentées par une hypothyroïdie: dite le syndrome de basse T3, actuellement nommée "le syndrome de la maladie euthyroïdienne". L’objectif de notre travail est de déterminer le profil thyroïdien de nos HDC afin de préciser la prévalence des différents troubles thyroïdiens dans notre population et de dégager les facteurs prédictifs, aussi on a précisé l’évolution sur une période de 3 ans. METHODES: Il s’agit d’une étude rétrospective réalisée en Mars 2007 concernant 68 patients adultes en hémodialyse périodique. Nous avons analysé les paramètres anthropométriques, cliniques et biologiques. Le dosage des hormones thyroïdiennes ((triiodothyronine libre FT3, (thyroxine libre FT4 et (thyréostimuline ultra-sensible TSHus s’est effectué selon la méthode radio-immunologique. Nous avons comparé 2 groupes de patients avec et sans dysthyroïdie (définie par un taux anormal de FT3 et/ou de FT4 et/ou de TSH afin de dégager les facteurs de risque. On a réalisé une surveillance biologique des hormones thyroïdiennes pendant 3 ans afin de préciser l’incidence des différents troubles thyroïdiens dans la même population. RESULTATS: Tous les patients sont en euthyroïdie clinique. On n’a noté aucun cas de goitre. Le profil thyroïdien est caractérisé par une hypothyroïdie biologique, la prévalence était de 28%. Nous n'avons pas trouvé des cas d'hyperthyroïdie. L'étude comparative des deux groupes de malades biologiquement euthyroïdiens et hypothyroïdiens a révèle le syndrome inflammatoire (p=0.001, l’âge avancé (p=0.003, et la durée prolongée en hémodialyse (p=0.04 comme des facteurs de risque liés à l’hypothyroïdie biologique. Deux HDC ont nécessité un traitement hormonal substitutif vu le contexte du diabète dans un cas et de la grossesse dans l’autre cas. Le suivi biologique pendant trois ans n’a r

  11. La double-page chez Hirohiko Araki : l’ubris faite norme

    Directory of Open Access Journals (Sweden)

    Aurélien Pigeat

    2011-03-01

    Full Text Available Le style d’Araki se caractérise par un usage massif de la double-page, loin de l’usage ponctuel que l’on trouve habituellement dans les shonen. Elle témoigne d’une forme d’ubris qui se fait norme de composition c’est-à-dire qu’elle érige le principe de débordement en règle de structuration de l’action et des planches Elle est ainsi la marque de la démesure d’un auteur qui, sous l’apparence du manga populaire, et à travers les codes de ce dernier, élabore une œuvre d’une puissance et d’une sophistication rares..

    Pour appréhender ce phénomène, il nous faut d’abord observer concrètement l’usage que fait Hirohiko Araki de la double-page, les lieux du récit que celle-ci investit, la fréquence de ses manifestations, et la manière dont elle caractérise les différentes parties de la saga Jojo’s bizarre Adventure. L’ubris de la double-page met alors particulièrement en relief deux éléments centraux de la poétique d’Hirohiko Araki : le corps et le temps.  La double-page apparaît comme la réponse matérielle à ces corps qui débordent de la page classique, qui éclatent ou se dispersent de telle sorte que l’auteur doit étendre les limites de ce cadre pour les représenter. Le temps entre lui en scène à travers le détail : la double-page devient le règne d’un détail sur lequel le lecteur passe trop vite et auquel le héros accorde toute son attention. Enfin, la double-page possède chez Hirohiko Araki une dimension proprement esthétique que révèle clairement l’usage presque absolu qui en est fait dans la septième partie de Jojo’s bizarre Adventure, Steel Ball Run, et dans le volume Rohan au Louvre, même si l’on peut la deviner déjà auparavant. La double-page est un moment où l’énigme se présente au héros, se met en mouvement ou se trouve élucidée. Le règne de l’ubris s’affirme là, dans ces doubles-pages qui n’en sont finalement plus, dans cette

  12. Open reading frame 5 (ORF5), encoding a ferredoxinlike protein, and nifQ are cotranscribed with nifE, nifN, nifX, and ORF4 in Rhodobacter capsulatus.

    OpenAIRE

    Moreno-Vivian, C; Hennecke, S; Pühler, A.; Klipp, W

    1989-01-01

    DNA sequence analysis of a 1,600-base-pair fragment located downstream of nifENX in nif region A of Rhodobacter capsulatus revealed two additional open reading frames (ORFs): ORF5, encoding a ferredoxinlike protein, and nifQ. The ferredoxinlike gene product contained two cysteine motifs, typical of ferredoxins coordinating two 4Fe-4S clusters, but the distance between these two motifs was unusual for low-molecular-weight ferredoxins. The R. capsulatus nifQ gene product shared a high degree of...

  13. Étude séro-épidémiologique de la cowdriose chez le zébu maure au sénégal

    Directory of Open Access Journals (Sweden)

    Mbengue M.

    2007-06-01

    Full Text Available La séroprévalence de la cowdriose chez des zébus maures en provenance du Mali et de Mauritanie a été analysée par la technique de l’ELISA indirect utilisant la protéine antigénique majeure n° 1-B (MAP1-B. Les résultats de l’étude séroépidémiologique réalisée chez ces zébus montrent une bonne adéquation entre la prévalence, d’une part, et l’abondance ou l’absence de la tique vectrice, d’autre part, dans les deux pays d’origine avec un taux de 98% au Mali (zone infectée et de 0% en Mauritanie (zone indemne.

  14. Les plantes provoquant des dermatites de contact chez l’Homme : intérêt en médecine vétérinaire

    OpenAIRE

    Ngo Ngoc Dong, Claire

    2013-01-01

    Les dermatites de contact sont des réactions cutanées provoquées par des substances au contact de la peau. Les plantes font partie des substances souvent impliquées dans ce type d’affections. Chez l’Homme, les dermatites de contact liées aux plantes sont fréquentes et certaines sont même considérées comme des maladies professionnelles. Chez les animaux, ces dermatoses, bien que probablement sous-diagnostiquées, sont plus rarement rencontrées. Après avoir réalisé un bref récapitulatif des plan...

  15. Distribution, métabolisme et rôle du sorbitol chez les plantes supérieures. Synthèse

    OpenAIRE

    Escobar Gutierrez, Abraham; Gaudillere, Jean-Pierre

    1996-01-01

    Le sorbitol est l’un des 17 alditols trouvés chez les plantes supérieures. Il est, avec le saccharose, un produit majeur de la photosynthèse chez plusieurs espèces de la famille des Rosaceae et des Plantaginaceae. L’accumulation de sorbitol permet une réponse adaptative des plantes soumises à des stress salins, hydriques et aux basses températures. La biosynthèse de sorbitol est confinée aux organes source et sa dégradation n’a lieu que dans les organes puits. La synthèse de sorbitol est en c...

  16. The Effects of Rhodobacter capsulatus KCTC-2583 on Cholesterol Metabolism, Egg Production and Quality Parameters during the Late Laying Periods in Hens.

    Science.gov (United States)

    Lokhande, Anushka; Ingale, S L; Lee, S H; Kim, J S; Lohakare, J D; Chae, B J; Kwon, I K

    2013-06-01

    An experiment was conducted to investigate the effects of dietary supplementation of Rhodobacter capsulatus KCTC-2583 on egg-yolk and serum cholesterol, egg production and quality parameters during the late laying periods in hens. A total of 160 Hy-Line Brown layers (54 wk-old) were randomly allotted to 4 treatment groups on the basis of laying performance. Each treatment had 4 replicates with 10 birds each (40 birds per treatment). Two hens were confined individually with cage size 35×35×40 cm and each 10 birds (5 cages) shared a common feed trough between them forming one experimental unit. Dietary treatments were; basal diet supplemented with 0 (control), 0.05, 0.10 and 0.15% R. capsulatus KCTC-2583. Experimental diets were fed in meal form for 56 d. Dietary supplementation of increasing levels of R. capsulatus KCTC-2583 reduced (linear, phens fed a diet supplemented with increasing levels of R. capsulatus KCTC-2583 had increased (linear; p0.05) on feed intake of laying hens. At d 28 and 56, breaking strength and yolk colour of eggs were linearly improved (phens fed dietary increasing levels of R. capsulatus KCTC-2583. Dietary treatment had no effects (linear or quadratic; p>0.05) on albumin height, shell thickness and shell weight at any period of experiment. These results indicate that dietary supplementation of R. capsulatus KCTC-2583 has the potential to improve the laying hen performance and lead to the development of low cholesterol eggs during late laying period in Hy-Line Brown hens.

  17. Métastases pleuropulmonaires révélant un mélanome malin de la conjonctive chez un sujet jeune

    OpenAIRE

    El Ouazzani, Hanane; Janah, Hicham; El Machichi, Sabah Alami; Achachi, Leila; Fihry, Mohamed Taoufiq El Fassy; El Ftouh, Mohamed

    2016-01-01

    Le mélanome de la conjonctive est une tumeur rare avec une incidence de 0,03 à 0,08 pour 100000 dans la population blanche. Le mélanome malin métastatique constitue environ 5% de toutes les tumeurs malignes secondaires du poumon. Nous rapportons un cas de métastase pleurale et pulmonaire d'un mélanome conjonctival de découverte fortuite chez un sujet jeune.

  18. Localisations particulières de l'histiocytose langerhansienne chez l'enfant, scapula et pubis: à propos de deux cas

    Science.gov (United States)

    Atarraf, Karima; Chater, Lamiae; Arroud, Mounir; Afifi, My Abderrahman

    2014-01-01

    L'histiocytose X ou histiocytose de Langerhans est une maladie de l'enfant et de l'adulte jeune. Dont l'incidence est estimée à 1 cas sur 200 000 par an. C'est une maladie au spectre clinique très divers, allant du simple granulome éosinophile à la forme grave multiviscérale avec dysfonctionnement d'organe. Les auteurs rapportent deux observations concernant deux localisations assez rares de cette maladie, au niveau du pubis chez le premier enfant, et au niveau de la scapula chez le deuxième. Chez nos deux malades la localisation était focale, et l’évolution était favorable. A travers ces deux observations, nous allons essayer de décrire les différents aspects cliniques et radiologiques et discuter a travers une revue de littérature les démarches diagnostiques et thérapeutiques de cette maladie rare. PMID:25478049

  19. Iconicity and Typography in Steve McCaffery’s Panel-Poems Iconicité et typographie chez Steve McCaffery: les poèmes-panneaux

    Directory of Open Access Journals (Sweden)

    Fiona McMahon

    2007-01-01

    Full Text Available Cet article se propose de retracer les étapes d’un projet d’écriture qui se rattache historiquement aux mouvances internationales de la poésie concrète comme à l’émergence d’une poétique de l’iconicité chez l’avant-garde nord-américaine du vingtième siècle. Le matérialisme dont se réclame la poésie de Steve McCaffery se traduit dans son œuvre typographique Carnival (1967-75 par une pratique mettant en jeu la lettre, le plus petit dénominateur de la langue, et la page, qui doit se laisser transformer pour que se réalise un nouvel espace de signification poétique. Le dialogue qui se joue entre le lisible et le visible prend forme grâce à un répertoire de techniques expérimenté avec la machine à écrire et de concert avec le lecteur, devenu acteur de l’œuvre poétique. La pratique architecturale du poème-panneau chez McCaffery sera envisagée dans son rapport actuel avec le prolongement des problématiques de la poésie visuelle chez l’avant-garde nord-américaine.

  20. Aménorrhée chimio induite chez une population marocaine: à propos d'une cohorte retrospective

    Science.gov (United States)

    Brahmi, Sami Aziz; Ziani, Fatima Zahra; Youssef, Seddik; Afqir, Said

    2016-01-01

    Introduction Le cancer du sein est un des cancers les plus fréquents chez la femme en pré ménopause et son traitement peut compromettre la fertilité. En effet, la chimiothérapie utilisée dans le cancer du sein peut conduire à une aménorrhée transitoire ou permanente chez les femmes non ménopausées. Méthodes Nous avons mené une étude rétrospective au service d'oncologie médicale du CHU Mohammed VI d'Oujda sur une période de 3 ans allant de janvier 2009 à décembre 2011 incluant les patientes jeunes ayant un cancer du sein localisé, pour étudier l'incidence de l'aménorrhée chimio-induite (ACI), ainsi que les facteurs prédictifs intervenant dans sa survenue. Résultats Dans notre série 74% de nos patientes ont présenté une ACI et 33.6% de nos patientes ont présenté une aménorrhée chimio-induite définitive. Plusieurs facteurs ont été étudiés à la recherche d’élément prédictifs de la survenue de l'aménorrhée. Concernant le facteur âge, l'analyse a montré que les femmes avec un âge supérieur à 40 ans étaient plus susceptibles de présenter une aménorrhée que celles avec un âge inférieur à 40 avec un pourcentage de 95,7% versus 56,1% avec une différence significative (p = 0.003). Conclusion L'incidence dans notre étude de l'ACI semble comparable à celle retrouvé dans la littérature, l’âge dans notre étude est le facteur prédictif le plus prédominant dans sa survenue. PMID:27642399

  1. Characterization of a nif-regulated flavoprotein (FprA) from Rhodobacter capsulatus. Redox properties and molecular interaction with a [2Fe-2S] ferredoxin.

    Science.gov (United States)

    Jouanneau, Y; Meyer, C; Asso, M; Guigliarelli, B; Willison, J C

    2000-02-01

    A flavoprotein from Rhodobacter capsulatus was purified as a recombinant (His)6-tag fusion from an Escherichia coli clone over-expressing the fprA structural gene. The FprA protein is a homodimer containing one molecule of FMN per 48-kDa monomer. Reduction of the flavoprotein by dithionite showed biphasic kinetics, starting with a fast step of semiquinone (SQ) formation, and followed by a slow reduction of the SQ. This SQ was in the anionic form as shown by EPR and optical spectroscopies. Spectrophotometric titration gave a midpoint redox potential for the oxidized/SQ couple of Em1 = +20 mV (pH 8.0), whereas the SQ/hydroquinone couple could not be titrated due to the thermodynamic instability of SQ associated with its slow reduction process. The inability to detect the intermediate form, SQ, upon oxidative titration confirmed this instability and led to an estimate of Em2 - Em1 of > 80 mV. The reduction of SQ by dithionite was significantly accelerated when the [2Fe-2S] ferredoxin FdIV was used as redox mediator. The midpoint redox potential of this ferredoxin was determined to be -275 +/- 2 mV at pH 7.5, consistent with FdIV serving as electron donor to FprA in vivo. FdIV and FprA were found to cross-react when incubated together with the 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide, giving a covalent complex with an Mr of approximately 60 000. Formation of this complex was unaffected by the redox states of the two proteins. Other [2Fe-2S] ferredoxins, including FdV and FdVI from R. capsulatus, were ineffective as electron carriers to FprA, and cross-reacted poorly with the flavoprotein. The possible function of FprA with regard to nitrogen fixation was investigated using an fprA-deleted mutant. Although nitrogenase activity was significantly reduced in the mutant compared with the wild-type strain, nitrogen fixation was apparently unaffected by the fprA deletion even under iron limitation or microaerobic conditions.

  2. Functional assignment of gene AAC16202.1 from Rhodobacter capsulatus SB1003: new insights into the bacterial SDR sorbitol dehydrogenases family.

    Science.gov (United States)

    Sola-Carvajal, Agustín; García-García, María Inmaculada; Sánchez-Carrón, Guiomar; García-Carmona, Francisco; Sánchez-Ferrer, Alvaro

    2012-11-01

    Short-chain dehydrogenases/reductases (SDR) constitute one of the largest enzyme superfamilies with over 60,000 non-redundant sequences in the database, many of which need a correct functional assignment. Among them, the gene AAC16202.1 (NCBI) from Rhodobacter capsulatus SB1003 has been assigned in Uniprot both as a sorbitol dehydrogenase (#D5AUY1) and, as an N-acetyl-d-mannosamine dehydrogenase (#O66112), both enzymes being of biotechnological interest. When the gene was overexpressed in Escherichia coli Rosetta (DE3)pLys, the purified enzyme was not active toward N-acetyl-d-mannosamine, whereas it was active toward d-sorbitol and d-fructose. However, the relative activities toward xylitol and l-iditol (0.45 and 6.9%, respectively) were low compared with that toward d-sorbitol. Thus, the enzyme could be considered sorbitol dehydrogenase (SDH) with very low activity toward xylitol, which could increase its biotechnological interest for determining sorbitol without the unspecific cross-determination of added xylitol in food and pharma compositions. The tetrameric enzyme (120 kDa) showed similar catalytic efficiency (2.2 × 10(3) M(-1) s(-1)) to other sorbitol dehydrogenases for d-sorbitol, with an optimum pH of 9.0 and an optimum temperature of 37 °C. The enzyme was also more thermostable than other reported SDH, ammonium sulfate being the best stabilizer in this respect, increasing the melting temperature (T(m)) up to 52.9 °C. The enzyme can also be considered as a new member of the Zn(2+) independent SDH family since no effect on activity was detected in the presence of divalent cations or chelating agents. Finally, its in silico analysis enabled the specific conserved sequence blocks that are the fingerprints of bacterial sorbitol dehydrogenases and mainly located at C-terminal of the protein, to be determined for the first time. This knowledge will facilitate future data curation of present databases and a better functional assignment of newly described

  3. Systeme microfluidique d'analyse sanguine en temps reel pour l'imagerie moleculaire chez le petit animal

    Science.gov (United States)

    Convert, Laurence

    De nouveaux radiotraceurs sont continuellement développés pour améliorer l'efficacité diagnostique en imagerie moléculaire, principalement en tomographie d'émission par positrons (TEP) et en tomographie d'émission monophotonique (TEM) dans les domaines de l'oncologie, de la cardiologie et de la neurologie. Avant de pouvoir être utilisés chez les humains, ces radiotraceurs doivent être caractérisés chez les petits animaux, principalement les rats et les souris. Pour cela, de nombreux échantillons sanguins doivent être prélevés et analysés (mesure de radioactivité, séparation de plasma, séparation d'espèces chimiques), ce qui représente un défi majeur chez les rongeurs à cause de leur très faible volume sanguin (˜1,4 ml pour une souris). Des solutions fournissant une analyse partielle sont présentées dans la littérature, mais aucune ne permet d'effectuer toutes les opérations dans un même système. Les présents travaux de recherche s'insèrent dans le contexte global d'un projet visant à développer un système microfluidique d'analyse sanguine complète en temps réel pour la caractérisation des nouveaux radiotraceurs TEP et TEM. Un cahier des charges a tout d'abord été établi et a permis de fixer des critères quantitatifs et qualitatifs à respecter pour chacune des fonctions de la puce. La fonction de détection microfluidique a ensuite été développée. Un état de l'art des travaux ayant déjà combiné la microfluidique et la détection de radioactivité a permis de souligner qu'aucune solution existante ne répondait aux critères du projet. Parmi les différentes technologies disponibles, des microcanaux en résine KMPR fabriqués sur des détecteurs semiconducteurs de type p-i-n ont été identifiés comme une solution technologique pour le projet. Des détecteurs p-i-n ont ensuite été fabriqués en utilisant un procédé standard. Les performances encourageantes obtenues ont mené à initier un projet de ma

  4. Valorisation de tourteaux de soja issus d’une production locale non OGM chez les fabricants d’aliments

    Directory of Open Access Journals (Sweden)

    Le Cadre Patricia

    2015-09-01

    Full Text Available L’opportunité de mettre en place une filière française intégrée de la production de graines de soja à l’utilisation du tourteau, est liée à la faisabilité économique de celle-ci et notamment à la valorisation des coproduits. L’étude réalisée à l’échelle territoriale (Sud-Ouest et Rhône Alpes, démontre qu’un tourteau de soja gras local possède de nombreux débouchés rémunérateurs liés ou non, à son caractère non OGM et à son image « terroir » chez les fabricants d’aliments pour animaux de rente. Cela lui confère un intérêt économique face à un tourteau d’importation (standard ou non OGM, qui peut cependant varier en fonction du contexte de prix, mais aussi en fonction des décisions de mise en marché qui seront prises par les opérateurs concernés (contractualisation ou non dans des filières locales de qualité.

  5. Effect of Spray Freeze Drying on Antioxidant Activity of Phycocyprotein from Nostoc sphaeroides KUting%喷雾冷冻干燥对葛仙米藻胆蛋白抗氧化特性的影响

    Institute of Scientific and Technical Information of China (English)

    程超; 朱玉婷; 田瑞; 汪兴平; 潘思轶

    2012-01-01

    研究喷雾冷冻干燥对葛仙米藻胆蛋白抗氧化特性的影响,并与冷冻干燥技术进行比较。主要测定ABTS+·、铁还原抗氧化能力(FRAP)、对羟自由基(·OH)清除作用和H2O2诱导的脂质过氧化的抑制作用,结果发现,喷雾冷冻干燥(SFD)对葛仙米藻胆蛋白的抗氧化特性有一定的影响,在基于电子转移和氢原子转移的抗氧化测定方法中,SFD与冷冻干燥(FD)制备的样品差异不明显,但在基于活性氧自由基清除的测定方法中,SFD显著优于FD。表明SFD非常适合于高活性成分的干燥。%In this study, the effect of spray freeze drying on the antioxidant activity of phycobiliprotein fromNostoc sphaeroides KUting was studied and compared with that of common freeze drying. The scavenging effect of phycobiliprotein on ABTS+· and hydroxyl radicals (·OH), H2O2-induced lipid peroxidation and ferric-ion reducing power (FRAP) were evaluated. The results indicated that spray freeze drying method had obvious effect on antioxidant activity of phycobiliprotein from Nostoc sphaeroides Kuting. The samples dried by two different methods showed no significant difference in the antioxidant activity determined based on electron transfer and hydrogen atom transfer. The free radical scavenging activity of the sample dried by spray freeze drying method was markedly higher than that of the sample dried by common freeze drying method. These data suggest that spray freeze drying is more suitable for drying active substances.

  6. Evaluation de la fonction hépatique au cours du paludisme grave chez les enfants de moins de cinq ans à Kinshasa en République Démocratique du Congo

    Science.gov (United States)

    Kabamba, Arsène Tshikongo; Mukuku, Olivier; Shamashanga, Laurent Kwete; Kamunga, Daniel Badibanga; Bokanya, Alex Impele; Lukumwena, Zet Kalala; Longanga, Albert Otshudi

    2014-01-01

    Introduction Le paludisme est toujours compté parmi les problèmes de santé publique prioritaires en République Démocratique du Congo suite au nombre de malades et de décès qu'il provoque. Cette étude évalue l'atteinte de la fonction hépatique au cours du paludisme grave chez les enfants de moins de 5 ans. Méthodes Il s'agit d'une étude cas-témoins menée de janvier à juin 2013 à Kinshasa (République Démocratique du Congo) où le dosage des bilirubines totale, directe et indirecte et la mesure de l'activité enzymatique de la Glutamate Pyruvate Transaminase (GPT), de la Glutamate Oxaloacétate Transaminase (GOT) et du taux d'hémoglobine ont été faits chez 46 enfants âgés de moins de 5 ans atteints de paludisme grave (groupe I) et chez 46 autres considérés sains avec une goutte négative (groupe II). Les résultats obtenus ont été comparés dans les deux groupes et le seuil de signification a été fixé à p bilirubine directe, la bilirubine indirecte et la bilirubine totale chez les enfants atteints du paludisme grave. Ces analyses montrent une différence significative en défaveur de ces derniers (p < 0,001). Conclusion En effet, cette augmentation des taux plasmatiques des paramètres biologiques analysés observée chez les enfants gravement impaludés traduit ainsi une altération de la fonction hépatique au cours d'un paludisme grave chez l'enfant de moins de cinq ans. PMID:25870721

  7. La programmmation foetale de la dysfonction vasculaire pulmonaire chez la souris : rôle des mécanismes épigénétiques = Fetal programming of pulmonary vascular dysfunction in mice : role of epigenetic mechanisms

    OpenAIRE

    Rexhaj, E.

    2011-01-01

    Rapport de synthèseDes événements pathologiques survenant pendant la période foetale prédisposent la descendance aux maladies cardiovasculaires systémiques. Il existe peu de connaissances au sujet de la circulation pulmonaire et encore moins quant aux mécanismes sous-jacents. La sous-alimentation maternelle pendant la grossesse peut représenter un modèle d'investigation de ces mécanismes, parce que chez l'animal et l'homme elle est associée à une dysfonction vasculaire systémique chez la prog...

  8. Ctenophthalmus (Ethioctenophthalmus kemmelberg n. sp. (Insecta : Siphonaptera : Ctenophthalmidae, Puce nouvelle de Tanzanie et description de structures internes non signalées chez les Mécoptèroïdes

    Directory of Open Access Journals (Sweden)

    Laudisoit A.

    2007-09-01

    Full Text Available Nous avons récemment décrit deux taxa nouveaux de Siphonaptères (Ctenophthalmus (Ethioctenophthalmus teucqae teucqae et C. (E. teucqae shumeensis Laudisoit & Beaucournu, 2007 du foyer pesteux de Lushoto (Monts Usambara occidentaux, Tanzanie. Nous étudierons ici un taxon nouveau, Ctenophthalmus kemmelberg, puce originale, non seulement par ses segments génitaux, mais aussi par des structures jusqu’à maintenant décrites, à notre connaissance, chez aucun Mécoptèroïde. Elles sont observables chez les femelles uniquement. Nous proposons d’attribuer à ces structures remarquables le nom d’“organes de Teucq”.

  9. L'accident ischémique cérébral chez le sujet jeune: à propos de 6 cas

    Science.gov (United States)

    Khammassi, Naziha; Sassi, Yosra Ben; Aloui, Asma; Kort, Youssef; Abdelhedi, Haykel; Cherif, Ouahida

    2015-01-01

    Les accidents ischémiques cérébraux (AIC) du sujet jeune se caractérisent par une panoplie d’étiologies différentes de celles des accidents vasculaires cérébraux (AVC) du sujet âgé d'où l'intérêt de bien creuser devant une telle atteinte à la recherche surtout d'une thrombophilie ou d'une cardiopathie emboligène. Cependant, il ne faut pas négliger une exposition de plus en plus accrue du sujet jeune à des facteurs de risque cardio-vasculaires tel le tabagisme qui accélère le processus d'athérosclérose, étiologie principale d'AVC tout âge confondu. Nous avons rétrospectivement collecté les données de six patients âgés de moins de 45 ans qui ont été hospitalisés dans notre service pour un AIC. La moyenne d’âge était de 35,3 et les hommes représentaient 16% de notre série. L'enquête étiologique a conclu à un syndrome des anticorps anti-phospholipides secondaire à un syndrome de Gougerot Sjögren chez l'un des patients, un déficit en protéine S chez deux patients et un syndrome de Sneddon chez un autre. Les causes d'AIC n'ont pas été identifiées dans les deux autres cas. Un traitement à base d'anti-vitamines K ou d'antiagrégants plaquettaires a été instauré en cas d’étiologie révélée. PMID:26889323

  10. Development of a Rhodobacter capsulatus self-reporting model system for optimizing light-dependent, [FeFe]-hydrogenase-driven H 2 production: A Model System for Optimizing H 2 Production

    Energy Technology Data Exchange (ETDEWEB)

    Wecker, Matt S. A. [GeneBiologics, LLC, Boulder Colorado; Beaton, Stephen E. [United States Air Force Academy, Department of Chemistry, Colorado Springs Colorado; Chado, Robert A. [United States Air Force Academy, Department of Chemistry, Colorado Springs Colorado; Ghirardi, Maria L. [National Renewable Energy Laboratory, MS 3313, 15013 Denver West Parkway Golden Colorado 80401

    2016-08-23

    The photosynthetic bacterium Rhodobacter capsulatus normally photoproduces H2 as a by-product of its nitrogenase-catalyzed nitrogen-fixing activity. Such H2 production, however, is expensive from a metabolic perspective, requiring nearly four times as many photons as the equivalent algal hydrogenase-based system (Ghirardi et al. 2009). Here we report the insertion of a Clostridium acetobutylicum [FeFe]-hydrogenase and its three attendant hydrogenase assembly proteins into an R. capsulatus strain lacking its native uptake hydrogenase. Further, this strain is modified to fluoresce upon sensing H2. The resulting strain photoproduces H2 and self-reports its own H2 production through fluorescence. This model system represents a unique method of developing hydrogenase-based H2 production in R. capsulatus, may serve as a powerful system for in vivo directed evolution of hydrogenases and hydrogenase-associated genes, and provides a means of screening for increased metabolic production of H2.

  11. Les biotechnologies de la reproduction chez les bovins et leurs applications réelles ou potentielles en sélection

    OpenAIRE

    Colleau, J Jacques; HEYMAN, Y.; Renard, Jean Paul

    1998-01-01

    Cet article décrit les bases de plusieurs biotechnologies de la reproduction chez les bovins : superovulation et transplantation embryonnaire, sexage des embryons, ponction des ovocytes in vivo et fécondation in vitro, clonage embryonnaire et clonage somatique. On précise leurs limites techniques actuelles, leurs perspectives d’amélioration et leurs coûts respectifs. Les conséquences de leur utilisation dans les programmes d’amélioration génétique sont analysées tant au niveau de la situation...

  12. Premiers résultats de sex-ratio, puberté et dimorphisme sexuel chez le Paraha peue (Platax orbicularis) en élevage.

    OpenAIRE

    Gasset, Eric; Joufoques, Vaiana; David, Rarahu; Maamaatuaiahutapu, Moana; Teissier, Alexandre; Tamata, Thierry; Dupieux, Sylvain

    2009-01-01

    Cette première étude du sex-ratio menée chez Platax orbicularis en élevage donne d’importantes indications dans l’optique d’optimiser la gestion des productions (1) de lots de futurs géniteurs issus d’un plan de croisement et (2) des lots d’alevins destinés à la production en cages. La poursuite du suivi des lots en cours et des nouvelles familles produites (sans tri des alevins et avec marquage magnétique individuel des poissons) permettra de confirmer sans doute ces indications et d’oriente...

  13. Corps étranger métallique inhalé: 36 mois d’évolution intrabronchique chez un enfant de 8 ans

    OpenAIRE

    Mupepe, Alexis Kumba; Mukuku, Olivier; Bagale, Yves; Ruhindiza, Bienvenu Mukuku

    2014-01-01

    Les corps étrangers dans les voies respiratoires constituent une urgence relativement fréquente chez les enfants. Nous présentons ici le cas d'une fillette de 8 ans qui avait inhalé un clou que la radiographie avait localisé dans la bronche droite. L’évolution est marquée par une symptomatologie muette et une migration vers le bas de ce clou. Ne disposant pas d’équipement pour une chirurgie adaptée, le malade vit encore avec ce corps étranger en lui. La nature et l’évolution clinique et parac...

  14. Traitements didactiques preventifs d'un type de conceptions erronees en sciences physiques chez des eleves du secondaire

    Science.gov (United States)

    Blondin, Andre

    Dans un contexte constructiviste, les connaissances anterieures d'un individu sont essentielles a la construction de nouvelles connaissances. Quelle qu'en soit la source (certaines de ces connaissances ont ete elaborees en classe, d'autres ont ete elaborees par interaction personnelle de l'individu avec son environnement physique et social), ces connaissances, une fois acquises, constituent les matieres premieres de l'elaboration des nouvelles conceptions de cet individu. Generalement, cette influence est consideree comme positive. Cependant, dans un milieu scolaire ou l'apprentissage de certaines conceptions enchassees dans un programme d'etudes et enterinees par l'ensemble d'une communaute est obligatoire, certaines connaissances anterieures peuvent entraver la construction des conceptions exigees par la communaute. La litterature abonde de tels exemples. Cependant, certaines connaissances anterieures, en soi tout a fait conformes a l'Heritage, peuvent aussi, parce qu'utilisees de facon non pertinente, entraver la construction d'une conception exigee par la communaute. Ici, la litterature nous donne peu d'exemples de ce type, mais nous en fournirons quelques-uns dans le cadre theorique, et ce sera un d'entre eux qui servira de base a nos propos. En effet, une grande proportion d'eleves inscrits a un cours de sciences physiques de la quatrieme secondaire, en reponse a un probleme deja solutionne durant l'annee et redonne lors d'un examen sommatif, "Pourquoi la Lune nous montre-t-elle toujours la meme face?", attribue principalement la cause de ce phenomene a la rotation de la Terre sur son axe. En tant que responsable de l'enseignement de ce programme d'etudes, plusieurs questions nous sont venues a l'esprit, entre autres, comment, dans un contexte constructiviste, est-il possible de reduire chez un eleve, l'impact de cette connaissance anterieure dans l'elaboration de la solution et ainsi prevenir la construction d'une conception erronee? Nous avons teste nos

  15. GenBank blastx search result: AK243491 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK243491 J100073O14 M86823.1 RCANIFA Rhodobacter sphaeroides ORF1, complete cds; nif...U gene, complete cds; nifS gene, complete cds; nifV gene, complete cds; nifW gene, complete cds; rponN gene, partial cds. BCT 2e-36 1 ...

  16. GenBank blastx search result: AK287500 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK287500 J043034C21 M86823.1 RCANIFA Rhodobacter sphaeroides ORF1, complete cds; nif...U gene, complete cds; nifS gene, complete cds; nifV gene, complete cds; nifW gene, complete cds; rponN gene, partial cds. BCT 7e-11 0 ...

  17. Argonaute of the archaeon Pyrococcus furiosus is a DNA-guided nuclease that targets cognate DNA

    NARCIS (Netherlands)

    Swarts, D.C.; Hegge, J.W.; Hinojo, Ismael; Shiimori, Masami; Ellis, Michael A.; Dumrongkulraksa, Justin; Terns, Rebecca M.; Terns, Michael P.; Oost, Van Der John

    2015-01-01

    Functions of prokaryotic Argonautes (pAgo) have long remained elusive. Recently, Argonautes of the bacteria Rhodobacter sphaeroides and Thermus thermophilus were demonstrated to be involved in host defense. The Argonaute of the archaeon Pyrococcus furiosus (PfAgo) belongs to a different branch in

  18. On the signaling mechanism and the absence of photoreversibility in the AppA BLUF domain

    NARCIS (Netherlands)

    Toh, K.C.; van Stokkum, I.H.M.; Hendriks, J.; Alexandre, M.T.A.; Arents, J.C.; Avila Perez, M.; van Grondelle, R.; Hellingwerf, K.J.; Kennis, J.T.M.

    2008-01-01

    The flavoprotein AppA from Rhodobacter sphaeroides contains an N-terminal, FAD-binding BLUF photoreceptor domain. Upon illumination, the AppA BLUF domain forms a signaling state that is characterized by red-shifted absorbance by 10 nm, a state known as AppA(RED). We have applied ultrafast spectrosco

  19. Conformational regulation of charge recombination reactions in a photosynthetic bacterial reaction center

    DEFF Research Database (Denmark)

    Katona, Gergely; Snijder, Arjan; Gourdon, Pontus Emanuel;

    2005-01-01

    In bright light the photosynthetic reaction center (RC) of Rhodobacter sphaeroides stabilizes the P(+)(870).Q(-)(A) charge-separated state and thereby minimizes the potentially harmful effects of light saturation. Using X-ray diffraction we report a conformational change that occurs within the cy...

  20. GenBank blastx search result: AK061856 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK061856 001-040-G03 AF018073.1 Rhodobacter sphaeroides operon regulator (smoC), periplasmic sorbitol...-binding protein (smoE), sorbitol/mannitol transport inner membrane protein (smoF), sorbitol.../mannitol transport inner membrane protein (smoG), sorbitol/mannitol transport ATP-binding transport protein (smoK), sorbitol

  1. On the Role of Aromatic Side Chains in the Photoactivation of BLUF Domains

    NARCIS (Netherlands)

    Gauden, M.; Grinstead, J.S.; Laan, W.; Stokkum, I.H.M.; Avila-Perez, M.; Toh, K.C.; Boelens, R.; Kaptein, R.; van Grondelle, R.; Hellingwerf, K.J.; Kennis, J.T.M.

    2007-01-01

    BLUF (blue-light sensing using FAD) domain proteins are a novel group of blue-light sensing receptors found in many microorganisms. The role of the aromatic side chains Y21 and W104, which are in close vicinity to the FAD cofactor in the AppA BLUF domain from Rhodobacter sphaeroides, is investigated

  2. GenBank blastx search result: AK058791 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK058791 001-002-F06 M86823.1 Rhodobacter sphaeroides ORF1, complete cds; nifU gene, complete... cds; nifS gene, complete cds; nifV gene, complete cds; nifW gene, complete cds; rponN gene, partial cds.|BCT BCT 3e-13 +3 ...

  3. GenBank blastx search result: AK059171 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK059171 001-023-F01 M86823.1 Rhodobacter sphaeroides ORF1, complete cds; nifU gene, complete... cds; nifS gene, complete cds; nifV gene, complete cds; nifW gene, complete cds; rponN gene, partial cds.|BCT BCT 2e-66 +3 ...

  4. La prévention des blessures non intentionnelles chez les enfants et adolescents autochtones au Canada

    Science.gov (United States)

    Banerji, Anna

    2012-01-01

    RÉSUMÉ Les blessures non intentionnelles sont la principale cause de décès chez les enfants et adolescents autochtones canadiens, à un taux de trois à quatre fois la moyenne nationale. Non seulement les décès et les blessures invalidantes dévastent les familles et les communautés, mais elles font également d’énormes ravages sur les ressources de santé. L’absence de statistiques, de surveillance continue ou de programmes de prévention des blessures à l’égard des enfants et adolescents autochtones exacerbe les coûts en matière de main-d’œuvre et de santé. Les communautés autochtones sont hétérogènes sur le plan culturel, qu’il s’agisse de l’accès aux ressources ou même des risques et des types de blessures. Pourtant, en général, ces communautés sont beaucoup plus susceptibles d’être pauvres, d’habiter dans un logement insalubre et d’éprouver de la difficulté à accéder aux soins de santé, des facteurs qui accroissent le risque et les conséquences des blessures. Il existe un besoin urgent de surveillance des blessures, de recherche, de renforcement des capacités, de diffusion des connaissances et de programmes de prévention des blessures qui sont axés sur les populations autochtones. Pour prévenir les blessures de manière efficace, il faut adopter des démarches multidisciplinaires, coopératives et durables, fondées sur des pratiques exemplaires, tout en étant spécifiques et sensibles sur le plan culturel et linguistique.

  5. Mécanismes et traitement de l’anémie aiguë chez le brûlé grave

    Science.gov (United States)

    Siah, S.; El Khatib, K.; Messaoudi, N.

    2016-01-01

    Summary Les brûlés graves présentent souvent, au cours de la phase aiguë, des anémies plus au moins profondes pouvant nécessiter des transfusions. L’anémie du brûlé a deux origines principales: le saignement péri-opératoire (des stratégies doivent être mises en place pour le réduire) et l’anémie de réanimation (que l’on peut en partie réduire en évitant les bilans inutiles) chez un patient ayant des troubles de l’hématopoïèse. Le traitement, chez ces patients à l’hématopoïèse altérée, repose sur la transfusion. Celle-ci n’est pas dénuée d’effets secondaires et une stratégie transfusionnelle restrictive doit être appliquée. PMID:28149231

  6. Hypotension artérielle intra dialytique chez un hémodialysé chronique révélatrice d'insuffisance antéhypophysaires

    Science.gov (United States)

    El Maghraoui, Jaouad; Ouahabi, Hanane; Kabbali, Nadia; Arrayhani, Mohamed; Ajdi, Farida; Houssaini, Tariq Sqalli

    2016-01-01

    L'hypotension artérielle per dialytique est une complication fréquente chez l'hémodialysé chronique. Elle est occasionnée par des facteurs liés à la séance d'hémodialyse et/ou au patient. Nous rapportons le cas d'un patient âgé de 42 ans, hémodialysé chronique sur néphropathie lithiasique depuis 5 ans. Il a rapporté des céphalées chroniques atypiques, compliquées d'une baisse progressive de l'acuité visuelle, une asthénie, une hypertrophie mammaire, et une baisse de libido. Il est référé pour une hypotension artérielle per dialytique non expliquée par les causes habituelles, dont la recherche étiologique a objectivé une insuffisance anté hypophysaire et une masse hypophysaire à l'IRM. A travers cette observation, nous montrons qu'après avoir éliminé les causes classiques d'hypotension artérielle chez l'hémodialysé, une cause endocrinienne doit être recherchée. PMID:27642391

  7. Séroprévalence de l’AgHBs chez la femme enceinte dans le centre du Maroc

    Science.gov (United States)

    Sbiti, Mohammed; Khalki, Hanane; Benbella, Imane; louzi, Lhoussaine

    2016-01-01

    La transmission materno-fœtale du virus de l'hépatite B (VHB) est un problème qui préoccupe toujours les autorités sanitaires à travers le monde et suscite la mise en place de mesures préventives renforcées. Le statut réplicatif du virus chez la mère séropositive, évalué par la positivité de l'AgHbe et le taux de la charge virale, conditionne le risque de contamination qui est plus important en période péri-natale. Les mères porteuses chroniques du VHB constituent un véritable réservoir de la transmission verticale de cette infection. Nous avons étudié, à travers cette enquête sur 1120 femmes enceintes Marocaines, la séroprévalence de l'AgHBs qui était de 2,35%, dans le but d'alimenter les données nationales sur ce sujet. Parmi ces femmes séropositives pour l'AgHBs, 79,1% avaient un AgHBe négatif et ont bénéficié d'une recherche moléculaire qui s'est révélée positive dans 89,4% des cas. La vaccination de la femme en âge de procréer est l'un des piliers majeurs de la prévention de la transmission verticale du VHB, seulement 2,4% de nos patientes étaient vaccinées. Ceci relève l'intérêt du dépistage au cours de la grossesse, qui doit se focaliser sur la sensibilisation à la vaccination de femmes séronégatives, et le suivi par biologie moléculaire des mères séropositives dans le but d'instaurer un traitement prophylactique adéquat. PMID:27795784

  8. Les séquelles de brûlures cervicocéphaliques chez l’enfant

    Science.gov (United States)

    Sankale, A.A.; Ndiaye, A.; Ndoye, A.; Ndiaye, L.; Ndoye, M.

    2011-01-01

    Summary La peau, barrière protectrice de l’organisme, est très exposée aux agressions et donc aux brûlures. Le but de ce travail est d’apprécier les particularités des séquelles de brûlure cervicofaciales chez l’enfant en milieu sub-saharien et d’évaluer leur prise en charge. Il s’agit d’une étude rétrospective réalisée dans le service de Chirurgie Pédiatrique du Centre Hospitalo-universitaire Aristide Le Dantec de Dakar (Sénégal). Vingt-sept dossiers de patients ont été colligés entre mai 2001 et avril 2008. L’âge moyen lors de la consultation était de 6,7 ans et le sex ratio m:f de 1,7:1. La topographie des séquelles se répartit ainsi: la face (66,7%), le cou (29,6%) et le cuir chevelu (11,1%). Concernant le type de séquelles, les brides prédominaient (33,3%), suivies des cicatrices chéloïdiennes ou hypertrophiques (25,9%), des ectropions de paupières (18,5%), des alopécies du cuir chevelu (11,1%), des ulcérations chroniques (7,4%) et de dyschromie (3,7%). Le traitement a été chirurgical dans 55,7% des cas: plasties en Z suivies ou non d’une greffe de peau pour les brides et libération de bride suivie d’une greffe pour les ectropions de paupières. Pour ce qui concerne les patients opérés, la morbidité opératoire a été de 20% et la mortalité opératoire nulle. Les cicatrices chéloïdiennes ont fait l’objet d’un traitement médical par infiltrations de dermocorticoïdes. Au-delà de l’urgence, les brûlures cervicofaciales de l’enfant entraînent un préjudice esthétique et fonctionnel important. L’amélioration de leur pronostic passe par la qualité des premiers soins et par la sensibilisation des parents aux risques d’accidents domestiques. PMID:21991239

  9. Pharmacothérapie de la dépression chez les aînés

    Science.gov (United States)

    Frank, Christopher

    2014-01-01

    Résumé Objectif Discuter du traitement pharmacologique de la dépression chez les personnes âgées, y compris le choix des antidépresseurs, le titrage de la dose, la surveillance de la réponse et des effets secondaires et le traitement des cas réfractaires. Sources des données Les lignes directrices de 2006 de la Canadian Coalition for Seniors’ Mental Health sur l’évaluation et le traitement de la dépression ont servi comme source principale. Pour recenser les articles publiés après les lignes directrices, on a procédé à une recherche documentaire dans MEDLINE de 2007 à 2012 à l’aide des expressions en anglais depression, treatment, drug therapy et elderly. Message principal Le but du traitement devrait être la rémission des symptômes. L’amélioration des symptômes peut être surveillée en fonction des objectifs du patient qu’on a identifiés ou en se servant d’outils cliniques comme le Patient Health Questionnaire–9. On devrait envisager le traitement en 3 étapes: l’étape du traitement aigu pour obtenir la rémission des symptômes, une étape de continuation pour prévenir la récurrence d’un même épisode de la maladie (rechute) et une étape de maintien (prophylaxie) pour prévenir de futurs épisodes (récurrence). Le dosage initial devrait être la moitié de la dose de départ habituelle chez l’adulte et il devrait être titré régulièrement jusqu’à ce que le patient réponde, jusqu’à ce que la dose maximale soit atteinte ou encore que les effets secondaires en limitent l’augmentation. Parmi les effets secondaires fréquents, on peut mentionner les chutes, la nausée, les étourdissements, les céphalées et, moins communément, l’hyponatrémie et des changements dans l’intervalle QT. Des stratégies pour changer ou augmenter les antidépresseurs sont présentées. Les patients plus âgés devraient être traités pendant au moins un an à compter de l’observation d’une amélioration clinique et

  10. Prévalence de l'hépatite B chez les personnes infectées par le VIH à Parakou au Bénin

    Science.gov (United States)

    Dovonou, Comlan Albert; Amidou, Salimanou Ariyoh; Kpangon, Amadohoué Arsène; Traoré, Yacoubou Adam; Godjedo, Togbemabou Primous Martial; Satondji, Assongba Joseph; Wachinou, Ablo Prudence; Issa-Djibril, Fatioulaye Mahamadi; Fourn, Léonard; Zannou, Djimon Marcel; Gandaho, Prosper

    2015-01-01

    Introduction La co-infection avec l'hépatite B est l'un des défis majeurs de la prise en charge du VIH depuis l'amélioration de l'accès aux antirétroviraux en Afrique. La présente étude visait à estimer la prévalence de l'hépatite B chez les personnes séropositives au VIH à Parakou et décrire les facteurs associés. Méthodes Il s'agit d'une étude transversale menée de Mai 2011 à Juin 2012 dans le service de Médecine du CHU de Parakou. Ont été inclus tous les adultes séropositifs au VIH vus en consultation ou hospitalisés. Les données ont été collectées par interviews et dépouillement de dossiers médicaux. L'antigène HBs a été recherché par un test rapide et l'ALAT a été dosé. L'analyse des données a été faite avec le logiciel EpiInfo 3.5.1. Les proportions ont été comparées grâce au test de Chi-deux ou au test de Fisher au seuil de significativité de 5%. Un modèle de régression logistique multivariable a permis d'expliquer la prévalence de l'hépatite B. Résultats Sur les 744 sujets inclus on a dénombré 555 femmes. L’âge moyen était de 35,5 + 10,1 ans. La prévalence de l'hépatite B a été estimée à 16,9% (IC95: 14,3%-19,9%). Cette prévalence était plus élevée chez les sujets originaires du Borgou/Alibori et ceux au stade 4 de l'OMS. Conclusion La prévalence de la co-infection VIH/VHB au CHU Parakou est élevée. Le dispositif national de prise en charge et de prévention de l'hépatite B chez les personnes séropositives au VIH doit être renforcé. PMID:26097629

  11. Signes cliniques rencontrés chez l'enfant malnutri dans un milieu minier: cas de la ville de Lubumbashi et ses environs

    Science.gov (United States)

    Musimwa, Aimée Mudekereza; Kanteng, Gray Wakamb; Kitoko, Hermann Tamubango; Luboya, Oscar Numbi

    2016-01-01

    Introduction La malnutrition reste à ce jour un problème majeur de santé publique, notamment dans les pays en voie de développement. Cette étude a eu pour objectif de déterminer les signes cliniques observés chez l'enfant mal nourri, admis dans une unité de prise en charge. Méthodes Il s'agit d'une étude descriptive transversale, effectuée de juillet 2013 à décembre 2014. 311 cas ont été colligés (182 malnutris et 129 biens nourris), par échantillonnage exhaustif, avec un dépistage actif des enfants malnutris et biens nourris. Le diagnostic est fait cliniquement associé à l'anthropométrie. Résultats Les signes les plus enregistrés chez les enfants malnutris étaient dominés par la toux ou pneumopathie dans 42,50%, la gastroentérite dans 38,55%, les lésions dermatologiques ont présenté 22,91% de cas, la fièvre dans 22,35% de cas, 19,0% des enfants ont présenté les œdèmes, 8,38% d'enfants ont présenté la pâleur, enfin hépatomégalie et splénomégalie sont les signes les moins fréquents avec respectivement 1,68% et 2,89%. Tandis que les enfants en bonne état nutritionnel ont présenté plus la splénomégalie et la fièvre qui seraient liés au paludisme. Conclusion Les enfants malnutris vivant dans un milieu minier présentent une symptomatologie qui ne pas différents de autres enfants mal nourris à l'exception de l'hépatomégalie et splénomégalie qui sont très rare chez nos mal nourris. PMID:27642407

  12. Jeux et enjeux d’écriture chez Chrétien de Troyes: l’exemple de «Cligès»

    Directory of Open Access Journals (Sweden)

    Ida Lucia Machado

    2011-10-01

    Full Text Available Neste artigo, nos propomos descrever a estética da trama irônica presente na escritura de Chrétien de Troyes, tomando por base seu romance Cligès. A destacar algumas estratégias passíveis de criar o fenômeno irônico, estaremos também mostrando o poder de sedução que emana desta escritura.Nous nous proposons, dans cet artible, de décrire l’esthétique du jeu ironique chez Chrétien de Troyes, em puisant dans son roman Cligès. Enn dégageant qulques unes dês stratégies susceptibles de créer le phénomène ironique, nous montrerons, à la fois, le pouvoir de séduction qui emane de cette écriture.

  13. La langue européenne nommée Tâlyân chez Evliyâ Çelebi et ailleurs

    OpenAIRE

    Römer, Claudia

    2013-01-01

    Que désigne le terme Tâlyân chez Evliyâ ? Les imprécisions géographiques et historiques nous laissent quelques hésitations, italien, latin, slovène ? Et le Lâtîn désigne-t-il le grec, une langue slave en général, le slavon d’église ou/et le latin ? Ce texte apporte quelques éclaircissements. What does mean the word Tâlyân in Evliyâ? Geographical and historical inaccuracies leave us with a few hesitations, italian, latin, slovenian? And does the word Lâtîn indicate greek, any slavic languag...

  14. Écriture et processus psychomoteurs, cognitifs et conatifs chez les enfants âgés de 8 à 12 ans

    OpenAIRE

    Sage, Isabelle Hélène

    2010-01-01

    Cette recherche étudie les liens qu’entretient l’écriture avec des processus psychomoteurs, cognitifs et conatifs chez les enfants âgés de 8 à 12 ans. Des recherches antérieures ont montré une influence de compétences comme l’équilibre, la coordination oculo-manuelle, le déliement digital, la maturation neurologique, la régulation tonique, les gnosies digitales ou les compétences visuo-spatiales sur l’écriture. Or, ces liens ont été étudiés de façon isolée. C’est pourquoi, cette étude porte u...

  15. Hypotension artérielle intra dialytique chez un hémodialysé chronique révélatrice d'insuffisance antéhypophysaires

    OpenAIRE

    El Maghraoui, Jaouad; Ouahabi, Hanane; Kabbali, Nadia; Arrayhani, Mohamed; Ajdi, Farida; Houssaini, Tariq Sqalli

    2016-01-01

    L'hypotension artérielle per dialytique est une complication fréquente chez l'hémodialysé chronique. Elle est occasionnée par des facteurs liés à la séance d'hémodialyse et/ou au patient. Nous rapportons le cas d'un patient âgé de 42 ans, hémodialysé chronique sur néphropathie lithiasique depuis 5 ans. Il a rapporté des céphalées chroniques atypiques, compliquées d'une baisse progressive de l'acuité visuelle, une asthénie, une hypertrophie mammaire, et une baisse de libido. Il est référé pour...

  16. Evaluation de quelques paramètres de la balance oxydants / antioxydants chez des rats diabétiques recevant de la quercétine

    OpenAIRE

    BESSAOUD, Sarra

    2015-01-01

    L’objectif de notre travail est de déterminer l’effet des polyphénols « la quercétine » au cours du diabète comme étant un antioxydant en évaluant le statut oxydant/antioxydant chez les rats diabétiques traités par la quercétine comparés aux rats diabétiques au niveau du plasma et des organes « le foie et le tissu adipeux ». Nos résultats montrent que le diabète favorise le stress oxydatif, sa présence est marquée par une augmentation des protéines carbonylées, une diminution d...

  17. Synchronisation des chaleurs chez la vache laitière : bilan de l'utilisation du synchro-mate Beta pendant cinq années successives

    OpenAIRE

    de Fontaubert, Yves; Cochaud, Jacques; TERQUI, M.

    1989-01-01

    Une technique de maîtrise de la reproduction chez les bovins, le Syncro-Mate B, a été testée sur un troupeau d’une centaine de vaches laitières durant cinq années afin d’en étudier les effets sur la reproduction et sur la production laitière. La conduite de ce troupeau est caractérisée par l’existence d’une seule période imposée de mise en reproduction du 15 décembre au 1er mars et par l’obligation de réformer systématiquement toutes les femelles non gravides en fin de campagne. La fertilité ...

  18. Héroïsme et conscience de l’échec chez Paco Ignacio Taibo II : le Mexique selon Cosa Fácil, La

    OpenAIRE

    Collado, Michael

    2016-01-01

    « Héroïsme et conscience de l'échec chez Paco Ignacio Taibo II » s'intéresse, grâce à la grille d'identification générique que constitue l'organisation fonctionnelle du roman policier, aux anomalies fondamentales présentes dans l'oeuvre de l'écrivain mexicain Paco Ignacio Taibo II. Si la structure narrative propre au genre est l'illustration de l'indéfectible victoire de la Loi, alors, la décomposition progressive de toute la grammaire fondatrice doit être vue comme l'expression de la défianc...

  19. Prévalence des calcifications vasculaires et facteurs associés chez le patient hémodialysé

    OpenAIRE

    XHIGNESSE, Patricia; Saint-Remy, Annie; Weekers, Laurent; Dubois, Bernard; Krzesinski, Jean-Marie

    2005-01-01

    Les maladies cardiovasculaires constituent la première cause de décès chez les patients dialysés chroniques. Parmi les facteurs impliqués on trouve les anomalies du métabolisme phosphocalcique. Le but de cette étude est de relier l'incidence de nouvelles calcifications et des décès (22%, n=18) avec les paramètres du métabolisme phosphocalcique au travers d'une étude prospective portant sur les années 2003-2004. L'établissement d'un score de calcification vasculaire précoce (dès la prise en...

  20. Etude épidémiologique et histopathologique de la gale sarcoptique et de la teigne chez le dromadaire dans le sud marocain

    OpenAIRE

    Driot, Caroline

    2009-01-01

    Une étude a été menée entre avril et mai 2009 aux abattoirs de trois villes du Sud marocain, dans le but de collecter des données épidémiologiques sur la gale et la teigne du dromadaire et de réaliser des prélèvements cutanés sur des animaux malades, afin d’étudier les schémas histopathologiques de ces dermatoses chez cet animal. Au total, 268 dromadaires ont été examinés, et 98 ont fait l’objet de prélèvements de peau. La gale atteignait en moyenne 12% des animaux abattus, 33% des animaux ab...

  1. Le développement d'une qualité de coordination en EPS chez les élèves du CYT

    OpenAIRE

    Gremaud, Jessica; Favre, Romain; Weber, Serge

    2012-01-01

    La présente recherche porte sur l’enseignement de la qualité de coordination de différenciation en éducation physique et sportive (EPS) chez les élèves du cycle de transition. Elle a été conduite auprès de deux classes de 5ème année (8e année HarmoS). Ce travail propose dans un premier temps une approche théorique sur le déroulement du mouvement et sur la coordination motrice, puis une focalisation plus détaillée sur la qualité de différenciation. Elle présente et précise également le s...

  2. Etat confusionnel aigu chez l'enfant: un phénomène méconnu dans la discipline infirmière

    OpenAIRE

    Blunschi, Florence; Cortellini, Lara; Velo, Maxime; Thévoz, Anne-Laure

    2015-01-01

    Cette revue de littérature s’inscrit dans le cadre de la validation finale de la formationBachelor of Science en soins infirmiers. Nous avons choisis le thème de l’état confusionnel aigu ou délirium chez l’enfant car c’est un phénomène encore méconnu qui peut avoir des conséquences sur la récupération de l’enfant après l’anesthésie. Nous nous sommes donc intéressés au rôle de l’infirmière dans la prévention, la détection et le traitement de cette pathologie.

  3. L’évaluation du risque cardiaque avant l’utilisation de stimulants chez les enfants et les adolescents

    Science.gov (United States)

    Bélanger, SA; Warren, AE; Hamilton, RM; Gray, C; Gow, RM; Sanatani, S; Côté, J-M; Lougheed, J; LeBlanc, J; Martin, S; Miles, B; Mitchell, C; Gorman, DA; Weiss, M; Schachar, R

    2009-01-01

    Les décisions en matière de réglementation et les documents scientifiques au sujet de la prise en charge du trouble de déficit de l’attention avec hyperactivité (TDAH) soulèvent des questions quant à l’innocuité des médicaments et à l’évaluation convenable à effectuer avant le traitement afin de déterminer la pertinence d’une pharmacothérapie. Ce constat est particulièrement vrai en présence de cardiopathies structurelles ou fonctionnelles. Le présent article contient l’analyse des données disponibles, y compris les publications révisées par des pairs, des données tirées du site Web de la Food and Drug Administration des États-Unis au sujet des réactions indésirables déclarées chez des enfants qui prennent des stimulants, ainsi que des données de Santé Canada sur le même problème. Des lignes directrices consensuelles sur l’évaluation pertinente sont proposées d’après l’apport des membres de la Société canadienne de pédiatrie, de la Société canadienne de cardiologie et de l’Académie canadienne de psychiatrie de l’enfant et de l’adolescent, qui possèdent notamment des compétences et des connaissances précises tant dans le secteur du TDAH que de la cardiologie pédiatrique. Le présent document de principes prône une anamnèse et un examen physique détaillés avant la prescription de stimulants et s’attarde sur le dépistage des facteurs de risque de mort subite, mais il ne contient pas de recommandations systématiques de dépistage électrocardiographique ou de consultations avec un spécialiste en cardiologie, à moins que les antécédents ou que l’examen physique ne le justifient. Le document contient un questionnaire pour repérer les enfants potentiellement vulnérables à une mort subite (quel que soit le type de TDAH ou les médicaments utilisés pour le traiter). Même si les recommandations dépendent des meilleures données probantes disponibles, le comité s’entend pour affirmer que

  4. Mourir chez soi

    Science.gov (United States)

    Kiyanda, Brigitte Gagnon; Dechêne, Geneviève; Marchand, Robert

    2015-01-01

    Résumé Objectif Démontrer que des infirmières dédiées en soins palliatifs d’un centre local de services communautaires (CLSC) urbain peuvent garder à domicile jusqu’au décès plus de 50 % de leurs patients en fin de vie et que le suivi médical à domicile est un facteur déterminant du décès à domicile. Type d’étude Analyse du lieu de décès des patients décédés en 2012 et 2013 suivis par les infirmières dédiées (N = 212), en fonction du suivi médical. Contexte Soins palliatifs du CLSC de Verdun, un territoire urbain situé dans le sud-ouest de Montréal. Participants Un total de 212 patients en fin de vie décédés en 2012 et 2013, suivis par 3 infirmières dédiées en soins palliatifs. Principaux paramètres à l’étude Le pourcentage de décès à domicile. Résultats Des 212 patients suivis à domicile par les infirmières en soins palliatifs, 56,6 % sont décédés à domicile, 62,6 % lorsque suivis par des médecins à domicile du CLSC, contre 5,0 % lorsque sans médecin à domicile. Conclusion Le développement des services médicaux à domicile au Québec, couplé à une simple restructuration des services de soins infirmiers des CLSC, permettrait à plus de 50 % des patients en fin de vie à domicile suivis par ces CLSC d’y demeurer jusqu’au décès, le souhait d’une majorité.

  5. On Time chez Dummett

    CERN Document Server

    Butterfield, Jeremy

    2014-01-01

    I discuss three connections between Dummett's writings about time and philosophical aspects of physics. The first connection (Section 2) arises from remarks of Dummett's about the different relations of observation to time and to space. The main point is uncontroversial and applies equally to classical and quantum physics. It concerns the fact that perceptual processing is so rapid, compared with the typical time-scale on which macroscopic objects change their observable properties, that it engenders the idea of a 'common now', spread across space. The other two connections are specific to quantum theory, as interpreted along the lines of Everett. So for these two connections, the physics side is controversial, just as the philosophical side is. In Section 3, I connect the subjective uncertainty before an Everettian 'splitting' of the multiverse to Dummett's suggestion, inspired by McTaggart, that a complete, i.e. indexical-free description of a temporal reality is impossible. And in Section 4, I connect Barb...

  6. Etude comparative de la tomodensitométrie et de l’imagerie par résonance magnétique dans le diagnostic des tumeurs intracrâniennes chez le chien et le chat

    OpenAIRE

    Dangy, Louise

    2012-01-01

    Les techniques d’imagerie médicale modernes sont utilisées dans l’exploration des affections intracrâniennes chez l’homme et se développent en médecine vétérinaire. Malgré des inégalités d’accès dues au manque d’infrastructures et au coût élevé de réalisation de ces examens, la tomodensitométrie et l’imagerie par résonance magnétique (IRM) sont devenues les examens complémentaires de choix lors de troubles neurologiques d’origine centrale intracrânienne chez le chien et le chat. Si la tomoden...

  7. Evaluation du probiotique bactérien Pediococcus acidilactici MA18/5M chez la crevette pénéide Litopenaeus stylirostris en Nouvelle- Calédonie

    OpenAIRE

    Castex, Mathieu

    2009-01-01

    Pediococcus acidilacticii MA18/5M est un probiotique bactérien (BACTOCELL®) qui a démontré son efficacité chez plusieurs espèces d'animaux terrestres et aquatiques. Cette thèse avait pour objectif d'investiguer plus en détails les effets de ce probiotique chez les crevettes pénéides d'élevage. Pour cette étude, nous avons choisi une approche globale replaçant la problématique dans un modèle d'interactions entre trois compartiments : la crevette, sa microflore intestinale et le probiotique. Ap...

  8. Dimorphisme sexuel dans la force de morsure et de préhension chez le microcèbe mignon et héritabilité des caractères

    OpenAIRE

    Thomas, Pauline; Herrel, Anthony; Pouydebat, Emmanuelle; Aujard, Fabienne

    2015-01-01

    Le dimorphisme sexuel est présent dans de nombreux taxa dans le règne animal, notamment chez les mammifères où il est très bien étudié. Ce phénomène a d’abord été perçu comme le résultat direct de la sélection sexuelle et par la suite, d’autres théories ont mis en avant la compétition pour l’accès à la nourriture ou encore la différenciation de niche écologique. Chez la plupart des primates, le dimorphisme sexuel est poussé et bien visible, souvent en relation avec un système social mettant e...

  9. Effet du numéro d'oestrus et du nombre de jours après le vêlage sur la probabilité de conception chez les vaches laitières

    DEFF Research Database (Denmark)

    Friggens, Nic; Labouriau, Rodrigo

    2007-01-01

    Pour résoudre les problèmes actuels de reproduction chez les vaches laitières, une meilleure connaissance des facteurs animaux impliqués dans l'élaboration de la performance est nécessaire. Un intérêt particulier est porté sur l'accroissement du taux de conception qui est observé avec le numéro d...

  10. The role of advocacy coalitions in a project implementation process: the example of the planning phase of the At Home/Chez Soi project dealing with homelessness in Montreal.

    Science.gov (United States)

    Fleury, Marie-Josée; Grenier, Guy; Vallée, Catherine; Hurtubise, Roch; Lévesque, Paul-André

    2014-08-01

    This study analyzed the planning process (summer 2008 to fall 2009) of a Montreal project that offers housing and community follow-up to homeless people with mental disorders, with or without substance abuse disorders. With the help of the Advocacy Coalition Framework (ACF), advocacy groups that were able to navigate a complex intervention implementation process were identified. In all, 25 people involved in the Montreal At Home/Chez Soi project were surveyed through interviews (n=18) and a discussion group (n=7). Participant observations and documentation (minutes and correspondence) were also used for the analysis. The start-up phase of the At Home/Chez may be broken down into three separate periods qualified respectively as "honeymoon;" "clash of cultures;" and "acceptance & commitment". In each of the planning phases of the At Home/Chez Soi project in Montreal, at least two advocacy coalitions were in confrontation about their specific belief systems concerning solutions to address the recurring homelessness social problem, while a third, more moderate one contributed in rallying most key actors under specified secondary aspects. The study confirms the importance of policy brokers in achieving compromises acceptable to all advocacy coalitions.

  11. Présence de trois espèces de grégarines (Apicomplexa : Eugregarinorida chez l’Annélide Polychete Marphysa sanguinea (Montagu, 1815 dans le lac de Tunis

    Directory of Open Access Journals (Sweden)

    Elbarhoumi M.

    2010-03-01

    Full Text Available Trois espèces de grégarines ont été trouvées dans des spécimens de l’annélide polychète Marphysa sanguinea récoltés dans le lac de Tunis : Bhatiella marphysae Setna, 1931, parasite de Marphysa sanguinea (Inde, Europe; Ferraria cornucephala iwamusi H. Hoshide, 1956, parasite de Marphysa iwamusi (Japon ; et Viviera sp. qui présente des similitudes avec Viviera marphysae Schrével, 1963, aussi décrite chez Marphysa sanguinea (France. Ces grégarines sont rapportées pour la première fois chez ce dernier hôte en Tunisie. Bhatiella marphysae et Viviera sp. appartiennent à la famille des Lecudinidae (Aseptatorina. La présence d’un septum proto-deutoméritique est confirmée chez Ferraria cornucephala qui doit être maintenue dans les Polyrhabdinae.

  12. Télémonitorage des grandes fonctions physiologiques chez les primates vigiles Remote monitoring of physiologic functions in monkeys

    Directory of Open Access Journals (Sweden)

    Guy Germain

    2011-02-01

    Full Text Available Les caractéristiques communes à l'étude des primates non-humains sont proches des contraintes que l'on rencontre dans l'application des principes de la télémédecine humaine. Elles découlent de l’éloignement des animaux et de leur dispersion géographique pour les études en milieu naturel, elles découlent aussi du besoin de contrôler au laboratoire les traitements expérimentaux en perturbant le moins possible le comportement social des animaux. Les ondes radio sont un excellent signal de transmission pour le suivi des animaux parce qu'elles peuvent propager des informations rapidement et sur de longues distances dans l'air. Tous les dispositifs télémétriques consistent en un ou plusieurs capteurs couplés à un émetteur encodeur radio et d'un système d'antenne couplé à un récepteur décodeur, analogique ou numérique. Le progrès des télétransmissions résulte par ailleurs de la miniaturisation des dispositifs électroniques d'acquisition et d'émission qui sont de moins en moins gourmands en énergie et acquièrent des durées d'autonomie beaucoup plus grande. De nombreux dispositifs télémétriques très souvent totalement implantables dans le corps de l'animal sont aujourd'hui commercialement disponibles. Ils permettent une surveillance détaillée des paramètres physiologiques des systèmes cardiovasculaire, nerveux, locomoteur, métabolique, respiratoire et reproducteur chez les primates non-humains entièrement libres de leurs mouvements. Ils sont très largement exploités dans les études pharmacologiques et toxicologiques. D'autres dispositifs encore au stade expérimental intègrent également la combinaison de l'enregistrement télémétrique des pressions, biopotentiels musculaires ou nerveux, température, avec des enregistrements audio et vidéo pouvant être eux-mêmes acquis et transmis, partiellement ou en totalité, par télémétrie. Le développement des systèmes futurs sera probablement axé sur les

  13. Des recommandations probantes pour surveiller l’innocuité des antipsychotiques de deuxième génération chez les enfants et les adolescents

    Science.gov (United States)

    Pringsheim, Tamara; Panagiotopoulos, Constadina; Davidson, Jana; Ho, Josephine

    2012-01-01

    HISTORIQUE : Au Canada, l’utilisation d’antipsychotiques, notamment les antipsychotiques de deuxième génération (ADG), a augmenté de façon considérable depuis cinq ans chez les enfants ayant des troubles de santé mentale. Ces médicaments ont le potentiel de causer de graves complications métaboliques et neurologiques lorsqu’on les utilise de manière chronique. OBJECTIF : Synthétiser les données probantes relatives aux effets secondaires métaboliques et neurologiques précis associés à l’usage d’ADG chez les enfants et fournir des recommandations probantes sur la surveillance de ces effets secondaires. MÉTHODOLOGIE : Les auteurs ont procédé à une analyse systématique des essais cliniques contrôlés des ADG auprès d’enfants. Ils ont fait des recommandations à l’égard de la surveillance de l’innocuité des ADG d’après un modèle de classification fondé sur le système GRADE (système de notation de l’évaluation et de l’élaboration des recommandations). Lorsque les données probantes n’étaient pas suffisantes, ils fondaient leurs recommandations sur le consensus et l’avis d’experts. Un groupe consensuel multidisciplinaire a analysé toutes les données probantes pertinentes et est parvenu à un consensus à l’égard des recommandations. RÉSULTATS : Les recommandations probantes portant sur la surveillance de l’innocuité des ADG figurent dans les présentes lignes directrices. Les auteurs indiquent la qualité des recommandations relatives à des examens physiques et tests de laboratoire précis à l’égard de chaque ADG à des moments déterminés. CONCLUSION : De multiples essais aléatoires et contrôlés ont permis d’évaluer l’efficacité de bon nombre des ADG utilisés pour traiter les troubles de santé mentale en pédiatrie. Toutefois, leurs avantages ne sont pas sans risques : on observe à la fois des effets secondaires métaboliques et neurologiques chez les enfants traités au moyen d

  14. Anoplastie périnéale simple pour le traitement des malformations anorectales basses chez l'adulte, à propos de deux cas

    Science.gov (United States)

    Echchaoui, Abdelmoughit; Benyachou, Malika; Hafidi, Jawad; Fathi, Nahed; Mohammadine, Elhamid; ELmazouz, Samir; Gharib, Nour-eddine; Abbassi, Abdellah

    2014-01-01

    Les malformations anorectales chez l'adulte sont des anomalies congénitales rares du tube digestif qui prédominent chez le sexe féminin. Notre étude porte sur deux observations de malformation anorectale basses vues et traitées au stade adulte par les 2 équipes (plasticiens et viscéralistes) à l'Hôpital Avicenne à Rabat. Il s'agit d'un homme de 24 ans avec une dyschésie anale l'autre cas est une femme de 18 ans avec une malformation anovulvaire Les caractéristiques cliniques combinées avec les imageries radiologiques (lavement baryté, et la manométrie anorectale) ont confirmé qu'il s'agit d'une malfomation anorectale basse. Les deux cas sont corrigés par une reconstruction sphinctérienne, réimplantation anale avec anoplastie périnéale. Les suites opératoires étaient simples, pas de souffrance cutanée ou nécrose, avec changement de pansement gras chaque jour. Le résultat fonctionnel (la continence) était favorable pour les 2 patients. La présentation des MAR à l’âge adulte est rare, d’étiologie mal connu, elles apparaissent selon le mode sporadique. Les caractéristiques cliniques, couplées à l'imagerie (lavement baryté, IRM pelvienne), l'endoscopie et la manométrie anorectale, permettent de confirmer le diagnostic et classer ces anomalies en 3 types: basses, intermédiaires, et hautes. Les formes basses sont traités d'emblée par une réimplantation anale et anoplastie périnéale simple tels nos deux cas, elles peuvent être traités dans certains cas par un abaissement anorectale associé à une plastie V-Y permettant ainsi un emplacement anatomique correct de l'anus; alors que les formes hautes ou intermédiaires relèvent d'une chirurgie complexe avec souvent une dérivation digestive transitoire. Contrairement aux autres formes, Les formes basses ont un pronostic fonctionnel favorable. PMID:25667689

  15. Prises de risques chez les jeunes de Bobo Dioulasso: une analyse des facteurs associés à la précocité et au multipartenariat sexuel

    Science.gov (United States)

    Adohinzin, Clétus Come; Meda, Nicolas; Belem, Adrien Marie Gaston; Ouédraogo, Georges Anicet; Sombie, Issiaka; Berthe, Abdramane; Fond-Harmant, Laurence

    2016-01-01

    Introduction Malgré les efforts d'éducation à la santé, les jeunes continuent d'adopter des comportements sexuels à risques, susceptibles d'avoir des répercussions importantes sur leur santé. Cette étude visait à analyser les facteurs associés à la précocité sexuelle et au multipartenariat chez les jeunes de 19-24 ans de Bobo-Dioulasso. Méthodes Il s'agit d'une étude quantitative et transversale. Les données d'enquête ont été recueillies en décembre 2014 à Bobo-Dioulasso (Burkina Faso), auprès de 573 jeunes de 15 à 24 ans. Ces enquêtés ont été sélectionnés par un sondage en grappes à deux degrés. Des facteurs à risques relatifs à la précocité sexuelle et au multipartenariat ont été analysés à l'aide du logiciel Stata IC 13. Le seuil de signification de P<0,05 a été utilisée. Résultats Plus de la moitié des enquêtés (54%) étaient sexuellement actifs dont 14% avant l'âge de 16 ans. Le multipartenariat sexuel avait été observé chez 24% des jeunes sexuellement actifs. Parmi les facteurs déterminants de la précocité sexuelle et du multipartenariat figuraient l'âge, le sexe, le niveau d'étude, et la situation économique des parents. Nos données avaient aussi montré que les rapports sexuels trop précoces étaient associés au multipartenariat sexuel (p<0,005). Conclusion Les actions visant à renforcer les capacités des jeunes à retarder les premiers rapports sexuels et à mieux évaluer les risques seront de toute importance. Les capacités des parents, des enseignants et des prestataires devraient être aussi renforcées pour l'amélioration de la qualité des relations entre eux et les jeunes. PMID:28292094

  16. 草甘膦对可食用蓝藻葛仙米生长和生理的影响%EFFECTS OF ACUTE GLYPHOSATE EXPOSURE ON THE GROWTH AND PHYSIOLOGY OF NOSTOC SPHAEROIDES, AN EDIBLE CYANOBACTERIUM OF PADDY RICE FIELDS

    Institute of Scientific and Technical Information of China (English)

    阮祚禧; Murray T.Brown

    2008-01-01

    The productivity of Nostoc sphaeroides,an edible cyanobacterium found in paddy rice fields has declined in recent years. It may relate to the increased application of agricultural herbicides. To assess the impact of glyphosate exposure(0.15,0.30,0.45 and 0.6 mmol/L Gly acid) ,the effects on colony size,dry biomass accumulation,chlorophyll a fluorescence (Fv/Fm) and chlorophyll a biosynthesis were investigated over an 8d period. All parameters were significantly inhibited in a concentration used and time dependent way. After 2d exposure to 0. 15 mmol/L Gly colonies were approximately 15% smaller than the controls. After 4d exposure,chlorophyll a content and Fv/Fm were affected by the highest concentration used(0.6 mmol/L Gly). By the 8d, chlorophyll biosynthesis and Fv/Fm were significantly inhibited by concentrations greater than 0.15 and 0.3 mmol/L Gly, respectively. The 8d relative growth rates ( RGRs), calculated for dry biomass, were significantly affected by all glyphosate treatments,there was a 60% reduction at 0.15 mmol/L Gly and negative RGRs at higher concentrations indicate a loss of biomass. Exposure to 0. 6 mmol/L Gly was lethal with loss of colony integrity,bleaching of pigments and no photosynthetic activity by 8d. These results are discussed in terms of the mechanisms of toxicity and the potential implications for the long term sustainability of the N. sphaeroides resource.%葛仙米(N.sphaeroides)的产量和产地面积逐年减少,这可能与当地广泛使用除草剂草甘膦有关.为此,本文测定了不同浓度(0.15、0.30、0.45、0.6mmol/L)的草甘膦处理的葛仙米的颗粒大小、干重、叶绿素荧光、叶绿素浓度.所有测量参数与浓度和时间显著相关:0.15mmol/L处理组的颗粒直径较对照组小15%(2d后);叶绿素a浓度和最大量子产率(Fv/Fm)在最高浓度组(0.6mmol/L)4d后开始受到影响;第8天,相对生长速率(以干重计算,大于0.15mmol/L)、光合作用活性(大于0.3mmol

  17. Molecular Regulation of Photosynthetic Carbon Dioxide Fixation in Nonsulfur Purple Bacteria

    Energy Technology Data Exchange (ETDEWEB)

    Tabita, Fred Robert [The Ohio State Univ., Columbus, OH (United States)

    2015-12-01

    The overall objective of this project is to determine the mechanism by which a transcriptional activator protein affects CO2 fixation (cbb) gene expression in nonsulfur purple photosynthetic bacteria, with special emphasis to Rhodobacter sphaeroides and with comparison to Rhodopseudomonas palustris. These studies culminated in several publications which indicated that additional regulators interact with the master regulator CbbR in both R. sphaeroides and R. palustris. In addition, the interactive control of the carbon and nitrogen assimilatory pathways was studied and unique regulatory signals were discovered.

  18. Portage vaginal du streptocoque du groupe B chez la femme enceinte au niveau de la région de Marrakech

    Science.gov (United States)

    Bassir, Ahlam; Dhibou, Hanane; Farah, Majdi; Mohamed, Lharmis; Amal, Addebous; Nabila, Souraa; Abderahim, Aboulfalah; Asmouki, Hamid; Soummani, Abderraouf

    2016-01-01

    Introduction Le streptocoque du groupe B est le principal agent impliqué dans les infections materno-fœtales, les septicémies et les méningites du nouveau-né à terme. L'objectif est de déterminer le taux de portage maternel du streptocoque du groupe B (SGB) à terme. Méthodes Un prélèvement vaginal a été réalisé de manière prospective chez 275 parturientes lors de l'entrée en salle d'accouchement sur une période de 06 mois. Résultats Le taux de portage était de 20,2%. Le portage était variable en fonction de l’âge gestationnel, il constitue 57.5% entre 37 et 38 semaines d'aménorrhée. Aucun des facteurs de risque n'a était statistiquement prédictif du portage maternel du SGB. Conclusion Le dépistage doit être réalisé à partir de 37 semaines d'aménorrhée, et comme le portage est intermittent, un prélèvement négatif ne garantirait pas que le portage soit négatif à l'accouchement. PMID:27222693

  19. What Happens After the Demonstration Phase? The Sustainability of Canada's At Home/Chez Soi Housing First Programs for Homeless Persons with Mental Illness.

    Science.gov (United States)

    Nelson, Geoffrey; Caplan, Rachel; MacLeod, Timothy; Macnaughton, Eric; Cherner, Rebecca; Aubry, Tim; Méthot, Christian; Latimer, Eric; Piat, Myra; Plenert, Erin; McCullough, Scott; Zell, Sarah; Patterson, Michelle; Stergiopoulos, Vicky; Goering, Paula

    2017-03-01

    This research examined the sustainability of Canada's At Home/Chez Soi Housing First (HF) programs for homeless persons with mental illness 2 years after the end of the demonstration phase of a large (more than 2000 participants enrolled), five-site, randomized controlled trial. Qualitative interviews were conducted with 142 participants (key informants, HF staff, and persons with lived experience) to understand sustainability outcomes and factors that influenced those outcomes. Also, a self-report HF fidelity measure was completed for nine HF programs that continued after the demonstration project. A cross-site analysis was performed, using the five sites as case studies. The findings revealed that nine of the 12 HF programs (75%) were sustained, and that seven of the nine programs reported a high level of fidelity (achieving an overall score of 3.5 or higher on a 4-point scale). The sites varied in terms of the level of systems integration and expansion of HF that were achieved. Factors that promoted or impeded sustainability were observed at multiple ecological levels: broad contextual (i.e., dissemination of research evidence, the policy context), community (i.e., partnerships, the presence of HF champions), organizational (i.e., leadership, ongoing training, and technical assistance), and individual (i.e., staff turnover, changes, and capacity). The findings are discussed in terms of the implementation science literature and their implications for how evidence-based programs like HF can be sustained.

  20. Blast pulmonaire primaire chez le brûlé. a propos d’un cas et revue de la littérature

    Science.gov (United States)

    Siah, S.; Emane, A.; Bertin-Maghit, M.

    2016-01-01

    Summary Le blast est à l’origine de lésions spécifiques pour lesquelles une prise en charge spécialisée est nécessaire. Après une explosion on peut observer des lésions de blast primaire, liées à l’onde de choc, secondaire par polycriblage et tertiaire par projection du patient. Les blasts secondaire et tertiaire sont plus fréquents que le blast primaire et peuvent entraîner un polytraumatisme. Dans 5% des cas, on retrouve des brûlures pouvant faire partie du blast quaternaire, qui regroupe toutes les lésions d’autres mécanismes que ceux précités. La prise en charge des lésions secondaires et tertiaires de blast est comparable à celle des traumatisés graves. Le blast pulmonaire primaire aggrave le pronostic des blessés les plus graves mais impose rarement une prise en charge spécifique. La connaissance des particularités physiopathologiques et lésionnelles permet de mieux traiter les blastés et brûlés graves survivants. Nous rapportons une observation de blast pulmonaire primaire chez un brûlé. PMID:28149247

  1. Recovery and radio-resistance in mice after external irradiation; Restauration et radio-resistance chez la souris apres irradiation externe

    Energy Technology Data Exchange (ETDEWEB)

    Le Guillou, S. [Commissariat a l' Energie Atomique, Fontenay-aux-Roses (France). Centre d' Etudes Nucleaires

    1965-07-01

    The author presents a literature study concerning recovery from external irradiation and an analysis of experimental data (which appear to suggest the idea of a radio-resistance in animals), as well as the hypotheses put forward for explaining this phenomenon. The author then describes an experiment carried out on mice whose LD 50/30 days increased from 1005 to 1380 rads and for which it was shown that an increase occurs in the number of certain anti-bodies circulating after a low dose of {gamma} irradiation. (author) [French] L'auteur presente une etude bibliographique de la restauration apres irradiation externe et une analyse des donnees experimentales qui paraissent suggerer la notion de radioresistance chez les animaux ainsi que les hypotheses cherchant a expliquer ce phenomene. Il relate ensuite une experience realisee sur des souris dont la DL 50/30 jours est passee de 1005 a 1380 rads et dans laquelle est montree l'augmentation de certains anticorps circulant apres une faible dose d'irradiation gamma. (auteur)

  2. SOLUTIONS AUX PROBLEMES DE L'INTERFERENCE LINGUISTIQUE CHEZ L'APPRENANT YORUBA PHONE DE LA LANGUE FRANCAISE AU NIGERIA.E

    Directory of Open Access Journals (Sweden)

    Alaje Oyebola Olubunmi

    2014-06-01

    Full Text Available Le transfert interlingual d'une langue a l'autre qui soit volontaire soit involontaire est un changement de la norme d'une langue. Une langue n'a jamais enseigne a travers un simple contenu linguistique. L'enseignement des langues s'opere toujours dans un contexte de contacts entre plusieurs culturees parce que toute langue vehicule a avec elle une culture dont elle est a la fois productrice et le produit. En principe, l'apprenant nigerian possede des multiples systemes linguistiques dont laquelle la connaissance qu'il a de ces systemes peut etre variable. L'interference de la connaissance anterieure des autres langues pose un grand probleme a l'etude du francais chez les apprenants nigerians. Ce travail est destine a mettre en evidence du point-de-vue de la linguistique, certaines de ces fautes d'une part et a suggerer quelques mesures qui permettront de les resoudre d'autre part afin de contribuer a faire progresser l'enseignement et l'apprentissage du francais au Nigeria. Il est motive par le souci d'identifier et d'exposer les sources des problemes d'interference des apprenants qui apprennent la langue francaise a l'ecole secondaire jusqu'a l'universite ou les raisons pour laquelle les apprenants rencontrent ces problemes de l'interference.

  3. Gibbosité vertébrale congénitale évoquant un mal de Pott chez un nouveau-né de mère tuberculeuse: à propos d'un cas et revue de la literature

    Science.gov (United States)

    Katamea, Tina; Mukuku, Olivier; Luboya, Oscar Numbi

    2014-01-01

    Les formes latentes de tuberculose chez la femme enceinte sont associées à un risque élevé de passage à une forme active qui augmente le risque de transmission de la mère infectée à l'enfant dans les 3 premières semaines de vie. Nous rapportons un cas de Gibbosité vertébrale congénitale évoquant un mal de Pott chez un nourrisson de mère tuberculeuse, observé à Lubumbashi, en République Démocratique du Congo. PMID:25478046

  4. Clinical and symptomatological study of pigs subjected to a lethal dose of integral gamma irradiation; Etude clinique et symptomatologique chez le porc soumis a une irradiation gamma totale a dose letale

    Energy Technology Data Exchange (ETDEWEB)

    Vaiman, M.; Guenet, J.-L.; Maas, J.; Nizza, P

    1966-05-01

    Results are reported from a clinical and haematological study on a Corsican species of pigs wholly exposed to an approximately lethal dose of {gamma} radiation. The aim of this work was to examine the changes in the irradiation syndrome of irradiation for pigs to make it thus possible to devise further experiments, in particular in the therapeutic field. The dose received was 285 rads (measured as the absorption in the vertical antero-posterior medial plane). Data are presented on cyto-haematological changes in the blood circulating immediately after irradiation, and followed up to death, and changes in the medullary cytology after irradiation. The clinical picture of lethal radiation injury in swine is described. (authors) [French] Les auteurs rapportent les resultats d'une etude clinique et hematologique chez des porcs de race corse irradies in toto a dose sensiblement letale. Le but de cette etude etait de connaitre l'evolution du syndrome aigu d'irradiation chez le porc et de permettre ainsi le developpement d'experimentations ulterieures, en particulier dans le domaine therapeutique. La dose delivree etait de 285 rad (en dose absorbee au niveau du plan median vertical anteroposterieur. L'etude a porte essentiellement: 1. Sur les modifications cyclo-hematologiques du sang circulant immediatement apres l'irradiation, pour les differentes lignees cellulaires; l'evolution de ces modifications a ete notee jusqu'a la mort; 2. Sur les modifications de la cytologie medullaire apres irradiation (evolution du myelogramme et essai d'evaluation de la cellularite de la moelle osseuse);: 3. Sur les signes cliniques, d'ailleurs tres discrets, observes chez les porcs apres irradiation. (auteurs)

  5. Efficacité des moyens de traitement physiothérapeutiques pour l'équilibre assis dynamique chez les patients souffrant d'une lésion médullaire

    OpenAIRE

    Laurent, Ailsa; Morel, Florence; Currat, Damien

    2014-01-01

    Introduction : afin d’acquérir et de maintenir leur autonomie, les patients souffrant de lésion médullaire doivent améliorer leur équilibre assis, pré requis pour réaliser les Activités de la Vie Quotidienne. Notre objectif est de déterminer quels sont les moyens physiothérapeutiques à disposition pour travailler l’équilibre assis dynamique chez cette population et quelles sont leurs preuves d’efficacité selon le stade de réadaptation (aigu/chronique). Méthodologie : nous avons inclus des étu...

  6. Impact d'une supplémentation en spiruline chez des enfants malnutris sévères dans le cadre de la réhabilitation nutritionnelle. Essai clinique randomisé en double aveugle

    OpenAIRE

    Doudou Halidou, Maïmouna

    2008-01-01

    Introduction Près de 842 millions de personnes dans le monde sont toujours sous- alimentées ou exposées à une insécurité alimentaire chronique. Or une consommation insuffisante en protéines et en calories, ainsi que les carences en micronutriments ont un impact majeur sur la morbidité et la mortalité, en particulier chez les enfants. On estime qu’entre 2000 et 2005 le nombre d’enfants présentant une insuffisance pondérale a augmenté dans la plupart des régions d’Afrique sub saharienne, alo...

  7. Impact d'une supplémentation en spiruline chez les enfants malnutris sévères dans le cadre de la réhabilitation nutritionnelle: esai clinique randomisé en double aveugle

    OpenAIRE

    Doudou Halidou, Maïmouna

    2008-01-01

    IntroductionPrès de 842 millions de personnes dans le monde sont toujours sous- alimentées ou exposées à une insécurité alimentaire chronique. Or une consommation insuffisante en protéines et en calories, ainsi que les carences en micronutriments ont un impact majeur sur la morbidité et la mortalité, en particulier chez les enfants. On estime qu’entre 2000 et 2005 le nombre d’enfants présentant une insuffisance pondérale a augmenté dans la plupart des régions d’Afrique sub saharienne, alors q...

  8. La prise en charge de la douleur chronique chez les personnes âgées par les interventions infirmières de confort: massage, musicothérapie et imagerie guidée

    OpenAIRE

    Qaderdan, Wazhma; Torny, Cindy; Gueniat, Christophe

    2015-01-01

    Problématique : La douleur chronique est un problème bien réel chez les personnes âgées. Elle affecte les dimensions physiologique, psychique, sociale et spirituelle ainsi qu’engendre de nombreuses conséquences sur la qualité de vie. Les polypathologies affectant cette population, l’amène à la prise de nombreux médicaments, ce qui engendre entre autre, divers effets secondaires. But : L’objectif de ce travail est d’évaluer l’efficacité des interventions non-pharmacologiques que peuvent utilis...

  9. Incidence des accidents vasculaires cérébraux chez les patients VIH positifs sous traitement antirétroviral au long court

    Science.gov (United States)

    Mapoure, Yacouba Njankouo; Nkongni, Ines Nepetsoun; Luma, Henry Namme; Ngahane, Bertrand Hugo Mbtachou; Barla, Esther; Ngwane, Samuel; Mouelle, Albert Soné; Njamnshi, Alfred Kongnyu

    2016-01-01

    Introduction Avec l'introduction de la trithérapie dans les années 1996, la morbidité et la mortalité liées à l'infection par le VIH a nettement diminué. Concomitamment avec ce succès clinique, plusieurs changements métaboliques incluant diabète, hypertension artérielle, dyslipidémie et lipodystrophie ont été observés, ceux-ci étant des pourvoyeurs d'accidents vasculaires cérébraux. L'objectif de ce travail était de déterminer l'incidence des accidents vasculaires cérébraux chez les patients VIH positifs sous traitement antirétroviral au long court. Méthodes Il s'agissait d'une étude de cohorte rétrospective, menée dans le Centre de Traitement Agrée de l'Hôpital Général de Douala (HGD), avec un recueil des données sur 10 ans allant de Mai 2001 à avril 2010, portant sur les patients VIH positifs adultes sous traitement antirétroviral depuis au moins 6 mois. Les patients étaient suivis selon le protocole national de prise en charge du Cameroun. La survenue d'un AVC a été déterminée par la méthode Kaplan-Meyer tandis que les facteurs associés à la survenue d'un AVC ont été recherché par le test de Khi-2. Le seuil de signification statistique était fixé à 0,05. Résultats 307 patients étaient inclus dont 62,4% de sexe féminin, et l’âge moyen était de 40,1 ± 9,9 ans. L'incidence des AVC était de 1,7% sur 72 mois de suivi sans différence significative entre les femmes et les hommes (P= 0,76). Le taux d'incidence calculé était de 0,3 pour 100 personnes années. Dans 85,7% des cas il s'agissait d'un AVC ischémique. Le délai moyen de survenue d'un AVC était de 33,4 mois. Les facteurs associés à la survenue d'un AVC étaient: les patients ayant initié leur traitement au stade III et IV de l'OMS et le taux de CD4 > 100/mm3 à l'initiation du traitement antirétroviral. Conclusion L'incidence des AVC chez les patients VIH positifs sous traitement antirétroviral est similaire à celle rapportée ant

  10. Rôle de la morphologie chez les enfants dyslexiques : étude des effets d'un entraînement morphologique

    Directory of Open Access Journals (Sweden)

    Bogliotti Caroline

    2012-07-01

    Full Text Available Depuis les années 70, la majorité des travaux conduits sur l’apprentissage de la lecture dans un système alphabétique tel que celui utilisé par le français, ont mis en évidence la contribution majeure des habiletés phonologiques à cet apprentissage. La recherche a montré également que les dyslexiques (DL manifestent des difficultés importantes à identifier et traiter les unités non signifiantes (les graphèmes renvoyant aux sons du langage (les phonèmes. En revanche, le traitement des unités de sens tels que mots et morphèmes semble préservé. Des chercheurs ont alors émis l’hypothèse selon laquelle, les DL auraient mis en place une stratégie de lecture compensatoire qui utiliserait une unité formelle codant non pas le son mais le sens dénommé morphème (la plus petite unité de sens véhiculée par la langue. Ainsi, le développement de la conscience morphologique, c’est à dire la conscience de la structure morphémique des mots, et la capacité à manipuler cette structure, seraient préservées chez les enfants DL. Le repérage des unités morphémiques constituerait donc une aide non négligeable pour ces enfants. Dans notre recherche, nous avons étudié les effets d’un entraînement morphologique oral et écrit chez des enfants dyslexiques âgés de 10 à 14 ans, suivis individuellement pendant 20 semaines. Nous avons comparé le décodage de ces enfants à celui d’un groupe contrôle d’enfants dyslexiques, apparié en âge chronologique et en âge lexique mais n’ayant pas bénéficié de l’entraînement. Certaines catégories de mots sont apparues plus sensibles à l’entraînement (ex : diminution de 62 % des temps de latence pour les mots pseudo-préfixés. Les enfants suivis, qui avaient un retard de lecture important (en moyenne 35 mois, ont pu bénéficier de l’entraînement. Une amélioration significative du décodage (gain de 9 mois en âge lexique, et des progrès en conscience

  11. Prise en charge péri opératoire des urgences chirurgicales abdominales chez l’adulte au CHU Aristide Le Dantec

    Science.gov (United States)

    Gaye, Ibrahima; Leye, Pape Alassane; Traoré, Mamadou Mour; Ndiaye, Pape Ibrahima; Ba, El Hadji Boubacar; Bah, Mamadou Diawo; Fall, Mouhamed Lamine; Diouf, Elisabeth

    2016-01-01

    La prise en charge périopératoire des urgences chirurgicales abdominales reste une préoccupation majeure des anesthésistes du fait des désordres hémodynamiques et/ou métaboliques souvent présents en préopératoire; mais également des complications postopératoires auxquelles elles sont exposées. Les objectifs de ce travail étaient d'étudier les aspects épidémiologiques, diagnostiques, thérapeutiques et pronostiques des urgences abdominales. Etude rétrospective descriptive sur une période de 6 mois portant sur les patients âgés de plus de 16 ans opérés d'une urgence abdominale à l'hôpital Aristide Le Dantec. Les paramètres étudiés portaient sur les aspects épidémiologiques, diagnostiques, thérapeutiques et pronostiques des urgences chirurgicales abdominales. Nous avions colligé 161 cas, près de 20% de l'activité du service. L'âge moyen était de 41 ans [16, 80 ans]. Le sex ratio était de 2, 9. Le délai moyen de consultation était de 4,6 jours. Les péritonites étaient les pathologies les plus fréquentes (25,5%). La fréquence cardiaque moyenne des patients était de 92 bpm (battements/min)et 97 bpm pour ceux ayant eu une préparation hémodynamique préopératoire. La moyenne de la PAM était de 9,66 cmhg et 8,61 cmhg chez les patients préparés. 49,1% des patients étaient de la classe ASA1, 39,9% ASA2, 8,7% ASA3, 2,5% ASA4 et 0,6% ASA5. Une antibioprophylaxie était faite chez 46,30% des patients et 53,41% d'entre eux avaient eu une antibiothérapie.95,6% des patients avaient eu une anesthésie générale et 4,4% une rachianesthésie. La fréquence des incidents peropératoires était de 11,08%. La morbidité était de 4,3% et la mortalité 4,96%. La prise en charge des urgences chirurgicales abdominales doit être multidisciplinaire impliquant anesthésistes, chirurgiens et biologistes afin de réduire davantage le taux de morbimortalité qui reste de nos jours non négligeable. PMID:27795787

  12. Recherches sur le psychodiagnostic de Rorschach chez 110 enfants impubères (6 à 15 ans atteints de troubles névrotiques divers

    Directory of Open Access Journals (Sweden)

    M. Schachter

    1951-03-01

    Full Text Available Nous nous sommes propôs's d'étudier à la lumière du Rorschach, 110 enfants impubères atteints de troubles névrotiques divers. II s'agit de su-jets énurétiques (70 cas, de masturbateurs, instables, psycho-moleurs, colé-reux, mythomanes, fugueurs ou voleurs, onychophages ; en somme, ce soni "des petits caractériels". Ajoutons, toutefois, que nous avons éliniiné soigneu-sement les débiles mentaux proprement dits. Nous avons calcule les divers facteurs du test, aussi bien les moyennes arithmétiques que les médianes et les dispersions porcentuelles, toutes les fois que les matériaux étaient. suffisamment importantes. Nous donnons, ici, seulement les valeurs médianes, les plus utiles pour la recherche psychologique-statistique: a nombre des réponses, 22; b nombre des interpretations globales (G, 3,5; c nombre des interpretations de detail (D, 14,7; d nombre des interpretations de petits details (Dd, 2,5; e nombre des interpretations de details intermaculaires (DB1, 0,5; f nombre des details inhibitifs (Do, 0; g les "types de perceptions" (Erfassungtypus les plus couramment notes sont G-D-Dd (33,63% et G-D-Dd-Db1 (26,36%; le G pur est absent; le G-D-Dd est le plus rarement note (1,81% ; h la mediane des +F% est de 66, soit une valeur normale ou, du moins, supraliminale; i nombre des interpretations kines-thésiques (K, 0,5; j nombre des interpretations couleur-pure (C, 0; k nombre des interpretations couleur-forme (CF, 0,7; 1 nombre des interpretations forme-couleur (FC, 2,1; m la formule de reaction (Erlebnistypus ou experience balance la plus significative (en valeurs médianes est du type 0,5/2,8, montrant pratiquement une extra-tensivité nette. En fait, cette formule nous l'avons notée chez 66,36% de nos 110 enfants. La formule la plus rare est celle de l'ambiéqualité (4,54%; n le nombre des interpretations Clob n'a été calculé, car le materiel est faible. Ces réponses sont données par seulement 6 enfants (5,44% des su

  13. Circadian long call distribution in wild orangutans Distribution circadienne des cris longs (long calls chez l’orang-outan en milieu naturel

    Directory of Open Access Journals (Sweden)

    Thomas Geissmann

    2009-10-01

    Full Text Available We present first data on circadian long call distribution of wild orangutans in Northwest Borneo. Data were collected during two months in Batang Ai National Park. A total of 151 male long calls were heard, exhibiting a bimodal distribution pattern with peaks at 05:00-06:00 hours and 18:00-19:00 hours. An earlier study found pronounced differences between the calling rates of Bornean orangutans, which showed an almost unimodal call distribution with its peak at mid-morning, and those of Sumatran orangutans, which showed a bimodal call distribution with a distinct calling peak at predawn and a more moderate peak near dusk (MacKinnon 1974. Our findings from Batang Ai resemble more closely the pattern reported for Sumatra than those reported for other Bornean localities and, therefore, contradict earlier reports suggesting a Sumatra-Borneo dichotomy in orangutan call distribution. In addition, orangutans in Batang Ai were heard to regularly emit long calls throughout the night. This behaviour is unusual for a diurnal species.Nous présentons les premières données sur la distribution circadienne des cris longs (long calls chez les mâles orangs-outans vivant en milieu naturel au nord-ouest de Bornéo. Les données ont été récoltées lors d’une étude de terrain de deux mois au Parc National de Batang Ai. Les 151 cris longs entendus montraient une distribution bimodale, caractérisée par des pics à 05:00-06:00 et 18:00-19:00 heures. Une étude précédente avait révélé des différences profondes entre les taux de cris longs des orangs-outans de Bornéo et de Sumatra. Alors que la distribution des cris longs à Bornéo était presque unimodale et montrait un pic en milieu d’avant-midi, la distribution à Sumatra était bimodale et montrait un pic distinct avant l’aube et un second pic plus modéré au crépuscule (MacKinnon 1974. Nos résultats à Batang Ai ressemblent davantage au schéma rapporté précédemment à Sumatra qu

  14. Neandertal mobility and large-game hunting: the exploitation of reindeer during the Quina Mousterian at Chez-Pinaud Jonzac (Charente-Maritime, France).

    Science.gov (United States)

    Niven, Laura; Steele, Teresa E; Rendu, William; Mallye, Jean-Baptiste; McPherron, Shannon P; Soressi, Marie; Jaubert, Jacques; Hublin, Jean-Jacques

    2012-10-01

    Neandertals were effective hunters of large ungulates throughout their geographic and temporal ranges. Equipped with this knowledge, researchers in paleoanthropology continue to seek insight on the relationships between hunting and subsistence strategies with other components of the Neandertals' niche, such as mobility, site use, and lithic technology. The Quina Mousterian deposits from the rockshelter site of Chez Pinaud Jonzac (Charente-Maritime, France; hereafter Jonzac) offer an excellent opportunity to pursue these issues. This paper focuses on the extensive and well-preserved skeletal remains of reindeer (Rangifer tarandus) recovered from recent excavations of the site, representing at least 18 individuals that were hunted by Neandertals during the fall through winter. Our zooarchaeological results indicate that all ages of reindeer were hunted but adult individuals predominate. No bias is evident in the comparable frequencies of males and females. These prey were butchered on-site, with abundant evidence of meat filleting and marrow exploitation. In the excavated sample, the absence of hearths and the almost complete lack of burned bones or stones suggest that Neandertals were not using fire to assist with processing the reindeer carcasses. The zooarchaeological results presented here indicate that reindeer were hunted during a restricted window of time when they were seasonally abundant in the local area near Jonzac. Taken together with the lithic industry based on bifacial elements, the evidence is consistent with a pattern of site use by highly mobile hunter-gatherers making frequent, short-term visits. Ongoing research at Jonzac and other Quina Mousterian localities will contribute to a better understanding of Neandertal behavior during cold climate phases.

  15. INFLUENCE DE LA DIMENSION DES PLANTS-MERES SUR LE RENDEMENT FINAL ET CELUI DES DIFFERENTS CALIBRES CHEZ QUATRE VARIETES DE POMME DE TERRE (SOLANUM-TUBEROSUM L.

    Directory of Open Access Journals (Sweden)

    R BENNIOU

    2001-12-01

    Full Text Available Le calibre de plantation est un paramètre qui conditionne d’une manière importante la production et la dimension des tubercules-fils de la pomme de terre. A travers notre étude menée sur deux années (1991/92 et 1993/94, nous avons cherché à mettre en relief l’effet du calibre de plantation sur le rendement et la répartition de la production par classe des tubercules selon leur diamètre. Dans ce contexte, nous avons combiné les effets du calibre de plantation à trois niveaux (45/55, 35/45 et 28/35 chez quatre variétés (Desirée, Diamant, Nicola et Chieftain, dans les conditions agro-climatiques de la région de Sétif. Les résultats obtenus montrent que le calibre de plantation a un effet favorable sur le rendement final et sur le répartition des tubercules- fils. Le calibre (28/35 a tendance à produire des gros tubercules (> 55 mm, fraction destinée à la consommation. Par contre, les calibres (45/55 et (35/45 ont tendance à produire des moyens et petits tubercules (< 45 mm; cette fraction est destinée, d’une manière générale, à la semence, à l’exception des petits tubercules inférieurs à 28 mm, qui sont appréciés également à la consommation. De ce fait, le calibre de plantation pourrait être un moyen de contrôle de rendement et de la qualité physique des tubercules-fils, à savoir sa grosseur.

  16. Mapping lipid and detergent molecules at the surface of membrane proteins.

    Science.gov (United States)

    Cogdell, Richard J; Gardiner, Alastair T; Roszak, Aleksander W; Stončius, Sigitas; Kočovský, Pavel; Isaacs, Neil W

    2011-06-01

    Electron-density maps for the crystal structures of membrane proteins often show features suggesting binding of lipids and/or detergent molecules on the hydrophobic surface, but usually it is difficult to identify the bound molecules. In our studies, heavy-atom-labelled phospholipids and detergents have been used to unequivocally identify these binding sites at the surfaces of test membrane proteins, the reaction centres from Rhodobacter sphaeroides and Blastochloris viridis. The generality of this method is discussed in the present article.

  17. Prediction and Biochemical Demonstration of a Catabolic Pathway for the Osmoprotectant Proline Betaine

    OpenAIRE

    Kumar, Ritesh; Zhao, Suwen; Vetting, Matthew W.; Wood, B. McKay; Sakai, Ayano; Cho, Kyuil; Solbiati, José; Steven C Almo; Jonathan V Sweedler; Matthew P Jacobson; Gerlt, John A.; Cronan, John E.

    2014-01-01

    ABSTRACT Through the use of genetic, enzymatic, metabolomic, and structural analyses, we have discovered the catabolic pathway for proline betaine, an osmoprotectant, in Paracoccus denitrificans and Rhodobacter sphaeroides. Genetic and enzymatic analyses showed that several of the key enzymes of the hydroxyproline betaine degradation pathway also function in proline betaine degradation. Metabolomic analyses detected each of the metabolic intermediates of the pathway. The proline betaine catab...

  18. GenBank blastx search result: AK243680 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK243680 J100090I20 AF018073.1 AF018073 Rhodobacter sphaeroides operon regulator (smoC), periplasmic sorbito...l-binding protein (smoE), sorbitol/mannitol transport inner membrane protein (smoF), sorbitol.../mannitol transport inner membrane protein (smoG), sorbitol/mannitol transport ATP-binding transport protein (smoK), sorbit...ol dehydrogenase (smoS), mannitol dehydrogenase (mtlK),

  19. GenBank blastx search result: AK240874 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK240874 J065025K09 AF018073.1 AF018073 Rhodobacter sphaeroides operon regulator (smoC), periplasmic sorbito...l-binding protein (smoE), sorbitol/mannitol transport inner membrane protein (smoF), sorbitol.../mannitol transport inner membrane protein (smoG), sorbitol/mannitol transport ATP-binding transport protein (smoK), sorbit...ol dehydrogenase (smoS), mannitol dehydrogenase (mtlK),

  20. GenBank blastx search result: AK241729 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK241729 J065199L10 AF018073.1 AF018073 Rhodobacter sphaeroides operon regulator (smoC), periplasmic sorbito...l-binding protein (smoE), sorbitol/mannitol transport inner membrane protein (smoF), sorbitol.../mannitol transport inner membrane protein (smoG), sorbitol/mannitol transport ATP-binding transport protein (smoK), sorbit...ol dehydrogenase (smoS), mannitol dehydrogenase (mtlK),

  1. Effets du conditionnement en jours longs à la fin du cycle reproducteur sur la période d'ovulation et sur les sécrétions gonadotropes chez l'omble chevalier (Salvelinus alpinus

    Directory of Open Access Journals (Sweden)

    GILLET C.

    1998-07-01

    Full Text Available Les ombles chevaliers originaires du Léman se reproduisent à la fin de l'automne. En élevage, il est intéressant de retarder de quelques mois la période des ovulations car ce poisson a besoin d'une température inférieure à 6°C pendant l'ovulation. Il est plus facile de fournir une eau à cette température aux géniteurs retardés qui ovulent en hiver qu'à ceux qui ovulent naturellement en automne. Le conditionnement des ombles chevaliers en jours longs (17L-7N pendant l'automne permet de retarder de plusieurs mois la période des ovulations. Cette méthode a l'inconvénient de provoquer un étalement des ovulations sur plus de 3 mois. Le reconditionnement des géniteurs en jours courts en décembre supprime ce problème. L'efficacité du traitement en jours longs ne semble pas dépendre de la durée de son application pourvu que celle-ci dépasse 1,5 mois. Chez les femelles conditionnées en jours longs en automne et en hiver, les concentrations en gonadotropine plasmatique (GTH II sont très faibles. Le niveau de la GTH II plasmatique augmente trois semaines après un transfert en jours courts en janvier. Les concentrations de la GTH II plasmatique au cours de l'ovulation sont significativement plus faibles chez les femelles conditionnées en jours longs en janvier que chez les animaux reconditionnés en jours courts. A ce stade du cycle reproducteur, la GTH I plasmatique reste toujours à un niveau très faible, quel que soit le régime photopériodique. La pose d'implant de mélatonine chez les poissons ne modifie pas les sécrétions gonadotropes en jours longs comme en jours courts. La réceptivité hypophysaire des femelles à une stimulation de la sécrétion gonadotrope par une injection de GnRH n'est pas modifiée par le conditionnement des poissons en jours longs. Aucun effet du pimozide sur la sécrétion de la GTH II n'a pu être mis en évidence chez les géniteurs conditionnés en jours longs. Ces résultats permettent

  2. L'obésité en consultation cardiologique à Lomé: prévalence et facteurs de risque cardio-vasculaire associés - étude chez 1200 patients

    Science.gov (United States)

    Pessinaba, Soulemane; Yayehd, Komlavi; Pio, Machiude; Baragou, Réné; Afassinou, Yaovi; Tchérou, Tchaa; Damorou, Findibé

    2012-01-01

    Introduction Introduction: Les objectifs de ce travail étaient de déterminer la fréquence de l'obésité et celle des autres facteurs de risque cardio-vasculaire chez ces patients obèses à Lomé (Togo). Méthodes Il s'est agi d'une étude multicentrique transversale de prévalence. Elle s'est déroulée du 05 septembre 2005 au 04 mars 2006 et a porté sur les malades vus en consultation externe dans 3 services de cardiologie de la commune de Lomé. Ont été inclus dans cette étude les malades ayant un surpoids selon les normes de l'OMS. Résultats Parmi 1200 patients vus en consultations, 779 (64,92%) avaient une surcharge pondérale. L’âge moyen était de 49,53 ± 17,24 ans. L'obésité était plus fréquente chez les femmes (79,49%) que chez les hommes (20,51%). Un antécédent d'obésité familiale (61,8%) était le principal facteur favorisant. Les autres facteurs de risque cardio-vasculaire retrouvés étaient: sédentarité (82% vs50% chez les non obèses), hypertension artérielle (54,8% vs 39,2%), alcool (50,9% vs 43,9%), dyslipidémie (34,5% vs 20%), diabète (30,9% vs 10,7%) et tabac (14,1% vs 20,3%). La différence était statistiquement significative entre les deux groupes. Les principales complications cardiovasculaires observées chez les obèses étaient: l'ischémie myocardique (26,7%), l'hypertrophie ventriculaire gauche (46,4%), la dilatation cavitaire cardiaque (30,1%) et les accidents vasculaires cérébraux (7,1%). Conclusion L'obésité est un problème de santé publique au Togo. Sa prévalence est très élevée et elle est le plus souvent associée aux autres facteurs de risque cardio-vasculaire. Des mesures préventives doivent être mises en jeu pour lutter contre ce facteur de risque. Mots clés: Obésité, prévalence, facteurs de risque. PMID:23133699

  3. Diagnostic moléculaire du Cytomégalovirus (CMV), de l’herpès virus humain de type 6 (HHV6) et d’Epstein-Barr virus (EBV) par PCR en temps réel chez les femmes enceintes VIH séropositives et séronégatives à Ouagadougou, Burkina Faso

    Science.gov (United States)

    Ouedraogo, Alice Rogomenoma; Kabre, Madeleine; Bisseye, Cyrille; Zohoncon, Théodora Mahoukèdè; Asshi, Maleki; Soubeiga, Serge Théophile; Diarra, Birama; Traore, Lassina; Djigma, Florencia Wendkuuni; Ouermi, Djénéba; Pietra, Virginio; Barro, Nicolas; Simpore, Jacques

    2016-01-01

    Introduction Les herpès virus EBV, CMV et HHV-6 sont des virus qui évoluent sous le modèle pandémique et sont responsables d’infections congénitales pouvant provoquer des séquelles graves chez les nouveau-nés. L’objectif de cette étude était de déterminer les prévalences de CMV, EBV et HHV-6 chez les femmes enceintes VIH(+) et VIH(-) à Ouagadougou. Méthodes Dans cette étude 200 échantillons de plasma sanguin de femmes enceintes dont 100 femmes VIH(+) et 100 femmes VIH(-) ont été diagnostiqués par PCR multiplex en temps réel pour les trois infections (EBV, CMV et HHV-6). Résultats Sur l’ensemble des 200 échantillons analysés, 18 (9,0%) étaient positifs à au moins un des trois virus, 12 (6,0%) étaient positifs au EBV, 13 (6,5%) au CMV et 12 (6,0%) positifs au HHV-6. Parmi les 18 cas d’infections, nous avons trouvé 10 cas (55,6%) de coïnfections dont 90,0% (9/10) d’infection multiple EBV/CMV/HHV6 et 10,0% de coinfection EBV/HHV6. Le taux d’infection HHVs était plus élevé chez les femmes VIH(-) que celles VIH(+) (12,0% versus 6,0%). Parmi les VIH(+), la PCR a révélé 7,1% (soit 6/85) d’infection HHVs chez celles qui n’étaient pas sous ARV contre 0% chez celles sous ARV. Conclusion Les herpès virus sont fréquents chez les femmes enceintes au Burkina Faso et pourraient constituer une menace chez ces dernières à cause des complications et des risques d’infection pour le nouveau-né. PMID:27800078

  4. L'acétylcholinestérase des poissons, cible des organophosphorés et des carbamates. Caractérisation du gène et des formes moléculaires de l'enzyme chez Danio rerio. Effets des anticholinestérasiques

    Directory of Open Access Journals (Sweden)

    BERTRAND C.

    1998-07-01

    Full Text Available L'acétylcholinestérase (AChE, EC 3.1.1.7 est une enzyme indispensable de la transmission synaptique cholinergique. Son inhibition par les organophosphorés et les carbamates est à la base de certains traitements insecticides et nématicides utilisés en agriculture. Les faunes sauvage (en particulier les poissons et domestique sont exposées aux résidus des traitements anticholinestérasiques. La mesure de l'inhibition de l'activité AChE chez ces espèces est un marqueur fiable de l'exposition. Ceci est montré ici pour l'AChE de carpes exposées expérimentalement au carbofuran (carbamate. Nous présentons parallèlement des données sur le gène de l'AChE chez Danio rerio et sur les formes moléculaires de l'enzyme chez Danio, Cyprinus carpio et Oncorhynchus mykiss. Contrairement à ce qui est observé chez d'autres vertébrés, le gène d'AChE de Danio ne possède pas d'exon H et seules les sous-unités de type T ont pu être identifiées chez ces trois espèces. Des résultats préliminaires d'hybridation in situ sur les embryons sont présentés et nous discutons l'intérêt des expériences de transgenèse dans l'oeuf de Danio pour étudier d'éventuelles fonctions morphogénétiques de l'AChE au début du développement.

  5. Les manifestations cutanées chez les patients hémodialysés chroniques dans un pays en voie de développement

    Science.gov (United States)

    Coulibaly, Gérard; Korsaga-Somé, Nina; Fomena, Dorisse Fernade Yongué; Nagalo, Yacouba; Karambiri, Adama Roger; Bassolet, Alban; Kafando, Hyacinthe; Traoré, Adama; Lengani, Adama

    2016-01-01

    Le but de cette étude était deconnaître les affections cutanées les plus fréquentes chez les patients hémodialysés chroniques du Centre Hospitalier Universitaire Yalgado Ouédraogo (CHU-YO) de Ouagadougou. L’étude, de type transversal descriptif, menée du 15 Septembre au 31 Décembre 2014, s'estdéroulée au CHU-YO. Elle concernait les patients qui avaient au moins trois mois d'ancienneté en hémodialyse chronique. La fréquence des séances d'hémodialyse était d'une tous les cinq jours. Le seuil de signification des tests statistiques était défini pour une probabilité p ≤ 0,05. Quatre-vingt-quinze patients (61,1% d'hommes et 38,9% de femmes), de moyenne d’âge 42,1 ans participaient à l’étude. La durée moyenne en hémodialyse était de 31,9 mois. Le taux de réalisation des analyses biologiques variait de 7,4 à 85,3%. Quatre-vingt patients (85,3%) avaient au moins une manifestation cutanée. La xérose cutanée (67,4%), le prurit (45,3%), et l'hyperpigmentation (23,2%) étaient les plus fréquentes des manifestations cutanées pouvant être spécifiques de l'hémodialyse. L'hypomélanose en gouttes (11,6%), le prurigo (11,6%) et la folliculite (8,4%) étaient les principales manifestations cutanées non spécifiques. L'atteinte cutanée était fréquente mais ne semblait pas liée à l'ancienneté en hémodialyse. Les mauvaises conditions d'hémodialyse et l'environnement sec et chaud à Ouagadougou, ont pu favoriser ces atteintes, en particulier la xérose et le prurit. Une meilleure subvention des soins de santé contribuerait à réduire la prévalence des maladies cutanées et à améliorer la qualité de vie de nos patients hémodialysés chroniques. PMID:27642449

  6. Origine de l'utilisation privilégiée du terme de Amr chez les mu'minides almohades

    Directory of Open Access Journals (Sweden)

    Fricaud, Émile

    2002-06-01

    Full Text Available Not available[es] La palabra amr («orden dada» - «autoridad» vino a ser, entre los Almohades Mu'miníes, una denominación utilizada para designar a cAbd al-Mu'min y a cada uno de sus sucesores los califas: «al-Amr» («la Autoridad», «hādā l-Amr» («esta Autoridad». Este artículo propone como origen de este uso mu'miní el recuerdo de las exclamaciones atribuidas al mahdī Ibn Tūmart, en las cuales había designado a cAbd al-Mu'min como el futuro poseedor del amr; entre estas exclamaciones tūmartíes se debe dar un lugar de preferencia a la que —entendida de otra manera hasta ahora— había proferido poco tiempo antes de su muerte, al enterarse de la derrota almohade de la Buhayra. [fr] Le mot amr («ordre donné» - «autorité» devint, chez les Almohades Mu'minides, une appellation utilisée pour désigner cAbd al-Mu'min et chacun de ses successeurs: «al-Amr» («l'Autorité», «hādā l-Amr» («cette Autorité». Le présent article propose que l'on donne pour origine à cet usage Mu'minide le souvenir des exclamations prêtées au mahdî Ibn Tûmart dans lesquelles il avait désigné cAbd al-Mu'min comme le futur détenteur du amr; parmi ces exclamations tùmartiennes, une place spéciale doit être faite à celle —comprise autrement jusqu'à présent— qu'il avait proférée, peu de temps avant sa mort, en apprenant la défaite almohade de la Buhayra.

  7. Epilepsies et crises épileptiques aiguës chez l'enfant en Afrique subsaharienne: défis et espoirs

    Science.gov (United States)

    Kaputu-Kalala-Malu, Célestin

    2016-01-01

    L’épilepsie est une maladie neurologique fréquemment rencontrée en Afrique Subsaharienne (ASS) au sein de la population pédiatrique. Bien que sa prévalence exacte au sein de cette population ne serait pas connue, il y a lieu de penser qu'elle n'est pas très différente de celle de la population générale à cause de l’âge précoce de son début - avant 20 ans dans plus 60% des cas - et à l'absence de la distribution bimodale retrouvée dans les pays industrialisés. Tout au long de cette revue de la littérature, une réalité se dégage: la prise en charge globale de l'enfant épileptique en ASS est inadéquate. Pour inverser cette tendance, les défis à relever semblent être de trois ordres. Outre la recherche, ces défis comportent une dimension thérapeutique et une dimension éducationnelle. Il y a nécessité de former des médecins à la pratique de la neurologie pédiatrique tout en créant des conditions de travail qui limitent la fuite des cerveaux. Il est urgent d'identifier et de combler les besoins nécessaires à la prise en charge correcte des enfants épileptiques selon les pays et les régions (indisponibilité des médicaments anti comitiaux, l'absence des guidelines nationaux, le déficit d'encadrement de guérisseurs traditionnels…) enfin, il est impérieux d'encourager la réalisation des études visant à établir l'incidence et la prévalence correctes des épilepsies chez l'enfant afin de faciliter la pose des jalons des mesures de lutte ciblées. PMID:27217883

  8. Ending homelessness among people with mental illness: the At Home/Chez Soi randomized trial of a Housing First intervention in Toronto

    Science.gov (United States)

    2012-01-01

    Background The At Home/Chez Soi (AH/CS) Project is a randomized controlled trial of a Housing First intervention to meet the needs of homeless individuals with mental illness in five cities across Canada. The objectives of this paper are to examine the approach to participant recruitment and community engagement at the Toronto site of the AH/CS Project, and to describe the baseline demographics of participants in Toronto. Methods Homeless individuals (n = 575) with either high needs (n = 197) or moderate needs (n = 378) for mental health support were recruited through service providers in the city of Toronto. Participants were randomized to Housing First interventions or Treatment as Usual (control) groups. Housing First interventions were offered at two different mental health service delivery levels: Assertive Community Treatment for high needs participants and Intensive Case Management for moderate needs participants. Demographic data were collected via quantitative questionnaires at baseline interviews. Results The effectiveness of the recruitment strategy was influenced by a carefully designed referral system, targeted recruitment of specific groups, and an extensive network of pre-existing services. Community members, potential participants, service providers, and other stakeholders were engaged through active outreach and information sessions. Challenges related to the need for different sectors to work together were resolved through team building strategies. Randomization produced similar demographic, mental health, cognitive and functional impairment characteristics in the intervention and control groups for both the high needs and moderate needs groups. The majority of participants were male (69%), aged >40 years (53%), single/never married (69%), without dependent children (71%), born in Canada (54%), and non-white (64%). Many participants had substance dependence (38%), psychotic disorder (37%), major depressive episode (36%), alcohol

  9. Ending homelessness among people with mental illness: the At Home/Chez Soi randomized trial of a Housing First intervention in Toronto

    Directory of Open Access Journals (Sweden)

    Hwang Stephen W

    2012-09-01

    Full Text Available Abstract Background The At Home/Chez Soi (AH/CS Project is a randomized controlled trial of a Housing First intervention to meet the needs of homeless individuals with mental illness in five cities across Canada. The objectives of this paper are to examine the approach to participant recruitment and community engagement at the Toronto site of the AH/CS Project, and to describe the baseline demographics of participants in Toronto. Methods Homeless individuals (n = 575 with either high needs (n = 197 or moderate needs (n = 378 for mental health support were recruited through service providers in the city of Toronto. Participants were randomized to Housing First interventions or Treatment as Usual (control groups. Housing First interventions were offered at two different mental health service delivery levels: Assertive Community Treatment for high needs participants and Intensive Case Management for moderate needs participants. Demographic data were collected via quantitative questionnaires at baseline interviews. Results The effectiveness of the recruitment strategy was influenced by a carefully designed referral system, targeted recruitment of specific groups, and an extensive network of pre-existing services. Community members, potential participants, service providers, and other stakeholders were engaged through active outreach and information sessions. Challenges related to the need for different sectors to work together were resolved through team building strategies. Randomization produced similar demographic, mental health, cognitive and functional impairment characteristics in the intervention and control groups for both the high needs and moderate needs groups. The majority of participants were male (69%, aged >40 years (53%, single/never married (69%, without dependent children (71%, born in Canada (54%, and non-white (64%. Many participants had substance dependence (38%, psychotic disorder (37%, major depressive episode (36

  10. Pour une comparaison des utilisations atypiques des constructions verbales chez les locuteurs bilingues anglais/français et anglais/allemand

    Directory of Open Access Journals (Sweden)

    Brasart, Charles

    2013-09-01

    lesquelles un verbe se voit affublé d'une désinence issue d'une autre langue, elles ont souvent été considérées illicites, c'est-à-dire ne pouvant être produites spontanément par les locuteurs, et font encore débat (POPLACK , 1980, MACSWAN, 1999, SEBBA, 2009. Malgré cela, une analyse du traitement du verbe chez les bilingues fondée sur l'étude de deux corpus oraux nous conduit à postuler que c'est souvent l'inverse qui se produit. En effet, chez les locuteurs bilingues français/anglais et anglais/allemand dont la pratique discursive est analysée pour cette étude, le groupe verbal semble être un lieu privilégié du passage d'une langue à l'autre et, de plus, ce passage prend des formes diverses et qui sont souvent similaires d'un couple de langue à un autre. C'est peut-être là d'ailleurs que se situe l'un des éléme nts phares dégagés par cette étude, à savoir que dans deux paires de langues se retrouvent des tendances syntaxiques et grammaticales communes. Nous souhaitons ainsi montrer que les locuteurs bilingues peuvent faire un usage similaire d'outils différents pour arriver au même but --communiquer un message précis --, quelles que soient les langues parlées. Après avoir présenté la méthodologie de la recherche dans le domaine de l'alternance codique, nous prendrons pour exemples les cas où les grammaires des deux langues en jeu sont rendues compatibles entre elles par divers " bricolages " syntaxiques, produisant des énoncés qui, en regard de la grammaire de chaque langue, seraient fautifs. Nous poursuivrons en nous penchant sur des énoncés où la rencontre des langues permet d'associer des propriétés qui n'existent que dans l'une ou l'autre. Ceci sera également l'occasion d'analyser les conflagrations morphologiques, dans lesquelles des désinences de langue X sont associées à des bases verbales de langue Y. Nous montrerons qu'il n'existe pas de systématicité dans l'utilisation ou non de ces conflagrations par les

  11. Le contrôle des croisements chez l’huître perlière Pinctada margaritifera : La maturation ovocytaire in vitro et l’induction de la ponte

    OpenAIRE

    Le Moullac, Gilles; Rouxel, Catherine; Vonau, Vincent; Ledu, Christophe; Cochard, Jean-Claude

    2003-01-01

    Afin de mener à bien le programme Maîtrise de la Reproduction chez l’huître perlière Pinctada margaritifera dont la perspective est l’amélioration génétique, il est essentiel de contrôler les croisements au niveau individuel. Ces croisements ne pourront être contrôlés que dans la mesure où les gamètes mâles et femelles sont obtenus séparément. Ceci permettra aussi de valider les travaux en cryoconservation des spermatozoïdes et de faciliter la production de polyploïdes. Ces travaux répondent ...

  12. L'étranger de la théorie chez P. Fédida: la théorie de la supervision et le Centre d'Estudes du Vivant

    Directory of Open Access Journals (Sweden)

    François Villa

    2007-09-01

    Full Text Available L'auteur montre qu 'il y a, chez P. Fédida, une continuité de démarche entre sa théorie de la psychanalyse de supervision et la théorie sur laquelle repose le projet du Centre d'Etudes du Vivant. Tant dans la supervision que dans la controverse entre la psychanalyse et d'autres disciplines, ce qui est en jeu c'est l'étranger de la théorie. Celui-ci défait l'illusion des supposées bases communes de la psychanalyse. C'est à partir de cet interlocuteur " interne" à chaque discipline que peut s'organiser une controverse sur les objets qui sont à la frontière des diverses sciences du vivant.

  13. Infection respiratoire aigüe et statut nutritionnel chez les enfants de 0-5 ans: cas des cliniques universitaires de Lubumbashi, République Démocratique du Congo

    OpenAIRE

    Ngombe, Léon Kabamba; Mbombo-Ditunga,; Kameya, Nduwa; Malingo, Aimé Abasiko; Kayomb, Nathalie Kaj; ea Ngolomba, Jean Ngolomba; Nday, David Kakez; Numbi, Luboya

    2014-01-01

    Les auteurs rapportent les données d'une étude rétrospective de 153 dossiers d'enfants hospitalisés dans le service de pédiatrie des Cliniques Universitaires de Lubumbashi/RD Congo pour IRA. En ce qui nous concerne, les IRA chez les enfants de moins de 5 ans représentent 26,11% de l'effectif, dont 17,75% âgés de moins d'un an. Le sexe masculin est légèrement prédominant (85 contre 68) et près de 70% des enfants ont un statut nutritionnel précaire. La répartition mensuelle connaît des pics en ...

  14. Etude de la pression artérielle, rigidité artérielle et neuropathie autonome cardiovasculaire chez les patients diabétiques de type 1

    OpenAIRE

    Philips, Jean-Christophe; Xhignesse, Patricia; Marchand, Monique; Saint-Remy, Annie; Krzesinski, Jean-Marie; Scheen, André

    2010-01-01

    Nous avons récemment eu l'honneur de recevoir l'Hypertension Young Investigator Award 2009 adressé par le Comité belge de Lutte contre l'Hypertension et soutenu par la fondation Astra Zeneca. Notre projet propose d'étudier différents indices cardiovasculaires au sein d'une population constituée de patients diabétiques de type 1. L'étude de la pression artérielle, estimée par différentes méthodes, ainsi que l'estimation de la rigidité artérielle chez ces patients pourraient être utiles afin ...

  15. Caractéristiques de l'association diabète type 2 et hypertension artérielle chez le sujet âgé de 65 ans et plus

    OpenAIRE

    Diyane, Khadija; El Ansari, Nawal; El Mghari, Ghizlane; Anzid, Karim; Cherkaoui, Mohamed

    2013-01-01

    Introduction L'HTA du diabétique âgé est particulière par sa fréquence et sa gravité. Cette association HTA-diabète type 2 (DT2) est particulièrement fréquente chez la personne âgée, et responsable d'une majoration du risque cardiovasculaire et d'une accélération de l'atteinte dégénérative du diabète. Méthodes Etude descriptive, concernant 100 patients diabétiques de type 2 hypertendus âgés de 65 ans ou plus, suivis au service d'endocrinologie-diabétologie du CHU de Marrakech, du mois de Nove...

  16. Les aliments issus de plantes génétiquement modifiées : équivalence, efficacité et sécurité chez les animaux de la ferme

    OpenAIRE

    2002-01-01

    On affirme, même sans preuve avérée, que les aliments issus de la transformation génétique des plantes présentent des risques pour l’homme et les animaux. On reconnaît seulement les avantages agronomiques des plantes génétiquement modifiées (GM) ayant fait l’objet d’une autorisation de dissémination. L’équivalence en substance (composition chimique), la sécurité et l’innocuité ont pourtant été vérifiées préalablement à leur autorisation. C’est seulement récemment que l’on a démontré chez les ...

  17. Chez une personne atteinte d’accident vasculaire cérébral vivant à domicile, quel est le rôle de l’infirmière face à l’incertitude de l’avenir

    OpenAIRE

    Mayor, Véronique; Minotti, Elisa; Goumoëns, Véronique de

    2016-01-01

    Contexte : L’AVC est la cause majeure d’invalidité physique, émotionnelle et cognitive et de diminution de la qualité de vie chez l’adulte. De par la nature soudaine et imprévisible de l’AVC, l’incertitude fait partie intégrante de la vie des malades. Objectif : L’objectif de cette revue de littérature est de mettre en avant les différents rôles d’une infirmière afin d’aider les patients ayant subi un AVC, une fois leur retour à domicile, dans la gestion de l’incertitude. Méthode : Deux bases...

  18. Application d'une méthode de détermination externe du sexe chez le Saumon atlantique (Salmo salar L. dans les rivières des Asturies (Espagne

    Directory of Open Access Journals (Sweden)

    PRÉVOST E.

    1991-10-01

    Full Text Available Une méthode de détermination externe du sexe basée sur le dimorphisme sexuel de la longueur relative de la mâchoire supérieure est appliquée chez le Saumon Atlantique (Salmo salar L.. 78 adultes capturés en juin et juillet 1990 dans trois rivières des Asturies (Nord de l'Espagne sont étudiés. L'Analyse Linéaire Discriminante sur un échantillon de 63 poissons donne un pourcentage d'erreurs de moins de 10 %. Les résultats sont comparés à ceux obtenus sur d'autres cours d'eaux d e l'aire de répartition du Saumon atlantique et sont discutés en fonction de la composition de l'échantillon.

  19. La rétention urinaire aiguë sur infection herpétique chez la femme jeune: description d'un cas et revue de la littérature

    OpenAIRE

    Rossier, Luca,; Iselin, Christophe

    2007-01-01

    La rétention urinaire aiguë reste sous-documentée et sous-diagnostiquée chez la femme. En dehors des causes habituelles, uro-génitales, médicamenteuses, ou même des lésions de la moelle par protusion discale ou tumorale, il faut également penser aux neuropathies, à la sclérose en plaque, et aux myéloradiculites virales, dont Herpès-Zoster est le virus prédominant. Connaître le diagnostic différentiel est important, car il permettra de rassurer la patiente, et d'orienter le bilan sélectivement...

  20. La rétention urinaire aiguë sur infection herpétique chez la femme jeune : description d'un cas et revue de la littérature

    OpenAIRE

    Rossier, Luca,

    2007-01-01

    La rétention urinaire aiguë reste sous-documentée et sous-diagnostiquée chez la femme. En dehors des causes habituelles, uro-génitales, médicamenteuses, ou même des lésions de la moelle par protusion discale ou tumorale, il faut également penser aux neuropathies, à la sclérose en plaque, et aux myéloradiculites virales, dont Herpès-Zoster est le virus prédominant. Connaître le diagnostic différentiel est important, car il permettra de rassurer la patiente, et d'orienter le bilan sélectivement...

  1. Variations morphologiques de l’appareil nucléaire chez les ciliés Astomes Almophrya bivacuolata et A. mediovacuolata (Protozoa : Ciliophora endocommensaux d’oligochètes terricoles du Cameroun

    Directory of Open Access Journals (Sweden)

    Nana P.A.

    2010-12-01

    Full Text Available L’imprégnation argentique complétée par la coloration nucléaire de Feulgen et la coloration au DAPI nous ont permis d’étudier les variations morphologiques de l’appareil nucléaire chez deux espèces de ciliés Astomes, Almophrya bivacuolata (de Puytorac et Dragesco, 1968 et A. mediovacuolata (Ngassam, 1983 endocommensaux. Nous avons mis en évidence d’importantes digitations et la présence de bandes sombres dans la structure du macronoyau en “H” des petits types cellulaires ainsi que la présence de formes intermédiaires entre “H” et “X” dans ces deux espèces.

  2. Synthèse bibliographique sur le comportement de recherche de l’hôte chez la punaise de lit (Cimex lectularius) et applications dans le cadre de la lutte intégrée

    OpenAIRE

    2016-01-01

    Cette étude analyse le comportement de recherche de l’hôte chez la punaise de lit, Cimex lectularius, en portant une attention particulière sur les stimuli émis par l’Homme et impliqués dans ce processus d’orientation. Elle met également en évidence les applications possibles en matière de lutte intégrée. La punaise de lit est un ectoparasite exclusivement hématophage étroitement lié à l’Homme depuis des millénaires. Lors de sa recherche alimentaire, cet insecte utilise des stimuli émis pa...

  3. Evaluation du traitement antirétroviral chez les femmes enceintes VIH-1 positif, sur la transmission de l'infection de la mère à l'enfant: cas du Centre Médical Saint Camille de Ouagadougou, au Burkina Faso

    Science.gov (United States)

    Soubeiga, Serge Theophile; Compaore, Rebecca; Djigma, Florencia; Zagre, Nicaise; Assengone, Elsa; Traore, Lassina; Diarra, Birama; Bisseye, Cyrille; Ouermi, Djeneba; Sagna, Tani; Karou, Simplice; Pietra, Virginio; Simpore, Jacques

    2015-01-01

    Introduction L'infection au VIH chez les nouveau-nés par leur mère peut être réduite grâce à des programmes de prévention de transmission mère-enfant du VIH (PTME). L'objectif dans cette étude était d’évaluer le traitement antirétroviral chez les femmes enceintes VIH-1 positif sur la transmission mère-enfant de l'infection au Centre Médical Saint Camille de Ouagadougou, Burkina Faso. Méthodes Des échantillons de spot de sang total ont été collectés chez 160 enfants âgés de 6 semaines, nés de mères VIH-1 positif et chez 40 enfants âgés de 2 à 13 mois provenant d'orphelinats et dont les mères étaient inconnues. Ces échantillons ont été testés avec le kit Abbott Real Time HIV-1 Qualitative. Un questionnaire a permis de connaitre les âges et les fonctions des femmes enceintes. Résultats Les femmes enceintes avaient un âge moyen global de 29,50±5,19 ans. Au total, 50,5% (101/200) ont été mises sous combinaison AZT/3TC/NVP et 29,5% (59/200) étaient sous prophylaxie (AZT/3TC). Le taux de transmission verticale du VIH-1 était de 0,0% (0/160) (p < 0,001) chez les enfants dont les mères étaient sous combinaison AZT/3TC/NVP ou sous prophylaxie AZT/3TC et de 15,0% (6/40) chez les enfants orphelins qui n’étaient pas inclus dans le protocole de la PTME. Conclusion Selon les résultats, le protocole de la PTME est efficace et réduit très significativement le risque de transmission du VIH-1 de la mère à l'enfant. De plus, le dépistage par PCR, des enfants orphelins infectés verticalement par le VIH, permet leur prise en charge thérapeutique précoce. PMID:26301003

  4. Listériose Humaine : Expériences Cliniques Avec Cette Zoonose Chez 12 Patients en Estrie, Québec Sur une Période de 19 ans (1976 à 1995

    Directory of Open Access Journals (Sweden)

    Pierre-Jean Maziade

    1997-01-01

    Full Text Available Une étude rétrospective a été faite dans le but de réviser l’épidémiologie, les facteurs de risque, les manifestations cliniques et l’évolution des cas d’infection à Listeria monocytogenes en Estrie, Québec de 1976–1995. Les patients ont été repérés à partir des cultures positives et du diagnostic donné par le Service des maladies infectieuses du Centre hospitalier universitaire de Sherbrooke, Sherbrooke, Québec. Un total de 12 patients ont fait partie de l’étude. La septicémie non reliée à la grossesse (4/12 et la méningite (6/12 ont été les deux présentations cliniques majeures. Il y avait 1 cas de listériose de grossesse et 1 cas de granulomatosis infanti septica. Dix patients avaient au moins une condition prédisposante. Un seul décès a été attribué à l’infection à L monocytogenes. Des séquelles neurologiques ont été observées chez la moitié des patients avec méningite tandis qu’aucune séquelle a été notée chez ceux avec septicémie. En conclusion, la listériose est une maladie de patients âgés et immunocompromis. La présentation clinique et l’évolution ne sont pas différentes de ce qui a déjà été rapporté dans d’autres régions industrialisées.

  5. Une masculinité en crise à la fin du XVIIe siècle ? La critique de l'efféminé chez La Bruyère

    Directory of Open Access Journals (Sweden)

    Cédric Corgnet

    2008-07-01

    Full Text Available L’efféminé est toujours un cas sexuel limite : homme aux airs féminins, il interroge l’innée de la nature sexuelle, critique les genres et leur définition explicitement physique. La fin du XVIIe siècle illustre cette tension chez les moralistes français et surtout chez La Bruyère dans ses Caractères où celui-ci interroge cette monstruosité générique à travers une analyse sémiologique. Mais cette tératologie n’est pas avant tout clinique mais sociale et morale : il nous avertit, par cet écart de genre, d’une corruption morale du monde tant par une sémiologie clinique que mythologique ovidienne ne cherchant pas le réalisme pathologique mais la filiation antique qui ante son ouvrage sur les Caractères Théophrastiens : philosophe plus que naturaliste.The effeminate is always a sexual limit case: man in the feminine sights, he questions the innate of the sexual nature, criticizes genders and their explicitly physical definition. The end of the XVIIth century illustrates this tension at the French moralists and especially in La Bruyère’s Characters where this one questions this generic monstrousness through a semiological analysis. But this teratology is not above all clinical but social and moral: he warns us, by this distance from gender, from a moral corruption of the world both by a clinical semiology and ovidian mythology not looking for the pathological realism but the antic filiation with Theophrast’s Characters : philosopher more than naturalist.

  6. RÉPARTITION SPATIALE ET SÉLECTION DE L’HABITAT CHEZ LE MULOT SYLVESTRE (APODEMUS SYLVATICUS LINNAEUS, 1758 ET LA SOURIS SAUVAGE (MUS SPRETUS LATASTE, 1883 EN KABYLIE DU DJURDJURA (ALGERIE

    Directory of Open Access Journals (Sweden)

    K KHIDAS

    1999-12-01

    Full Text Available La répartition du mulot sylvestre Apodemus sylvaticus et de la souris sauvage Mus spretus a fait l’objet d’une analyse à l’échelle stationnelle en Kabylie du Djurdjura. Une analyse factorielle des correspondances a été appliquée sur des données d’abondance et de localisation de ces rongeurs. Cette étude a permis de révéler les modes de répartition, et d’identifier à partir d’un ensemble de paramètres décrivants les milieux échantillonnés ceux apparaissant comme éléments efficaces dans la sélection de l’habitat chez ces deux espèces. Il ressort que le mulot et la souris sauvage se comportent de façon inverse vis-à-vis de la nature et de la structure du milieu. Le mulot semble sensible au caractère forestier des milieux ainsi qu’à la présence de rochers et de gros blocs de pierre; il se retrouve dans divers types de milieux, mais il occupe préférentiellement les formations forestières (sensu lato. La souris sauvage occupe surtout les biotopes ouverts et ne semble pas très affectée par l'anthropisation des milieux; le climat serait aussi un autre paramètre déterminant les normes de sélection de l’habitat chez cette espèce.

  7. Obésité chez l’enfant : définition, prévalence et facteurs d’environnement

    Directory of Open Access Journals (Sweden)

    Rolland-Cachera Marie‐Françoise

    2003-03-01

    Full Text Available Depuis quelques dizaines d’années l’obésité augmente rapidement dans de nombreux pays. Cette évolution concerne particulièrement l’obésité infantile. Selon la définition française, le pourcentage d’enfants ayant un excès pondéral est passé de 5,1 à 12,5 % entre 1980 et 1996. En 2000, la prévalence atteint 16,3 %. D’après la nouvelle définition de l’IOTF qui permet des comparaisons internationales, en 2000 en France, 18,1 % des enfants âgés de 7 à 9 ans présentent un surpoids dont 3,8 % sont obèses. Alors que l’obésité augmente, la plupart des études ne relèvent pas d’augmentation des apports énergétiques. Les résultats des études épidémiologiques ayant examiné les facteurs alimentaires responsables du développement de l’obésité n’ont pas apporté de réponses claires à ce problème. L’importance des premières années de la vie est soulignée par le rebond d’adiposité précoce retrouvé chez la plupart des enfants obèses. De nombreuses études relèvent que les nourrissons ont des apports faibles en lipides et élevés en protéines. Cependant, une alimentation riche en en lipides et à teneur réduite en protéines, telle que le lair maternel, est adaptée aux beoins d’énergie élevés du nourrisson. Les études montrent qu’ensuite, les apports en lipides augmentent progressivement avec l’âge et deviennent excessifs. L’alimentation devrait tenir compte des besoins spécifiques à chaque âge. Les conseils de prévention ne reposent donc pas actuellement sur des certitudes. Il est cependant souhaitable de mieux respecter les recommandations nutritionnelles aux différents âges de la vie et d’encourager l’activité physique des enfants. Ces mesures pourraient permettre d’améliorer les processus de croissance et limiter la progression de l’obésité.

  8. HISTOPLASMOSE AFRICAINE DISSEMINEE CHEZ UN ENFANT IMMUNOCOMPETENT AU BURKINA FASO: UN CAS [DISSEMINATED AFRICAN HISTOPLASMOSIS IN AN IMMUNOCOMPETENT CHILD IN BURKINA FASO: ONE CASE

    Directory of Open Access Journals (Sweden)

    Gilles Lemasson

    2013-07-01

    Full Text Available Résumé Introduction: L’histoplasmose à Histoplasma capsulatum var. duboisii est une affection rare en Afrique. Les lésions cutanées localisées sont les plus fréquentes. Nous rapportons une forme disséminée chez un enfant immunocompétent. Observation: Une élève de 8 ans est hospitalisée pour des nodules cutanés, généralisés, associés à des douleurs ostéo-articulaires très intenses de la quasi-totalité des articulations. L’examen a noté une malnutrition aiguë modérée, des nodules sous cutanés, multiples, des papules rosées, à surface plane, des papules ombiliquées, des tuméfactions nodulaires très douloureuses de plusieurs articulations, de multiples adénopathies fermes, mobiles, une atteinte osseuse multiple à la radiographie, une hépatosplénomégalie et des ulcérations secondaires douloureuses. L’histologie d’un nodule cutané et d’une papule ombiliquée a mis en évidence H.capsulatum var. duboisii. Après l’échec d’un traitement au fluconazole, l’évolution a été favorable sous l’amphotéricine B. La patiente a bénéficié de la collaboration Nord-Sud et de l’aide des structures sociales.Conclusion: Cette observation nous a permis de décrire les particularités cliniques et socio-économiques, les difficultés diagnostiques et thérapeutiques d’un cas d’histoplasmose africaine disséminée et de démontrer encore l’efficacité de l’amphotéricine B. AbstractIntroduction: Histoplasmosis due to Histoplasma capsulatum var. duboisii is a rare affection in Africa. Localized cutaneous lesions are the most common form. We report a disseminated form in an immunocompetent child. Case report: An 8-year-old student has been hospitalized for generalized, cutaneous nodules associated with very severe osteo-articular pains of almost all the joints. The examination has noted a moderate acute malnutrition, multiple and sub-cutaneous nodules, pinkish and plan papules, umbilicate papules

  9. Présentations inhabituelles d'un syndrome de Plummer-Vinson chez l'africain de race noire: à propos de deux observations

    Science.gov (United States)

    Berthé, Adama; Diop, Madoky Magatte; Toure, Papa Souleymane; Tall, Cheikh Tidiane; Fulgence Faye, Abdoul; Diop, Bernard Marcel; Ka, Mamadou Mourtalla

    2014-01-01

    Le syndrome de Plummer Vinson (SPV) est une affection rare caractérisée par une dysphagie cervicale associée à une anémie ferriprive et un anneau sur l’œsophage supérieur. Parfois, son mode de présentation inhabituelle peut faire errer le diagnostic. Le rétrécissement annulaire peut être de découverte fortuite lors d'une endoscopie digestive haute. Nous rapportons deux observations de syndrome de Plummer-Vinson chez des sujets de genre masculin et féminin. Celles-ci ont comme point commun une découverte fortuite lors d'une endoscopie digestive haute. La première observation concernait un garçon de 14 ans aux antécédents de brûlure caustique de l’œsophage dans l'enfance avec dysphagie haute passagère ne l'inquiétant pas depuis lors. Il était reçu en urgence pour une endoscopie digestive haute motivée par une dysphagie de survenue brutale secondaire à une prise d'aliment solide. L'examen clinique avait objectivé une chéilite angulaire. La biologie montrait un abaissement de la ferritinémie sans anémie. L'endoscopie avait mis en évidence un anneau circulaire franchi avec ressaut au niveau de la bouche de Killian. Elle avait également permis l'extraction d'un corps étranger à type de noyau de « pain de singe » mais la lumière de l’œsophage était infranchissable à partir du niveau d'arrêt. Le transit œsophagien montrait un ralentissement du produit de contraste au niveau de l'sophage cervical et thoracique sans lésions morphologiques. Dans la deuxième observation, il s'agissait d'une jeune femme de 35 ans adressée à l unité d'endoscopie digestive pour objectiver une gastrite atrophique sur une suspicion de la maladie de Biermer. La fibroscopie mettait alors en évidence, un rétrécissement annulaire infranchissable à 18 centimètres des arcades dentaires. La biologie montrait une anémie avec augmentation de la ferritinémie. Dans les deux cas, le traitement martial était systématique associé à des séances de

  10. Par-delà l’interdit (haram. Une ethnographie du mariage et de la sexualité chez les Sahraouis du Sud marocain

    Directory of Open Access Journals (Sweden)

    Claire Cécile Mitatre

    2009-03-01

    Full Text Available Par-delà l’interdit (haram. Une ethnographie du mariage et de la sexualité chez les Sahraouis du Sud marocain. Avant de me rendre dans l’Oued Noun, région oasienne du pré-Sahara atlantique, mes lectures sur le monde musulman et le bassin méditerranéen me portaient à penser que, par le mariage, une femme entrait dans le haram de son mari, domaine de l’interdit qu’un galant ne peut enfreindre sans risquer d’être tué par l’époux offensé. Les premiers temps de mon expérience ethnographique, j’interprétais alors le caractère insouciant des invitations galantes que l’on pouvait me faire tout en me sachant mariée, comme une manière détournée d’affirmer que les Occidentaux n’avaient pas de domaine de l’interdit sur lequel étendre leur autorité, et de me renvoyer à mon statut d’étrangère. C’est cependant en prenant les avances des hommes à mon égard comme objet d’analyse que je compris comment, dans cette région présaharienne, le mariage constituait en réalité, pour la femme sahraouie, un rite d’accession aux relations de galanterie : par la perte rituelle de sa virginité, la femme s’affranchit du seul véritable haram auquel elle a jamais appartenu, celui de son père.Beyond the forbidden (haram. An ethnography of marriage and sexuality among the Sahraoui of Southern Morocco. Before going to the Oued Noun, an oasis region of the Atlantic pre-Sahara, my readings on the Muslim world and the Mediterranean basin led me to think that when she married, a woman entered the haram of her husband, a forbidden domain that an admirer can only infringe upon at the risk of being killed by the offended husband. At the beginning of my ethnographic experience, I interpreted the carefree nature of the amorous invitations I received from men who knew I was married as a roundabout way of affirming that Westerners have no forbidden domain to exert their authority over, and to remind me of my status as a

  11. Les Rêves chez Marguerite Yourcenar

    Directory of Open Access Journals (Sweden)

    Kyeongmi Kim-Bernard

    2005-04-01

    Full Text Available Marguerite Yourcenar a publié un recueil de récits de rêves intitulé Les Songes et Les Sorts en 1938. La préface de ce texte qui registre une trentaine de récits authentiques rêvés entre 1930 et 1936, donc entre ses 28 et 33 ans, nous intéresse particulièrement par ses profondes réflexions sur la matière du rêve dont les traces se trouvent dans ses écrits, notamment romanesques. Partiellement convaincue par la théorie freudienne, elle marque clairement la différence de sa vision sur ce système d’images qu’elle souhaite ne pas être traité comme le sujet d’une analyse psychanalytique ou psychologique: elle refuse le rôle intégral du rêve qui serait, selon le fondateur de la psychanalyse, la partie submergée du défoulement psychologique, notamment celle de la libido. « Le freudisme a trop cru à l’unité du symbole.

  12. Polyphonie musicale chez Milan Kundera

    DEFF Research Database (Denmark)

    Boisen, Jørn

    Artiklen undersøger, hvordan Milan Kundera i sine romaner anvender kompositionstekniske greb fra musikken, i særdeleshed polyfoni.......Artiklen undersøger, hvordan Milan Kundera i sine romaner anvender kompositionstekniske greb fra musikken, i særdeleshed polyfoni....

  13. Piscines et plages chez Kundera

    DEFF Research Database (Denmark)

    Boisen, Jørn

    2007-01-01

    Swimming pools, stricto sensu, are a newcomer in the gallery of western topoï, linked as they are to 20th century consumer culture. For obvious reasons they have become a recognized cinematographic topos, but - more surprisingly - they have also made their way to novel. For instance you find a lot...

  14. Infection with high risk Human Papillomavirus (HRHPV) among HIV-positive women: epidemiology, natural history and impact of combined antiretroviral therapy/Infection par le papillomavirus à haut risque chez les femmes VIH-positives:epidémiologie, histoire naturelle et impact des thérapies antirétrovirales combinées

    OpenAIRE

    Konopnicki, Deborah

    2014-01-01

    L’infection persistante par les papillomavirus (HPV) dits « à haut risque » induit le cancer du col. Chez les femmes infectées par le VIH, les infections par ces HPV oncogènes et les lésions associées, allant des dysplasies au cancer invasif, sont plus fréquentes, plus sévères et de moins bon pronostic que chez les femmes non porteuses du VIH. Etonnamment, alors qu’il a été clairement établi que l’importance de la pathologie liée à HPV est directement proportionnelle au degré d’immunodépressi...

  15. Utilisation des sécrétions de myriapodes chez les lémurs et les sapajous : fonction curative ou signalisation sociale ? Fur-rubbing with millipedes in lemurs and capuchin monkeys: social function or zoopharmacognosy?

    Directory of Open Access Journals (Sweden)

    Bruno Simmen

    2011-10-01

    Full Text Available L’utilisation des myriapodes en friction sur le pelage et d’autres zones corporelles est documentée chez les primates en conditions naturelles, notamment à partir des observations récurrentes menées chez le genre Cebus. La typologie de ces comportements suggère différentes hypothèses, fonctionnelles (zoopharmacognosie, alimentaire, sociale ou non (sensorielle, auto-stimulation. Nous présentons des observations qualitatives comparées de l’utilisation non alimentaire de myriapodes diplopodes chez une forme hybride du genre Eulemur au Sud de Madagascar (occurrences en janvier 2005 et chez le sapajou Cebus apella en Guyane Française (occurrences en mars-avril 1996. L’application des sécrétions à benzoquinones sur une large partie du pelage chez Cebus contraste avec la friction exclusive de la zone périgénitale faisant suite au flairage du diplopode chez Eulemur qui manifeste en outre une réponse stéréotypée analogue au flehmen. Dans notre étude, l’imprégnation de fluides à forte intensité olfactive potentialiserait la signalisation de l’identité individuelle chez Eulemur alors que le "fur-rubbing" chez Cebus est compatible avec l’hypothèse commune d’une forme d’appropriation des défenses antiparasitaires de ces invertébrés. La sécrétion de ces défenses chimiques n’est pas automatiquement déclenchée par la manipulation des diplopodes. Le stress induit par les morsures légères (Eulemur et Cebus et l’arrachage des pattes sur plusieurs segments (Cebus augmente la probabilité de sécrétion, ce qui témoignerait d’un apprentissage d’autant plus efficace des conditions d’émission de ces fluides que l’usage est spécifique et très opportuniste.Body-rubbing with millipedes is repeatedly documented in primates living under natural conditions, mainly in capuchin monkeys (Cebus spp.. Various functional (zoopharmacognosy, ingestion, social and non-functional hypotheses (sensory, auto

  16. Diagnostic moléculaire du Cytomégalovirus (CMV), de l’herpès virus humain de type 6 (HHV6) et d’Epstein-Barr virus (EBV) par PCR en temps réel chez les femmes enceintes VIH séropositives et séronégatives à Ouagadougou, Burkina Faso

    OpenAIRE

    2016-01-01

    Introduction Les herpès virus EBV, CMV et HHV-6 sont des virus qui évoluent sous le modèle pandémique et sont responsables d’infections congénitales pouvant provoquer des séquelles graves chez les nouveau-nés. L’objectif de cette étude était de déterminer les prévalences de CMV, EBV et HHV-6 chez les femmes enceintes VIH(+) et VIH(-) à Ouagadougou. Méthodes Dans cette étude 200 échantillons de plasma sanguin de femmes enceintes dont 100 femmes VIH(+) et 100 femmes VIH(-) ont été diagnostiqués...

  17. Composition en acide alphalinolénique des esters de cholestérol plasmatiques : un marqueur de consommation chez l’homme

    Directory of Open Access Journals (Sweden)

    Combe Nicole

    2002-07-01

    étude cas-témoins de Simon et al. [10] a montré en 1995 qu’un taux plasmatique de 18:3n-3 élevé était associé à une réduction de 37% du risque d’accident vasculaire cérébral. Après analyse multivariée pour prendre en compte les facteurs de confusion, susceptibles d’interférer dans le risque étudié, seul le pourcentage de 18:3n-3 dans les EC plasmatiques restait inversement associé au risque d’accident vasculaire cérébral (p < 0,05. De même, l’étude d’intervention de Bemelmans et al. [13], destinée à la prévention MCV chez des sujets à risques, a récemment montré que le pourcentage de 18:3n-3 dans les EC du plasma était inversement associé à la pression diastolique (p < 0,05. Il ressort de l’ensemble de ces données que le niveau d’acide alphalinolénique souhaitable dans les EC du plasma se situerait entre 0,4 et 0,9% par rapport aux acides gras totaux liés au cholestérol.

  18. Facteurs influençant une saine alimentation chez des adolescents : revue de littérature destinée à l’infirmière en milieu scolaire

    Directory of Open Access Journals (Sweden)

    Danielle Boucher

    2008-01-01

    Full Text Available Certaines habitudes alimentaires des adolescents sont associées à une augmentation inquiétante de l’excès de poids, du nombre de cas d’obésité et du développement de maladies chroniques. Ce phénomène est maintenant considéré comme un problème majeur en santé publique. En promotion de la santé, des modèles écologiques ont été développés pour illustrer la manière dont les caractéristiques personnelles, interpersonnelles, institutionnelles, communautaires et politiques peuvent influencer les comportements. Nous avons utilisé ce modèle pour revoir les facteurs d’influence d’une saine alimentation chez des adolescents de 12 à 18 ans vivant dans des pays industrialisés. Nous avons identifié dans la littérature scientifique des facteurs individuels tels que les connaissances, l’attitude et les croyances, des facteurs interpersonnels tels que la famille et les pairs et des facteurs institutionnels tels que l’école qui peuvent influencer les choix alimentaires des adolescents. La connaissance de ces facteurs peut constituer un préalable lors du choix d’interventions pertinentes ciblant un changement de comportement et permettre ainsi aux infirmières, notamment celles œuvrant en milieu scolaire, d’intervenir plus efficacement auprès des jeunes. Les futures interventions pour promouvoir une saine alimentation pourraient donc cibler ces différents niveaux écologiques et prendre en compte leurs interactions. Le but du présent article est de faire le point sur l’état des connaissances concernant les facteurs qui influencent une saine alimentation chez les adolescents de 12 à 18 ans par le biais d’une revue de littérature dans ce domaine.

  19. Association entre les hormones sexuelles, les marqueurs de remodelage osseux et la densité minérale osseuse chez des femmes ménopausées d'origine marocaine (étude transversale)

    Science.gov (United States)

    El Maataoui, Aissam; Biaz, Asmae; El Boukhrissi, Fatima; El Machtani, Si; Dami, Abdellah; Bouhsain, Sanae; Bamou, Youssef; El Maghraoui, Abdellah; Ouzzif, Zhor

    2015-01-01

    Introduction Le présent travail se propose d’étudier la relation entre les hormones sexuelles, notamment l’œstradiol et l'indice de l’œstradiol libre, le sulfate de déhydroépiandrosterone et la sex hormone binding globulin, les marqueurs de remodelage osseux et la densité minérale osseuse chez une population de femmes marocaine ménopausées. Méthodes Il s'agit d'une étude transversale, menée sur une période de 6 mois d'octobre 2012 à fin avril 2013 et ayant fait participer deux cent deux (202). Résultats L’œstradiol et l'indice d’œstradiol libre (IEL) ont montré une corrélation négative respectivement à l'ostéocalcine (OC), à la crosslaps (β-CTX) et l'OC (ptravail montre que l'augmentation de l’âge et la diminution de l’œstradiol libre expliquent la diminution de la DMO au niveau du col du fémur, alors que l'augmentation du taux sérique de la SHBG et la diminution du poids expliquent la diminution de la DMO au rachis lombaire. PMID:26848353

  20. Infection respiratoire aigüe et statut nutritionnel chez les enfants de 0-5 ans: cas des cliniques universitaires de Lubumbashi, République Démocratique du Congo

    Science.gov (United States)

    Ngombe, Léon Kabamba; Mbombo-Ditunga; Kameya, Nduwa; Malingo, Aimé Abasiko; Kayomb, Nathalie Kaj; ea Ngolomba, Jean Ngolomba; Nday, David Kakez; Numbi, Luboya

    2014-01-01

    Les auteurs rapportent les données d'une étude rétrospective de 153 dossiers d'enfants hospitalisés dans le service de pédiatrie des Cliniques Universitaires de Lubumbashi/RD Congo pour IRA. En ce qui nous concerne, les IRA chez les enfants de moins de 5 ans représentent 26,11% de l'effectif, dont 17,75% âgés de moins d'un an. Le sexe masculin est légèrement prédominant (85 contre 68) et près de 70% des enfants ont un statut nutritionnel précaire. La répartition mensuelle connaît des pics en mars et octobre. Les diagnostiques notifiés sont: rhinite(16,3%),Amygdalite(5,9%),Otite Moyenne Aigue(0,7%),Laryngite (3,3%), Rhinopharyngite (39,2%), Pharyngite (6,5%), Bronchite (7,2%), Bronchopneumonie (5,9%), Pneumonie(2,6%) et Bronchiolite (12,4%).Tous les cas ont bien évolués sous traitement. Le but de ce travail est de déterminer la fréquence des IRA et le statut nutritionnel des enfants ayant été admis dans le service des pédiatries aux C.U.L. PMID:25995789

  1. Planning a multi-site, complex intervention for homeless people with mental illness: the relationships between the national team and local sites in Canada's At Home/Chez Soi project.

    Science.gov (United States)

    Nelson, Geoffrey; Macnaughton, Eric; Goering, Paula; Dudley, Michael; O'Campo, Patricia; Patterson, Michelle; Piat, Myra; Prévost, Natasha; Strehlau, Verena; Vallée, Catherine

    2013-06-01

    This research focused on the relationships between a national team and five project sites across Canada in planning a complex, community intervention for homeless people with mental illness called At Home/Chez Soi, which is based on the Housing First model. The research addressed two questions: (a) what are the challenges in planning? and (b) what factors that helped or hindered moving project planning forward? Using qualitative methods, 149 national, provincial, and local stakeholders participated in key informant or focus group interviews. We found that planning entails not only intervention and research tasks, but also relational processes that occur within an ecology of time, local context, and values. More specifically, the relationships between the national team and the project sites can be conceptualized as a collaborative process in which national and local partners bring different agendas to the planning process and must therefore listen to, negotiate, discuss, and compromise with one another. A collaborative process that involves power-sharing and having project coordinators at each site helped to bridge the differences between these two stakeholder groups, to find common ground, and to accomplish planning tasks within a compressed time frame. While local context and culture pushed towards unique adaptations of Housing First, the principles of the Housing First model provided a foundation for a common approach across sites and interventions. The implications of the findings for future planning and research of multi-site, complex, community interventions are noted.

  2. L’utilisation du prémélange de monensin chez les vaches laitières : un suivi simple et essentiel pour s’assurer d’une utilisation adéquate

    Science.gov (United States)

    Dubuc, Jocelyn; Baril, Jean; DesCôteaux, Luc

    2009-01-01

    Le prémélange de monensin est utilisé fréquemment sur les fermes laitières canadiennes. L’ingrédient actif de ce produit est le monensin sodique. Bien que son utilisation chez les vaches laitières soit sécuritaire, des cas de surdose ont été rapportés à la suite de consommation de niveaux de monensin plus élevés que ceux recommandés. Un suivi hebdomadaire du pourcentage de matières grasses du réservoir de lait de la ferme devrait être fait de routine suite à la livraison d’aliment médicamenteux contenant du monensin pour détecter rapidement les situations de surdose. L’observation d’une baisse soudaine de la consommation volontaire de matière sèche et l’apparition de diarrhée dans un troupeau sont d’autres signes cliniques de surdose de monensin. Une détection rapide de ces cas permettra de corriger la situation. PMID:19721781

  3. Study of contamination by 100 {mu}Ci of Sr 90 in the rat: clinical, hematological and osseous effects (appearance of osteosarcomas); Etude d'une contamination par 100 {mu}Ci de Sr 90 chez le rat: consequences cliniques, hematologiques et osseuses (apparition d'osteosarcomes)

    Energy Technology Data Exchange (ETDEWEB)

    Graf, B.; Lafuma, J.; Parmentier, C.; Parmentier, N. [Commissariat a l' Energie Atomique, Fontenay-aux-Roses (France). Centre d' Etudes Nucleaires

    1968-07-01

    Clinical, hematological and osseous effects following an intramuscular injection of 100 {mu}Ci 90 Sr were studied in the rat. In spite of the magnitude of the injection and the resulting damage, the elimination of strontium could compare with what occurs after an injection at tracer doses. Comparing with the controls at the outcoming time, clinical monitoring mainly brought out a loss of body weight. Fairly early (20. - 30. day) there occurred severe hematological damage, especially on lymphocyte line, which subsided spontaneously. As foreseen, the anatomo-pathological survey of the early period showed bone and medullar lesions in the areas of enchondral ossification. In the late period, bone sarcomas occurred in nine animals out of ten. The outstanding histological type was osteogenic osteosarcomas; besides, two animals experienced bilateral tumors. (authors) [French] Les auteurs etudient les consequences cliniques, hematologiques et osseuses d'une contamination par 100 microcuries de Sr 90 injectes par voie intramusculaire chez le rat. Malgre l'importance de la contamination et les lesions consequentes, l'elimination du Sr 90 est comparable a celle que l'on observe apres injection de doses traceuses. La surveillance clinique ne met essentiellement en evidence, a la periode terminale, qu'une diminution du poids par rapport aux temoins. Les lesions hematologiques sont importantes, predominant sur la lignee lymphocytaire. Elles sont relativement precoces (20e - 30e jours) et regressent spontanement. La surveillance anatomo-pathologique de la periode precoce a montre, comme il etait previsible, des lesions osseuses et medullaires dans les zones d'ossification enchondrale. A la periode tardive, la survenue de sarcomes osseux a ete observee chez neuf animaux sur dix. Le type histologique predominant est l'osteosarcome osteogenique et il faut signaler egalement les tumeurs bilaterales observees chez deux animaux. (auteurs)

  4. Contribution to the study of the leukemia potential of radiation used in radio-diagnostic in children: statistical study of the main radiological examinations according to age and sex (1963); Contribution a l'etude du pouvoir leukemogene des radiations utilisees en radiodiagnostic chez l'enfant: etude statistique des principaux examens radiologiques suivant l'age et le sexe

    Energy Technology Data Exchange (ETDEWEB)

    Larcher, B. [Commissariat a l' Energie Atomique, Fontenay-aux-Roses (France). Centre d' Etudes Nucleaires

    1963-06-15

    With a view to discovering whether low irradiation doses are liable to increase the incidence of leukemia or cancer amongst people exposed to this risk, an enquiry, has been undertaken into the distribution according to age and to sex of 13,596 important radiological examinations carried out in radio-pediatric departments from 1953 to 1961, a population structure study essential for choosing the group studied and the comparison group. This survey will be used as the basis for the constitution of a population whose pathology will be examined with great care. The main conclusion resulting from this enquiry is that the frequency of digestive and urinary examinations is very high in babies of under one year old and higher in boys than in girls. (author) [French] Dans le but de determiner si les faibles doses d'irradiations sont susceptibles d'augmenter le taux de leucemies ou de cancer dans les populations exposees a ce risque, une enquete a ete faite sur la repartition par age et par sexe de 13596 examens radiologiques importants effectues dans des services de radiopediatrie de 1953 a 1961, elude de la structure de la population necessaire pour choisir le groupe etudie et le groupe temoin. Ce releve sert de base a la constitution d'une population dont la pathologie sera recherchee avec soin. De cette enquete, il ressort essentiellement que la frequence des examens digestifs et urinaires est tres elevee chez les nourrissons ages de moins d'un an, et plus elevee chez les garcons que chez les filles. (auteur)

  5. Approche au diagnostic de la maladie cœliaque chez les patients ayant une faible densité minérale osseuse ou des fractures de fragilité

    Science.gov (United States)

    Rios, Lorena P.; Khan, Aliya; Sultan, Muhammad; McAssey, Karen; Fouda, Mona A.; Armstrong, David

    2013-01-01

    Résumé Objectif Présenter aux cliniciens une mise à jour sur le diagnostic de la maladie cœliaque (MC), ainsi que des recommandations sur les indications de procéder au dépistage de la MC chez les patients présentant une faible densité minérale osseuse (DMO) ou des fractures de fragilité. Qualité des données Un groupe de travail multidisciplinaire a élaboré des questions cliniquement pertinentes relativement au diagnostic de la MC servant de fondement à une recherche documentaire dans les bases de données MEDLINE, EMBASE et CENTRAL (de janvier 2000 à janvier 2009) à l’aide des mots clés en anglais celiac disease, osteoporosis, osteopenia, low bone mass et fracture. Les ouvrages scientifiques existants comportent des études de niveaux I et II. Message principal La prévalence estimée de la MC asymptomatique est de 2 % à 3 % chez les personnes qui ont une faible DMO. Par ailleurs, un dépistage ciblé est recommandé pour les patients qui ont des T-scores de −1,0 ou moins à la colonne vertébrale ou aux hanches ou des antécédents de fractures de fragilité associées à des symptômes ou à des problèmes reliés à la MC, des antécédents familiaux de MC ou de bas niveaux de calcium urinaire, une insuffisance en vitamine D et des niveaux à la hausse d’hormones parathyroïdiennes en dépit d’un apport suffisant en calcium et en vitamine D. Le dépistage de la MC devrait se faire pendant que le sujet consomme un régime alimentaire contenant du gluten. On procède au dépistage initial par le dosage d’immunoglobuline (Ig) A antitransglutaminase en utilisant la transglutaminase tissulaire humaine recombinante ou une autre transglutaminase tissulaire, en association avec l’immunofluorescence des IgA anti-endomysium. Une biopsie du duodénum est nécessaire pour confirmer le diagnostic de la MC. Le typage des antigènes des leucocytes humains peut aider à confirmer ou à exclure le diagnostic de la MC dans les cas où la s

  6. Evaluation de l'effet de l'environnement et de l'alimentation sur l'apparition d'anomalies de développement chez l'alevin de bar (Dicentrarchus labrax

    Directory of Open Access Journals (Sweden)

    MENU B.

    1998-07-01

    Full Text Available Une ponte naturelle de bar, obtenue dans les installations expérimentales de Palavas, est mise en élevage dans ce même laboratoire et dans celui de Brest, après un transport fictif ou réel. Les protocoles spécifiques de chacun des deux laboratoires sont utilisés sans changer le contexte d'élevage particulier de chacun des deux sites : mise à jeun à l'obscurité jusqu'à 160 degrés jours et première alimentation sur Artemia à Palavas en bacs de 500 litres et, première alimentation à 75 degrés jours sur rotifères à Brest en bacs de 250 litres et de 35 litres. Dans les conditions d'environnement comparables (bacs de 250 litres à Brest une période de jeûne est également testée, de 75 à 160 degrés jours, soit en obscurité sans aération, soit sous éclairage continu avec aération. Les malformations des vertèbres, des maxillaires, des opercules (courts et soulevés, la non-inflation de la vessie natatoire et la présence de calculs urinaires sont relevées à 3 mois sur tous les lots. Plusieurs malformations apparaissent inféodées à un site ou un traitement particulier : cristaux urinaires à Palavas, vessies natatoires non fonctionnelles à Brest, maxillaires anormaux en bac de 35 litres. Les opercules soulevés sont observés dans deux installations utilisant des méthodologies différentes mais sont négligeables dans la ligne d'élevage où les tests méthodologiques ont été effectués. Les taux de survie sont significativement influencés par les traitements. La répartition des fréquences des lordoses entre les sites ou les différents traitements peut s'interpréter comme une conséquence de mortalités sélectives. L'association entre les lordoses et les vessies natatoires non fonctionnelles, déjà connue chez le bar, est observée. L'étude des fréquences croisées des malformations montre également que les opercules courts sont 10 fois plus fréquents chez les individus dont les vessies natatoires ne sont

  7. Épidémiologie des brûlures de la main chez les enfants vus dans le Centre National des Brûlés et de Chirurgie Plastique de Casablanca, Maroc

    Science.gov (United States)

    Rafik, A.; Lahlou, M.; Diouri, M.; Bahechar, N.; Chlihi, A.

    2015-01-01

    Summary Les brûlures de la main chez l’enfant constituent une source de séquelles invalidantes. A cet régard, la conservation et la restauration complète de la fonction de la main demeurent le but primordial de la prise en charge. Afin de répertorier les caractéristiques épidémiologiques, cliniques et évolutives des mains brûlées, nous avons réalisé une étude rétrospective étalée sur 4 ans, de janvier 2011 à janvier 2015. Cette étude a permis de colliger les cas de 313 enfants atteints de brûlure de la main vus dans le Centre National des Brulés et de Chirurgie Plastique du CHU Ibn Rochd de Casablanca. La majorité des brûlures touche les enfants de 3 à 6 ans (70% des cas), avec une légère prédominance masculine. La principale cause des brûlures survenant à cet âge est l’ébouillantement. Les brûlures par flamme représentent 33% des cas, celles par électricité 4,5%. Les brûlures chimiques et par contact sont anecdotiques (1 cas chacune). L’accident survient le plus souvent à domicile. Soixante douze pour cent des brûlures ont guéri spontanément. Afin de diminuer l’incidence de ces accidents, une approche préventive faite de sensibilisation et d’éducation devrait faire partie du cursus scolaire. PMID:27777543

  8. Experimental results concerning the metabolism of ingested iodine-131 in adult sheep under lactation; Resultats experimentaux relatifs au metabolisme de l'iode 131 ingere chez la brebis adulte en lactation

    Energy Technology Data Exchange (ETDEWEB)

    Daburon, F.; Capelle, A.; Tricaud, Y.; Nizza, P. [Commissariat a l' Energie Atomique, 92 - Fontenay-aux-Roses (France). Centre d' Etudes Nucleaires. Departement de la Protection Sanitaire, Laboratoire-etable de Radiobiologie Appliquee

    1967-07-01

    The authors give the results of a series of experiments on metabolism of ingested iodine-131 in adult sheep under lactation; the measurement were carried out over a number of years from 1961 to 1966. The work was concerned initially with the fixation of iodine 131 in the thyroid gland, with the calculation of radiation doses absorbed and with ways of showing up any possible radiation damage in the gland. The modes of absorption of iodine 131 and its elimination through milk, urine and the faeces were then considered. Finally, a last chapter is devoted to changes in the radioactivity of the blood and of the milk, to variations of the PBI level of the blood serum as to different methods for measuring this level. (authors) [French] Les auteurs rapportent les resultats d'une serie d'experimentations relatives au metabolisme de l'iode 131 ingere chez la brebis adulte en lactation, et qui se sont etalees sur plusieurs annees, de 1961 a 1966. Les etudes ont porte d'abord sur les aspects de la fixation de l'iode 131 dans la thyroide, avec le calcul des doses de rayonnements absorbees et les moyens de mettre en evidence les radiolesions eventuelles de la glande. Ensuite ont ete traitees les modalites de l'absorption de l'iode 131 et de son elimination par le lait, les urines et les feces. Enfin un dernier chapitre a ete consacre a l'evolution de la radioactivite du sang et du lait, aux variations ainsi qu'aux divers moyens d'evaluation du taux de PBI du serum sanguin. (auteurs)

  9. Facteurs prédictifs de la réponse à la CERA chez les hémodialysés chroniques naïfs de traitement par agent stimulant l’érythropoïèse

    Science.gov (United States)

    Ezziani, Mariam; Najdi, Adil; Mikou, Souad; Hanin, Hakim; Arrayhani, Mohammed; Houssaini, Tarik Sqalli

    2015-01-01

    La correction et la stabilité du taux d'hémoglobine est un objectif majeur du traitement de l'anémie chez les hémodialysés chroniques. Toutefois, la cible d'hémoglobine > 11g/dl fixée par les recommandations demeure difficile à atteindre dans notre contexte. Le but de cette étude est d’évaluer la réponse au traitement par CERA (continuous erythropoietin receptor activator) chez une population d'hémodialysés chroniques naïfs de tout traitement par agent stimulant de l’érythropoïèse et étudier les différents facteurs associés à une mauvaise réponse au traitement. Il s'agit une étude prospective mono centrique faite au sein d'une population d’ hémodialysés chroniques. Ont été inclus les patients en hémodialyse depuis plus de 12 mois, naïfs de tout traitement par agent stimulant de l’érythropoïèse (ASE) et ayant un taux d'hémoglobine(Hb) 11g/dl. Sur 87 patients en hémodialyse périodique, 22 (25,3%) sont naïfs de tout traitement par ASE. Il s'agit de 13 hommes et 9 femmes avec un âge moyen de 46 ± 19 ans et une ancienneté en hémodialyse de 67 ± 59 mois. Le taux initial d'hémoglobine est de 7,8 ± 1,3 g/dl. Au bout de 4 mois de traitement régulier par la CERA, le taux final d'Hb est de 10,9 ± 2,1g/dl et 63,6% des patients ont atteint la cible d'Hb > 11g/dl. La dose moyenne de CERA à la fin de l’étude est de 0,89 ± 0,35 µg/kg/15j. L'analyse des facteurs prédictifs montre que la réponse finale dépend du taux d'Hb initial (p = 0,002). En effet, quand le taux d'Hb initial est > 8 g/dl, le taux de réponse est de 88% vs 46% lorsque le taux d'Hb gestion de l'anémie rénale est devenue meilleure avec une amélioration de la qualité de vie des patients [5–9]. Les recommandations de bonne pratique suggèrent actuellement le maintien de l'Hb à un taux > 11 g/dl sans dépasser 13 g/dl [9, 10]. Cependant, le maintien d'un taux d'hémoglobine stable nécessite du temps, des ressources humaines et financières et exige

  10. Photobiological hydrogen production.

    Science.gov (United States)

    Asada, Y; Miyake, J

    1999-01-01

    The principles and recent progress in the research and development of photobiological hydrogen production are reviewed. Cyanobacteria produce hydrogen gas using nitrogenase and/or hydrogenase. Hydrogen production mediated by native hydrogenases in cyanobacteria occurs under in the dark under anaerobic conditions by degradation of intracellular glycogen. In vitro and in vivo coupling of the cyanobacterial photosynthetic system with a clostridial hydrogenase via cyanobacterial ferredoxin was demonstrated in the presence of light. Genetic transformation of Synechococcus PCC7942 with the hydrogenase gene from Clostridium pasteurianum was successful; the active enzyme was expressed in PCC7942. The strong hydrogen producers among photosynthetic bacteria were isolated and characterized. Coculture of Rhodobacter and Clostriudium was applied for hydrogen production from glucose. A mutant strain of Rhodobacter sphaeroides RV whose light-harvesting proteins were altered was obtained by UV irradiation. Hydrogen productivity by the mutant was improved when irradiated with monochromatic light of some wavelengths. The development of photobioreactors for hydrogen production is also reviewed.

  11. The study of photo-induced ultrafast dynamics in light-harvesting complex LH2 of purple bacteria

    Institute of Scientific and Technical Information of China (English)

    LIU Wei-min; YAN Yong-li; LIU Kang-jun; XU Chun-he; QIAN Shi-xiong

    2006-01-01

    In this paper,we introduce the photo-induced ultrafast dynamics taking place in the peripheral light harvesting antenna LH2 from purple bacteria Rhodobacter sphaeroides by using absorption,fluorescence emission and ultrafast spectroscopic techniques.Three kinds of LH2 sampies,pH treated LH2 (complete removal of B800 pigments),carotenoid mutated LH2 (GM 309) and electrochemical oxidation treated LH2 were used in comparison with native LH2 to investigate the mechanism of photo-induced ultrafast energy transfer within the LH2 complex.

  12. AcEST: DK956327 [AcEST

    Lifescience Database Archive (English)

    Full Text Available tr|Q470H5|Q470H5_RALEJ Probable proline-rich protein OS=Ralstoni... 35 4.3 tr|A4WX08|A4WX08_RHOS5 Antenna co...ell division protein OS=Bacillus thuring... 33 9.5 tr|A3PG62|A3PG62_RHOS1 Antenna complex, alpha/beta subuni...tr|A4WX08|A4WX08_RHOS5 Antenna complex, alpha/beta subunit OS=Rhodobacter sphaeroides (strain ATCC 17025 / A... E A S Sbjct: 68 PVTEALPVSPSKAPAQASAPATEDSNLFSLYAMRRVEAPAAQAPVAALSPASEDAVHS 125 >

  13. A Conserved Steroid Binding Site in Cytochrome c Oxidase

    Energy Technology Data Exchange (ETDEWEB)

    Qin, Ling; Mills, Denise A.; Buhrow, Leann; Hiser, Carrie; Ferguson-Miller, Shelagh (Michigan)

    2010-09-02

    Micromolar concentrations of the bile salt deoxycholate are shown to rescue the activity of an inactive mutant, E101A, in the K proton pathway of Rhodobacter sphaeroides cytochrome c oxidase. A crystal structure of the wild-type enzyme reveals, as predicted, deoxycholate bound with its carboxyl group at the entrance of the K path. Since cholate is a known potent inhibitor of bovine oxidase and is seen in a similar position in the bovine structure, the crystallographically defined, conserved steroid binding site could reveal a regulatory site for steroids or structurally related molecules that act on the essential K proton path.

  14. Biodegradation of azo dyes by genetically engineered azoreductase

    Institute of Scientific and Technical Information of China (English)

    WANG Jing; YAN Bin; ZHOU Ji-ti; BAO Yong-ming; LU Hong; YUAN Xiao-dong

    2005-01-01

    A azoreductase gene with 537 bp was obtained by PGR amplification from Rhodobacter sphaeroides AS1.1737. The enzyme,with a molecular weight of 18.7 kD, was efficiently expressed in Escherichia coli and its biodegradation characteristics for azo dyes were investigated. Furthermore, the reaction kinetics and mechanism of azo dyes catalyzed by the genetically engineered azoreductase were studied in detail. The presence of a hydrazo-intermediate was identified, which provided a convincing evidence for the assumption that azo dyes were degraded via an incomplete reduction stage.

  15. Continuous Cultivation of Photosynthetic Bacteria for Fatty Acids Production

    OpenAIRE

    Kim, Dong-Hoon; Lee, Ji-Hye; Hwang, Yuhoon; Kang, Seoktae; Kim, Mi-Sun

    2013-01-01

    In the present work, we introduced a novel approach for microbial fatty acids (FA) production. Photosynthetic bacteria, Rhodobacter sphaeroides KD131, were cultivated in a continuous-flow, stirred-tank reactor (CFSTR) at various substrate (lactate) concentrations.At hydraulic retention time (HRT) 4 d, cell concentration continuously increased from 0.97 g dcw/L to 2.05 g dcw/L as lactate concentration increased from 30 mM to 60 mM. At 70 mM, however, cell concentration fluctuated with incomple...

  16. L’espace péruvien chez le précurseur des Indépendances Viscardo y Guzmán : inscription territoriale, parcours géographico-historique et abandon spatial

    Directory of Open Access Journals (Sweden)

    Nicolas De Ribas

    2012-01-01

    Full Text Available La réflexion émancipatrice de Juan Pablo Viscardo, le précurseur idéologique des Indépendances ibéro-américaines, va clairement s’amorcer et se façonner lorsque ce jésuite va abandonner le Cusco en 1767, et donc se confronter à un nouvel espace, l’espace européen. Par le mouvement qu’il engendre, cet exil va être un acte créateur de réflexions et de nouveaux espaces qui va instaurer alors, entre autres choses, une dialectique entre un extérieur étranger et un intérieur familier. Chez le jésuite, le voyage dans l’espace géographique est aussi la métaphore du parcours initiatique qui transforme le jeune homme et le rend progressivement conscient de qui il est. Cette connaissance de soi va alors devenir indissociable de la connaissance de la société coloniale et de la conscience de son appartenance à un espace américain à reconstruire. Ses pérégrinations en Italie et en Angleterre permettent ainsi à ce personnage historique insigne de rassembler les fragments de sa personnalité individuelle et de reformer le puzzle d’une identité collective historique.La reflexión emancipadora de Juan Pablo Viscardo, el precursor ideológico de las Independencias iberoamericanas, se inicia y se estructura cuando el jesuita abandona el Cuzco en 1767, y entonces se confronta con un nuevo espacio, el espacio europeo. Con los movimientos engendrados, este exilio es un acto creador de reflexiones y de nuevos espacios que instaura entonces, entre otras cosas, una dialéctica entre un exterior extranjero y un interior familiar. En la obra del jesuita, el viaje en el espacio geográfico es también la metáfora de un proceso iniciático que transforma al joven hombre, y gracias al cual éste toma conciencia de sí mismo. Este conocimiento de su persona se convierte en algo inseparable del conocimiento de la sociedad colonial y de la conciencia de su pertenencia a un espacio americano que hay que reconstruir. Sus viajes italianos e

  17. Séroprévalence du virus de l'herpès humain-8 chez des patients VIH positif à l'hôpital général de Yaoundé – Cameroun

    Science.gov (United States)

    Jacky, Njiki Bikoï; Paul, Ndom; Lilian, Mupang; Sylvie, Agokeng Demanou

    2015-01-01

    L'épidémiologie de l'infection par le virus herpès humain de type 8 (HHV8) associée à celle à VIH, reste encore méconnue au Cameroun, bien que le pays soit considéré comme une zone endémique pour ces deux virus. L'objectif de ce travail était de ressortir le profil de la séroprévalence du HHV8 au sein de notre population d'étude. 57 personnes ont été recrutées à l'Hôpital Général de Yaoundé et suivies sur une durée 12 mois. Des anticorps IgG anti-HHV8 ont été déterminés par ELISA. Des paramètres autres, tels que l'âge, le sexe, le stade des maladies (SK et VIH/SIDA), le protocole ARV, ainsi que les taux de CD4 ont été utilisés pour déterminer les variables associées à la séropositivité au HHV8. Cette association a été évaluée par le test khi carré. La séroprévalence du HHV8 était de 90% dans notre population en début d'étude et de 74% douze mois plus tard, une séroprévalence qui restait élevée quelque soit le profil clinique, la tranche d'âge, le sexe ou le taux de CD4+ de l'individu. Aucune variable de l'étude n'était significativement associée à la séropositivité du HHV8. Le virus HHV8 semblait circuler au sein de notre population d'étude. Cependant l'on constate, douze mois plus tard, l'absence de manifestations cliniques du SK chez les patients VIH+ positifs, malgré des titres très élevés en IgG anti-HHV8. PMID:26090027

  18. Profil épidémio-clinique des dermatoses chez les enfants vus en consultation dermatologique dans le service de dermatologie du centre national d’appui à la lutte contre la maladie à Bamako (Mali)

    Science.gov (United States)

    Fofana, Youssouf; Traore, Bekaye; Dicko, Adama; Faye, Ousmane; Berthe, Siritio; Cisse, Lamissa; Keita, Alimata; Tall, Koureissi; Kone, Mamadou Bakary; Keita, Somita

    2016-01-01

    Introduction Les maladies de peau constituent un problème majeur de santé publique dans les pays en voie développement. En pratique courante les enfants représentent la couche sociale la plus touchée. Le but de notre travail était de décrire les aspects épidémio- cliniques des dermatoses chez les enfants de 0-15 ans dans le service de dermatologie du centre national d’appui à la lutte contre la maladie à Bamako, Mali. Méthodes Il s’agissait d’une étude transversale effectuée au cours de la période allant du premier janvier 2009 au 31 Décembre 2009 dans le service de Dermato-vénérologie du centre national d’appui à la lutte contre la maladie. Sur un total de 16339 patients ayant fait une consultation dermatologique 5149 enfants ont été inclus. Résultats La fréquence hospitalière des dermatoses infantiles était de 31,51%. Les malades se répartissaient en 2838 garçons (55,10%) et 2311 filles (44,90%) soit un sex-ratio de 1,22. L’âge des malades variait de 03 jours à 15 ans avec une moyenne d’âge de 8±5,7 ans. Parmi les affections retrouvées les dermatoses infectieuses représentaient 55,10% de l’ensemble des dermatoses, les dermatoses immuno-allergiques (32,5%), les dermatoses inflammatoires (11,85%). Conclusion Notre étude a révélé l’importance des pathologies infectieuses et immuno-allergiques et la nécessité de mener des actions de prévention simple comme l’hygiène, l’achat d’une tondeuse pour chaque enfant. PMID:28293354

  19. Facteurs associes a l'asthme sévère chez les patients asthmatiques suivis au Centre National Hospitalier de Pneumo-phtisiologie de Cotonou (Benin) en 2014

    Science.gov (United States)

    Santos, Bella Adodo Hounkpe–Dos; Gbary, Akpa Raphaël; Kpozehouen, Alphonse; Kassa, Ferdinand

    2015-01-01

    Introduction la présente étude vise à déterminer la fréquence de l'asthme sévère chez les patients asthmatiques suivis au Centre National Hospitalier de Pneumo-Phtisiologie (CNHPP) de Cotonou et identifier les facteurs de risque qui lui sont associés Méthodes l’étude transversale, descriptive et analytique a porté sur 213 patients asthmatiques de la file active 2013 du CNHPP. Les données ont été collectées par l'exploitation des dossiers et l'entretien individuel avec les patients. Elles ont été traitées et analysées à l'aide des logiciels EPIINFO7 et STATA11. Le test Chi2 de Pearson, la régression logistique uni variée et multi variée ont été utilisés au seuil de signification de 0,05 Résultats au total, 154 patients asthmatiques soit 72,7% ont répondu au questionnaire. Parmi eux 20,8% (IC95%:(14,67; 28,05)) souffraient d'asthme sévère. L’âge des patients s’étendait de 10 à 76 ans avec une médiane de 41 ans; 51,3% étaient de sexe féminin, 79,9% avaient des antécédents d'allergie, 61,7% ont commencé leur asthme après l’âge de 12 ans et seuls 11% ont consommé ou consommaient du tabac. Les facteurs associés à la survenue de l'asthme sévère étaient: l’âge de 46 à 55 ans (p = 0,04); les troisième et quatrième quintiles du bien-être économique (p = 0,01) et le début de l'asthme après l’âge de 12 ans (p < 0,001) Conclusion l’étude a montré une fréquence élevée de l'asthme sévère au Bénin et permettra d'améliorer sa prise en charge au CNHPP. PMID:26600910

  20. Diagnostic moléculaire d'helicobacter pylori par PCR chez les patients en consultation gastroentérologique au Centre Médical Saint Camille de Ouagadougou

    Science.gov (United States)

    Werme, Karidia; Bisseye, Cyrille; Ouedraogo, Issiaka; Yonli, Albert Théophane; Ouermi, Djénèba; Djigma, Florencia; Moret, Rémy; Gnoula, Charlemagne; Nikiema, Jean-Baptiste; Simpore, Jacques

    2015-01-01

    Introduction L'infection par Helicobacter pylori constitue un problème de santé publique notamment dans les pays en développement. Elle entraine une gastrite pouvant évoluer vers des formes sévères d'ulcération et de transformation maligne. La présenté étude avait pour objectif de diagnostiquer H. pylori par des techniques sérologique et moléculaire au Burkina Faso. Méthodes L’étude prospective a été conduite de mars à juin 2012 sur 70 patients venus en consultation dans le service de gastroentérologie au Centre Médical Saint Camille. Le diagnostic de H. pylori a été réalisé par le test ELISA Immunocomb (ORGENICS Ltd, Yavne, Israël) et la PCR sur des biopsies gastriques prélevées sur les patients. Résultats Les pathologies gastroduodénales étaient plus fréquentes chez les patients de plus de 45 ans. Les prévalences de H. pylori étaient respectivement de 88,57% et de 91,43% par sérologie Immunocomb et par PCR. La différence entre les deux techniques n’était pas significative (P = 0,573). La performance de la PCR a été comparée à celle de la technique Immunocomb. Les résultats montrent une sensibilité et une spécificité de 92,2% et 50,0% pour la technique Immunocomb. Conclusion Le diagnostic de H. pylori par PCR est plus spécifique que le test sérologique Immunocomb et devrait être introduit dans le diagnostic de routine de cette bactérie pathogène au Burkina Faso. PMID:26327960

  1. Reverse micelles as suitable microreactor for increased biohydrogen production

    Energy Technology Data Exchange (ETDEWEB)

    Pandey, Anjana [Nanotechnology and Molecular Biology Laboratory, Centre of Biotechnology, University of Allahabad, Allahabad 211002 (India); Pandey, Ashutosh [Centre of Energy Studies, MNNIT, Allahabad 211004 (India)

    2008-01-15

    Reverse micelles have been shown to act as efficient microreactors for enzymic reactions and whole cell entrapment in organic (non-aqueous) media wherein the reactants are protected from denaturation by the surrounding organic solvent. These micelles are thermodynamically stable, micrometer sized water droplets dispersed in an organic phase by a surfactant. It has been observed that when whole cells of photosynthetic bacteria (Rhodopseudomonas sphaeroides or Rhodobacter sphaeroides 2.4.1) are entrapped inside these reverse micelles, the H{sub 2} production enhanced from 25 to 35 folds. That is, 1.71mmol(mgprotein){sup -1}h{sup -1} in case of R. sphaeroides which is 25 fold higher in benzene-sodium lauryl sulfate reverse micelles. Whereas, in case of R. sphaeroides 2.4.1 the H{sub 2} production was increased by 35 fold within AOT-isooctane reverse micelles i.e. 11.5mmol(mgprotein){sup -1}h{sup -1}. The observations indicate that the entrapment of whole cells of microbes within reverse micelles provides a novel and efficient technique to produce hydrogen by the inexhaustible biological route. The two microorganisms R. sphaeroides 2.4.1 (a photosynthetic bacteria) and Citrobacter Y19 (a facultative anaerobic bacteria) together are also entrapped within AOT-isooctane and H{sub 2} production was measured i.e. 69mmol(mgprotein){sup -1}h{sup -1}. The nitrogenase enzyme responsible for hydrogen production by R. sphaeroides/R. sphaeroides 2.4.1 cells is oxygen sensitive, and very well protected within reverse micelles by the use of combined approach of two cells (R. sphaeroides 2.4.1 and Citrobacter Y19). In this case glucose present in the medium of Citrobacter Y19 serves double roles in enhancing the sustained production rate of hydrogen. Firstly, it quenches the free O{sub 2}liberated as a side product of reaction catalyzed by nitrogenase, which is O{sub 2} labile. Secondly, organic acid produced by this reaction is utilized by the Citrobacter Y19 as organic substrate in

  2. Nutrition et santé : lipides et protéines d’origine végétale - De nouvelles données pour juger de la qualité des protéines végétales chez l’homme - Implications et perspectives

    Directory of Open Access Journals (Sweden)

    Mariotti François

    2003-01-01

    Full Text Available La qualité des protéines pour l’alimentation de l’homme est un sujet très ancien mais les différentes méthodes proposées jusqu’ici pour évaluer la qualité protéique ont été largement critiquées, pour des problèmes conceptuels et méthodologiques. Depuis quelques années des avancées ont pu être faites grâce à l’emploi d’isotopes stables dans la phase postprandiale chez l’homme. Ces techniques proposent des mesures fines et conceptuellement adaptées pour évaluer la qualité des protéines et explorer le concept de qualité protéique. Ces approches ont montré que les différences globales de qualités entre sources protéiques chez l’homme au bon statut nutritionnel sont bien plus faibles que cela n’était attendu. Parallèlement, la nature des protéines alimentaires pourrait avoir des effets métaboliques plus subtils, au niveau de certains tissus ou au niveau des voies métaboliques secondaires de certains acides aminés, dont il faudra mesurer l’étendue et évaluer les conséquences physiologiques et fonctionnelles.

  3. La percezione del ruolo materno in madri detenute/La perception du rôle maternel chez les mères détenues/The Perception Incarcerated Mothers' Maternal role

    Directory of Open Access Journals (Sweden)

    Agostini Francesca

    2011-12-01

    Full Text Available Nel panorama nazionale ed internazionale non si discute ancora abbastanza della maternità vissuta in carcere, tuttavialargamente diffusa e quindi tema che merita opportuni approfondimenti al fine di promuovere la ricerca di strategie chegarantiscano il diritto della donna detenuta ad essere madre e il diritto dei figli a non essere privati di questo legame.Questo studio esplorativo, svolto presso la Casa Circondariale “Dozza” di Bologna, nella sezione femminile, ha avutocome obiettivo quello di indagare le caratteristiche della percezione del ruolo materno in donne detenute che non vivonocon il proprio figlio. Attraverso le interviste e l’uso di strumenti standardizzati, si è approfondito il tipo di maternitàesperita dalle donne e le difficoltà personali che la lontananza e l’ambiente frappongono alla possibilità di svolgereadeguatamente il proprio ruolo genitoriale. Pur essendo piccolo il campione, le indagini qualitative hanno consentito dievidenziare un quadro di consistente sofferenza, con utilizzo di meccanismi difensivi quali processi di idealizzazionedell’esperienza di maternità e di razionalizzazione.RésuméDans le panorama national et international, on ne discute pas encore assez de la maternité vécue en prison. Toutefois,celle-ci est largement répandue. Partant, il s’agit d’un thème qui mérite d’être approfondi afin de promouvoir larecherche de stratégies qui garantissent le droit de la femme détenue à être mère et le droit des enfants à ne pas êtreprivés de ce lien.Cette étude - réalisée dans le quartier pour femmes de la maison d’arrêt "Dozza" de Bologne - a eu comme objectifd’analyser les caractéristiques de la perception du rôle maternel chez les femmes détenues qui ne vivent pas avec leurspropres enfants. À travers les entretiens et l'usage d'instruments standardisés, nous avons approfondi le type dematernité vécue par ces femmes et les difficultés personnelles que l

  4. L’exposition contrôlée à la lumière et à l’obscurité ajuste le rythme du cortisol salivaire chez les travailleurs de nuit

    Directory of Open Access Journals (Sweden)

    Anny Casademont

    2005-05-01

    Full Text Available Dans cette étude réalisée sur le terrain et en laboratoire, nous avons testé l’efficacité d’une intervention consistant à contrôler l’exposition à la lumière/obscurité de façon à favoriser l’adaptation circadienne au travail de nuit. Six travailleurs permanents de nuit (moyenne d’âge 37,1 ± σ : 8,1 ans avaient comme consigne de s’exposer de façon intermittente à une lumière blanche vive plein spectre (~2 000 lux au cours des 6 premières heures de leur quart de travail de 8 heures. Il leur était demandé de se protéger de la lumière solaire du matin avec des verres teintés (densité gris neutre, transmission visuelle de la lumière 15 % et de maintenir des épisodes réguliers de sommeil/obscurité dans une pièce très sombre. Ces épisodes devaient commencer 2 heures après la fin de chaque quart de travail de nuit. Cinq travailleurs du groupe contrôle (41,1 ± σ : 9,9 ans ont été étudiés alors qu’ils devaient uniquement maintenir un horaire régulier de sommeil/obscurité. Des procédures de routine constante, réalisées avant et après une série d’environ 12 quarts de travail de nuit s’échelonnant sur 3 semaines, ont montré chez les travailleurs du groupe traitement une variation significative dans l’heure d’apparition du pic de cortisol ainsi qu’un ajustement de ce rythme à un horaire de travail de nuit. Un plus petit changement de phase a été observé dans le groupe contrôle, ce qui suggère une adaptation partielle à l’horaire de travail de nuit. Nos résultats démontrent l’efficacité d’une exposition judicieuse à la lumière et à l’obscurité pour favoriser l’adaptation des rythmes physiologiques au travail de nuit.The efficacy of a light/darkness intervention designed to promote circadian adaptation to night shift work was tested in this combined field and laboratory study. Six permanent night shift workers (mean age: 37.1 / s: 8.1 years were instructed to

  5. Roman versus politique chez Milan Kundera

    OpenAIRE

    Ivanova, Velichka

    2016-01-01

    Le xxe siècle a vu le règne et l’effondrement de régimes politiques dictatoriaux. Convaincus que l’homme dirige l’histoire vers le bonheur et le progrès, leurs adeptes affirmaient avoir déjà réalisé l’utopie et assuré le bonheur collectif. Expulsée du non-lieu imaginaire auquel elle appartient, l’aspiration à une vie meilleure devient idéologie et se trouve soudain inféodée au pouvoir. L’idéologie, que Paul de Man définit comme « la confusion de la réalité linguistique avec la réalité naturel...

  6. Le biopouvoir chez Foucault et Agamben

    Directory of Open Access Journals (Sweden)

    Katia Genel

    2012-01-01

    Full Text Available Foucault repère une transformation du pouvoir lorsque la vie entre dans ses préoccupations à partir du XVIIIe siècle. Il appelle « bio-pouvoir » les techniques spécifiques du pouvoir s’exerçant sur les corps individuels et les populations, hétérogènes aux mécanismes juridico-politiques du pouvoir souverain. Agamben, dans Homo sacer, reprend l’hypothèse foucaldienne et la fait fonctionner précisément sur le terrain délaissé par Foucault, celui de la souveraineté. La souveraineté ne porte pas à ses yeux sur des sujets de droits, mais de manière cachée sur une « vie nue », ex-ceptée par le pouvoir qui l’expose à sa violence et à sa décision souveraine. On peut alors interroger le déplacement de l’hypothèse foucaldienne opéré par Agamben et les rapports problématiques entre pouvoir souverain et bio-pouvoir, afin d’évaluer la pertinence et la fécondité de la notion de bio-pouvoir.According to Foucault, a transformation in the way of exerting power can be discerned from the 18th century onwards, as life becomes a topic of concern for power itself. « Biopower » is the term he uses to describe the new tactics of power when it focuses on life, that is to say individual bodies and populations; when such mechanisms differ from those that exert their influence in the legal and political sphere of sovereign power. In Homo sacer, Agamben takes up Foucault’s analysis and brings it into play on the very terrain that the latter wanted to break with, namely the field of sovereignty. He argues that sovereign power is not linked to rightholders, but is covertly linked to a «bare life», which is life included in the political realm by a paradoxical exclusion, exposed to the violence and the decision of sovereign power. It is consequently interesting to examine how Agamben shifts the emphasis from Foucault’s standpoint and the difficult relationship between sovereign power and biopowers, in order to assess the relevance and fruitfulness afforded by the notion of biopower.

  7. "Les Hollande" de Whistler chez Proust

    NARCIS (Netherlands)

    M. van Montfrans

    2011-01-01

    Le rôle que les portraits mondains et les marines de Whistler, l’un des modèles d’Elstir, ont joué dans la Recherche, a fait l’objet de nombreux commentaires. Il n’en est pas de même pour « les Hollande », fruit des séjours fréquents du peintre aux Pays-Bas. Les rares références aux voyages en Holla

  8. Individu et individualisme chez Marguerite Yourcenar

    Directory of Open Access Journals (Sweden)

    Nicolas Di Méo

    2008-07-01

    Full Text Available Dans les œuvres de Marguerite Yourcenar, l’autonomie de l’individu se trouve remise en cause à la fois par la modernité, perçue comme un phénomène uniformisant, et par le souci de l’écrivain de découvrir les liens étroits qui unissent l’homme au reste du cosmos. Le rôle de l’individu reste cependant essentiel, dans la mesure où il apparaît comme l’unique voie d’accès à l’universel et comme le médiateur par excellence entre la dimension fragmentée de l’existence historique et les abîmes ontologiques infinis que l’auteur se propose d’explorer.

  9. Caractérisation éthologique de l’émotivité chez le cercopithèque de Brazza (Cercopithecus neglectus Ethological characterization of emotivity in the de Brazza's monkey (Cercopithecus neglectus

    Directory of Open Access Journals (Sweden)

    Hélène Meunier

    2009-09-01

    environnement social d’un individu (présence ou absence de congénères sur son degré d’émotivité. En présence de congénères, des profils individuels ont pu être dressés, les cinq sujets testés présentant des caractéristiques individuelles persistantes à travers les différentes sessions d’observation. Suite à un isolement social (expérience 1, les modifications comportementales les plus marquantes chez la majorité des individus, portent sur les comportements d’exploration de l’environnement, les comportements locomoteurs et l’émission de vocalisations. Toutefois plus le degré d’isolement augmente, plus les profils individuels divergent ; il apparaît ainsi une individualisation du comportement avec le degré d’isolement. Lors du test de réaction à la nouveauté (expérience 2, certaines catégories de comportement se sont trouvées modifiées alors qu’elles ne l’étaient pas lors du test d’isolement social. Ce sont ces modifications comportementales qui peuvent être considérées comme réponse à la nouveauté sans biais de l’isolement social. Nous avons pu distinguer trois types de réaction à un objet nouveau : (1 une néophobie importante avec beaucoup de vocalisations de menace vis-à-vis de l’objet mais peu d’approche ; (2 une certaine « curiosité » avec des individus qui restent menaçants mais présentent plus d’approche et d’exploration de l’objet ; et enfin (3 une réponse plus modérée avec très peu de réactions face à l’objet nouveau. En conclusion des profils individuels d’émotivité chez le singe de Brazza ont pu être établi grâce à deux tests expérimentaux, ces profils divergeant avec le degré d’isolement social. De plus, cette étude soulève l’importance de coupler les expériences (isolement social et réaction à la nouveauté afin de pouvoir mettre en évidence la réaction spécifique à la nouveauté sans biais de l’isolement social.The understanding of the functioning of

  10. Quantification de la Charge Virale et tests de résistance du VIH-1 aux ARV à partir d’échantillons DBS (Dried Blood Spots chez des patients Guinéens sous traitement antirétroviral

    Directory of Open Access Journals (Sweden)

    Nestor Bangoura

    2015-05-01

    Full Text Available Problématique: Comme dans plusieurs pays du Sud, le suivi virologique des patients sous traitement antirétroviral (TARV en Guinée est timide voire inexistant dans certaines localités. Le but de cette étude était d’évaluer la faisabilité technique et logistique de l’utilisation des DBS dans les tests de charge virale (CV et de génotypage.Méthode: De septembre à octobre 2010, les DBS ont été préparés à partir de prélèvements sanguins de patients adultes sous TARV. Le délai d’envoi des échantillons au laboratoire de référence était de 30 jours maximum après le prélèvement et se faisait à température ambiante. La CV a été quantifiée et les échantillons de patients en échec virologique (CV ≥ 3 log10 copies/mL ont été génotypés selon le protocole de l’ANRS. L’algorithme de Stanford version 6.0.8 a été utilisé pour l’analyse et l’interprétation des mutations de résistance.Résultats: Parmi les 136 patients inclus, 129 et 7 étaient respectivement sous première et deuxième ligne de traitement avec une médiane de suivi de 35 mois [IQR: 6-108]. L’échec virologique a été noté chez 33 patients. Parmi eux, 84.8% (n = 28/33 ont bénéficié d’ungénotypage. Le taux de résistance global était de 14% (n = 19/136. Le CRF02_AG était le sous type viral le plus prévalent (82%; n = 23.Conclusion: En plus de montrer la faisabilité technique et logistique des tests de CV et de génotypage à partir des DBS, ces résultats montrent l’intérêt de leurs utilisations dans le suivi virologique des patients sous TARV. Cette étude a permis également de documenter l’échec virologique, la résistance aux ARV et la diversité génétique du VIH-1 en Guinée.Mots clés: VIH-1, Résistance aux ARV, DBS (Dried Blood Spots, Guinée Conakry, Génotypage,Charge Virale. Quantification of Viral load and resistance tests of HIV-1 to ARVs from dried blood spotssamples in Guinean patients undergoing

  11. Metabolism of {sup 137}cesium, {sup 137}barium in the rat. Therapeutics of the contamination; Metabolisme du {sup 137}cesium, {sup 137}baryum chez le rat. Therapeutique de la contamination

    Energy Technology Data Exchange (ETDEWEB)

    Remy, J.; Philippon, A.; Lafuma, J.; Walter, C. [Commissariat a l' Energie Atomique, 92 - Fontenay-aux-Roses (France). Centre d' Etudes Nucleaires. Departement de la Protection Sanitaire, Laboratoire de Radiopathologie

    1967-07-01

    'elimination du {sup 137}Cs - {sup 137}Ba chez le rat. Ils montrent l'independance de ces phenomenes vis-a-vis des modalites d'une administration unique. La distribution tend dans tous les cas vers un schema type qui se maintient ensuite identique a lui-meme en fonction de la charge corporelle. L'analyse biochimique de l'etat du cesium dans les milieux biologiques montre qu'il y est transporte sous une forme libre et ionisee. Abordant le probleme du mode de penetration de l'ion cesium dans le milieu intracellulaire et notamment par l'etude cinetique du systeme plasma-hematie in vivo et in vitro, les auteurs adoptent l'hypothese d'un transport actif du cesium par la membrane cellulaire. Ils en arrivent ainsi a un schema general de la distribution du cesium dans l'organisme, essentiellement caracterise par un equilibre dynamique de repartition entre deux compartiments: 99 pour cent du cesium est accumule dans le pool intracellulaire, 1 pour cent dans les liquides extracellulaires. Ce dernier compartiment est ouvert sur les emonctoires. Du fait du transport actif par les membranes cellulaires, la charge du pool intracellulaire est rapide, mais la decharge est lente. Ce phenomene est le facteur limitant de la decroissance de la charge corporelle. De ce schema les auteurs deduisent les raisons de l'echec relatif des diverses voies therapeutiques explorees a ce jour par eux-memes, et par d'autres auteurs. La stimulation des emonctoires naturels, dans le cas des diuretiques par exemple, ne saurait accroitre que l'epuration du compartiment extracellulaire. Or ce dernier ne contient que 1 pour cent de la charge corporelle et sa recharge est lente. En outre, les procedes visant a contrarier ou inhiber le transport actif du cesium par la membrane cellulaire restent, a ce jour, incompatibles avec la survie de la cellule. (auteurs)

  12. Mechanisms for hydrogen production by different bacteria during mixed-acid and photo-fermentation and perspectives of hydrogen production biotechnology.

    Science.gov (United States)

    Trchounian, Armen

    2015-03-01

    H2 has a great potential as an ecologically-clean, renewable and capable fuel. It can be mainly produced via hydrogenases (Hyd) by different bacteria, especially Escherichia coli and Rhodobacter sphaeroides. The operation direction and activity of multiple Hyd enzymes in E. coli during mixed-acid fermentation might determine H2 production; some metabolic cross-talk between Hyd enzymes is proposed. Manipulating the activity of different Hyd enzymes is an effective way to enhance H2 production by E. coli in biotechnology. Moreover, a novel approach would be the use of glycerol as feedstock in fermentation processes leading to H2 production. Mixed carbon (sugar and glycerol) utilization studies enlarge the kind of organic wastes used in biotechnology. During photo-fermentation under limited nitrogen conditions, H2 production by Rh. sphaeroides is observed when carbon and nitrogen sources are supplemented. The relationship of H2 production with H(+) transport across the membrane and membrane-associated ATPase activity is shown. On the other hand, combination of carbon sources (succinate, malate) with different nitrogen sources (yeast extract, glutamate, glycine) as well as different metal (Fe, Ni, Mg) ions might regulate H2 production. All these can enhance H2 production yield by Rh. sphaeroides in biotechnology Finally, two of these bacteria might be combined to develop and consequently to optimize two stages of H2 production biotechnology with high efficiency transformation of different organic sources.

  13. Thermal Adaptability of the Light-Harvesting Complex 2 from Thermochromatium tepidum: Temperature-Dependent Excitation Transfer Dynamics.

    Science.gov (United States)

    Shi, Ying; Zhao, Ning-Jiu; Wang, Peng; Fu, Li-Min; Yu, Long-Jiang; Zhang, Jian-Ping; Wang-Otomo, Zheng-Yu

    2015-11-25

    The photosynthetic purple bacterium Thermochromatium (Tch.) tepidum is a thermophile that grows at an optimal temperature of ∼50 °C. We have investigated, by means of steady-state and time-resolved optical spectroscopies, the effects of temperature on the near-infrared light absorption and the excitation energy transfer (EET) dynamics of its light-harvesting complex 2 (LH2), for which the mesophilic counterpart of Rhodobacter (Rba.) sphaeroides 2.4.1 (∼30 °C) was examined in comparison. In a limited range around the physiological temperature (10-55 °C), the B800-to-B850 EET process of the Tch. tepidum LH2, but not the Rba. sphaeroides LH2, was found to be characteristically temperature-dependent, mainly because of a temperature-tunable spectral overlap. At 55 °C, the LH2 complex from Tch. tepidum maintained efficient near-infrared light harvesting and B800-to-B850 EET dynamics, whereas this EET process was disrupted in the case of Rba. sphaeroides 2.4.1 owing to the structural distortion of the LH2 complex. Our results reveal a remarkable thermal adaptability of the light-harvesting function of Tch. tepidum, which could enhance our understanding of the survival strategy of this thermophile in response to environmental challenges.

  14. Communication: Coherences observed in vivo in photosynthetic bacteria using two-dimensional electronic spectroscopy

    Science.gov (United States)

    Dahlberg, Peter D.; Norris, Graham J.; Wang, Cheng; Viswanathan, Subha; Singh, Ved P.; Engel, Gregory S.

    2015-01-01

    Energy transfer through large disordered antenna networks in photosynthetic organisms can occur with a quantum efficiency of nearly 100%. This energy transfer is facilitated by the electronic structure of the photosynthetic antennae as well as interactions between electronic states and the surrounding environment. Coherences in time-domain spectroscopy provide a fine probe of how a system interacts with its surroundings. In two-dimensional electronic spectroscopy, coherences can appear on both the ground and excited state surfaces revealing detailed information regarding electronic structure, system-bath coupling, energy transfer, and energetic coupling in complex chemical systems. Numerous studies have revealed coherences in isolated photosynthetic pigment-protein complexes, but these coherences have not been observed in vivo due to the small amplitude of these signals and the intense scatter from whole cells. Here, we present data acquired using ultrafast video-acquisition gradient-assisted photon echo spectroscopy to observe quantum beating signals from coherences in vivo. Experiments were conducted on isolated light harvesting complex II (LH2) from Rhodobacter sphaeroides, whole cells of R. sphaeroides, and whole cells of R. sphaeroides grown in 30% deuterated media. A vibronic coherence was observed following laser excitation at ambient temperature between the B850 and the B850∗ states of LH2 in each of the 3 samples with a lifetime of ∼40-60 fs. PMID:26373989

  15. Communication: Coherences observed in vivo in photosynthetic bacteria using two-dimensional electronic spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Dahlberg, Peter D. [Graduate Program in the Biophysical Sciences, Institute for Biophysical Dynamics, and The James Franck Institute, The University of Chicago, Chicago, Illinois 60637 (United States); Norris, Graham J.; Wang, Cheng; Viswanathan, Subha; Singh, Ved P.; Engel, Gregory S., E-mail: gsengel@uchicago.edu [Department of Chemistry, Institute for Biophysical Dynamics, and The James Franck Institute, The University of Chicago, Chicago, Illinois 60637 (United States)

    2015-09-14

    Energy transfer through large disordered antenna networks in photosynthetic organisms can occur with a quantum efficiency of nearly 100%. This energy transfer is facilitated by the electronic structure of the photosynthetic antennae as well as interactions between electronic states and the surrounding environment. Coherences in time-domain spectroscopy provide a fine probe of how a system interacts with its surroundings. In two-dimensional electronic spectroscopy, coherences can appear on both the ground and excited state surfaces revealing detailed information regarding electronic structure, system-bath coupling, energy transfer, and energetic coupling in complex chemical systems. Numerous studies have revealed coherences in isolated photosynthetic pigment-protein complexes, but these coherences have not been observed in vivo due to the small amplitude of these signals and the intense scatter from whole cells. Here, we present data acquired using ultrafast video-acquisition gradient-assisted photon echo spectroscopy to observe quantum beating signals from coherences in vivo. Experiments were conducted on isolated light harvesting complex II (LH2) from Rhodobacter sphaeroides, whole cells of R. sphaeroides, and whole cells of R. sphaeroides grown in 30% deuterated media. A vibronic coherence was observed following laser excitation at ambient temperature between the B850 and the B850{sup ∗} states of LH2 in each of the 3 samples with a lifetime of ∼40-60 fs.

  16. Remodelage des temps et des espaces de travail chez les travailleurs indépendants de l’informatique : l’affrontement des effets de marchés et des préférences personnelles Software freelancers remodel their working time and space: the clash between market effects and personal preference

    Directory of Open Access Journals (Sweden)

    Diane-Gabrielle Tremblay

    2009-11-01

    Full Text Available Cette recherche s’intéresse à la perméabilité spatiale et temporelle des frontières entre le travail et le hors travail chez les travailleurs indépendants de l’informatique. Cette perméabilité participe d’une certaine recomposition des lieux et des temps de travail, permise par les TIC, mais sans doute en partie impulsée par la pression du marché, ou la concurrence entre travailleurs, dans ce secteur de travail. Les travailleurs indépendants de l’informatique constituent un groupe de travailleurs qui combine une utilisation intense des technologies et une relative autonomie dans le travail. Après un état des lieux de la perméabilité spatiale et temporelle du travail chez ces travailleurs, nous pouvons distinguer deux groupes, un premier groupe pour lequel les frontières sont très perméables (comportement intégrateur et un second pour lequel les frontières sont imperméables (comportement séparateur. Nous constatons aussi que les divers clients de ces contractuels ont une forte incidence sur l’organisation de leur temps de travail, mais aussi de leur espace de travail. Il semble donc bien y avoir un effet de marché, tout au moins en partie, même si les travailleurs autonomes de l’informatique ont tenté de se donner une certaine maîtrise temporelle.Our research inquired into the spatial and temporal permeability of borders separating work and off-work among independent software employees. Such permeability is part of the remodeling process of working time and place that ICT allows for, though doubtless under the influence of the market or of competition between workers in that sector. Freelance software workers are a group that combines an intensive use of technology with relative autonomy. After reporting on the state of the art on the subject of porous spatial and temporal borders between work and off-work among them, two groups will be distinguished: one for whom frontiers are very permeable (integrating

  17. GUIDE POUR L'INTERPRÉTATION DES ÉCAILLES ET L'ESTIMATION DE L'ÂGE CHEZ LES ALOSES (ALOSA SPP. DE LA FAÇADE ATLANTIQUE-EST ET DE LA MÉDITERRANÉE-OUEST. A GUIDE TO SCALE INTERPRETATION AND AGE ESTIMATION FOR THE EAST-ATLANTIC AND WEST-MEDITERRANEAN SHADS (ALOSA SPP..

    Directory of Open Access Journals (Sweden)

    BAGLINIÈRE J. L.

    2008-05-01

    Full Text Available L'objectif général de ce guide est de fournir un manuel d'utilisation et d'interprétation des écailles pour l'estimation de l'âge chez les aloses de l'Atlantique-Est et de Méditerranée-Ouest (Grande Alose, Alose feinte atlantique et méditerranéenne. Après un présentation rapide des espèces, populations et fleuves analysés, les écailles d'aloses et les méthodes de récolte, de préparation et de montage les concernant sont décrites en détail. Des définitions et un système de notation de l'âge standards sont donnés. La grande majorité des difficultés rencontrées pour l'interprétation des écailles sont analysées en proposant des solutions et en donnant certaines recommandations. L'ensemble de ce guide est largement illustré à l'aide d'exemples d'écailles typiques et atypiques choisis chez tous les taxons des différentes populations étudiées. The general objective of this guide is to provide a practical manual for interpreting scales and the estimation of age of Alosa from the East Atlantic and West-Mediterranean (Allis shad, Atlantic and Mediterranean shad. Following a brief presentation of the species, populations and rivers studied, the scales, sampling methods and their preparation for reading are described in detail. Definitions and a standard system of notating age are given. The majority of the difficulties encountered in the interpretation of scales are analysed, solutions proposed and some recommendations given. The whole guide is largely illustrative using examples of typical and atypical scales from the various taxons of the different populations studied.

  18. Ovogenèse chez l'Anguille (Anguilla anguilla L. : ultrastructure de l'ovaire à différents stades de développement et implication des lipoprotéines au cours de la vitellogenèse

    Directory of Open Access Journals (Sweden)

    BURZAWA-GERARD E.

    1994-10-01

    Full Text Available Dans les eaux douces, l'anguille est présente à deux stades de développement : le stade jaune où l'animal se nourrit et assure sa croissance et le stade argenté où il jeûne et se prépare à la migration de reproduction. Ce cycle est particulièrement intéressant pour l'étude des régulations hormonales de l'ovogénèse et en particulier celle de la vitellogenèse, étape pendant laquelle l'ovocyte incorpore la vitellogénine pour former le vitellus. Cet article décrit, d'une part, les différents critères de la vitellogenèse disponibles chez l'anguille (caractérisation des lipoprotéines, ultrastructure des ovocytes, teneurs plasmatiques des stéroïdes sexuels et de la vitellogénine, caractérisation des récepteurs hépatiques de l'oestradiol (RE2 et, d'autre part, l'effet de traitements gonadotropes ou stéroïdiens sur ces critères pour dégager la nature des contrôles endocriniens impliqués au cours de la vitellogenèse. Les lipoprotéines présentes dans le plasma de l'anguille jaune ou argentée sont les VLDL (lipoprotéine de très faible densité et les HDL (lipoprotéine de haute densité ; les LDL (lipoprotéine de faible densité ne sont pas trouvées. Des modifications des apolipoprotéines présentes dans les lipoprotéines de haute densité (HDL sont observées au cours de l'argenture. Par des traitements à l'oestradiol, les VLDL augmentent considérablement ; il apparaît aussi une classe nouvelle de lipoprotéines, les VHDL (lipoprotéine de très haute densité ou vitellogénine. L'analyse de l'ultrastructure ovocytaire montre que l'anguille jaune est prévitellogénique en raison de l'absence des structures ovocytaires spécifiques de l'endocytose ; elles sont présentes chez l'anguille argentée qui est donc vitellogénique. In vivo chez l'anguille jaune, après un mois de traitement gonadotrope, une augmentation de l'oestradiol (E2 plasmatique est observée sans apparition de vitellogénine circulante

  19. Effets des orthèses prophylactiques de genou sur l'incidence des récidives de lésion du ligament collatéral médial et du ligament croisé antérieur chez les joueurs de hockey sur glace en Suisse: une étude pilote épidémiologique rétrospective

    OpenAIRE

    Matthey-Doret, Gwendoline; Kupferschmied, Elisabeth; Mathieu, Nicolas

    2016-01-01

    Chez les joueurs de hockey sur glace en Suisse, l'utilisation des orthèses de genou prophylactiques afin de prévenir les récidives de lésion du ligament collatéral médial (LCM) et du ligament croisé antérieur (LCA) est largement répandue. Les résultats des études sur les effets du port d'orthèse restent actuellement controversés. Use of prophylactic knee orthoses is very common among Swiss ice hockey players to prevent recurrent lesions of medial collateral ligament (MCL) and anterior cruc...

  20. A new method for studying iodine metabolism; the isotopic equilibrium method - kinetic and quantitative aspects of measurements made on rats; Une nouvelle methode d'etude du metabolisme de l'iode: la methode d'equilibre isotopique - aspects cinetiques et quantitatifs obtenus chez le rat

    Energy Technology Data Exchange (ETDEWEB)

    Simon, C. [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

    1964-05-15

    The isotopic equilibrium method which has been developed in the case of the rat has made it possible to measure the absolute values of the principal parameters of iodine metabolism in this animal. The quantities and concentrations of iodine have been measured in the thyroid gland and in the plasma with a sensitivity of 0.001 {mu}g of {sup 127}I. This sensitivity has made it possible to measure pools as small as the iodide and the free iodotyrosines of the thyroid and to demonstrate the absence of free iodotyrosines in the plasma of the normal rat. In vivo, the isotopic equilibrium method has made it possible to measure the iodine content of the thyroid gland and to calculate the intensity of this gland's secretion without removing it. By double labelling with {sup 125}I and {sup 131}I the isotopic equilibrium method has made it possible to measure the flux, intensity of the intrathyroidal recycling as well as the turnover rates of all the iodine containing compounds of the thyroid gland. For this gland no precursor-product relationship has been found between The iodotyrosines (MIT and DIT) and the iodothyronines (T{sub 4} and T{sub 3}). The absence of this relationship is due to the heterogeneity of the thyroglobulin turnover. It has been shown furthermore that there exists in the plasma an organic fraction of the iodine which is different to thyroglobulin and which is renewed more rapidly than the circulating hormones T{sub 3} and T{sub 4}. The isotopic equilibrium method is very useful for series measurements of iodine. It makes it possible furthermore to improve the biochemical fractionations by adding carriers without affecting the subsequent {sup 127}I measurements. (author) [French] La methode d'equilibre isotopique, mise au point chez le rat, a permis de mesurer en valeur absolue les principaux parametres du metabolisme de l'iode chez cet animal. Les quantites ou les concentrations d'iode ont ete mesurees pour la thyroide et pour le

  1. Breeding of Coenzyme Q10 High Yield Strain%发酵生产辅酶Q10高产菌株的选育

    Institute of Scientific and Technical Information of China (English)

    陈金卿

    2016-01-01

    以实验室保存的类球红细菌(Rhodobacter sphaeroides)JDW61为出发菌株,考察了紫外、紫外结合氯化锂和亚硝基胍对菌株产生辅酶Q10能力的诱变效应,并结合辅酶Q10的合成途径设计了快速筛选辅酶Q10高产菌株的模型,获得一株辅酶Q10产量提高的突变株CP222,该菌株摇瓶发酵的辅酶Q10产量为276.14 mg·L-1,较出发菌株提高了190%,并且遗传性能稳定.

  2. Light-induced structural changes in photosynthetic reaction centres studied by ESEEM of spin-correlated D+QA- radical pairs.

    Science.gov (United States)

    Borovykh, I V; Dzuba, S A; Proskuryakov, I I; Gast, P; Hoff, A J

    1998-03-25

    Zn-substituted Rhodobacter sphaeroides R26 reaction centres (RCs) frozen in the dark and under illumination exhibit quite different recombination kinetics of the D+QA- radical pairs [Kleinfeld et al., Biochemistry, 23 (1984) 5780]. We have applied electron spin echo envelope modulation (ESEEM) of the spin-correlated D+QA- radical pairs to assess a possible light-induced change in the distance between the D and QA cofactors. The recombination kinetics and the field-swept spin-polarized EPR signal for the two preparations have been monitored by time-resolved EPR spectroscopy. For the samples frozen under illumination, a slight increase in the distance, 0.4+/-0.2 A, has been detected.

  3. Photoprotection Mechanism of Light-Harvesting Antenna Complex from Purple Bacteria.

    Science.gov (United States)

    Kosumi, Daisuke; Horibe, Tomoko; Sugisaki, Mitsuru; Cogdell, Richard J; Hashimoto, Hideki

    2016-02-11

    Photosynthetic light-harvesting apparatus efficiently capture sunlight and transfer the energy to reaction centers, while they safely dissipate excess energy to surrounding environments for a protection of their organisms. In this study, we performed pump-probe spectroscopic measurements with a temporal window ranging from femtosecond to submillisecond on the purple bacterial antenna complex LH2 from Rhodobacter sphaeroides 2.4.1 to clarify its photoprotection functions. The observed excited state dynamics in the time range from subnanosecond to microsecond exhibits that the triplet-triplet excitation energy transfer from bacteriochlorophyll a to carotenoid takes place with a time constant of 16.7 ns. Furthermore, ultrafast spectroscopic data suggests that a molecular assembly of bacteriochlorophyll a in LH2 efficiently suppresses a generation of triple bacteriochlorophyll a.

  4. Comparison of different mixed cultures for bio-hydrogen production from ground wheat starch by combined dark and light fermentation.

    Science.gov (United States)

    Ozmihci, Serpil; Kargi, Fikret

    2010-04-01

    Composition of the mixed culture was varied in combined dark-light fermentation of wheat powder starch in order to improve hydrogen gas formation rate and yield. Heat-treated anaerobic sludge and pure culture of Clostridium beijerinckii (DSMZ 791T) were combined with two different light fermentation bacteria of Rhodobacter sphaeroides (RS-NRRL and RS-RV) in order to select a more suitable mixture resulting in high hydrogen yield and formation rate. A combination of the anaerobic sludge and RS-NRRL yielded the highest cumulative hydrogen (CHF = 140 ml), the highest yield (0.36 mol H2 mol(-1) glucose) and specific hydrogen formation rate (2.5 ml H2 g(-1) biomass h(-1)). During dark fermentation (70 h) hydrogen was produced simultaneously by the dark and light fermentation bacteria using glucose from hydrolyzed starch. However, only light fermentation bacteria produced hydrogen from VFA's derived from dark fermentation after a long adaptation period.

  5. Synthetic Antenna Functioning As Light Harvester in the Whole Visible Region for Enhanced Hybrid Photosynthetic Reaction Centers.

    Science.gov (United States)

    Hassan Omar, Omar; la Gatta, Simona; Tangorra, Rocco Roberto; Milano, Francesco; Ragni, Roberta; Operamolla, Alessandra; Argazzi, Roberto; Chiorboli, Claudio; Agostiano, Angela; Trotta, Massimo; Farinola, Gianluca M

    2016-07-20

    The photosynthetic reaction center (RC) from the Rhodobacter sphaeroides bacterium has been covalently bioconjugated with a NIR-emitting fluorophore (AE800) whose synthesis was specifically tailored to act as artificial antenna harvesting light in the entire visible region. AE800 has a broad absorption spectrum with peaks centered in the absorption gaps of the RC and its emission overlaps the most intense RC absorption bands, ensuring a consistent increase of the protein optical cross section. The covalent hybrid AE800-RC is stable and fully functional. The energy collected by the artificial antenna is transferred to the protein via FRET mechanism, and the hybrid system outperforms by a noteworthy 30% the overall photochemical activity of the native protein under the entire range of visible light. This improvement in the optical characteristic of the photoenzyme demonstrates the effectiveness of the bioconjugation approach as a suitable route to new biohybrid materials for energy conversion, photocatalysis, and biosensing.

  6. 4-Vinylphenol biosynthesis from cellulose as the sole carbon source using phenolic acid decarboxylase- and tyrosine ammonia lyase-expressing Streptomyces lividans.

    Science.gov (United States)

    Noda, Shuhei; Kawai, Yoshifumi; Tanaka, Tsutomu; Kondo, Akihiko

    2015-03-01

    Streptomyces lividans was adopted as a host strain for 4-vinylphenol (4VPh) production directly from cellulose. In order to obtain novel phenolic acid decarboxylase (PAD) expressed in S. lividans, PADs distributed among Streptomyces species were screened. Three novel PADs, derived from Streptomycessviceus, Streptomyceshygroscopicus, and Streptomycescattleya, were successfully obtained and expressed in S. lividans. S. sviceus PAD (SsPAD) could convert p-hydroxycinnamic acid (pHCA) to 4VPh more efficiently than the others both in vitro and in vivo. For 4VPh production directly from cellulose, l-tyrosine ammonia lyase derived from Rhodobacter sphaeroides and SsPAD were introduced into endoglucanase-secreting S. lividans, and the 4VPh biosynthetic pathway was constructed therein. The created transformants successfully produced 4VPh directly from cellulose.

  7. Ultrafast Structural Dynamics of BlsA, a Photoreceptor from the Pathogenic Bacterium Acinetobacter baumannii

    Science.gov (United States)

    2013-01-01

    Acinetobacter baumannii is an important human pathogen that can form biofilms and persist under harsh environmental conditions. Biofilm formation and virulence are modulated by blue light, which is thought to be regulated by a BLUF protein, BlsA. To understand the molecular mechanism of light sensing, we have used steady-state and ultrafast vibrational spectroscopy to compare the photoactivation mechanism of BlsA to the BLUF photosensor AppA from Rhodobacter sphaeroides. Although similar photocycles are observed, vibrational data together with homology modeling identify significant differences in the β5 strand in BlsA caused by photoactivation, which are proposed to be directly linked to downstream signaling. PMID:24723998

  8. Fabrication of biomolecule copolymer hybrid nanovesicles as energy conversion systems

    Science.gov (United States)

    Ho, Dean; Chu, Benjamin; Lee, Hyeseung; Brooks, Evan K.; Kuo, Karen; Montemagno, Carlo D.

    2005-12-01

    This work demonstrates the integration of the energy-transducing proteins bacteriorhodopsin (BR) from Halobacterium halobium and cytochrome c oxidase (COX) from Rhodobacter sphaeroides into block copolymeric vesicles towards the demonstration of coupled protein functionality. An ABA triblock copolymer-based biomimetic membrane possessing UV-curable acrylate endgroups was synthesized to serve as a robust matrix for protein reconstitution. BR-functionalized polymers were shown to generate light-driven transmembrane pH gradients while pH gradient-induced electron release was observed from COX-functionalized polymers. Cooperative behaviour observed from composite membrane functionalized by both proteins revealed the generation of microamp-range currents with no applied voltage. As such, it has been shown that the fruition of technologies based upon bio-functionalizing abiotic materials may contribute to the realization of high power density devices inspired by nature.

  9. 光合细菌对土壤中呋喃丹的生物降解%Characterization of Biodegradation for Carbofuran Pesticides in Soils by Photosynthetic Bacteria

    Institute of Scientific and Technical Information of China (English)

    白红娟; 肖根林; 贾万利

    2013-01-01

    以一株降解呋喃丹的光合细菌球形红细菌(Rhodobacter sphaeroides)H菌株为材料,考察了其在实验室模拟条件下降解土壤中呋喃丹的影响因素及其动力学过程.结果表明,该菌降解呋喃丹的最适条件为:温度30℃,pH=7.0,接种量107个/g.在最适条件下,H菌株对初始质量浓度为5.0~25 mg/kg呋喃丹的降解反应均符合一级动力学特征.可以将其应用于呋喃丹污染土壤的生物修复.

  10. Jean Bruller, dessinateur et illustrateur de la littérature coloniale pour la jeunesse de l’entre-deux-guerres : de Loulou chez les nègres (1929 à Baba Diène et Morceau-de-Sucre (1937

    Directory of Open Access Journals (Sweden)

    Nathalie Gibert-Joly

    2012-01-01

    Full Text Available Cet article vise à mettre en exergue l’évolution des prises de position contre le colonialisme du dessinateur Jean Bruller, futur écrivain Vercors (1902-1991, dans l’entre-deux-guerres. L’Appel des 121 que Vercors signa sans hésiter en 1960 pour clamer publiquement le droit à l'insoumission dans la guerre d'Algérie, son combat dès 1955 en faveur de l’indépendance de ce pays pourraient nous conduire à une interprétation rétrospective erronée, celle d’un homme et d’un mythe de la résistance anticolonialiste dès le début de l’entrée dans l’âge adulte et dans son parcours artistique vecteur de cette pensée. Les illustrations qu’il fournit pour la littérature de jeunesse de l’entre-deux-guerres, mais aussi l’une de ses créations personnelles prouvent au contraire que le dessinateur bascula d’une acceptation inconsciente à une interrogation critique du colonialisme du début des années vingt à la fin des années trente. De l’empan de Loulou chez les nègres à Baba Diène et Morceau-de-Sucre, nous distinguerons trois moments marqués par la publication d’ouvrages-clés pour comprendre la prise de conscience graduelle de Jean Bruller, visible dans ses choix collaboratifs comme dans les rapports entre le texte et ses dessins. Il est nécessaire de le situer dans un temps autant personnel qu’historique : celui d’un jeune homme dans un milieu éducatif et social donné, mais suffisamment attentif au monde pour avoir les moyens de s’en émanciper ; celui de l’artiste dans ses réalités symboliques et économiques, influencé par des réseaux de sociabilité correspondant à certains de ses idéaux ; celui d’artistes et d’écrivains qui s’interrogent, d’intellectuels qui prennent des positions de plus en plus tranchées au cours de ces années-là.

  11. Apports nutritionnels, dépense et bilan énergétiques chez l’homme et les primates non-humains : aspects méthodologiques Nutritional intakes, energy expenditure and energy balance in human and non-human primates: methodological aspects

    Directory of Open Access Journals (Sweden)

    Laurent Tarnaud

    2011-02-01

    Full Text Available Cet article est une revue des méthodes de terrain et des techniques de laboratoire, traditionnelles et récentes, qui permettent d’évaluer les apports alimentaires et nutritionnels, les profils d’activité, la dépense énergétique et les réserves énergétiques corporelles des primates humains et non-humains. Cette revue a pour objectif de faire le point sur l’avancement des techniques utilisées pour estimer les paramètres énergétiques en anthropobiologie. Les primates non-humains et l’homme partagent un certain nombre de traits psycho-physiologiques issus des processus d’adaptation biologique à l’environnement et/ou liés à l’inertie phylogénétique. Identifier les mécanismes qui président à la dynamique énergétique chez les primates non-humains permet ainsi de situer certaines des bases biologiques partagées avec l’homme dans le contexte de l’évolution. Cette revue s'attache donc à présenter les méthodes en dégageant, lorsqu’ils existent, les points de recoupement des différentes approches méthodologiques appliquées à l’homme et aux primates non-humains. Par ailleurs, des comparaisons inter-populationnelles au sein de l’espèce humaine ou chez des primates non-humains permettent de préciser les relations entre les variables écologiques et les adaptations énergétiques. Dans cet article le lecteur trouvera différentes méthodes, présentées dans différents chapitres, selon qu'il s'intéresse à décrire et quantifier les apports alimentaires, nutritionnels et énergétiques des individus dans des conditions environnementales spécifiques, mesurer les dépenses énergétiques associées aux activités ou déterminer le statut nutritionnel et la composition corporelle des individus ou encore préciser le rôle des composés secondaires sur la sélection des items alimentaires et les propriétés pharmacologiques des plantes consommées. À l’origine descriptives, les méthodes actuelles

  12. Magnetic resonance imaging in primates. The example of the mouse lemur (Microcebus murinus: From detection of pathological aging to therapeutic evaluations Imagerie par résonance magnétique chez les primates. L’exemple du microcèbe murin (Microcebus murinus : De la détection du vieillissement cérébral pathologique à l'évaluation thérapeutique

    Directory of Open Access Journals (Sweden)

    Nadine El Tannir El Tayara

    2011-02-01

    also be used during therapeutic interventions by selecting animals to be involved in therapeutic trials and also by following specific MR biomarkers. MRI is thus critical to better characterize cerebral aging in the mouse lemur and to better carry out longitudinal studies in this primate model.Le vieillissement cérébral est un problème majeur de santé public. Il est associé dans certains cas à des maladies neurodégénératives telles que la maladie d’Alzheimer (MA. La compréhension de la physiopathologie du vieillissement cérébral et l'évaluation de nouvelles thérapies nécessitent l’utilisation de modèles animaux. Les souris transgéniques sont très utilisées mais restent peu représentatives de l’ensemble des aspects des maladies humaines. Les modèles primates sont plus proches phylogénétiquement de l’homme et sont plus prédictifs de l’efficacité de médicaments chez l'homme. Le microcèbe murin est un petit primate (environ 12cm, 100g qui est un modèle de vieillissement cérébral et un modèle potentiel de la MA. En effet certains animaux développent avec l’âge des altérations cérébrales telles que de l’amyloïdose. Des méthodes d'imagerie non-invasives comme l’imagerie par résonance magnétique (IRM peuvent être utilisées pour étudier les altérations cérébrales chez ces animaux. Nous montrons ici comment l'IRM permet d'étudier le microcèbe et présentons l'utilisation de l'IRM pour l'évaluation de thérapies et d'autres applications. Chez le microcèbe, l’IRM a permis de décrire l’anatomie cérébrale, le système vasculaire cérébral (grâce à l’angiographie par RMN et aussi de caractériser l’atrophie cérébrale liée à l’âge ainsi que des processus entraînant une accumulation de fer intracérébrale. La consommation cérébrale de glucose a aussi pu être étudiée par une autre modalité d’imagerie in vivo, la tomographie par émission de positons (TEP. Dans ce cas, l’IRM sert de support

  13. Redox-Dependent Conformational Changes in Cytochrome c Oxidase Suggest a Gating Mechanism for Proton Uptake

    Energy Technology Data Exchange (ETDEWEB)

    Qin, Ling; Liu, Jian; Mills, Denise A.; Proshlyakov, Denis A.; Hiser, Carrie; Ferguson-Miller, Shelagh; (MSU)

    2009-08-05

    A role for conformational change in the coupling mechanism of cytochrome c oxidase is the subject of controversy. Relatively small conformational changes have been reported in comparisons of reduced and oxidized crystal structures of bovine oxidase but none in bacterial oxidases. Comparing the X-ray crystal structures of the reduced (at 2.15 {angstrom} resolution) and oxidized forms of cytochrome c oxidase from Rhodobacter sphaeroides, we observe a displacement of heme a3 involving both the porphyrin ring and the hydroxyl farnesyl tail, accompanied by protein movements in nearby regions, including the mid part of helix VIII of subunit I which harbors key residues of the K proton uptake path, K362 and T359. The conformational changes in the reduced form are reversible upon reoxidation. They result in an opening of the top of the K pathway and more ordered waters being resolved in that region, suggesting an access path for protons into the active site. In all high-resolution structures of oxidized R. sphaeroides cytochrome c oxidase, a water molecule is observed in the hydrophobic region above the top of the D path, strategically positioned to facilitate the connection of residue E286 of subunit I to the active site or to the proton pumping exit path. In the reduced and reduced plus cyanide structures, this water molecule disappears, implying disruption of proton conduction from the D path under conditions when the K path is open, thus providing a mechanism for alternating access to the active site.

  14. Improved hydrogen production by coupled systems of hydrogenase negative photosynthetic bacteria and fermentative bacteria in reverse micelles

    Energy Technology Data Exchange (ETDEWEB)

    Singh, Anita [Centre for Biotechnology, University of Allahabad, Allahabad 211002 (India); Misra, Krishna [Indo-Russian Center for Bioinformatics, Indian Institute of Information Technology, Allahabad 211011 (India)

    2008-11-15

    Significant improvement in biological hydrogen production is achieved by the use of coupled bacterial cells in reverse micellar systems. Two coupled systems (a) Rhodopseudomonas palustris CGA009/Citrobacter Y19, and (b) Rhodobacter sphaeroides 2.4.1/Citrobacter Y19 bacteria have been immobilized separately in aqueous pool of the reverse micelles fabricated by various surfactants (AOT, CBAC and SDS) and apolar organic solvents (benzene and isooctane). The gene for uptake hydrogenase enzyme has been manipulated further for hydrogen generation. Mutants deficient in uptake hydrogenase (Hup{sup -}) were obtained from R. palustris CGA009 and R. sphaeroides 2.4.1, and entrapped with Citrobacter Y19 in the reverse micellar systems. More than two fold increase in hydrogen production was obtained by the use of Hup{sup -} mutants instead of wild-type photosynthetic bacteria together with Citrobacter Y19. Addition of sodium dithionite, a reducing agent to AOT/H{sub 2}O/isooctane reverse micellar system with the coupled systems of wild-type photosynthetic bacteria and fermentative bacterium Y19 effected similar increase in hydrogen production rate as it is obtained by the use of mutants. CBAC/H{sub 2}O/isooctane reverse micellar system is used for the first time for hydrogen production and is as promising as AOT/H{sub 2}O/isooctane reverse micellar system. All reverse micellar systems of coupled bacterial cultures gave encouraging hydrogen production (rate as well as yield) compared to uncoupled bacterial culture. (author)

  15. Continuous cultivation of photosynthetic bacteria for fatty acids production.

    Science.gov (United States)

    Kim, Dong-Hoon; Lee, Ji-Hye; Hwang, Yuhoon; Kang, Seoktae; Kim, Mi-Sun

    2013-11-01

    In the present work, we introduced a novel approach for microbial fatty acids (FA) production. Photosynthetic bacteria, Rhodobacter sphaeroides KD131, were cultivated in a continuous-flow, stirred-tank reactor (CFSTR) at various substrate (lactate) concentrations. At hydraulic retention time (HRT) 4d, cell concentration continuously increased from 0.97 g dcw/L to 2.05 g dcw/L as lactate concentration increased from 30 mM to 60mM. At 70 mM, however, cell concentration fluctuated with incomplete substrate degradation. By installing a membrane unit to CFSTR, a stable performance was observed under much higher substrate loading (lactate 100mM and HRT 1.5d). A maximum cell concentration of 16.2g dcw/L, cell productivity of 1.9 g dcw/L/d, and FA productivity of 665 mg FA/L/d were attained, and these values were comparable with those achieved using microalgae. The FA content of R. sphaeroides was around 35% of dry cell weight, mainly composed of vaccenic acid (C18:1, omega-7).

  16. Enhanced Hydrogen Production by Co-cultures of Hydrogenase and Nitrogenase in Escherichia coli.

    Science.gov (United States)

    Lee, Hyun Jeong; Sekhon, Simranjeet Singh; Kim, Young Su; Park, Ju-Yong; Kim, Yang-Hoon; Min, Jiho

    2016-03-01

    Rhodobacter sphaeroides is a bacterium that can produce hydrogen by interaction with hydrogenase and nitrogenase. We report a hydrogen production system using co-cultivation of hydrogenase in liquid medium and immobilized nitrogenase in Escherichia coli. The recombinant plasmid has been constructed to analyze the effect of hydrogen production on the expression of hupSL hydrogenase and nifHDK nitrogenase isolated from R. sphaeroides. All recombinant E. coli strains were cultured anaerobically, and cells for nitrogenase were immobilized in agar gel, whereas cells for hydrogenase were supplemented on the nitrogenase agar gel. The hupSL hydrogenase has been observed to enhance hydrogen production and hydrogenase activity under co-culture with nifHDK nitrogenase. The maximum hydrogen production has been obtained at an agar gel concentration and a cell concentration for co-culture of 2 % and 6.4 × 10(8) CFU. Thus, co-culture of hupSL hydrogenase and nifHDK nitrogenase provides a promising route for enhancing the hydrogen production and hydrogenase activity.

  17. A Computational Strategy to Analyze Label-Free Temporal Bottom-up Proteomics Data

    Energy Technology Data Exchange (ETDEWEB)

    Du, Xiuxia; Callister, Stephen J.; Manes, Nathan P.; Adkins, Joshua N.; Alexandridis, Roxana A.; Zeng, Xiaohua; Roh, Jung Hyeob; Smith, William E.; Donohue, Timothy J.; Kaplan, Samuel; Smith, Richard D.; Lipton, Mary S.

    2008-07-01

    Motivation: Biological systems are in a continual state of flux, which necessitates an understanding of the dynamic nature of protein abundances. The study of protein abundance dynamics has become feasible with recent improvements in mass spectrometry-based quantitative proteomics. However, a number of challenges still re-main related to how best to extract biological information from dy-namic proteomics data; for example, challenges related to extrane-ous variability, missing abundance values, and the identification of significant temporal patterns. Results: This article describes a strategy that addresses the afore-mentioned issues for the analysis of temporal bottom-up proteomics data. The core strategy for the data analysis algorithms and subse-quent data interpretation was formulated to take advantage of the temporal properties of the data. The analysis procedure presented herein was applied to data from a Rhodobacter sphaeroides 2.4.1 time-course study. The results were in close agreement with existing knowledge about R. sphaeroides, therefore demonstrating the utility of this analytical strategy.

  18. Light-field-characterization in a continuous hydrogen-producing photobioreactor by optical simulation and computational fluid dynamics.

    Science.gov (United States)

    Krujatz, Felix; Illing, Rico; Krautwer, Tobias; Liao, Jing; Helbig, Karsten; Goy, Katharina; Opitz, Jörg; Cuniberti, Gianaurelio; Bley, Thomas; Weber, Jost

    2015-12-01

    Externally illuminated photobioreactors (PBRs) are widely used in studies on the use of phototrophic microorganisms as sources of bioenergy and other photobiotechnology research. In this work, straightforward simulation techniques were used to describe effects of varying fluid flow conditions in a continuous hydrogen-producing PBR on the rate of photofermentative hydrogen production (rH2 ) by Rhodobacter sphaeroides DSM 158. A ZEMAX optical ray tracing simulation was performed to quantify the illumination intensity reaching the interior of the cylindrical PBR vessel. 24.2% of the emitted energy was lost through optical effects, or did not reach the PBR surface. In a dense culture of continuously producing bacteria during chemostatic cultivation, the illumination intensity became completely attenuated within the first centimeter of the PBR radius as described by an empirical three-parametric model implemented in Mathcad. The bacterial movement in chemostatic steady-state conditions was influenced by varying the fluid Reynolds number. The "Computational Fluid Dynamics" and "Particle Tracing" tools of COMSOL Multiphysics were used to visualize the fluid flow pattern and cellular trajectories through well-illuminated zones near the PBR periphery and dark zones in the center of the PBR. A moderate turbulence (Reynolds number = 12,600) and fluctuating illumination of 1.5 Hz were found to yield the highest continuous rH2 by R. sphaeroides DSM 158 (170.5 mL L(-1) h(-1) ) in this study.

  19. Regulation of bacterial photosynthesis genes by the small noncoding RNA PcrZ.

    Science.gov (United States)

    Mank, Nils N; Berghoff, Bork A; Hermanns, Yannick N; Klug, Gabriele

    2012-10-02

    The small RNA PcrZ (photosynthesis control RNA Z) of the facultative phototrophic bacterium Rhodobacter sphaeroides is induced upon a drop of oxygen tension with similar kinetics to those of genes for components of photosynthetic complexes. High expression of PcrZ depends on PrrA, the response regulator of the PrrB/PrrA two-component system with a central role in redox regulation in R. sphaeroides. In addition the FnrL protein, an activator of some photosynthesis genes at low oxygen tension, is involved in redox-dependent expression of this small (s)RNA. Overexpression of full-length PcrZ in R. sphaeroides affects expression of a small subset of genes, most of them with a function in photosynthesis. Some mRNAs from the photosynthetic gene cluster were predicted to be putative PcrZ targets and results from an in vivo reporter system support these predictions. Our data reveal a negative effect of PcrZ on expression of its target mRNAs. Thus, PcrZ counteracts the redox-dependent induction of photosynthesis genes, which is mediated by protein regulators. Because PrrA directly activates photosynthesis genes and at the same time PcrZ, which negatively affects photosynthesis gene expression, this is one of the rare cases of an incoherent feed-forward loop including an sRNA. Our data identified PcrZ as a trans acting sRNA with a direct regulatory function in formation of photosynthetic complexes and provide a model for the control of photosynthesis gene expression by a regulatory network consisting of proteins and a small noncoding RNA.

  20. The phylogenetic relationships of Caulobacter, Asticcacaulis and Brevundimonas species and their taxonomic implications.

    Science.gov (United States)

    Sly, L I; Cox, T L; Beckenham, T B

    1999-04-01

    The phylogenetic relationships among the species of Caulobacter, Asticcacaulis and Brevundimonas were studied by comparison of their 16S rDNA sequences. The analysis of almost complete sequences confirmed the early evolutionary divergence of the freshwater and marine species of Caulobacter reported previously [Stahl, D. A., Key, R., Flesher, B. & Smit, J. (1992). J Bacteriol 174, 2193-2198]. The freshwater species formed two distinct clusters. One cluster contained the species Caulobacter bacteroides, Caulobacter crescentus, Caulobacter fusiformis and Caulobacter henricii. C. bacteroides and C. fusiformis are very closely related (sequence identity 99.8%). The second cluster was not exclusive and contained the specis Caulobacter intermedius, Caulobacter subvibrioides and Caulobacter variabilis, as well as Brevundimonas diminuta and Brevundimonas vesicularis. The marine species Caulobacter halobacteroides and Caulobacter maris were very closely related, with a sequence identity of 99.7%. These two species were most closely but distantly related to the marine hyphal/budding bacteria Hyphomonas jannaschiana and Hirschia baltica, which formed a deep phylogenetic line with Rhodobacter sphaeroides and Rhodobacter capsulatus. Caulobacter leidyia is unrelated to the other species of Caulobacter and belongs to the alpha-4 subclass of the Proteobacteria, forming a distinct cluster with Asticcacaulis excentricus and Asticcacaulis biprosthecium. The taxonomic implications of the polyphyletic nature of the genus Caulobacter and the absence of a type culture for the type species of the genus Caulobacter vibrioides, are discussed.

  1. Representaciones sociales de la computadora en usuarios semirrurales de México (Social Representations of Semirural Computer Users of Mexico (Les représentations sociales de l′ordinateur chez les usagers semi-ruraux au Méxique (Representações sociais do computador em usuários semirrurais do México

    Directory of Open Access Journals (Sweden)

    Marco Antoniog González-Pérez

    2012-12-01

    Full Text Available ResumenEste artículo de investigación se deriva de un estudio de campo realizado para identificar representaciones sociales (RS de la computadora en usuarios de los Centros Comunitarios de Aprendizaje del Instituto Tecnológico y de Estudios Superiores de Monterrey, ITESM. Se aplicaron dos instrumentos: prueba de aso- ciación libre y guion de entrevista a muestras de 217 sujetos, en la primera condición y 31, en la segunda. El estudio se realizó en Chapa de Mota y Villas del Car- bón, Estado de México. Se mostraron representacio- nes sociales, RS, cambiantes entre usuarios con base en edad y tiempo de uso y se observó cómo los miem- bros de la comunidad insertan la computadora en sus actividades cotidianas.AbstractThis research article is derived from a field study conducted to identify social representations (SR of the computer users of Community Learning Centers at ITESM. The instruments used were: free association test and interview script to samples of 217 subjects in the first condition and 31 in the sec- ond one. The study was conducted in Chapa de Mota and Villas del Carbón, Estado de México. SR were chang- ing between users based on age and length of use and showed how com- munity members used the computer in their daily activities.RésuméCet article de recherche découle d'une étude dans le terrain réalisée pour identifier les représentations sociales (RS de l’ordinateur chez les usagers des Centres Communautaires d’ap- prentissage dans le Tecnológico de Monterrey (Technologique de Mon- terrey. On a appliqué deux outils: la preuve d’association libre à 217 per- sonnes et le scenario d’entretien à 31 personnes. Les résultats ont montrés des représentations sociales chan- geantes en fonction de l’âge et le temps d’usage et on a observé com- ment les membres de la communauté utilisent l’ordinateur dans leurs activi- tés au quotidien.ResumoEste artigo se deriva de uma pesqui- sa de campo realizada

  2. Formación del pensamiento reflexivo en estudiantes universitarios (Training Reflexive Thinking in University Students (Formation de la pensée réflexive chez les étudiants universitaires (Formação do pensamento reflexivo em estudantes universitários

    Directory of Open Access Journals (Sweden)

    Claudia Ximena González-Moreno

    2012-06-01

    Full Text Available ResumenSe parte del soporte científico y conceptual del enfo- que histórico-cultural de Lev Semiónovich Vygotsky para presentar los resultados de una investigación des- criptiva, sobre el quehacer educativo en el aula por lo que se establece una interacción dialéctica entre teoría y práctica. El objetivo fue la formación del pensamien- to reflexivo en estudiantes universitarios en la licencia- tura en Pedagogía Infantil, en la clase Teorías cogniti- vas del aprendizaje. Los resultados muestran que las acciones pedagógicas pueden impactar positivamente la consolidación de los procesos de aprendizaje y que el pensamiento reflexivo se constituye en el motor del cambio mediante el uso intencionado del lenguaje.AbstractThe starting point of this paper is the scien- tific and conceptual framework of Vygotsky's cultural-historical approach, which is used to present the results of a descriptive research work on classroom activities, establishing a dialectic interaction between theory and practice. The aim was to train reflexive thin- king in university students of the teacher training course in Children's Pedagogy, more specifically a subject in Cognitive Theories of Learning. The results show that pedagogical actions can have a positive impact on the consolidation of learning processes. Reflexive thinking is an agent of change through inten- tional use of language.RésuméLe point de départ de cette étude est la base scientifique et conceptuelle de la perspective historico-culturelle de Vygotsky pour présen- ter les résultats d'une recherche de type des- criptive, par rapport au travail éducatif dans la salle de classe, c'est pourquoi on a établit l'interaction dialectique entre la théorie et la pratique. L'objectif a été la formation de la pensée réflexive chez les étudiants univer- sitaires dans la carrière de Pédagogie pour l'enfance, à travers le cours Théories Cogni- tives de l'apprentissage. Les résultats mon- trent

  3. Comparison of the Photosynthetic Characteristics of Two Developmental Stages in Nostoc sphaeroides Kützing(Cyanophyta)

    Institute of Scientific and Technical Information of China (English)

    LI Dun-hai; CHEN Lan-zhou; LI Gen-bao; WANG Gao-hong; LIU Yong-ding

    2005-01-01

    The photosynthetic activities between two main developmental stages, colony and hormogonium, of the edible cyanobacterium Nostoc sphaephyll than that of colonies. It showed that the ratios of phycocyain (PC), allophycocyain (APC) and phycoerythrocyanin (PEC) in hormogonia and colonies were different. The room temperature chlorophyll fluorescence, 77 K chlorophyll fluorescence, measurements of PS Ⅰ and PS Ⅱ activities all showed that colony has higher photosynthetic competence than hormogonia. Hormogonia had a higher respiration rate than colony, while their maximum photosynthetic oxygen evolution rates were very close. The responses of hormogonia and colonies to high light illuminations also were different. Both of their oxygen evolution rates decreased quickly with the prolonged high light illumination, but hormogonia can keep relatively higher PS Ⅱ activity (Fv/Fm ) than that of colonies.The results suggested that colony was photosynthetically more competent than hormogonia, while the ability of hormogonia to tolerate high light illumination was higher than that of colony.

  4. Le zona ophtalmique: une dermatose rare chez l'enfant

    OpenAIRE

    Zakia, Douhi; Meziane, Marieme; Salim, Gallouj; Zahra, Mernissi Fatima

    2015-01-01

    Le zona est dû a une réactivation du virus varicelle-zona (VZV) qui reste quiescent dans les ganglions sensitifs dorsaux après la varicelle. Le zona de l'enfant est rare et particulièrement la forme ophtalmique, qui peut être responsable de complications oculaires graves nécessitant une prise en charge adéquate et précoce. Il est parfois associé à des douleurs post-zostériennes dont le traitement est difficile. L'aciclovir per os administré dans les 72 heures après l’éruption a prouvé son eff...

  5. Le statut de la proposition chez Tesnière

    Directory of Open Access Journals (Sweden)

    Teddy Arnavielle

    1994-12-01

    Full Text Available Un grammairien montpellérain ne peut manquer de ressentir une intense émotion à venir rendre hommage, dans des lieux qu'il aima, à un linguiste qui vécut quinze ans à Montpellier, où il laissa le souvenir d'un professeur éblouissant, où il réalisa, pour l'essentiel, son oeuvre, et où ilacheva une vie trop brève. J'espère ne pas représenter trop indignement une Université pour laquelle Lucien Tesnière reste un modèle difficilement surpassable, et contribuer à resserrer des liens d'amitié plus que cinquantenaires entre Ljubljana et Montpellier.

  6. République et républicanisme chez Milton

    Directory of Open Access Journals (Sweden)

    Christophe TOURNU

    2003-10-01

    Full Text Available Simone Goyard-Fabre, dans son article sur la république, relève la connotation “plurielle”, mais aussi “flottante” du terme. En effet, dans un sens premier, la république désigne un régime politique, la politeia platonicienne, paradigme idéel de la Cité, ou la res populi cicéronienne, gouvernement mixte participant de l’ordre immanent de la nature. Elle en vient à s’appliquer, dans une deuxième acception, à la forme ou à l’essence de la politique lorsqu’elle se confond avec la souveraineté au...

  7. Le bilinguisme chez les enfants: bibliographie (Child Bilingualism: a Bibliography)

    Science.gov (United States)

    Lundgren-Turiaf, Simone

    1976-01-01

    This bibliography on child bilingualism in France contains 82 entries distributed among three sections: 1) psychosociologic and cultural aspects of migrant worker children, learning conditions; 2) bilingual-bicultural education, experiences and methodological problems; and 3) bilingualism in the countries of origin. (Text is in French.) (TL)

  8. Reconnaissance coloniale chez des fourmis se reproduisant par bouturage

    OpenAIRE

    Ichinose, K.; Lenoir, Alain; Cerdá, Xim

    2002-01-01

    Certaines fourmis se reproduisant par bouturage, comme les Aphaenogaster senilis, sont peu agressives envers les individus d¿autres colonies proches de la même espèce. Dans ce cas, il est difficile d¿apprécier les relations entre colonies. Nous avons cherché à mettre au point une méthode qui permette de discriminer deux colonies différentes. Nous avons effectué des rencontres entre individus de colonies élevées au laboratoire depuis plus d¿un an, et de nids collectés récemment. Quatre catégor...

  9. Les équivoques de la souffrance chez Jean Bodel

    Directory of Open Access Journals (Sweden)

    Gabriela Tanase

    2010-02-01

    Full Text Available Atteint d’un mal qu’il désigne plus loin comme la lèpre, Jean Bodel prend congé des arrageois et établit ainsi un genre poétique qui, au début du XIIIe siècle, représente la première manifestation en littérature française de la perspective ironique du poète envers lui-même. Les Congés de Bodel semblent se fonder sur un «jeu de la souffrance et de la honte, du ‘dire’ et de ‘se cacher’» et, par une variante du thème de la chantepleure, ils anticipent la poésie lyrique du XVe siècle. (... La souffrance constitue ainsi le leurre d’un sens qui serait séditieux et qui dépasse pourtant la sphère du social ou de l’idéologique, car il se résout dans la maîtrise de la parole. L’étalage d’habileté poétique, art d’un discours où les significations s’effritent, séduit le lecteur d’aujourd’hui, tout comme le public d’alors, appelés tous les deux à chercher les multiples visages du poète.

  10. Empire et souveraineté populaire chez Marsile de Padoue

    Directory of Open Access Journals (Sweden)

    Nestor Capdevila

    2010-09-01

    Full Text Available Marsile de Padoue a été jugé comme un penseur médiéval ou un précurseur de la modernité en raison de sa défense de l’empire et de la thèse dite de la souveraineté populaire. Ces discussions négligent la dimension impériale de la modernité et séparent des thèses qui sont liées dans la pensée de l’auteur. L’argumentation de Marsile de Padoue permet d’analyser rétrospectivement les affinités de la logique des concepts d’empire et de souveraineté populaire en montrant la part d’imaginaire de leur objet. Elle est une condition de leur existence et un argument pour la mettre en doute.

  11. Tuberculose multifocale chez les immunocompétents

    Science.gov (United States)

    Rezgui, Amel; Fredj, Fatma Ben; Mzabi, Anis; Karmani, Monia; Laouani, Chadia

    2016-01-01

    La tuberculose multifocale est définie par la l'atteinte d'au moins deux sites extra-pulmonaires associée ou non à une atteinte pulmonaire. On se propose d’étudier les différentes caractéristiques cliniques et évolutives de la tuberculose multifocale à travers une étude rétrospective de 10 cas. Parmi 41 cas de tuberculose colligés entre 1999 et 2013. Dix patients avaient une tuberculose multifocale, soit 24% des patients. Il s'agissait de 9 femmes et 1 homme d’âge moyen à 50 ans (30-68 ans). Nos patients étaient tous correctement vaccinés par le BCG. Un bilan à la recherche d'une éventuelle immunodépression fait pour tous les patients était négatif. Il s'agissait d'une tuberculose ganglionnaire dans 7 cas, digestive dans 3 cas, péricardique dans 2 cas, ostéo-articulaire dans 2 cas, cérébrale dans 1 cas, urinaire dans 2 cas, uro-génitale dans 4 cas, surrénalienne dans 1 cas, cutanée dans 1 cas et musculaire dans 1 cas. Tous nos patients ont bénéficié d'un traitement antituberculeux pour une durée moyenne de 10 mois avec bonne évolution. La tuberculose multifocale est une des maladies à diagnostic difficile. Elle peut toucher les immunocompétents mais son pronostic est souvent bon. Un traitement anti-tuberculeux doit être instauré le plus rapidement possible pour éviter les séquelles. PMID:27583077

  12. Transformation chez les plantes fixatrices d'azote

    OpenAIRE

    Duhoux, Emile; Bogusz, Didier; Franche, Claudine

    1992-01-01

    Les techniques classiques d'amélioration végétale par hybridation sexuée, fusion somatique et mutagénèse artificielle, conduisent à l'introduction, en mélange et de manière aveugle, d'informations génétiques dans la descendance. Or, de plus en plus, on souhaite introduire seulement un ou quelques caractères nouveaux, parfaitement identifiés, sans bouleverser l'architecture génétique globale de la plante. Les transformations génétiques assurent cette opération. Il n'y a pas actuellement de mét...

  13. ONTOLOGIE ET MÉTAPHYSIQUE CHEZ LES GRECS. PLATON

    Directory of Open Access Journals (Sweden)

    GHEORGHE VLĂDUŢESCU

    2011-11-01

    Full Text Available The aim of this essay is to highlighting the issue of being(nessand of modality in Plato’s philosophy under the Socratic influence for the ontological design in its metaphysical significance. I follow some cardinal concepts, like: eidos and idéa within the development of the doctrine of ideas, trying to stress the importance of a holistic reading in the dynamic unity of Plato’s Dialogues, to enlightening the central category of being(ness.

  14. L'obscurité du sens chez Clauberg

    Directory of Open Access Journals (Sweden)

    Guillaume Coqui

    2007-07-01

    Full Text Available On examine ici les principaux linéaments de l'herméneutique de Johannes Clauberg, notamment à travers la structure de sa Logica Vetus et Nova et le modèle qu'elle propose de l'analyse de la " phrase obscure ". La thèse soutenue est que si Clauberg place essentiellement dans le lexique, et non dans la syntaxe, les racines de l'ambiguïté et de l'obscurité des énoncés, c'est que sa conception du langage et de la pensée les rend trop isomorphes l'un à l'autre pour qu'une obscurité proprement syntaxique puisse être conçue.The major features of Johannes Clauberg's hermeneutics are examined in this paper, as they appear in the very structure of one of his major works, the Logica Vetus et Nova, and particularly in the pattern of analysis provided by this work when it comes to interpret an " obscure sentence ". Clauberg looks for the roots of ambiguity and obscurity rather in the words themselves than in their syntactic combinations; because - that's the conclusion we intend to draw - of his conception of the relation between language and thought. For Clauberg, language and thought are too identical in their structures for a major discrepancy to occur between them.

  15. Les modalités du temps chez Benjamin Franklin

    Directory of Open Access Journals (Sweden)

    Elise Marienstras

    2010-01-01

    Full Text Available La renommée multiséculaire de Benjamin Franklin tient surtout à sa qualité d'homme des Lumières. Cet article s'intéresse à l'extrême complexité de sa pensée sur le temps comme concept, comme mode de vie, comme outil pour s'enrichir, et comme vision générale du progrès du genre humain.The long-lasting fame of Benjamin Franklin rests principally on his characteristics as a scientist and a philosopher of the Enlightenment. This article raises the question of Franklin's conception of time and examines his numerous uses of « time » as a concept, as a way of living, as a means to obtain wealth, as a general vision of the progress of mankind.

  16. Pesticides et toxicité chez l'abeille - USA

    OpenAIRE

    Johnson, Reed M.; Marion D Ellis; Mullin, Christopher A.; Frazier, Maryann

    2010-01-01

    International audience; Until 1985 discussions of pesticides and honey bee toxicity in the USA were focused on pesticides applied to crops and the unintentional exposure of foraging bees to them. The recent introduction of arthropod pests of honey bees, Acarapis woodi (1984), Varroa destructor (1987), and Aethina tumida (1997), to the USA have resulted in the intentional introduction of pesticides into beehives to suppress these pests. Both the unintentional and the intentional exposure of ho...

  17. Compréhension et histoire chez Dilthey

    Directory of Open Access Journals (Sweden)

    Csaba Olay

    2014-06-01

    Full Text Available The paper investigates Dilthey’s hermeneutic conception of understanding with regard to the question of the human sciences (Geisteswissenschaften, and analyses his path-breaking work as the first elaboration of a dualistic account in philosophy of science. Although not having reached a satisfying version of his approach, Dilthey opened with the distinction between natural sciences and human sciences an ongoing discussion on the unity or plurality of what might be called “science”. I follow in the paper how Dilthey developed in his later writings a hermeneutics designed to give epistemological foundations for human sciences. Afterwards, I explore the work of Dilthey by relating it to the philosophical hermeneutics of Hans-Georg Gadamer which can be analyzed partly as continuation, partly as critique of Dilthey’s philosophical project. I shall argue for the claim that Gadamer gives a deeper image of human sciences, while renouncing to grasp them in terms of their scientific character..

  18. Peste émotionnelle et imaginaire social chez Wilhelm Reich

    Directory of Open Access Journals (Sweden)

    Georges Bertin

    2003-12-01

    Full Text Available Il est pour nous frappant, presque au sens premier, de constater aujourd'hui que les analyses sociologiques posées par Wilhelm Reich voici 70 ans sont à nouveau d'une extrême actualité. Alors qu'une des grandes voix de l'analyse critique, celle de Castoriadis, bien éloignée des sophismes actuels de nouveaux philosophes s'évertuant surtout à accéder aux prébendes publiques et éditoriales, s'est éteinte depuis maintenant six ans, alors que les politiciens s'évertuent, sur les scènes de la Société du Spectacle, à faire assaut des procédés de communication les plus dérisoires pour masquer leur absence de pensée politique, jamais notre société post moderne n'a en effet été aussi proche de cette crise des significations imaginaires sociales que Reich nommait déjà, dans les années 30, peste émotionnelle.

  19. Imitation et communication chez le jeune enfant avec autisme

    OpenAIRE

    Bendiouis, Sarah

    2015-01-01

    Our study tests the effects of training to imitation on the development of imitative and communicative skills of children with autism spectrum disorder. We selected a group of 21 children, aged between 4 and 10 years, diagnosed according to ICD-10, the ADOS and ADI-R. We followed a three-step procedure: assessment of imitative performance, learning by imitation, nonverbal communication and intensity of the disorder; training in imitation using a protocol based on the development of imitation;...

  20. Tuberculose multifocale chez les immunocompétents

    OpenAIRE

    Rezgui, Amel; Fredj, Fatma Ben; Mzabi, Anis; Karmani, Monia; Laouani, Chadia

    2016-01-01

    La tuberculose multifocale est définie par la l'atteinte d'au moins deux sites extra-pulmonaires associée ou non à une atteinte pulmonaire. On se propose d’étudier les différentes caractéristiques cliniques et évolutives de la tuberculose multifocale à travers une étude rétrospective de 10 cas. Parmi 41 cas de tuberculose colligés entre 1999 et 2013. Dix patients avaient une tuberculose multifocale, soit 24% des patients. Il s'agissait de 9 femmes et 1 homme d’âge moyen à 50 ans (30-68 ans). ...

  1. Espace et spatialité chez Kazuo Iwamura

    Directory of Open Access Journals (Sweden)

    Christophe Meunier

    2012-01-01

    Full Text Available Pour amorcer une étude sur les représentations de l’espace et les relations que les personnages de l’auteur/illustrateur japonais Kazuo Iwamura tissent avec le territoire qu’ils habitent, je voudrais partir de la double page 10-11 du premier album de la série consacrée à la famille Souris : les quatorze souris ont été obligées de fuir leur habitation d’origine et traversent alors un sous-bois. Kazuo Iwamura les représente dans un espace qu’ils ne connaissent pas, qui leur est donc étranger et...

  2. Effets du fluor et du phosphogypse chez les organismes marins

    OpenAIRE

    Martin, J.L.; Le Guellec, Anne-marie; Cosson, R.

    1982-01-01

    Dans le cadre général des recherches visant à déterminer l'action des effluents industriels et plus précisément du fluor dans le cas de cette étude, le programme dont les résultats sont présentés avait pour but de déterminer les effets de cet élément sur les organismes marins. Trois aspects essentiels ont été envisagés : - Effets létaux du fluor ; - effets du fluor sur certaines fonctions éthologiques ; - bio-accumulation de l'élément par les organismes marins.

  3. Chez Peter Higgs, père du fameux boson

    CERN Multimedia

    Dessibourg, Olivier

    2008-01-01

    At CERN, near Geneva, the LHC accelerator should start in 2008 for a fabulous search: find the "Higgs boson", a postulated particle in 1964, and who should revolutionize physics. An exclusive meeting in Edimburg with its "inventor", a modest Scottish physicist. (4 pages)

  4. Facteurs de risque de cancer du poumon chez la femme

    OpenAIRE

    Papadopoulos, Alexandra

    2012-01-01

    The incidence of female lung cancer in developed countries has been increasing since 1950 and particularly in France where the cigarettes consumption has also increased. Since 1980, a growing number of epidemiological surveys have pinpointed the risk of female lung cancer related to smoking. Consecutively, a debate on gender differences in lung cancer risk has appeared, but still in progress nowadays. The reproductive factors could explain these differences. In order to have recent and reliab...

  5. Molecular Mechanism of Solar Energy Harvesting by Purple Photosynthetic Bacteria%紫色光合细菌捕获太阳能的分子机理

    Institute of Scientific and Technical Information of China (English)

    王万能; 陈国平; 胡宗利; 李尽哲; 何帅

    2011-01-01

    光合作用是地球上最重要的化学反应,生物体通过它捕获太阳能,转为化学能供生长繁殖需要.光合细菌是地球上最早出现的具有原始光能合成体系的微生物,其光合反应中心是一个由多种色素分子与蛋白质以非共价键方式结合的、具有特定构象的色素-蛋白复合体-光反应中心RC(Reaction center)和LH(Light Harvesting),光能通过电荷分离及电子转移反应转化为化学能,其效率是当前人工模拟远远不能及的.本文综述了紫色光合细菌捕获太阳能的分子结构、作用机理的研究进展,并结合作者在R.sphaeroides LHII蛋白组份同源及异源基因表达方面的研究结果进行相应的分析,明确了Rhodobacter sphaeroides基因组中同源基因puc2BA的表达特点和功能,Rhodovulum sulfidophilum pucsBA与R.sphaeroides pufBA能够同时在R.sphaeroides中表达,能同时形成LHII和LHI,并具有能量传递功能.%Photosynthesis is arguably the most important biological process, by it organisms harvest solar energy and transfer it into chemical energy for growth and reproduction.The photosynthetic bacteria are the earliest microbe with photosynthesis found on earth.The photosynthetic apparatus of purple bacteria is a nanometric assembly in the intracytoplasmic membranes and consists of pigment-protein complexes, the photosynthetic RC (Reaction center) and LH (Light harvesting).The primary processes of photosynthesis involve absorption of photons by LH complexes, transfer of excitation energy from the LH complexes to the photosynthetic RC, where the primary energy conversion takes place.The researches on molecular structure and mechanism of purple photosynthetic bacteria harvesting solar energy were summarized.Molecular biology techniques and spectroscopic analysis were applied to research the expression and function of puc2BA and pucsBA by the authors, and it was concluded that the puc2BA gene was normally expressed in Rhodobacter

  6. Male breast cancer: 22 case reports at the National Hospital of Niamey- Niger (West Africa Le cancer du sein chez l'homme: à propos de 22 cas a l'Hôpital National de Niamey- Niger (Afrique de l'Ouest

    Directory of Open Access Journals (Sweden)

    Nouhou Hassane

    2009-11-01

    Full Text Available BACKGROUND: Male breast cancer (MBC is rare. The objective of the study is to report clinicopathological characteristics, treatment patterns, and outcomes of MBC. METHODS: This study, which includes two parts (retrospective and prospective, focused on all hospitalized male patients with breast cancer during 17 years (1992–2008 with histological confirmation. RESULTS: The series included 22 patients. The mean age was 52.8 years (range: 28–80 years. MBC represented 5.7% of all breast cancers. Most patients had an advanced disease with skin ulceration and inflammation T3 (31.9% and T4 (59.1%. The majority of patients came from rural areas (63.6%. The duration of signs ranged from 1 to 7 years. Histology found infiltrating ductal carcinoma in 14 cases (63.6%, sarcoma in 3 cases (13.6%, papillary carcinoma in 2 cases (9%, and lobular carcinoma, medullar carcinoma, and mucinous carcinoma in 4.6% each of the others cases. The treatment had consisted of a radical mastectomy (Halsted or Patey in 19 cases (86.4% with axillary clearance and incomplete resection in 3 cases (13.6%. In the retrospective study follow-up of 14 patients, we lost sight of 13 patients 6 months after surgery. In the prospective study of 8 patients 10 to 36 months after mastectomy, 4 patients were deceased (50%, 4 were alive with 1 case having a local recurrence and pulmonary metastasis. CONCLUSION: The advanced clinical forms of MBC are most frequent with skin ulceration and nodal enlargement. The absence of radiotherapy and the low access of chemotherapy limited the treatment to radical mastectomy (Halsted in the majority of cases. OBJECTIF : Le cancer du sein chez l’homme (CSH est une affection rare .Le but de cette étude est de déterminer les caractéristiques clinicopathologiques, les résultats du traitement et l’évolution du CSH. Méthodologie : Il s’agit d’étude comportant 2 volets (rétrospectif et prospectif. Etaient inclus tous les patients de sexe

  7. Potential use of thermophilic dark fermentation effluents in photofermentative hydrogen production by Rhodobacter capsulatus

    NARCIS (Netherlands)

    Ozgur, E.; Afsar, N.; Vrije, de G.J.; Yucel, M.; Gunduz, U.; Claassen, P.A.M.; Eroglu, I.

    2010-01-01

    Biological hydrogen production by a sequential operation of dark and photofermentation is a promising route to produce hydrogen. The possibility of using renewable resources, like biomass and agro-industrial wastes, provides a dual effect of sustainability in biohydrogen production and simultaneous

  8. Biological hydrogen production from olive mill wastewater with two-stage processes

    Energy Technology Data Exchange (ETDEWEB)

    Eroglu, Ela; Eroglu, Inci [Department of Chemical Engineering, Middle East Technical University, 06531, Ankara (Turkey); Guenduez, Ufuk; Yuecel, Meral [Department of Biology, Middle East Technical University, 06531, Ankara (Turkey); Tuerker, Lemi [Department of Chemistry, Middle East Technical University, 06531, Ankara (Turkey)

    2006-09-15

    In the present work two novel two-stage hydrogen production processes from olive mill wastewater (OMW) have been introduced. The first two-stage process involved dark-fermentation followed by a photofermentation process. Dark-fermentation by activated sludge cultures and photofermentation by Rhodobacter sphaeroides O.U.001 were both performed in 55ml glass vessels, under anaerobic conditions. In some cases of dark-fermentation, activated sludge was initially acclimatized to the OMW to provide the adaptation of microorganisms to the extreme conditions of OMW. The highest hydrogen production potential obtained was 29l{sub H{sub 2}}/l{sub OMW} after photofermentation with 50% (v/v) effluent of dark fermentation with activated sludge. Photofermentation with 50% (v/v) effluent of dark fermentation with acclimated activated sludge had the highest hydrogen production rate (0.008ll{sup -1}h{sup -1}). The second two-stage process involved a clay treatment step followed by photofermentation by R. sphaeroides O.U.001. Photofermentation with the effluent of the clay pretreatment process (4% (v/v)) gives the highest hydrogen production potential (35l{sub H{sub 2}}/l{sub OMW}), light conversion efficiency (0.42%) and COD conversion efficiency (52%). It was concluded that both pretreatment processes enhanced the photofermentative hydrogen production process. Moreover, hydrogen could be produced with highly concentrated OMW. Two-stage processes developed in the present investigation have a high potential for solving the environmental problems caused by OMW. (author)

  9. Temperature dependent LH1→RC energy transfer in purple bacteria Tch. tepidum with shiftable LH1-Qy band: A natural system to investigate thermally activated energy transfer in photosynthesis.

    Science.gov (United States)

    Ma, Fei; Yu, Long-Jiang; Wang-Otomo, Zheng-Yu; van Grondelle, Rienk

    2016-04-01

    The native LH1-RC complex of the purple bacterium Thermochromatium (Tch.) tepidum has an ultra-red LH1-Qy absorption at 915nm, which can shift to 893 and 882nm by means of chemical modifications. These unique complexes are a good natural system to investigate the thermally activated energy transfer process, with the donor energies different while the other factors (such as the acceptor energy, special pair at 890nm, and the distance/relative orientation between the donor and acceptor) remain the same. The native B915-RC, B893-RC and B882-RC complexes, as well as the LH1-RC complex of Rhodobacter (Rba.) sphaeroides were studied by temperature-dependent time-resolved absorption spectroscopy. The energy transfer time constants, kET(-1), are 65, 45, 46 and 45ps at room temperature while 225, 58, 85, 33ps at 77K for the B915-RC, B893-RC, B882-RC and Rba. sphaeroides LH1-RC, respectively. The dependences of kET on temperature have different trends. The reorganization energies are determined to be 70, 290, 200 and 45cm(-1), respectively, by fitting kET vs temperature using Marcus equation. The activation energies are 200, 60, 115 and 20cm(-1), respectively. The influences of the structure (the arrangement of the 32 BChl a molecules) on kET are discussed based on these results, to reveal how the B915-RC complex accomplishes its energy transfer function with a large uphill energy of 290cm(-1).

  10. Production of bioplastics and hydrogen gas by photosynthetic microorganisms

    Science.gov (United States)

    Yasuo, Asada; Masato, Miyake; Jun, Miyake

    1998-03-01

    Our efforts have been aimed at the technological basis of photosynthetic-microbial production of materials and an energy carrier. We report here accumulation of poly-(3-hydroxybutyrate) (PHB), a raw material of biodegradable plastics and for production of hydrogen gas, and a renewable energy carrier by photosynthetic microorganisms (tentatively defined as cyanobacteria plus photosynthetic bateria, in this report). A thermophilic cyanobacterium, Synechococcus sp. MA19 that accumulates PHB at more than 20% of cell dry wt under nitrogen-starved conditions was isolated and microbiologically identified. The mechanism of PHB accumulation was studied. A mesophilic Synechococcus PCC7942 was transformed with the genes encoding PHB-synthesizing enzymes from Alcaligenes eutrophus. The transformant accumulated PHB under nitrogen-starved conditions. The optimal conditions for PHB accumulation by a photosynthetic bacterium grown on acetate were studied. Hydrogen production by photosynthetic microorganisms was studied. Cyanobacteria can produce hydrogen gas by nitrogenase or hydrogenase. Hydrogen production mediated by native hydrogenase in cyanobacteria was revealed to be in the dark anaerobic degradation of intracellular glycogen. A new system for light-dependent hydrogen production was targeted. In vitro and in vivo coupling of cyanobacterial ferredoxin with a heterologous hydrogenase was shown to produce hydrogen under light conditions. A trial for genetic trasformation of Synechococcus PCC7942 with the hydrogenase gene from Clostridium pasteurianum is going on. The strong hydrogen producers among photosynthetic bacteria were isolated and characterized. Co-culture of Rhodobacter and Clostriumdium was applied to produce hydrogen from glucose. Conversely in the case of cyanobacteria, genetic regulation of photosynthetic proteins was intended to improve conversion efficiency in hydrogen production by the photosynthetic bacterium, Rhodobacter sphaeroides RV. A mutant acquired by

  11. Studies of Structure and Dynamics of Light Harvesting Complex 1 of R. Sphaeroides by Solid State NMR

    Energy Technology Data Exchange (ETDEWEB)

    McDermott, Ann E [Columbia Univ., New York, NY (United States)

    2014-11-14

    Studies of the structure and dynamics of a light harvesting complex from photosynthetic bacteria are described. Using Nuclear Magnetic Resonance methods, we explored the idea that optical properties are modulated via a conformational switch in the BChl chromophores, in a way that provides benefits for the efficiency of energy conversion.

  12. Hydrogen production as a novel process of wastewater treatment - studies on tofu wastewater with entrapped R. sphaeroides and mutagenesis

    Energy Technology Data Exchange (ETDEWEB)

    Heguang Zhu [Tongji Univ., Shanghai (China). Inst. of Environmental Science; Ueda, Shunsaku [Utsunomiya Univ. (Japan). Dept. of Biological Productive Science; Asada, Yasio [Nihon Univ., Chiba (Japan). College of Science and Technology; Miyake, Jun [National Inst. for Advanced Interdisciplinary Research, Ibaraki (Japan)

    2002-12-01

    Attention is focusing on hydrogen production from wastewater, not only because hydrogen is a clean energy but also because it can be a process for wastewater treatment. In this paper, the characteristics of biological hydrogen production as a process of wastewater treatment is discussed by a comparison with methane production. The hydrogen production from tofu wastewater by anoxygenic phototrophic bacteria and its potential for wastewater treatment are reported. The possibility of co-cultivation with heterotrophic anaerobic bacteria was also investigated. As a solution to overcome the repressive effect of NH{sub 4}{sup +} on hydrogen production by anoxygenic phototrophic bacteria, a study was done using glutamine auxotroph which was obtained by chemical mutagenesis. To confirm that the mutation had occurred in DNA molecular level, the glutamine synthetase gene was cloned and sequenced. (Author)

  13. Structural Changes of Water Molecules Upon the Reduction of Quinones in The Reaction Center from Rhodobactery Sphaeroides

    Institute of Scientific and Technical Information of China (English)

    T.Iwata; M.L.Paddock; M.Y.Okamura; H.Kandori

    2007-01-01

    1 Results The photosynthetic bacterial reaction center (RC) is a membrane protein complex.The RC is composed of three protein subunits and redox components such as bacteriochlorophylls, bacteriopheophytins,and quinones.The RC performs the photochemical electron transfer from the bacteriochlorophyll dimer through a series of electron donor and acceptor molecules to a secondary quinone,QB.QB accepts electrons from a primary quinone,QA,in two sequential electron transfer reactions.The second electron trans...

  14. La φιλοστοργία chez Fronton, une vertu sans équivalent latin ? Is φιλοστοργία in Fronto a virtue without Latin equivalent? La φιλοστοργία di Frontone: una virtù senza esatto equivalente latino?

    Directory of Open Access Journals (Sweden)

    Sophie Aubert

    2011-07-01

    Full Text Available Oscillant entre deux acceptions – l’amour d’un être vivant pour sa progéniture ou, chez les auteurs chrétiens, l’affection vive - la philostorgia ne semble pas dotée d’un équivalent latin exact : dans leur correspondance, Cicéron puis Fronton emploient en effet ce terme grec sans le traduire. L’Arpinate en réélabore le sens, grâce à l’apport du stoïcisme, pour le rattacher à l’amour du genre humain (philanthrôpia par le biais de la théorie de l’oikéiôsis (ou « appropriation », démontrant ainsi que l’affection des parents pour leurs enfants est ancrée dans la nature et que l’aptitude de l’homme à vivre en société, par conséquent, est elle aussi naturelle, selon un raisonnement exposé au livre III du De Finibus, ouvrage contemporain du premier emploi du mot philostorgia dans les lettres de Cicéron. Quant au maître de rhétorique de Marc Aurèle, il souligne son incapacité à traduire ce mot tout en l’associant à la franchise dans l’affection ainsi qu’à une intimité quasi familiale et en déplorant que cette vertu fût absente du cœur des Romains, plus précisément sans doute des courtisans de son élève impérial. Or si ce dernier, dans ses Pensées, exprime le même regret face à la dureté et à l’hypocrisie de son entourage, il réinterprète la philostorgia à la lumière de la philosophie du Portique puisqu’il la rattache non seulement à la bonté (eumeneia, l’une des subdivisions de l’émotion positive qu’est le désir rationnel (ou boulêsis, mais aussi à la philanthrôpia, et qu’il bannit l’ironie au profit d’une sincérité indispensable à l’affection, faisant ici écho au portrait du sage stoïcien tel que le dresse Stobée. Ainsi Marc Aurèle tire-t-il profit à la fois des leçons de son professeur et de l’enseignement des philosophes du Portique.Oscillating between two meanings - the love of a living being for its offspring, or among Christian

  15. DETERMINATION DE QUELQUES PARAMETRES BIOCHIMIQUES CHEZ LES FEMMES ENCEINTES OBESES AVEC OU SANS COMPLICATIONS ET CHEZ LEURS NOUVEAU-NES DANS LA REGION DE TLEMCEN

    OpenAIRE

    BENMAHIEDDINE, Assia

    2014-01-01

    Le but de ce travail consiste à mettre en évidence les altérations métaboliques liées à l’obésité en absence ou en présence de complications au cours de la grossesse, par l’analyse des paramètres biochimiques (glucose, cholestérol, triglycérides, urée, créatinines, protéines totales, albumines, calcium, phosphore, transaminases TGO-TGP). Nos résultats montrent que l’obésité seule ou associée à l’une de ses complications (diabète et hypertension) au cours de la grossesse entraîn...

  16. Pleiotropic effects of puf interposon mutagenesis on carotenoid biosynthesis in Rubrivivax gelatinosus. A new gene organization in purple bacteria.

    Science.gov (United States)

    Ouchane, S; Picaud, M; Vernotte, C; Reiss-Husson, F; Astier, C

    1997-01-17

    Rubrivivax gelatinosus mutants affected in the carotenoid biosynthesis pathways were created by interposon mutagenesis within the puf operon. Genetic and biochemical analysis of several constructed mutants suggest that at least crtC is localized downstream of the puf operon and that it is cotranscribed with this operon. Sequence analysis confirmed the genetic data and showed the presence of crtD and crtC genes downstream of the puf operon, a localization different from that known for other purple bacteria. Inactivation of the crtD gene indicated that the two crt genes are cotranscribed and that they are involved not only in the hydroxyspheroidene biosynthesis pathway as in Rhodobacter sphaeroides and R. capsulatus, but also in the spirilloxanthin biosynthesis pathway. Carotenoid genes implicated in the spirilloxanthin biosynthesis pathway were thus identified for the first time. Furthermore, analysis of carotenoid synthesis in the mutants gave genetic evidence that crtD and crtC genes are cotranscribed with the puf operon using the oxygen-regulated puf promoter.

  17. Construction and validation of an atomic model for bacterial TSPO from electron microscopy density, evolutionary constraints, and biochemical and biophysical data.

    Science.gov (United States)

    Hinsen, Konrad; Vaitinadapoule, Aurore; Ostuni, Mariano A; Etchebest, Catherine; Lacapere, Jean-Jacques

    2015-02-01

    The 18 kDa protein TSPO is a highly conserved transmembrane protein found in bacteria, yeast, animals and plants. TSPO is involved in a wide range of physiological functions, among which the transport of several molecules. The atomic structure of monomeric ligand-bound mouse TSPO in detergent has been published recently. A previously published low-resolution structure of Rhodobacter sphaeroides TSPO, obtained from tubular crystals with lipids and observed in cryo-electron microscopy, revealed an oligomeric structure without any ligand. We analyze this electron microscopy density in view of available biochemical and biophysical data, building a matching atomic model for the monomer and then the entire crystal. We compare its intra- and inter-molecular contacts with those predicted by amino acid covariation in TSPO proteins from evolutionary sequence analysis. The arrangement of the five transmembrane helices in a monomer of our model is different from that observed for the mouse TSPO. We analyze possible ligand binding sites for protoporphyrin, for the high-affinity ligand PK 11195, and for cholesterol in TSPO monomers and/or oligomers, and we discuss possible functional implications.

  18. Ionic liquids effects on the permeability of photosynthetic membranes probed by the electrochromic shift of endogenous carotenoids.

    Science.gov (United States)

    Malferrari, Marco; Malferrari, Danilo; Francia, Francesco; Galletti, Paola; Tagliavini, Emilio; Venturoli, Giovanni

    2015-11-01

    Ionic liquids (ILs) are promising materials exploited as solvents and media in many innovative applications, some already used at the industrial scale. The chemical structure and physicochemical properties of ILs can differ significantly according to the specific applications for which they have been synthesized. As a consequence, their interaction with biological entities and toxicity can vary substantially. To select highly effective and minimally harmful ILs, these properties need to be investigated. Here we use the so called chromatophores--protein-phospholipid membrane vesicles obtained from the photosynthetic bacterium Rhodobacter sphaeroides--to assess the effects of imidazolinium and pyrrolidinium ILs, with chloride or dicyanamide as counter anions, on the ionic permeability of a native biological membrane. The extent and modalities by which these ILs affect the ionic conductivity can be studied in chromatophores by analyzing the electrochromic response of endogenous carotenoids, acting as an intramembrane voltmeter at the molecular level. We show that chromatophores represent an in vitro experimental model suitable to probe permeability changes induced in cell membranes by ILs differing in chemical nature, degree of oxygenation of the cationic moiety and counter anion.

  19. Atomic-level structural and functional model of a bacterial photosynthetic membrane vesicle.

    Science.gov (United States)

    Sener, Melih K; Olsen, John D; Hunter, C Neil; Schulten, Klaus

    2007-10-02

    The photosynthetic unit (PSU) of purple photosynthetic bacteria consists of a network of bacteriochlorophyll-protein complexes that absorb solar energy for eventual conversion to ATP. Because of its remarkable simplicity, the PSU can serve as a prototype for studies of cellular organelles. In the purple bacterium Rhodobacter sphaeroides the PSU forms spherical invaginations of the inner membrane, approximately 70 nm in diameter, composed mostly of light-harvesting complexes, LH1 and LH2, and reaction centers (RCs). Atomic force microscopy studies of the intracytoplasmic membrane have revealed the overall spatial organization of the PSU. In the present study these atomic force microscopy data were used to construct three-dimensional models of an entire membrane vesicle at the atomic level by using the known structure of the LH2 complex and a structural model of the dimeric RC-LH1 complex. Two models depict vesicles consisting of 9 or 18 dimeric RC-LH1 complexes and 144 or 101 LH2 complexes, representing a total of 3,879 or 4,464 bacteriochlorophylls, respectively. The in silico reconstructions permit a detailed description of light absorption and electronic excitation migration, including computation of a 50-ps excitation lifetime and a 95% quantum efficiency for one of the model membranes, and demonstration of excitation sharing within the closely packed RC-LH1 dimer arrays.

  20. Overall energy conversion efficiency of a photosynthetic vesicle.

    Science.gov (United States)

    Sener, Melih; Strumpfer, Johan; Singharoy, Abhishek; Hunter, C Neil; Schulten, Klaus

    2016-08-26

    The chromatophore of purple bacteria is an intracellular spherical vesicle that exists in numerous copies in the cell and that efficiently converts sunlight into ATP synthesis, operating typically under low light conditions. Building on an atomic-level structural model of a low-light-adapted chromatophore vesicle from Rhodobacter sphaeroides, we investigate the cooperation between more than a hundred protein complexes in the vesicle. The steady-state ATP production rate as a function of incident light intensity is determined after identifying quinol turnover at the cytochrome bc1 complex (cytb⁢c1) as rate limiting and assuming that the quinone/quinol pool of about 900 molecules acts in a quasi-stationary state. For an illumination condition equivalent to 1% of full sunlight, the vesicle exhibits an ATP production rate of 82 ATP molecules/s. The energy conversion efficiency of ATP synthesis at illuminations corresponding to 1%-5% of full sunlight is calculated to be 0.12-0.04, respectively. The vesicle stoichiometry, evolutionarily adapted to the low light intensities in the habitat of purple bacteria, is suboptimal for steady-state ATP turnover for the benefit of protection against over-illumination.

  1. Kinetic study approach of remazol black-B use for the development of two-stage anoxic-oxic reactor for decolorization/biodegradation of azo dyes by activated bacterial consortium.

    Science.gov (United States)

    Dafale, Nishant; Wate, Satish; Meshram, Sudhir; Nandy, Tapas

    2008-11-30

    The laboratory-isolated strains Pseudomonas aeruginosa, Rhodobacter sphaeroides, Proteus mirabilis, Bacillus circulance, NAD 1 and NAD 6 were observed to be predominant in the bacterial consortium responsible for effective decolorization of the azo dyes. The kinetic characteristics of azo dye decolorization by bacterial consortium were determined quantitatively using reactive vinyl sulfonated diazo dye, remazol black-B (RB-B) as a model substrate. Effects of substrate (RB-B) concentration as well as different substrates (azo dyes), environmental parameters (temperature and pH), glucose and other electron donor/co-substrate on the rate of decolorization were investigated to reveal the key factor that determines the performance of dye decolorization. The activation energy (E(a)) and frequency factor (K(0)) based on the Arrhenius equation was calculated as 11.67 kcal mol(-1) and 1.57 x 10(7)mg lg MLSS(-1)h(-1), respectively. The Double-reciprocal or Lineweaver-Burk plot was used to evaluate V(max), 15.97 h(-1) and K(m), 85.66 mg l(-1). The two-stage anoxic-oxic reactor system has proved to be successful in achieving significant decolorization and degradation of azo dyes by specific developed bacterial consortium with a removal of 84% color and 80% COD for real textile effluents vis-à-vis >or=90% color and COD removal for synthetic dye solution.

  2. Electrostatics of the photosynthetic bacterial reaction center. Protonation of Glu L 212 and Asp L 213 - A new method of calculation.

    Science.gov (United States)

    Ptushenko, Vasily V; Cherepanov, Dmitry A; Krishtalik, Lev I

    2015-12-01

    Continuum electrostatic calculation of the transfer energies of anions from water into aprotic solvents gives the figures erroneous by order of magnitude. This is due to the hydrogen bond disruption that suggests the necessity to reconsider the traditional approach of the purely electrostatic calculation of the transfer energy from water into protein. In this paper, the method combining the experimental estimates of the transfer energies from water into aprotic solvent and the electrostatic calculation of the transfer energies from aprotic solvent into protein is proposed. Hydrogen bonds between aprotic solvent and solute are taken into account by introducing an imaginary aprotic medium incapable to form hydrogen bonds with the solute. Besides, a new treatment of the heterogeneous intraprotein dielectric permittivity based on the microscopic protein structure and electrometric measurements is elaborated. The method accounts semi-quantitatively for the electrostatic effect of diverse charged amino acid substitutions in the donor and acceptor parts of the photosynthetic bacterial reaction center from Rhodobacter sphaeroides. Analysis of the volatile secondary acceptor site QB revealed that in the conformation with a minimal distance between quinone QB and Glu L 212 the proton uptake upon the reduction of QB is prompted by Glu L 212 in alkaline and by Asp L 213 in slightly acidic regions. This agrees with the pH dependences of protonation degrees and the proton uptake. The method of pK calculation was applied successfully also for dissociation of Asp 26 in bacterial thioredoxin.

  3. Long term stabilization of reaction center protein photochemistry by carbon nanotubes

    Energy Technology Data Exchange (ETDEWEB)

    Magyar, Melinda; Hajdu, Kata; Szabo, Tibor; Nagy, Laszlo [Department of Medical Physics and Informatics, University of Szeged, 6720 Szeged (Hungary); Hernadi, Klara [Department of Applied and Environmental Chemistry, University of Szeged, 6720 Szeged (Hungary); Dombi, Andras [Institute of Material Sciences and Engineering, University of Szeged, 6701 Szeged (Hungary); Horvath, Endre; Magrez, Arnaud; Forro, Laszlo [Institute of Physics of Complex Matter, Ecole Polytechnique Federale de Lausanne, 1015 Lausanne (Switzerland)

    2011-11-15

    The long term stability and the redox interaction between single walled carbon nanotubes (SWNTs) and photosynthetic reaction center proteins (RCs) purified from purple bacterium Rhodobacter sphaeroides R-26 in the SWNT/RC complex has been investigated. The binding of SWNT to RC results in an accumulation of positive (the oxidized primary electron donor, P{sup +}) and negative (semiquinone forms, Q{sup -}{sub A} and Q{sup -}{sub B}, the reduced primary and secondary quinones, respectively) charges followed by slow reorganization of the protein structure after excitation. The photochemical activity of the SWNT/RC complexes remains stable for several weeks even in dried form. In the absence of SWNT the secondary quinone activity decays quickly as a function of time after drying the RC onto a glass surface. Polarography measurements substantiate the idea that there is an electronic interaction between the RCs and SWNTs after light excitation, which was suggested earlier by optical measurements. The special electronic properties of the SWNT/protein complexes open the possibility for several applications, e.g., in microelectronics, analytics, or energy conversion and storage. (Copyright copyright 2011 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  4. RpoH2 sigma factor controls the photooxidative stress response in a non-photosynthetic rhizobacterium, Azospirillum brasilense Sp7.

    Science.gov (United States)

    Kumar, Santosh; Rai, Ashutosh Kumar; Mishra, Mukti Nath; Shukla, Mansi; Singh, Pradhyumna Kumar; Tripathi, Anil Kumar

    2012-12-01

    Bacteria belonging to the Alphaproteobacteria normally harbour multiple copies of the heat shock sigma factor (known as σ(32), σ(H) or RpoH). Azospirillum brasilense, a non-photosynthetic rhizobacterium, harbours five copies of rpoH genes, one of which is an rpoH2 homologue. The genes around the rpoH2 locus in A. brasilense show synteny with that found in rhizobia. The rpoH2 of A. brasilense was able to complement the temperature-sensitive phenotype of the Escherichia coli rpoH mutant. Inactivation of rpoH2 in A. brasilense results in increased sensitivity to methylene blue and to triphenyl tetrazolium chloride (TTC). Exposure of A. brasilense to TTC and the singlet oxygen-generating agent methylene blue induced several-fold higher expression of rpoH2. Comparison of the proteome of A. brasilense with its rpoH2 deletion mutant and with an A. brasilense strain overexpressing rpoH2 revealed chaperone GroEL, elongation factors (Ef-Tu and EF-G), peptidyl prolyl isomerase, and peptide methionine sulfoxide reductase as the major proteins whose expression was controlled by RpoH2. Here, we show that the RpoH2 sigma factor-controlled photooxidative stress response in A. brasilense is similar to that in the photosynthetic bacterium Rhodobacter sphaeroides, but that RpoH2 is not involved in the detoxification of methylglyoxal in A. brasilense.

  5. Bacterial bioremediation of selenium oxyanions using a dynamic flow bioreactor and headspace analysis

    Energy Technology Data Exchange (ETDEWEB)

    McCarty, S.L.; Chasteen, T.G. [Sam Houston State Univ., Huntsville, TX (United States). Dept. of Chemistry; Stalder, V.; Bachofen, R. [Univ. of Zuerich (Switzerland). Inst. of Plant Biology

    1995-12-31

    The volatile products of the biological reduction and methylation of selenium`s most common oxyanions, selenate and selenite, were determined using capillary gas chromatography and fluorine-induced chemiluminescence detection. Dimethyl selenide and dimethyl diselenide were detected in the headspace above cultures of bacteria resistant to this metalloid using static and dynamic headspace sampling techniques. Fluorine-induced chemiluminescence detection was applied to determine the relative concentrations of the organosulfur and organoselenium species released over many days of culture growth at a controlled temperature and purge rate. A selenium-resistant bacterium, Pseudomonas fluorescens K27, and a phototrophic bacterium Rhodobacter sphaeroides 2.4.1 were exposed to SeO{sub 4}{sup 2{minus}}, and the cultures` headspaces were examined over a period of several days for volatile selenium-containing products. The results show that the relative production of the volatile species over time depicts a pattern generally independent of the growth phase in the case of the phototrophic bacterium; the concentrations of metabolic dimethyl sulfide and dimethyl selenide determined in static headspace were highest after the microbe had been in stationary phase for 4 days.

  6. Different biochemical mechanisms ensure network-wide balancing of reducing equivalents in microbial metabolism.

    Science.gov (United States)

    Fuhrer, Tobias; Sauer, Uwe

    2009-04-01

    To sustain growth, the catabolic formation of the redox equivalent NADPH must be balanced with the anabolic demand. The mechanisms that ensure such network-wide balancing, however, are presently not understood. Based on 13C-detected intracellular fluxes, metabolite concentrations, and cofactor specificities for all relevant central metabolic enzymes, we have quantified catabolic NADPH production in Agrobacterium tumefaciens, Bacillus subtilis, Escherichia coli, Paracoccus versutus, Pseudomonas fluorescens, Rhodobacter sphaeroides, Sinorhizobium meliloti, and Zymomonas mobilis. For six species, the estimated NADPH production from glucose catabolism exceeded the requirements for biomass synthesis. Exceptions were P. fluorescens, with balanced rates, and E. coli, with insufficient catabolic production, in which about one-third of the NADPH is supplied via the membrane-bound transhydrogenase PntAB. P. versutus and B. subtilis were the only species that appear to rely on transhydrogenases for balancing NADPH overproduction during growth on glucose. In the other four species, the main but not exclusive redox-balancing mechanism appears to be the dual cofactor specificities of several catabolic enzymes and/or the existence of isoenzymes with distinct cofactor specificities, in particular glucose 6-phosphate dehydrogenase. An unexpected key finding for all species, except E. coli and B. subtilis, was the lack of cofactor specificity in the oxidative pentose phosphate pathway, which contrasts with the textbook view of the pentose phosphate pathway dehydrogenases as being NADP+ dependent.

  7. Solvation effect of bacteriochlorophyll excitons in light-harvesting complex LH2.

    Science.gov (United States)

    Urboniene, V; Vrublevskaja, O; Trinkunas, G; Gall, A; Robert, B; Valkunas, L

    2007-09-15

    We have characterized the influence of the protein environment on the spectral properties of the bacteriochlorophyll (Bchl) molecules of the peripheral light-harvesting (or LH2) complex from Rhodobacter sphaeroides. The spectral density functions of the pigments responsible for the 800 and 850 nm electronic transitions were determined from the temperature dependence of the Bchl absorption spectra in different environments (detergent micelles and native membranes). The spectral density function is virtually independent of the hydrophobic support that the protein experiences. The reorganization energy for the B850 Bchls is 220 cm(-1), which is almost twice that of the B800 Bchls, and its Huang-Rhys factor reaches 8.4. Around the transition point temperature, and at higher temperatures, both the static spectral inhomogeneity and the resonance interactions become temperature-dependent. The inhomogeneous distribution function of the transitions exhibits less temperature dependence when LH2 is embedded in membranes, suggesting that the lipid phase protects the protein. However, the temperature dependence of the fluorescence spectra of LH2 cannot be fitted using the same parameters determined from the analysis of the absorption spectra. Correct fitting requires the lowest exciton states to be additionally shifted to the red, suggesting the reorganization of the exciton spectrum.

  8. The kinetic model for slow photoinduced electron transport in the reaction centers of purple bacteria

    Science.gov (United States)

    Serdenko, T. V.; Barabash, Y. M.; Knox, P. P.; Seifullina, N. Kh.

    2016-06-01

    The present work is related to the investigation of slow kinetics of electron transport in the reaction centers (RCs) of Rhodobacter sphaeroides. Experimental data on the absorption kinetics of aqueous solutions of reaction centers at different modes of photoexcitation are given. It is shown that the kinetics of oxidation and reduction of RCs are well described by the sum of three exponential functions. This allows to suggest a two-level kinetic model for electron transport in the RC as a system of four electron-conformational states which correspond to three balance differential equations combined with state equation. The solution of inverse problem made it possible to obtain the rate constant values in kinetic equations for different times and intensities of exciting light. Analysis of rate constant values in different modes of RC excitation allowed to suggest that two mechanisms of structural changes are involved in RC photo-oxidation. One mechanism leads to the increment of the rate of electron return, another one—to its drop. Structural changes were found out to occur in the RCs under incident light. After light was turned off, the reduction of RCs was determined by the second mechanism.

  9. A time-resolved iron-specific X-ray absorption experiment yields no evidence for an Fe2+ --> Fe3+ transition during QA- --> QB electron transfer in the photosynthetic reaction center.

    Science.gov (United States)

    Hermes, Sabine; Bremm, Oliver; Garczarek, Florian; Derrien, Valerie; Liebisch, Peter; Loja, Paola; Sebban, Pierre; Gerwert, Klaus; Haumann, Michael

    2006-01-17

    Previous time-resolved FTIR measurements suggested the involvement of an intermediary component in the electron transfer step Q(A)- --> Q(B) in the photosynthetic reaction center (RC) from Rhodobacter sphaeroides [Remy and Gerwert (2003) Nat. Struct. Biol. 10, 637]. By a kinetic X-ray absorption experiment at the Fe K-edge we investigated whether oxidation occurs at the ferric non-heme iron located between the two quinones. In isolated reaction centers with a high content of functional Q(B), at a time resolution of 30 micros and at room temperature, no evidence for transient oxidation of Fe was obtained. However, small X-ray transients occurred, in a similar micro- to millisecond time range as in the IR experiments, which may point to changes in the Fe ligand environment due to the charges on Q(A)- and Q(B)-. In addition, VIS measurements agree with the IR data and do not exclude an intermediate in the Q(A)- --> Q(B) transition.

  10. Effects of starch loading rate on performance of combined fed-batch fermentation of ground wheat for bio-hydrogen production

    Energy Technology Data Exchange (ETDEWEB)

    Ozmihci, Serpil; Kargi, Fikret [Department of Environmental Engineering, Dokuz Eylul University, 35160 Buca, Izmir (Turkey)

    2010-02-15

    Ground wheat powder solution (10 g L{sup -1}) was subjected to combined dark and light fermentations for bio-hydrogen production by fed-batch operation. A mixture of heat treated anaerobic sludge (AN) and Rhodobacter sphaeroides-NRRL (RS-NRRL) were used as the mixed culture of dark and light fermentation bacteria with an initial dark/light biomass ratio of 1/2. Effects of wheat starch loading rate on the rate and yield of bio-hydrogen formation were investigated. The highest cumulative hydrogen formation (CHF = 3460 ml), hydrogen yield (201 ml H{sub 2} g{sup -1} starch) and formation rate (18.1 ml h{sup -1}) were obtained with a starch loading rate of 80.4 mg S h{sup -1}. Complete starch hydrolysis and glucose fermentation were achieved within 96 h of fed-batch operation producing volatile fatty acids (VFA) and H{sub 2}. Fermentation of VFAs by photo-fermentation for bio-hydrogen production was most effective at starch loading rate of 80.4 mg S h{sup -1}. Hydrogen formation by combined fermentation took place by a fast dark fermentation followed by a rather slow light fermentation after a lag period. (author)

  11. Culture Studies of Nitrogen and Oxygen Isotope Effects Associated with Nitrate Assimilation and Denitrification

    Science.gov (United States)

    Sigman, D. M.; Granger, J.; Lehmann, M. F.; Difiore, P. J.; Tortell, P. D.

    2007-12-01

    The isotope effects of nitrate-consuming reactions such as nitrate assimilation and denitrification are potential indicators of the physiological state of the organisms carrying out these reactions. Moreover, an understanding of these isotope effects is needed to use the stable isotopes to investigate the fluxes associated with these reactions in modern and ancient environments. We have used batch cultures to investigate the nitrogen (N) and oxygen (O) isotope effects of (1) nitrate assimilation by eukaryotic and prokaryotic algae and by heterotrophic bacteria, and (2) nitrate reduction by denitrifying bacteria. We observe intra- and inter-specific variation in isotope effect amplitudes and, in the case of denitrifiers, indications of isotope effect decreases during individual nitrate drawdown experiments. However, the measured N and O isotope effect ratio is close to 1 for all studied organisms, with the exception of an unusual denitrifier (Rhodobacter sphaeroides) that possesses only periplasmic (non-respiratory) nitrate reductase. This observation and other findings are consistent with nitrate reductase being the predominant source of isotope fractionation and with most isotope effect amplitude variability arising from variable degrees to which nitrate imported into the cell is reduced versus effluxed back into the environment; the more efflux, the more complete the expression of the fractionation imparted by nitrate reduction. If this is the case, then isotope effect amplitudes in the field should be related to physiological conditions in the environment, a prediction that, we argue, is supported by recent studies of (1) nitrate assimilation in the polar ocean and (2) denitrification in sediment porewaters.

  12. Evidence for high-pressure-induced rupture of hydrogen bonds in LH2 photosynthetic antenna pigment-protein complexes

    Energy Technology Data Exchange (ETDEWEB)

    Kangur, L; Leiger, K; Freiberg, A [Institute of Physics, University of Tartu, Riia 142, Tartu 51014 (Estonia)

    2008-07-15

    The bacteriochlorophyll a-containing LH2 light harvesting complex is an integral membrane protein that catalyzes the photosynthetic process in purple photosynthetic bacteria. The LH2 complexes from Rhodobacter sphaeroides show characteristic strong absorbance at 800 and 850 nm due to the bacteriochlorophyll a molecules confined in two separate areas of the protein. Using these cofactors as intrinsic probes to monitor changes in membrane protein structure, we investigate the response to high hydrostatic pressure up to 2.1 GPa of LH2 complexes embedded into natural membrane environment or extracted with detergent. We demonstrate that high pressure does induce significant alterations to the tertiary structure of the protein in proximity of the protein-bound bacteriochlorophyll a molecules, including breakage of the hydrogen bond they are involved in. The membrane-embedded complexes appear more resilient to damaging effects of the compression than the complexes extracted into detergent environment. This difference has tentatively been explained by more compact structure of the membrane-embedded complexes.

  13. Global analysis of photosynthesis transcriptional regulatory networks.

    Science.gov (United States)

    Imam, Saheed; Noguera, Daniel R; Donohue, Timothy J

    2014-12-01

    Photosynthesis is a crucial biological process that depends on the interplay of many components. This work analyzed the gene targets for 4 transcription factors: FnrL, PrrA, CrpK and MppG (RSP_2888), which are known or predicted to control photosynthesis in Rhodobacter sphaeroides. Chromatin immunoprecipitation followed by high-throughput sequencing (ChIP-seq) identified 52 operons under direct control of FnrL, illustrating its regulatory role in photosynthesis, iron homeostasis, nitrogen metabolism and regulation of sRNA synthesis. Using global gene expression analysis combined with ChIP-seq, we mapped the regulons of PrrA, CrpK and MppG. PrrA regulates ∼34 operons encoding mainly photosynthesis and electron transport functions, while CrpK, a previously uncharacterized Crp-family protein, regulates genes involved in photosynthesis and maintenance of iron homeostasis. Furthermore, CrpK and FnrL share similar DNA binding determinants, possibly explaining our observation of the ability of CrpK to partially compensate for the growth defects of a ΔFnrL mutant. We show that the Rrf2 family protein, MppG, plays an important role in photopigment biosynthesis, as part of an incoherent feed-forward loop with PrrA. Our results reveal a previously unrealized, high degree of combinatorial regulation of photosynthetic genes and significant cross-talk between their transcriptional regulators, while illustrating previously unidentified links between photosynthesis and the maintenance of iron homeostasis.

  14. Proton transfer in ba(3) cytochrome c oxidase from Thermus thermophilus.

    Science.gov (United States)

    von Ballmoos, Christoph; Adelroth, Pia; Gennis, Robert B; Brzezinski, Peter

    2012-04-01

    The respiratory heme-copper oxidases catalyze reduction of O(2) to H(2)O, linking this process to transmembrane proton pumping. These oxidases have been classified according to the architecture, location and number of proton pathways. Most structural and functional studies to date have been performed on the A-class oxidases, which includes those that are found in the inner mitochondrial membrane and bacteria such as Rhodobacter sphaeroides and Paracoccus denitrificans (aa(3)-type oxidases in these bacteria). These oxidases pump protons with a stoichiometry of one proton per electron transferred to the catalytic site. The bacterial A-class oxidases use two proton pathways (denoted by letters D and K, respectively), for the transfer of protons to the catalytic site, and protons that are pumped across the membrane. The B-type oxidases such as, for example, the ba(3) oxidase from Thermus thermophilus, pump protons with a lower stoichiometry of 0.5 H(+)/electron and use only one proton pathway for the transfer of all protons. This pathway overlaps in space with the K pathway in the A class oxidases without showing any sequence homology though. Here, we review the functional properties of the A- and the B-class ba(3) oxidases with a focus on mechanisms of proton transfer and pumping.

  15. Overall energy conversion efficiency of a photosynthetic vesicle

    Science.gov (United States)

    Sener, Melih; Strumpfer, Johan; Singharoy, Abhishek; Hunter, C Neil; Schulten, Klaus

    2016-01-01

    The chromatophore of purple bacteria is an intracellular spherical vesicle that exists in numerous copies in the cell and that efficiently converts sunlight into ATP synthesis, operating typically under low light conditions. Building on an atomic-level structural model of a low-light-adapted chromatophore vesicle from Rhodobacter sphaeroides, we investigate the cooperation between more than a hundred protein complexes in the vesicle. The steady-state ATP production rate as a function of incident light intensity is determined after identifying quinol turnover at the cytochrome bc1 complex (cytb⁢c1) as rate limiting and assuming that the quinone/quinol pool of about 900 molecules acts in a quasi-stationary state. For an illumination condition equivalent to 1% of full sunlight, the vesicle exhibits an ATP production rate of 82 ATP molecules/s. The energy conversion efficiency of ATP synthesis at illuminations corresponding to 1%–5% of full sunlight is calculated to be 0.12–0.04, respectively. The vesicle stoichiometry, evolutionarily adapted to the low light intensities in the habitat of purple bacteria, is suboptimal for steady-state ATP turnover for the benefit of protection against over-illumination. DOI: http://dx.doi.org/10.7554/eLife.09541.001 PMID:27564854

  16. The role of pH control on biohydrogen production by single stage hybrid dark- and photo-fermentation.

    Science.gov (United States)

    Zagrodnik, R; Laniecki, M

    2015-10-01

    The role of pH control on biohydrogen production by co-culture of dark-fermentative Clostridium acetobutylicum and photofermentative Rhodobacter sphaeroides was studied. Single stage dark fermentation, photofermentation and hybrid co-culture systems were studied at different values of controlled and uncontrolled pH. Increasing pH during dark fermentation resulted in lower hydrogen production rate (HPR) and longer lag time for both controlled and uncontrolled conditions. However, it only slightly affected cumulative H2 volume. Results have shown that pH control at pH 7.5 increased photofermentative hydrogen production from 0.966 to 2.502 L H2/L(medium) when compared to uncontrolled process. Fixed pH value has proven to be an important control strategy also for the hybrid process and resulted in obtaining balanced co-culture of dark and photofermentative bacteria. Control of pH at 7.0 was found optimum for bacteria cooperation in the co-culture what resulted in obtaining 2.533 L H2/L(medium) and H2 yield of 6.22 mol H2/mol glucose.

  17. A molecular genetic analysis of carotenoid biosynthesis and the effects of carotenoid mutations on other photosynthetic genes in Rhodobacter capsulatus

    Energy Technology Data Exchange (ETDEWEB)

    Armstrong, G.A.

    1989-04-01

    The nine known R. capsulatus carotenoid genes are contained within the 46 kilobase (kb) photosynthesis gene cluster. An 11 kb subcluster containing eight of these genes has been cloned and its nucleotide sequence determined. A new gene, crtK, has been located in the middle of the subcluster. The carotenoid gene cluster contains sequences homologous to Escherichia coli ..omega../sup 70/ promoters, rho-independent transcription terminators, and prokaryotic transcriptional factor binding sites. The phenotypes and genotypes of ten transposon Tn5.7 insertion mutations within the carotenoid gene cluster have been analyzed, by characterization of the carotenoids accumulated and high resolution mapping of the Tn5.7 insertions. The enzymatic blockages in previously uncharacterized early carotenoid mutants have been determined using a new in vitro synthesis system, suggesting specific roles for the CrtB and CrtE gene products. The expression of six of the eight carotenoid genes in the cluster is induced upon the shift from dark chemoheterotrophic to anaerobic photosynthetic growth. The magnitude of the induction is equivalent to that of genes encoding structural photosynthesis polypeptides, although the carotenoid genes are induced earlier after the growth shift. Different means of regulating photosynthesis genes in R. capsulatus are discussed, and a rationale for the temporal pattern of expression of the carotenoid genes during photosynthetic adaptation is presented. Comparison of the deduced amino acid sequences of the two dehydrogenases of the R. capsulatus carotenoid biosynthesis pathway reveals two regions of strong similarity. The effect of carotenoid mutations on the photosynthetic phenotype has been studied by examining growth rates, pigments, pigment-protein complexes and gene expression for a complete set of carotenoid mutants. 161 refs.

  18. Quelques réflexions sur la connaissance des reliefs et processus alpins chez les Romains

    Directory of Open Access Journals (Sweden)

    Delphine Acolat

    2009-03-01

    Full Text Available Le vocabulaire géographique spécifique au relief montagnard n’existe pas ou peu dans l’Antiquité. Les Romains connaissaient-ils pour autant les glaciers, les crevasses, les avalanches, les éboulements de rochers, les érosions torrentielles saisonnières ? Savaient-ils chiffrer la hauteur des Alpes ? Si les auteurs grecs et latins du monde romain décrivent un processus ou un danger géomorphologique alpin, c’est surtout pour ses conséquences sur le voyageur, dans la perspective utilitaire du passage.During Antiquity times there existed little specific vocabulary pertaining to mountainous relief. Did Romans know what glaciers, crevasses, avalanches, rock falls, seasonal torrential erosion were? Could they estimate the height of the Alps? The phenomenon and dangers of alpine geomorphology were described by Greek and Latin authors of the Roman World mostly to warn the traveller of its consequences, in an attempt to ensure safe passage.

  19. Brain SPECT in childhood; Temp cerebrale chez l'enfant

    Energy Technology Data Exchange (ETDEWEB)

    Tranquart, F.; Saliba, E.; Prunier, C.; Baulieu, F.; Besnard, J.C.; Guilloteau, D.; Baulieu, J.L. [Hopital Bretonneau, Service de Medecine Nucleaire, Unite Inserm 316, 37 - Tours (France)

    2001-04-01

    The modalities and the indications of perfusion and neurotransmission SPECT in childhood are presented. The perfusion as well as neurotransmission tracers have not yet authorization for use in children; they have to be used by prescription of magistral preparation or in research protocols. The radioprotection rules have to be strictly respected. The most frequent indication of perfusion SPECT is pharmacologically resistant epilepsy; the ictal SPECT before surgery allows the localization of the epileptogenic focus. Other indications are relevant in the prognosis of neonatal anoxia and encephalitis. In psychiatric disorders, especially in autism, the interest is the physiopathological approach of the brain dysfunctions. The neurotransmission SPECT is emerging as a consequence of the development of new radiotracer, as the dopaminergic system ligands. The decrease of the dopamine D2 receptors in the striatum can be imaged and quantified in the neonate. The lesions of dopamine system seem to be a consequence of the neonatal hypoxia-ischemia and it is predictive of motor sequelae. Brain SPECT should become a routine examination in child neurologic and psychiatric disorders. (authors)

  20. Evaluation et prise en charge des risques de blessure des ischio-jambiers chez le sprinteur

    OpenAIRE

    2015-01-01

    La déchirure des ischio-jambiers est la blessure non-traumatique la plus fréquemment rencontrée dans les sports demandant une course à haute vitesse. Les ischio-jambiers sont particulièrement vulnérables lors de la fin de phase d'oscillation du sprint étant donné qu'ils se contractent excentriquement alors qu'ils sont en position d'allongement. Le renforcement excentrique a été montré comme étant une méthode efficace pour diminuer le risque de blessure. Cependant, les exercices classiquement...

  1. La représentation de l'espace chez des Touaregs du Sahel

    Directory of Open Access Journals (Sweden)

    Edmond BERNUS

    1988-09-01

    Full Text Available Une cartographie éphémère, par des cartographes d'occasion qui dessinent habituellement sur le sable. Des Touaregs reportent sur le papier une représentation graphique originale de leurs itinéraires, dans des régions où les repères sont rares et où le réseau hydrographique sert de trame aux aires de nomadisation.

  2. Quelques consequences de la différence entre les sexes chez Blaise Cendrars

    Directory of Open Access Journals (Sweden)

    Marie-France Borot

    2010-06-01

    Full Text Available La diferencia sexual, según el psicoanálisis, no se funda en un órgano (el pene sino en un objeto imaginario (el falo que no poseen ni el hombre ni la mujer. Frente a este significante, se produce la "sexuación" o posicionamiento respecto al falo y la castración, que permite al individuo adoptar una "postura" masculina y femenina. La autora analiza un capítulo del Bourlinguer de Blaise Cendars que constituye una verdadera ilustración, bajo el modo de la escritura poética del descubrimiento de la diferencia sexual por parte del niño y de su posicionamiento ulterior. La primera infancia es una época de plenitud andrógina (retratada en el texto de Cendrars a través de la unión del narrador y Elena, un "nosotros" perfectamente unido, hasta e drama que consiste en el descubrimiento de la diferencia y en la no aceptación de la falta (le manque en francés. Sin embargo, concluye el artículo, un cuerpo manco (manchot como el de Cendrars, ¿podría identificarse quizás a un cuerpo donde sí se inscribe la falta?

  3. Eosinophilic granuloma of bone in children; Le granulome eosinophile des os chez l`enfant

    Energy Technology Data Exchange (ETDEWEB)

    Leblan, I.; Gaucher, H.; Hoeffel, J.C.; Arnould, V.; Galloy, M.A.; Mainard, L. [Hopital d`Enfants, 54 - Vandoeuvre-les-Nancy (France)

    1995-12-31

    Eosinophilic granuloma of bone or Langerhans cell histiocytosis is mostly unifocal. It appears on plain X Ray as a solitary destructive lesion of long bones or flat bones. Computerized tomography (CT) is useful to define the extension to the cortical bone and also to precisely localize the lesion when the anatomy is complex (hip, spine, base of the skull). Magnetic resonance (MR) is very useful in case of more aggressive lesions when there is extension to soft tissues. Differential diagnosis includes circumscribed osteitis and tumors in the case of extensive destruction. The natural course of solitary lesions is favorable, spontaneously or with therapy. The prognosis is more serious in the case of multiple lesions. (authors).

  4. Topological properties of real algebraic varieties: du cote de chez Rokhlin

    Energy Technology Data Exchange (ETDEWEB)

    Degtyarev, A I [Bilkent University, Ankara (Turkey); Kharlamov, V M [Institut de Recherche Matematique Avanee, Universite Louis Pasteur et CNRS 7, rue Rene Descartes (France)

    2000-08-31

    The survey covers results in the topology of real algebraic varieties in the direction initiated in the early seventies by V.I. Arnol'd and V.A. Rokhlin. We make an attempt to systematize the principal achievements in the subject. After presenting general tools and results, we pay special attention to surfaces and curves on surfaces.

  5. Etude exploratoire de la synthèse des galactolipides chez Plasmodium falciparum

    OpenAIRE

    Saidani, Nadia

    2008-01-01

    Plastids are semi-autonomous organelles that derive from a unique endosymbiotic event between an ancestral eukaryotic cell and a cyanobacteria. The best characterized plastid is the chloroplast from plant cells and green algae. Differing from eukaryotic membrane systems that are naturally phospholipid-rich, plant chloroplasts membranes are composed of >70% galactoglycerolipids (monogalactosyldiacylglycerol, MGDG ; digalactosyldiacylglycerol, DGDG). Their synthesis is catalyzed by galactosyltr...

  6. Nous habitons tous dans la maison de Freud: usan Hiller chez Freud à Londres (*)

    OpenAIRE

    2008-01-01

    Dans un interview Susan Hiller a dit que «nous habitons tous dans le musée Freud» car «le musée Freud est un concept culturel auquel nous ne pouvons pas échapper» . Cette idée a été confirmée par Marina Warner dans sa préface au guide du musée Freud, quand elle a déclaré que «Sigmund Freud a formé l’idée de ce qu’est une personne au cours du vingtième siècle; nous ne nous reconnaîtrions pas sans lui» . Née Etats Unis en 1940, Hiller s’est installée à Londres en 1969 ap...

  7. Exploration De La Résilience éducationnelle Chez Des Enseignants

    Science.gov (United States)

    Théorêt, Manon; Garon, Roseline; Hrimech, Mohamed; Carpentier, Anylène

    2006-12-01

    AN EXPLORATION OF THE EDUCATIONAL RESILIENCE OF TEACHING STAFF - This study focuses on the degree of resilience displayed by teaching staff with the aim of promoting their professional development and preventing job-related exhaustion. Seven underprivileged schools in Montreal were selected, and 24 teaching staff with contrasting personal profiles were interviewed on the subject of their work. The Alceste software was used to analyse the conversations, which revolved around techniques applied when dealing with critical incidents. The main analysis identified five different discourses among the respondents. Three of these were associated with the more resilient of the teachers and two were associated with the more vulnerable ones. Resilient teaching staff characteristically discussed dealing with aggressive behaviour, the teaching-learning relationship and the subject of social relationships, whereas vulnerable teaching staff focused on work beyond the classroom, people in positions of higher authority and the community. The authors note that teachers who are just embarking on their careers appear more vulnerable than more experienced teaching staff, which suggests that more resources should be provided to support teachers in their profession.

  8. Aperçu des maladies neurométaboliques chez l'adulte

    OpenAIRE

    Mochel, Fanny

    2015-01-01

    International audience; Introduction : Inborn errors of metabolism (IEM) are traditionally defined by enzymatic deficiencies or defects in proteins involved in cellular metabolism. Historically discovered and characterized in children, a growing number of IEM are described in adults, and especially in the field of neurology. In daily practice, it is important to recognize emergency situations as well as neurodegenerative diseases for which a metabolic disease is likely, especially when therap...

  9. L’art populaire : un outil d’éveil identitaire chez l’apprenant iranien

    Directory of Open Access Journals (Sweden)

    Fatemeh Hassanzadeh

    2013-11-01

    Currently the wave of immigration of young Iranians has caused a state of conflict in the context of teaching and learning French in Iran. When the Iranian learners confront the cultural shock, far from becoming a cultural enrichment, they find themselves in a position of absolute acceptance of Western culture, which would lead to an intercultural approach, addressing itself to identity in its first phase, then to a complete failure. This research tries to see the origin of this failure which results in an identity crisis and also to see how the use of popular art in the framework of an experimental theatre could create a space of implicit awakening in the identity of the Iranian language learner.

  10. Consommation et digestibilité alimentaires chez l'aulacode Thryonomys swinderianus

    Directory of Open Access Journals (Sweden)

    Mensah, GA.

    1995-01-01

    Full Text Available Consumption and Food Digestibility by the Grass-Cutter Thryonomys swinderianus. Agricultural extension does not constitute an exact science but an art in which the proposed tricks tend to integrate all the rural development factors according to the different aims of decision makers. The utility of agricultural extension is often contested because of its high cost and its doubt ful efficacity. However, it remains the only transmission channel to bring the "knowledge" from the Research to the farmer. If agricultural extension in Africa dates from the colonial time, extension in matter of livestock, especially for small animals, is quite recent. It involves certain specificities that may include mainly human, economic and integration factors. This paper does not intend to formulate accurate rules but is to be considered as an exemple of a project which has developed some tracks in matter of strategy and methodology for small husbandry extension in rural area.

  11. Alimentation et identité chez les immigrants basques en Catalogne

    Directory of Open Access Journals (Sweden)

    F.Xavier Medina

    2001-10-01

    Full Text Available Il peut sembler réitératif d’affirmer aujourd’hui que les comportements alimentaires en général, s’inscrivent dans le cadre de sociétés qui les produisent et les recréent, et donc dans des systèmes socioculturels particuliers à partir desquels sont définies leurs caractéristiques. En effet, es conditionnements sociaux et culturels qui touchent l’alimentation sont variés et complexes. Comme l’écrit Mary Douglas (1979 :145, "le choix des aliments est assurément, entre toutes les activités hum...

  12. L’alimentation et le sourire : la communication corporative chez Danone

    OpenAIRE

    2016-01-01

    Danone est l’une des entreprises les plus importantes dans la production de yaourts et de produits laitiers. Sa dernière campagne de communication lancée en mars 2013, en Espagne, est fondée sur le lien entre alimentation et bonheur. Sous le slogan « Danone alimente le sourire », celle-ci tente de rapprocher l’image de marque avec le bonheur et les bons moments de la vie manifestés par le sourire. Tous les spots publicitaires abordent le thème du sourire et son rôle bienfaisant dans la vie qu...

  13. Analyse des relations conjugale chez une femme ayant subi une sterilisation par ligature des trompes

    OpenAIRE

    Jiménez Gómez, Fernando; Merino Barragán, Vicente; Sánchez Crespo, Guadalupe

    1994-01-01

    Se analizan las relaciones de pareja de mujeres que han elegido la esterilización tubárica como método anticonceptivo irreversible y se comparan con las de mujeres que han optado por métodos de contracepción no definitivos.

  14. Fabriquer le bonheur conjugal : sur l’argent et l’impuissance chez Tahar Ben Jelloun

    Directory of Open Access Journals (Sweden)

    Florina Matu

    2015-05-01

    Full Text Available Dans son dernier roman, intitulé de manière ironique Le Bonheur conjugal (2012, Tahar Ben Jelloun prépare soigneusement la recette d’un mariage infernal. Rien n’y manque dans ce pot au poison que constitue la vie commune des protagonistes: le choc des classes sociales entre un homme issu d’une famille aisée et une paysanne parvenue, la différence d’âge, l’immixtion de la belle-famille, la jalousie, l’adultère, la haine et la vengeance. Et pourtant c’est surtout l’argent, doublé d’une inévitable cupidité, qui représente la source des principaux conflits dans ce ménage. Cet article explore le rôle de l’argent dans la construction du bonheur et/ou du malheur conjugal, de même que la relation disproportionnelle entre la réussite financière et l’impuissance au sens propre et au figuré. Ces aspects seront analysés dans le cadre culturel marocain et français afin de faire ressortir le caractère universel des problèmes du couple dans la société contemporaine.

  15. Métabolisme du fer et de l'hème chez Lactobacillus sakei

    OpenAIRE

    Duhutrel, Philippe

    2011-01-01

    Lactobacillus sakei is a meat-borne lactic acid bacteria. This species harbors a quite complete genetic equipment dedicated to iron utilization such putative iron transporters and 3 transcriptional iron-dependent regulators of the Fur family. We evaluate L. sakei ability to use iron sources encountered in its natural environment by i) developing an iron microanalysis method coupling microscopy (EELS) and mass spectrometry (Nano-SIMS), ii) functional study of the 3 Fur-like regulators and iii)...

  16. Un ou des modèles de puissance chez les émergents ?

    Directory of Open Access Journals (Sweden)

    Joan Deas

    2013-01-01

    Full Text Available Trois émergents seulement répondent aux conditions requises pour devenir un jour des puissances globales (la Chine, l’Inde et le Brésil. Leurs stratégies manquent de clarté, elles ne convergent pas toujours, elles peuvent même se concurrencer. Observés dans quelques grandes négociations internationales, leurs représentants adoptent des attitudes convergentes sur la constitution de groupes coalisés, regroupant des pays en voie de développement face aux pays riches, tout en se rapprochant des grandes puissances établies chaque fois que leurs intérêts l’exigent. Ils agissent pour que leur pays soit mieux représenté dans les institutions internationales, sans remettre en cause leurs règles du jeu.

  17. Prostate cancer radiotherapy in elderly person; Radiotherapie du cancer de la prostate chez la personne agee

    Energy Technology Data Exchange (ETDEWEB)

    Serre, A. [Centre Alexis-Vautrin, Nancy (France)

    2011-10-15

    The author discusses the issue of prostate cancer radiotherapy in the case of elderly persons. The choice of the therapeutic strategy (local, hormonotherapy, simple monitoring) is complex. Different aspects must be considered: the carcinologic situation assessment, the patient health condition, the patient life expectancy, and the possible side effects of treatment. Radiotherapy appears to be a major therapeutic asset, but dose levels, toxicity effects must then be considered. Short communication

  18. Les orchidées comestibles chez le peuple Bagam, au Cameroun

    Directory of Open Access Journals (Sweden)

    Menzepoh, SB.

    2011-01-01

    Full Text Available Edible orchids by the Bagam tribe in Cameroon. In the Zambezian region of Africa, tuber orchids are renowned for their food, medicinal and economic values. In central Africa and in Cameroon in particular, socio-economic role of orchids is still to be documented. The current paper focuses on two orchids, Habenaria keayi Summerh. and Habenaria zambesina Rchb.f. which tuber and roots respectively are used to prepare a food called "napssié" or ground meat by the Bagam tribe in the subdivision of Galim, Western region of Cameroon. The paper also mentions their socio-economic role, threat and pleads for their domestication.

  19. Les besoins en isoleucine, valine et leucine chez le porcelet entre 7 et 15 kg

    DEFF Research Database (Denmark)

    Assadi Soumeh, Elham; van Milgen, Jaap; Sloth, Niels Morten

    2015-01-01

    La réduction des teneurs en protéines des aliments pour porcelets peut se faire uniquement sous contrôle des apports en acides aminés (AA) indispensables tels que les AA ramifies (AAR) valine (Val), isoleucine (Ile) et leucine (Leu) susceptibles d’être déficitaires et d’altérer les performances de...

  20. Effets oculaires de la tranquilisation avec le buthorphanol chez le chien

    OpenAIRE

    Dongay, Agnès

    2014-01-01

    Le butorphanol est utilisé en médecine vétérinaire pour ses propriétés analgésiques et sédatives dans divers protocoles anesthésiques L’objectif de cette étude était d’évaluer les effets oculaires de la sédation au butorphanol lors d’un examen ophtalmologique de routine. Vingt-deux beagles sans anomalie oculaire ont reçu une injection intramusculaire de butorphanol à la dose de 0,2 mg/kg. Des examens cliniques répétés ont été effectués 20 minutes avant et juste avant l’administration puis 10,...