Directory of Open Access Journals (Sweden)
Yen-Ping Lin
2017-04-01
Full Text Available The official analytical method of the Taiwan Food and Drug Administration, Ministry of Health and Welfare for testing for veterinary drug residues in foods is the multiresidue analysis of β-agonists. Samples are pretreated through liquid–liquid extraction and solid-phase extraction. This method is time consuming and requires the intensive use of solvents. To improve analytical efficiency and reduce costs, our study incorporated QuEChERS (Quick, Easy, Cheap, Effective, Rugged, and Safe techniques to establish a new method of multiresidue analysis of β-agonists in animal muscle and viscera. The pretreatment time was shortened and solvent usage was minimized. The modified analysis was conducted using liquid chromatography/tandem mass spectrometry (LC–MS/MS and quantification was performed using multiple reaction monitoring. The results demonstrated that the correlation coefficients of the tissue calibration curve were higher than 0.99 and the limit of quantification (LOQ was 1 ppb. The average recoveries in spiked samples varied from 70% to 120%, and the relative difference between duplicated analysis results was lower than 10%. On the basis of the results, the proposed method was concluded to be an appropriate procedure for determining the presence of β-agonists, and demonstrated the advantages of high recovery rates in spiked samples, high precision, reduced analysis time and solvent usage, and lower costs.
Zhu, Yulong; Liu, Xingang; Xu, Jun; Dong, Fengshou; Liang, Xuyang; Li, Minmin; Duan, Lifang; Zheng, Yongquan
2013-07-19
A modified quick, easy, cheap, effective, rugged, and safe (QuEChERS) method for the simultaneous determination of spirotetramat and its four metabolites in fruits (apple, peach) and vegetables (cabbage, tomato, potato, cucumber), based on the use of liquid extraction/partition and dispersive solid phase extraction (dispersive-SPE) followed by ultrahigh-performance chromatography coupled with tandem mass spectrometry (UHPLC-MS/MS), was established. Acidified acetonitrile (containing 1% (v/v) acetic acid) as the extraction solvent and simultaneous liquid-liquid partitioning formed by adding anhydrous magnesium sulfate (MgSO4) and anhydrous sodium acetate (NaOAc). The extract was then cleaned up by dispersive-SPE using graphitized carbon black (GCB) as selective sorbent. Further optimization of sample preparation and determination achieved recoveries of between 82 and 110% for all analytes with RSD values lower than 14% in apple, peach, cabbage, tomato, potato and cucumber at three levels (10, 100 and 1000μg/kg). The method showed excellent linearity (R(2)≥0.9895) for all studied analytes. The determination of the target compounds was achieved in less than 6.0min using an electrospray ionization source in positive mode (ESI+). The method is demonstrated to be convenient and reliable for the routine monitoring of spirotetramat and its metabolites in fruits and vegetables. Copyright © 2013 Elsevier B.V. All rights reserved.
Li, Yan-Fei; Qiao, Lu-Qin; Li, Fang-Wei; Ding, Yi; Yang, Zi-Jun; Wang, Ming-Lin
2014-09-26
Based on a modified quick, easy, cheap, effective, rugged and safe (QuEChERS) sample preparation method with Fe3O4 magnetic nanoparticles (MNPs) as the adsorbing material and gas chromatography-tandem mass spectrometry (GC-MS/MS) determination in multiple reaction monitoring (MRM) mode, we established a new method for the determination of multiple pesticides in vegetables and fruits. It was determined that bare MNPs have excellent function as adsorbent when purified, and it is better to be separated from the extract. The amount of MNPs influenced the clean-up performance and recoveries. To achieve the optimum performance of modified QuEChERS towards the target analytes, several parameters including the amount of the adsorbents and purification time were investigated. Under the optimum conditions, recoveries were evaluated in four representative matrices (tomato, cucumber, orange and apple) with the spiked concentrations of 10 μg kg(-1), 50 μg kg(-1)and 200 μg kg(-1) in all cases. The results showed that the recovery of 101 pesticides ranged between 71.5 and 111.7%, and the relative standard deviation was less than 10.5%. The optimum clean-up system improved the purification efficiency and simultaneously obtained satisfactory recoveries of multiple pesticides, including planar-ring pesticides. In short, the modified QuEChERS method in addition to MNPs used for removing impurities improved the speed of sample pre-treatment and exhibited an enhanced performance and purifying effect. Copyright © 2014 Elsevier B.V. All rights reserved.
Tao, Yan; Xu, Jun; Liu, Xingang; Cheng, Youpu; Liu, Na; Chen, Zenglong; Dong, Fengshou; Zheng, Yonguan
2014-09-01
This paper describes a novel, rapid, and sensitive analytical method for monitoring four triazolone herbicides in cereals (wheat, rice, corn, and soybean), using a quick, easy, cheap, effective, rugged, and safe sample extraction procedure followed by ultrahigh performance liquid chromatography coupled with tandem mass spectrometry. The four triazolone herbicides (amicarbazone, carfentrazone-ethyl, sulfentrazone, and thiencarbazone-methyl) were extracted using acidified acetonitrile (containing 1% v/v formic acid) and subsequently purified with octadecylsilane (C18 ) prior to sample analysis. Ultrahigh performance liquid chromatography coupled with tandem mass spectrometry was operated in positive and negative ionization switching mode. Amicarbazone and carfentrazone-ethyl were detected in the positive mode (ESI+), while sulfentrazone and thiencarbazone-methyl were detected in the negative mode (ESI-). All compounds were successfully separated in less than 3.0 min. Further optimization achieved desired recoveries ranging from 74.5 to 102.1% for all analytes with relative standard deviation values ≤17.2% in all tested matrices at three levels (10, 100, and 500 μg/kg). The limits of detection for all compounds were ≤2.3 μg/kg, and the limits of quantitation did not exceed 7.1 μg/kg. The developed method showed excellent linearity (R(2) ≥ 0.994) and was proven to be highly efficient and reliable for the routine monitoring of triazolone herbicides in cereals. © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Li, Jing; Dong, Fengshou; Xu, Jun; Liu, Xingang; Li, Yuanbo; Shan, Weili; Zheng, Yongquan
2011-09-19
A rapid and effective method for enantioselective determination of simeconazole enantiomers in food products (cucumber, tomato, apple, pear, wheat and rice) has been developed. The enantiomers were resolved by capillary gas chromatography (GC) using a commercial chiral column (BGB-172) and a temperature program from 150°C (held for 1 min) and then raised at 10°C min(-1) to 240°C (held for 10 min). This enantioselective gas chromatographic separation was combined with a clean-up/enrichment procedure based on the modification of QuEChERS (quick, easy, cheap, effective, rugged and safe) method. Co-extractives were removed with graphitized carbon black/primary secondary amine (GCB/PSA) solid-phase extraction (SPE) cartridges using acetonitrile:toluene (3:1, v/v) as eluent. Gas chromatography/ion trap mass spectrometry (GC-ITMS) with electron ionization (EI) was then used for qualitative and quantitative determination of the simeconazole enantiomers. Two precursor-to-product ion transitions (m/z 121-101 and 195-153) with the best signal intensity were chosen to build the multiple-reaction monitoring (MRM) acquisition method. The limits of detection for each enantiomer of simeconazole in six food products ranged between 0.4 and 0.9 μg kg(-1), which were much lower than maximum residue levels (MRLs) established by Japan. The methodology was successfully applied for the enantioselective analysis of simeconazole enantiomers in real samples, indicating its efficacy in investigating the environmental stereochemistry of simeconazole in food matrix. Copyright © 2011 Elsevier B.V. All rights reserved.
He, Ke; Timm, Anne; Blaney, Lee
2017-08-04
Ultraviolet-filters (UV-filters) and estrogens have attracted increased attention as contaminants of emerging concern (CECs) due to their widespread occurrence in the environment. Most of these CECs are hydrophobic and have the potential to accumulate in aquatic organisms. To date, co-analysis of UV-filters and estrogens has not been reported due, in part, to the complex environmental matrices. Here, a multi-residue method has been developed for simultaneous determination of five UV-filters and three estrogens in tissue from aquatic and marine organisms. The procedure involved a modified Quick, Easy, Cheap, Effective, Rugged, and Safe (QuEChERS) extraction with a novel reverse-solid-phase extraction (reverse-SPE) cleanup in place of dispersive-SPE, followed by liquid chromatography tandem mass spectrometry (LC-MS/MS) analysis. The tissue mass, acetonitrile content, and salt conditions for QuEChERS extraction, along with the reverse-SPE cartridge material and elution conditions, were thoroughly investigated and optimized. Five UV-filters (i.e., 3-(4-methylbenzylidene) camphor, benzophenone-3, ethylhexylmethoxycinnamate, homosalate, and octocrylene) and three estrogens (i.e., estrone, 17β-estradiol, and 17α-ethinylestradiol) were simultaneously analyzed by taking advantage of wrong-way-round ionization in LC-MS/MS. The optimized analytical protocol exhibited good recoveries (>80%) for target compounds and enabled their detection at concentrations as low as 0.2ng/g in 50mg tissue samples. The method was applied to determine concentrations of target analytes in four invertebrates (i.e., Orconectes virilis, Procambarus clarkii, Crassostrea virginica, and Ischadium recurvum). All eight target analytes were detected at least once in the tissue samples, with the highest concentration being 399ng/g of homosalate in O. virilis. These results highlight the ubiquitous bioaccumulation of CECs in aquatic and marine invertebrates. Copyright © 2017 Elsevier B.V. All rights
Trevisan, Maria Teresa Salles; Owen, Robert Wyn; Calatayud-Vernich, Pau; Breuer, Andrea; Picó, Yolanda
2017-08-25
An analytical method using a quick, easy, cheap, effective, rugged and safe (QuEChERS) procedure for multi-residue determination of 52 pesticides in coffee leaf extractshas been developed and validated according to SANTE/11945/2015 guidelines. Different sorbent combinations for dispersive solid phase extraction (d-SPE) clean-up as well as dispersive liquid-liquid microextraction (DLLME) were tested. The relative standard deviations (RSDs) for the recovery of 87-94% of pesticides added to coffee leaf extracts,was ≤20% for samples spiked at concentrations up to 50ng*g -1 depending on the clean-up procedures. However, samples spiked with a 100ng*g -1 pesticide mixture gave RSDs>20% for most pesticides when d-SPE was carried out adding Supelclean ENVI-Carb 120/400. To explain this fact,the secondary metabolic profile was analyzed in all the extraction and clean-up procedures. Only in the clean-up procedure with the addition of Supel QuE Z-Sep+, does caffeine show a constant adsorption between blank and spiked samples. In other clean-up procedures, the amount of caffeine was higher in those samples spiked with pesticides. This indicates competition between caffeine and pesticides for adsorption to the sorbent. Addition of Supel QuE Z-Sep+ to the procedure revealed only a 32% matrix effect, whereas using PSA+ C18 the matrix effect was close to 97%. The process efficiency is up to 54% with the addition of Supel QuE Z-Sep+ and just up to 7% for the other clean-up procedures. The method was successfully tested in coffee leaves from different types of cultivars. Pesticides were not detected in organic coffee leaf extracts, but thiametoxan was clearly detected in 50% of coffee leaf extracts harvested from coffee trees grown under traditional conditions as determined by UHPLC-TOFMSLC/QqTOF-MS/MS. Copyright © 2017 Elsevier B.V. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Li Jing, E-mail: lijing2011@gmail.com [Institute of Plant Protection, Chinese Academy of Agricultural Sciences, Key Laboratory of Pesticide Chemistry and Application, Ministry of Agriculture, Beijing, 100193 (China); Dong Fengshou; Xu Jun; Liu Xingang; Li Yuanbo [Institute of Plant Protection, Chinese Academy of Agricultural Sciences, Key Laboratory of Pesticide Chemistry and Application, Ministry of Agriculture, Beijing, 100193 (China); Shan Weili [Institute for the Control of Agrochemicals, Ministry of Agriculture, Beijing 100125 (China); Zheng Yongquan, E-mail: yongquan_zheng@yahoo.com.cn [Institute of Plant Protection, Chinese Academy of Agricultural Sciences, Key Laboratory of Pesticide Chemistry and Application, Ministry of Agriculture, Beijing, 100193 (China)
2011-09-19
Highlights: {center_dot} Simeconazole enantiomers were baseline separated by gas chromatography. {center_dot} Optical pure enantiomer was prepared and their elution order was distinguished. {center_dot} Clean-up/enrichment procedure was based on the modification of QuEChERS method. {center_dot} Cleanup step was further improved by solid phase extraction (SPE) technology. {center_dot} Analysis of samples was accomplished by GC-MS/MS. - Abstract: A rapid and effective method for enantioselective determination of simeconazole enantiomers in food products (cucumber, tomato, apple, pear, wheat and rice) has been developed. The enantiomers were resolved by capillary gas chromatography (GC) using a commercial chiral column (BGB-172) and a temperature program from 150 deg. C (held for 1 min) and then raised at 10 deg. C min{sup -1} to 240 deg. C (held for 10 min). This enantioselective gas chromatographic separation was combined with a clean-up/enrichment procedure based on the modification of QuEChERS (quick, easy, cheap, effective, rugged and safe) method. Co-extractives were removed with graphitized carbon black/primary secondary amine (GCB/PSA) solid-phase extraction (SPE) cartridges using acetonitrile:toluene (3:1, v/v) as eluent. Gas chromatography/ion trap mass spectrometry (GC-ITMS) with electron ionization (EI) was then used for qualitative and quantitative determination of the simeconazole enantiomers. Two precursor-to-product ion transitions (m/z 121-101 and 195-153) with the best signal intensity were chosen to build the multiple-reaction monitoring (MRM) acquisition method. The limits of detection for each enantiomer of simeconazole in six food products ranged between 0.4 and 0.9 {mu}g kg{sup -1}, which were much lower than maximum residue levels (MRLs) established by Japan. The methodology was successfully applied for the enantioselective analysis of simeconazole enantiomers in real samples, indicating its efficacy in investigating the environmental
International Nuclear Information System (INIS)
Li Jing; Dong Fengshou; Xu Jun; Liu Xingang; Li Yuanbo; Shan Weili; Zheng Yongquan
2011-01-01
Highlights: · Simeconazole enantiomers were baseline separated by gas chromatography. · Optical pure enantiomer was prepared and their elution order was distinguished. · Clean-up/enrichment procedure was based on the modification of QuEChERS method. · Cleanup step was further improved by solid phase extraction (SPE) technology. · Analysis of samples was accomplished by GC-MS/MS. - Abstract: A rapid and effective method for enantioselective determination of simeconazole enantiomers in food products (cucumber, tomato, apple, pear, wheat and rice) has been developed. The enantiomers were resolved by capillary gas chromatography (GC) using a commercial chiral column (BGB-172) and a temperature program from 150 deg. C (held for 1 min) and then raised at 10 deg. C min -1 to 240 deg. C (held for 10 min). This enantioselective gas chromatographic separation was combined with a clean-up/enrichment procedure based on the modification of QuEChERS (quick, easy, cheap, effective, rugged and safe) method. Co-extractives were removed with graphitized carbon black/primary secondary amine (GCB/PSA) solid-phase extraction (SPE) cartridges using acetonitrile:toluene (3:1, v/v) as eluent. Gas chromatography/ion trap mass spectrometry (GC-ITMS) with electron ionization (EI) was then used for qualitative and quantitative determination of the simeconazole enantiomers. Two precursor-to-product ion transitions (m/z 121-101 and 195-153) with the best signal intensity were chosen to build the multiple-reaction monitoring (MRM) acquisition method. The limits of detection for each enantiomer of simeconazole in six food products ranged between 0.4 and 0.9 μg kg -1 , which were much lower than maximum residue levels (MRLs) established by Japan. The methodology was successfully applied for the enantioselective analysis of simeconazole enantiomers in real samples, indicating its efficacy in investigating the environmental stereochemistry of simeconazole in food matrix.
Liu, Xingang; Xu, Jun; Dong, Fengshou; Li, Yuanbo; Song, Wenchen; Zheng, Yongquan
2011-08-01
The new analytical method using Quick, Easy, Cheap, Effective, Rugged, and Safe (QuEChERS) procedure for simultaneous determination of diacylhydrazine insecticide residues in fruits and vegetables was developed using ultra-performance liquid chromatography coupled with tandem mass spectrometry (UPLC-MS/MS). The four insecticides (tebufenozide, methoxfenozide, chromafenozide, and halofenozide) were extracted from six fruit and vegetable matrices using acetonitrile and subsequently cleaned up using primary secondary amine (PSA) or octadecylsilane (C18) as sorbent prior to UPLC-MS/MS analysis. The determination of the target compounds was achieved in less than 3.0 min using an electrospray ionization source in positive mode (ESI+) for tebufenozide, methoxfenozide, and halofenozide and in negative mode (ESI-) for chromafenozide. The limits of detection were below 0.6 μg kg(-1), while the limit of quantification did not exceed 2 μg kg(-1) in different matrices. The QuEChERS procedure by using two sorbents (PSA and C18) and the matrix-matched standards gave satisfactory recoveries and relative standard deviation (RSD) values in different matrices at four spiked levels (0.01, 0.05, 0.1, and 1 mg kg(-1)). The overall average recoveries for this method in apple, grape, cucumber, tomato, cabbage, and spinach at four levels ranged from 74.2% to 112.5% with RSDs in the range of 1.4-13.8% (n = 5) for all analytes. This study provides a theoretical basis for China to draw up maximum residue limits and analytical method for diacylhydrazine insecticide in vegetables and fruits.
Simulation and Analysis of the Topographic Effects on Snow-Free Albedo over Rugged Terrain
Directory of Open Access Journals (Sweden)
Dalei Hao
2018-02-01
Full Text Available Topography complicates the modeling and retrieval of land surface albedo due to shadow effects and the redistribution of incident radiation. Neglecting topographic effects may lead to a significant bias when estimating land surface albedo over a single slope. However, for rugged terrain, a comprehensive and systematic investigation of topographic effects on land surface albedo is currently ongoing. Accurately estimating topographic effects on land surface albedo over a rugged terrain presents a challenge in remote sensing modeling and applications. In this paper, we focused on the development of a simplified estimation method for snow-free albedo over a rugged terrain at a 1-km scale based on a 30-m fine-scale digital elevation model (DEM. The proposed method was compared with the radiosity approach based on simulated and real DEMs. The results of the comparison showed that the proposed method provided adequate computational efficiency and satisfactory accuracy simultaneously. Then, the topographic effects on snow-free albedo were quantitatively investigated and interpreted by considering the mean slope, subpixel aspect distribution, solar zenith angle, and solar azimuth angle. The results showed that the more rugged the terrain and the larger the solar illumination angle, the more intense the topographic effects were on black-sky albedo (BSA. The maximum absolute deviation (MAD and the maximum relative deviation (MRD of the BSA over a rugged terrain reached 0.28 and 85%, respectively, when the SZA was 60° for different terrains. Topographic effects varied with the mean slope, subpixel aspect distribution, SZA and SAA, which should not be neglected when modeling albedo.
Chen, Xiaochu; Bian, Yanli; Liu, Fengmao; Teng, Peipei; Sun, Pan
2017-10-06
Two simple sample pretreatment for the determination of difenoconazole in cowpea was developed including micellar extraction combined with ionic liquid based vortex-assisted liquid-liquid microextraction (ME-IL-VALLME) prior to high performance liquid chromatography (HPLC), and modified quick, easy, cheap, effective, rugged, and safe method (QuEChERS) coupled with HPLC-MS/MS. In ME-IL-VALLME method, the target analyte was extracted by surfactant Tween 20 micellar solution, then the supernatant was diluted with 3mL water to decrease the solubility of micellar solution. Subsequently, the vortex-assisted liquid-liquid microextraction (VALLME) procedure was performed in the diluted extraction solution by using the ionic liquid of 1-hexyl-3-methylimidazolium hexafluorophosphate ([HMIM]PF 6 ) as the extraction solvent and Tween 20 as an emulsifier to enhance the dispersion of the water-immiscible ionic liquid into the aqueous phase. Parameters that affect the extraction have been investigated in both methods Under the optimum conditions, the limits of quantitation were 0.10 and 0.05mgkg -1 , respectively. And good linearity was achieved with the correlation coefficient higher than 0.9941. The relative recoveries ranged from 78.6 to 94.8% and 92.0 to 118.0% with the relative standard deviations (RSD) of 7.9-9.6% and 1.2-3.2%, respectively. Both methods were quick, simple and inexpensive. However, the ME-IL-VALLME method provides higher enrichment factor compared with conventional QuEChERS method. The ME-IL-VALLME method has a strong potential for the determination of difenoconazole in complex vegetable matrices with HPLC. Copyright © 2017 Elsevier B.V. All rights reserved.
Testing the effect of a short cheap talk script in choice experiments
DEFF Research Database (Denmark)
Ladenburg, Jacob; Dahlgaard, Jens Olav; Bonnichsen, Ole
as hypothetical bias. The present paper attempts to frame the description of the hypothetical market so as to induce more “true market behaviour” in the respondents by including a short Cheap Talk script. The script informs respondents that in similar studies using stated preference methods, people have...... to be a preference mover, but does not affect preferences significantly. Significant effects are found when relating the effect of the Cheap Talk script to the cost levels of the alternatives, in that female respondents are found to choose higher cost alternatives less frequently when presented with the Cheap Talk...
Testing the effect of a short cheap talk script in choice experiments
DEFF Research Database (Denmark)
Ladenburg, Jacob; Bonnichsen, Ole; Dahlgaard, Jens Olav
2011-01-01
as hypothetical bias. The present paper attempts to frame the description of the hypothetical market so as to induce more “true market behaviour” in the respondents by including a short Cheap Talk script. The script informs respondents that in similar studies using stated preference methods, people have...... the demand for visual impact mitigation, but does not affect preferences significantly. Significant effects are found when relating the effect of the Cheap Talk script to the cost levels of the alternatives, in that female respondents are found to choose higher cost alternatives less frequently when...
Minimum Data Set RUGs by Assessment Report
U.S. Department of Health & Human Services — This table displays national frequencies and percentages for the RUG III categories from MDS Medicare assessment records. The RUG groups are classified using the...
Cheap effective thermal solar-energy collectors
Energy Technology Data Exchange (ETDEWEB)
Highgate, D.J.; Probert, S.D. [Cranfield University, Bedford (United Kingdom). Dept. of Applied Energy
1996-04-01
A light-weight flexible solar-collector, with a wavelength-selective absorption surface and an insolation-transparent thermal-insulation protecter for its aperture, was built and tested. Its cheapness and high performance, relative to a conventional flat-plate solar-collector, provide a prima-facie case for the more widespread adoption of its design. (author)
Rugged: an operational, open-source solution for Sentinel-2 mapping
Maisonobe, Luc; Seyral, Jean; Prat, Guylaine; Guinet, Jonathan; Espesset, Aude
2015-10-01
When you map the entire Earth every 5 days with the aim of generating high-quality time series over land, there is no room for geometrical error: the algorithms have to be stable, reliable, and precise. Rugged, a new open-source library for pixel geolocation, is at the geometrical heart of the operational processing for Sentinel-2. Rugged performs sensor-to-terrain mapping taking into account ground Digital Elevation Models, Earth rotation with all its small irregularities, on-board sensor pixel individual lines-of-sight, spacecraft motion and attitude, and all significant physical effects. It provides direct and inverse location, i.e. it allows the accurate computation of which ground point is viewed from a specific pixel in a spacecraft instrument, and conversely which pixel will view a specified ground point. Direct and inverse location can be used to perform full ortho-rectification of images and correlation between sensors observing the same area. Implemented as an add-on for Orekit (Orbits Extrapolation KIT; a low-level space dynamics library), Rugged also offers the possibility of simulating satellite motion and attitude auxiliary data using Orekit's full orbit propagation capability. This is a considerable advantage for test data generation and mission simulation activities. Together with the Orfeo ToolBox (OTB) image processing library, Rugged provides the algorithmic core of Sentinel-2 Instrument Processing Facilities. The S2 complex viewing model - with 12 staggered push-broom detectors and 13 spectral bands - is built using Rugged objects, enabling the computation of rectification grids for mapping between cartographic and focal plane coordinates. These grids are passed to the OTB library for further image resampling, thus completing the ortho-rectification chain. Sentinel-2 stringent operational requirements to process several terabytes of data per week represented a tough challenge, though one that was well met by Rugged in terms of the robustness and
Traveltime computation and imaging from rugged topography in 3D TTI media
Liu, Shaoyong; Wang, Huazhong; Yang, Qinyong; Fang, Wubao
2014-02-01
Foothill areas with rugged topography are of great potential for oil and gas seismic exploration, but subsurface imaging in these areas is very challenging. Seismic acquisition with larger offset and wider azimuth is necessary for seismic imaging in complex areas. However, the scale anisotropy in this case must be taken into account. To generalize the pre-stack depth migration (PSDM) to 3D transversely isotropic media with vertical symmetry axes (VTI) and tilted symmetry axes (TTI) from rugged topography, a new dynamic programming approach for the first-arrival traveltime computation method is proposed. The first-arrival time on every uniform mesh point is calculated based on Fermat's principle with simple calculus techniques and a systematic mapping scheme. In order to calculate the minimum traveltime, a set of nonlinear equations is solved on each mesh point, where the group velocity is determined by the group angle. Based on the new first-arrival time calculation method, the corresponding PSDM and migration velocity analysis workflow for 3D anisotropic media from rugged surface is developed. Numerical tests demonstrate that the proposed traveltime calculation method is effective in both VTI and TTI media. The migration results for 3D field data show that it is necessary to choose a smooth datum to remove the high wavenumber move-out components for PSDM with rugged topography and take anisotropy into account to achieve better images.
Larimer, Stanley J.; Lisec, Thomas R.; Spiessbach, Andrew J.
1990-01-01
Proposed walking-beam robot simpler and more rugged than articulated-leg walkers. Requires less data processing, and uses power more efficiently. Includes pair of tripods, one nested in other. Inner tripod holds power supplies, communication equipment, computers, instrumentation, sampling arms, and articulated sensor turrets. Outer tripod holds mast on which antennas for communication with remote control site and video cameras for viewing local and distant terrain mounted. Propels itself by raising, translating, and lowering tripods in alternation. Steers itself by rotating raised tripod on turntable.
Traveltime computation and imaging from rugged topography in 3D TTI media
International Nuclear Information System (INIS)
Liu, Shaoyong; Wang, Huazhong; Yang, Qinyong; Fang, Wubao
2014-01-01
Foothill areas with rugged topography are of great potential for oil and gas seismic exploration, but subsurface imaging in these areas is very challenging. Seismic acquisition with larger offset and wider azimuth is necessary for seismic imaging in complex areas. However, the scale anisotropy in this case must be taken into account. To generalize the pre-stack depth migration (PSDM) to 3D transversely isotropic media with vertical symmetry axes (VTI) and tilted symmetry axes (TTI) from rugged topography, a new dynamic programming approach for the first-arrival traveltime computation method is proposed. The first-arrival time on every uniform mesh point is calculated based on Fermat's principle with simple calculus techniques and a systematic mapping scheme. In order to calculate the minimum traveltime, a set of nonlinear equations is solved on each mesh point, where the group velocity is determined by the group angle. Based on the new first-arrival time calculation method, the corresponding PSDM and migration velocity analysis workflow for 3D anisotropic media from rugged surface is developed. Numerical tests demonstrate that the proposed traveltime calculation method is effective in both VTI and TTI media. The migration results for 3D field data show that it is necessary to choose a smooth datum to remove the high wavenumber move-out components for PSDM with rugged topography and take anisotropy into account to achieve better images. (paper)
Blood, Charles L.; Link, Martin
Based on the activities of the real Window Rock weaver, Glenmae, and her goat, Geraldine, this illustrated story incorporates authentic details relative to the Navajo art of rug weaving and is designed for children aged four to eight. Capitalizing on the humor inherent in Geraldine's point of view, the story centers on the goat's observation of…
Directory of Open Access Journals (Sweden)
Xingwen Lin
2018-01-01
Full Text Available The issue for the validation of land surface remote sensing albedo products over rugged terrain is the scale effects between the reference albedo measurements and coarse scale albedo products, which is caused by the complex topography. This paper illustrates a multi-scale validation strategy specified for coarse scale albedo validation over rugged terrain. A Mountain-Radiation-Transfer-based (MRT-based albedo upscaling model was proposed in the process of multi-scale validation strategy for aggregating fine scale albedo to coarse scale. The simulated data of both the reference coarse scale albedo and fine scale albedo were used to assess the performance and uncertainties of the MRT-based albedo upscaling model. The results showed that the MRT-based model could reflect the albedo scale effects over rugged terrain and provided a robust solution for albedo upscaling from fine scale to coarse scale with different mean slopes and different solar zenith angles. The upscaled coarse scale albedos had the great agreements with the simulated coarse scale albedo with a Root-Mean-Square-Error (RMSE of 0.0029 and 0.0017 for black sky albedo (BSA and white sky albedo (WSA, respectively. Then the MRT-based model was preliminarily applied for the assessment of daily MODerate Resolution Imaging Spectroradiometer (MODIS Albedo Collection V006 products (MCD43A3 C6 over rugged terrain. Results showed that the MRT-based model was effective and suitable for conducting the validation of MODIS albedo products over rugged terrain. In this research area, it was shown that the MCD43A3 C6 products with full inversion algorithm, were generally in agreement with the aggregated coarse scale reference albedos over rugged terrain in the Heihe River Basin, with the BSA RMSE of 0.0305 and WSA RMSE of 0.0321, respectively, which were slightly higher than those over flat terrain.
Zhao, Hui-Jie; Jiang, Cheng; Jia, Guo-Rui
2014-01-01
Adjacency effects may introduce errors in the quantitative applications of hyperspectral remote sensing, of which the significant item is the earth-atmosphere coupling radiance. However, the surrounding relief and shadow induce strong changes in hyperspectral images acquired from rugged terrain, which is not accurate to describe the spectral characteristics. Furthermore, the radiative coupling process between the earth and the atmosphere is more complex over the rugged scenes. In order to meet the requirements of real-time processing in data simulation, an equivalent reflectance of background was developed by taking into account the topography and the geometry between surroundings and targets based on the radiative transfer process. The contributions of the coupling to the signal at sensor level were then evaluated. This approach was integrated to the sensor-level radiance simulation model and then validated through simulating a set of actual radiance data. The results show that the visual effect of simulated images is consistent with that of observed images. It was also shown that the spectral similarity is improved over rugged scenes. In addition, the model precision is maintained at the same level over flat scenes.
GA-optimized feedforward-PID tracking control for a rugged electrohydraulic system design.
Sarkar, B K; Mandal, P; Saha, R; Mookherjee, S; Sanyal, D
2013-11-01
Rugged electrohydraulic systems are preferred for remote and harsh applications. Despite the low bandwidth, large deadband and flow nonlinearities in proportional valves valve and highly nonlinear friction in industry-grade cylinders that comprise rugged systems, their maintenance are much easier than very sophisticated and delicate servocontrol and servocylinder systems. With the target of making the easily maintainable system to perform comparably to a servosystem, a feedforward control has been designed here for compensating the nonlinearities. A PID feedback of the piston displacement has been employed in tandem for absorbing the unmodeled effects. All the controller parameters have been optimized by a real-coded genetic algorithm. The agreement between the achieved real-time responses for step and sinusoidal demands with those achieved by modern servosystems clearly establishes the acceptability of the controller design. Copyright © 2013 ISA. Published by Elsevier Ltd. All rights reserved.
E-books bij de RUG : Een update
Bijker, Alie; van Laarhoven, Peter
2011-01-01
Twee jaar gelden schreven we op deze plaats: “E-books bij de RUG: dat zijn er al meer dan je denkt...”. Inmiddels hebben we nog veel méér e-books in de bibliotheekcollectie, is het aanbod uitgebreid en heeft de iPad de wereld veroverd. Tijd voor een update.
Customer Service and Customer Satisfaction Level of CheapSleep Hostels, Helsinki
Nguyen, Hoa
2016-01-01
This bachelor thesis was commissioned by CheapSleep hostels, Helsinki. CheapSleep is a young budget hostel having operated for 3,5 years located in Vallila, Helsinki. CheapSleep has recently considered opening a new business in Helsinki, as well as the metropolitan area. The aim of this dissertation is to examine the service concept and identify the customer satisfaction level by conducting a customer satisfaction survey while the author was working at the reception in CheapSleep hostels. ...
The retrieval of land surface albedo in rugged terrain
Gao, B.; Jia, L.; Menenti, M.
2012-01-01
Land surface albedo may be derived from the satellite data through the estimation of a bidirectional reflectance distribution function (BRDF) model and angular integration. However many BRDF models do not consider explicitly the topography. In rugged terrain, the topography influences the observed
Directory of Open Access Journals (Sweden)
Jianguang Wen
2018-02-01
Full Text Available Rugged terrain, including mountains, hills, and some high lands are typical land surfaces around the world. As a physical parameter for characterizing the anisotropic reflectance of the land surface, the importance of the bidirectional reflectance distribution function (BRDF has been gradually recognized in the remote sensing community, and great efforts have been dedicated to build BRDF models over various terrain types. However, on rugged terrain, the topography intensely affects the shape and magnitude of the BRDF and creates challenges in modeling the BRDF. In this paper, after a brief introduction of the theoretical background of the BRDF over rugged terrain, the status of estimating land surface BRDF properties over rugged terrain is comprehensively reviewed from a historical perspective and summarized in two categories: BRDFs describing solo slopes and those describing composite slopes. The discussion focuses on land surface reflectance retrieval over mountainous areas, the difference in solo slope and composite slope BRDF models, and suggested future research to improve the accuracy of BRDFs derived with remote sensing satellites.
Rugged calorimeter with a fast rise time
International Nuclear Information System (INIS)
McMurtry, W.M.; Dolce, S.R.
1980-01-01
An intrinsic 1-mil-thick gold foil calorimeter has been developed which rises to 95% of the energy deposited in less than 2 microseconds. This calorimeter is very rugged, and can withstand rough handling without damage. The time constant is long, in the millisecond range, because of its unique construction. Use of this calorimeter has produced 100% data recovery, and agreement with true deposition to less than 10%
Enhancing cheap talk scripts in choice experiments
DEFF Research Database (Denmark)
Ladenburg, Jacob; Olsen, Søren Bøye; Nielsen, Rasmus Christian Fejer
eliminate some of the hypothetical bias. The present paper tests and addition to Cheap Talk, an Op-out Reminder. The Opt-Out Reminder is an objective short script presented prior to the choice sets, prompting the respondent to choose the opt-out alternative, if he/she finds the proposed policy generated...... alternatives in a choice set too expensive. The results sugggest that adding and Opt-Out Reminder to Cheap Talk can in fact reduce hypothetical bias even further and reduces some of the ineffectiveness of CT in relation to the survey bid range and experienced respondents...
The technique of QuEChERS (Quick, Easy, Cheap, Effective, Rugged and Safe) is only 7 years old, yet it is revolutionizing the manner in which multiresidue, multiclass pesticide analysis (and perhaps beyond) is performed. Columnist Ron Majors sits down with inventors Steve Lehotay and Michelangelo An...
ZnO as a cheap and effective filler for high breakdown strength elastomers
DEFF Research Database (Denmark)
Yu, Liyun; Skov, Anne Ladegaard
2017-01-01
. In this article, we explore the use of a cheap and abundant metal oxide filler, namely ZnO, as a filler in silicone-based dielectric elastomers. The electro-mechanical properties of the elastomer composites are investigated, and their performance is evaluated by means of figures of merit. Various commercial...
Mark Morrison; Thomas C. Brown
2009-01-01
Stated preference methods such as contingent valuation and choice modeling are subject to various biases that may lead to differences between actual and hypothetical willingness to pay. Cheap talk, follow-up certainty scales, and dissonance minimization are three techniques for reducing this hypothetical bias. Cheap talk and certainty scales have received considerable...
User's Guide To CHEAP0 II-Economic Analysis of Stand Prognosis Model Outputs
Joseph E. Horn; E. Lee Medema; Ervin G. Schuster
1986-01-01
CHEAP0 II provides supplemental economic analysis capability for users of version 5.1 of the Stand Prognosis Model, including recent regeneration and insect outbreak extensions. Although patterned after the old CHEAP0 model, CHEAP0 II has more features and analytic capabilities, especially for analysis of existing and uneven-aged stands....
A new method of sample preparation was developed and is reported for the first time. The approach combines in-vial filtration with dispersive solid-phase extraction (d-SPE) in a fast and convenient cleanup of QuEChERS (quick, easy, cheap, effective, rugged, and safe) extracts. The method was appli...
Hamed, Ahmed M; Moreno-González, David; Gámiz-Gracia, Laura; García-Campaña, Ana M
2017-01-01
A simple and efficient method for the determination of 28 carbamates in high-fat cheeses is proposed. The methodology is based on a modified quick, easy, cheap, effective, rugged, and safe procedure as sample treatment using a new sorbent (Z-Sep + ) followed by ultra-high performance liquid chromatography with tandem mass spectrometry determination. The method has been validated in different kinds of cheese (Gorgonzola, Roquefort, and Camembert), achieving recoveries of 70-115%, relative standard deviations lower than 13% and limits of quantification lower than 5.4 μg/kg, below the maximum residue levels tolerated for these compounds by the European legislation. The matrix effect was lower than ±30% for all the studied pesticides. The combination of ultra-high performance liquid chromatography and tandem mass spectrometry with this modified quick, easy, cheap, effective, rugged, and safe procedure using Z-Sep + allowed a high sample throughput and an efficient cleaning of extracts for the control of these residues in cheeses with a high fat content. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Developing the service concept for CheapSleep Helsinki
Grönroos, Johnny; Väätäinen, Minja
2013-01-01
This report is a bachelor’s thesis, assigned by the company CheapSleep Helsinki. CheapSleep is a new hostel that is looking to expand its business in Helsinki, and therefore one of the aims for the thesis is to research if the hostel should expand in a new location in addition to the old one or not. If the results show that a new location is needed, the aim is to find out how it should be chosen and suggest some locations for it. In addition to this, the competition in the city will be explor...
Analisis Strategi Bersaing Pada Usaha Laundry Di Padang Bulan (Studi Kasus Pada Cheap Laundry)
Sianipar, Nurcahaya
2015-01-01
Cheap Laundry is one of laundry that has built ± 4 years in an area of Padang Bulan, Medan. The increasing of growth laundry business requires Cheap laundry to be ready in facing the competition that will happen, therefore Cheap Laundry must implement appropriate competitive strategies to face competitors. The aim of this research is to determine and to analyze qualitatively the right competitive strategy and can be applied by Cheap Laundry to confront the competition. The Form of r...
Rugged Low Temperature Actuators for Tunable Fabry Perot Optical Filters, Phase II
National Aeronautics and Space Administration — Why are rugged, low temperature actuator materials important? By themselves, they are useless; however, when fabricated into thin films and integrated into optical...
Very Low-Cost, Rugged, High-Vacuum System for Mass Spectrometers, Phase II
National Aeronautics and Space Administration — NASA, the DoD, DHS, and commercial industry have a pressing need for miniaturized, rugged, low-cost, high vacuum systems. Recent advances in sensor technology at...
Rugged and compact mid-infrared solid-state laser for avionics applications
CSIR Research Space (South Africa)
Esser, MJD
2009-11-01
Full Text Available In order to demonstrate the feasibility of a helicopter-based application using advanced laser technology, the authors have developed a rugged and compact mid-infrared solid-state laser. The requirement for the laser was to simultaneously emit at 2...
Rugged Low-Resistance Contacts To High-Tc Superconductors
Caton, Randall; Selim, Raouf; Byvik, Charles E.; Buoncristiani, A. Martin
1992-01-01
Newly developed technique involving use of gold makes possible to fabricate low-resistance contacts with rugged connections to high-Tc superconductors. Gold diffused into specimen of superconducting material by melting gold beads onto surface of specimen, making strong mechanical contacts. Shear strength of gold bead contacts greater than epoxy or silver paste. Practical use in high-current-carrying applications of new high-Tc materials, including superconducting magnets, long-wavelength sensors, electrical ground planes at low temperatures, and efficient transmission of power.
Mechtenberg, Lydia
2006-01-01
In this paper, I o¤er a theoretical explanation of the robust gender differences in educational achievement distributions of school children. I consider a one shot cheap talk game with two different types of senders (biased teachers and fair teachers), two types of receivers ("normal" and "special" pupils) and uncertainty about the sender type on the side of the receiver. I demonstrate that the group of pupils who, in expectation, get either too much or too little encouragement will have less...
Mechtenberg, Lydia; Strausz, Roland
2006-01-01
In this paper, I offer a theoretical explanation of the robust gender differences in educational achievement distributions of school children. I consider a shot cheap talk game with two different types of senders (biased teachers and fair teachers), two types of receivers (normal and special pupils) and uncertainty about the sender type on the side of the receiver. I demonstrate that the group of pupils who, in expectation, get either too much or too little encouragement will have less top ac...
16 CFR 1631.61 - Hide carpets and rugs-alternative washing procedure.
2010-01-01
... normally used for that type of carpet or rug in service. (b) On February 10, 1972 (37 FR 3010) the Federal... 2″ in diameter and 9″ long composed of nonabsorbent material such as glass or plastic. (4) Select... remove all excess water and wrap around the operating applicator. (7) Immediately, with light pressure...
16 CFR 1630.61 - Hide carpets and rugs-alternative washing procedure.
2010-01-01
... normally used for that type of carpet or rug in service. (b) On February 10, 1972 (37 FR 3010) the Federal... 2″ in diameter and 9″ long composed of nonabsorbant material such as glass or plastic. (4) Select... remove all excess water and wrap around the operating applicator. (7) Immediately with light pressure...
Cheap carbon sorbents produced from lignite by catalytic pyrolysis
Energy Technology Data Exchange (ETDEWEB)
Kuznetsov, B.N.; Schchipko, M.L. [Inst. of Chemistry of Natural Organic Materials, Akademgorodok, Krasnoyarsk (Russian Federation)
1995-12-01
Some data are presented describing the new technology of carbon sorbent production from powdered lignite in the installation with fluidized bed of catalyst. It was shown the different types of char products with extended pore structure and high sorption ability can be produced from cheap and accessible lignite of Kansk-Achinsk coal pit in pilot installation with fluidized bed of Al-Cu-Cr oxide catalyst or catalytically active slag materials. In comparison with the conventional technologies of pyrolysis the catalytic pyrolysis allows to increase by 3-5 times the process productivity and to decrease significantly the formation of harmful compounds. The latter is accomplished by complete oxidation of gaseous pyrolysis products in the presence of catalysts and by avoiding the formation of pyrolysis tars - the source of cancerogenic compounds. The technology of cheap powdered sorbent production from lignites makes possible to obtain from lignite during the time of pyrolysis only a few seconds char products with porosity up to 0.6 cm{sup 3} /g, and specific surface area more than 400 m{sup 3} /g. Some methods of powdered chars molding into carbon materials with the different shape were proved for producing of firmness sorbents. Cheap carbon sorbents obtained by thermocatalytic pyrolysis can be successfully used in purification of different industrial pollutants as one-time sorbent or as adsorbents of long-term application with periodic regeneration.
International Nuclear Information System (INIS)
Wedekind, Lothar
2004-01-01
Full text: 50 years ago, at 17:30 hours, 26 June 1954, in the town of Obninsk, near Moscow, the first nuclear power plant sent electricity to residences and businesses. Atomic energy had crossed the divide from military uses to peaceful ones, demonstrating the potential to fuel civilian electric power plants. The milestone is being marked this year at an IAEA international nuclear power conference in Obninsk. Past experience will be reviewed, but the focus is on meeting future challenges. Though it has come a long way in 50 years, nuclear energy today finds itself in a struggle of the fittest to carve a niche over the next fifty - in the marketplace and in the public eye. Cliches and sound bites tell part of the nuclear story. Visionary talk by nuclear proponents in 1954 was about future energy sources that would be 'too cheap to meter', a phrase critics pounced upon. Today in 2004 the 'too cheap to meter' phrase occasionally haunts the atom, but pops up more often than not in promotional ads for anything from wind power to web sites. Talk of nuclear energy now is of a 'renaissance' and 'second wind.' New nuclear plants are most attractive where energy demand is growing and resources are scarce, and where energy security, air pollution and greenhouse gases are priorities, IAEA Director General Mohamed ElBaradei points out. In cities, towns, and villages, reality is different, or too much the same, depending how you see and live it. Cheap or not, nuclear energy today supplies one-sixth of the world's electricity in some 30 countries. Still, it does not produce enough power. Neither does any other energy source. More than 1.5 billion people have no electricity to meter whatsoever - not from renewables, solar, nuclear, biomass, wind, coal, oil, gas, firewood, or hydrogen, the publicized promise of tomorrow. So what will it take? Maybe bigger blackouts or hotter days than the world has seen. Certainly needed are more attention, action, and money. In dollar terms
Evaluation of coarse scale land surface remote sensing albedo product over rugged terrain
Wen, J.; Xinwen, L.; You, D.; Dou, B.
2017-12-01
Satellite derived Land surface albedo is an essential climate variable which controls the earth energy budget and it can be used in applications such as climate change, hydrology, and numerical weather prediction. The accuracy and uncertainty of surface albedo products should be evaluated with a reliable reference truth data prior to applications. And more literatures investigated the validation methods about the albedo validation in a flat or homogenous surface. However, the albedo performance over rugged terrain is still unknow due to the validation method limited. A multi-validation strategy is implemented to give a comprehensive albedo validation, which will involve the high resolution albedo processing, high resolution albedo validation based on in situ albedo, and the method to upscale the high resolution albedo to a coarse scale albedo. Among them, the high resolution albedo generation and the upscale method is the core step for the coarse scale albedo validation. In this paper, the high resolution albedo is generated by Angular Bin algorithm. And a albedo upscale method over rugged terrain is developed to obtain the coarse scale albedo truth. The in situ albedo located 40 sites in mountain area are selected globally to validate the high resolution albedo, and then upscaled to the coarse scale albedo by the upscale method. This paper takes MODIS and GLASS albedo product as a example, and the prelimarily results show the RMSE of MODIS and GLASS albedo product over rugged terrain are 0.047 and 0.057, respectively under the RMSE with 0.036 of high resolution albedo.
Experimental Rugged Fitness Landscape in Protein Sequence Space
Hayashi, Yuuki; Aita, Takuyo; Toyota, Hitoshi; Husimi, Yuzuru; Urabe, Itaru; Yomo, Tetsuya
2006-01-01
The fitness landscape in sequence space determines the process of biomolecular evolution. To plot the fitness landscape of protein function, we carried out in vitro molecular evolution beginning with a defective fd phage carrying a random polypeptide of 139 amino acids in place of the g3p minor coat protein D2 domain, which is essential for phage infection. After 20 cycles of random substitution at sites 12–130 of the initial random polypeptide and selection for infectivity, the selected phage showed a 1.7×104-fold increase in infectivity, defined as the number of infected cells per ml of phage suspension. Fitness was defined as the logarithm of infectivity, and we analyzed (1) the dependence of stationary fitness on library size, which increased gradually, and (2) the time course of changes in fitness in transitional phases, based on an original theory regarding the evolutionary dynamics in Kauffman's n-k fitness landscape model. In the landscape model, single mutations at single sites among n sites affect the contribution of k other sites to fitness. Based on the results of these analyses, k was estimated to be 18–24. According to the estimated parameters, the landscape was plotted as a smooth surface up to a relative fitness of 0.4 of the global peak, whereas the landscape had a highly rugged surface with many local peaks above this relative fitness value. Based on the landscapes of these two different surfaces, it appears possible for adaptive walks with only random substitutions to climb with relative ease up to the middle region of the fitness landscape from any primordial or random sequence, whereas an enormous range of sequence diversity is required to climb further up the rugged surface above the middle region. PMID:17183728
Experimental rugged fitness landscape in protein sequence space.
Hayashi, Yuuki; Aita, Takuyo; Toyota, Hitoshi; Husimi, Yuzuru; Urabe, Itaru; Yomo, Tetsuya
2006-12-20
The fitness landscape in sequence space determines the process of biomolecular evolution. To plot the fitness landscape of protein function, we carried out in vitro molecular evolution beginning with a defective fd phage carrying a random polypeptide of 139 amino acids in place of the g3p minor coat protein D2 domain, which is essential for phage infection. After 20 cycles of random substitution at sites 12-130 of the initial random polypeptide and selection for infectivity, the selected phage showed a 1.7x10(4)-fold increase in infectivity, defined as the number of infected cells per ml of phage suspension. Fitness was defined as the logarithm of infectivity, and we analyzed (1) the dependence of stationary fitness on library size, which increased gradually, and (2) the time course of changes in fitness in transitional phases, based on an original theory regarding the evolutionary dynamics in Kauffman's n-k fitness landscape model. In the landscape model, single mutations at single sites among n sites affect the contribution of k other sites to fitness. Based on the results of these analyses, k was estimated to be 18-24. According to the estimated parameters, the landscape was plotted as a smooth surface up to a relative fitness of 0.4 of the global peak, whereas the landscape had a highly rugged surface with many local peaks above this relative fitness value. Based on the landscapes of these two different surfaces, it appears possible for adaptive walks with only random substitutions to climb with relative ease up to the middle region of the fitness landscape from any primordial or random sequence, whereas an enormous range of sequence diversity is required to climb further up the rugged surface above the middle region.
Experimental rugged fitness landscape in protein sequence space.
Directory of Open Access Journals (Sweden)
Yuuki Hayashi
Full Text Available The fitness landscape in sequence space determines the process of biomolecular evolution. To plot the fitness landscape of protein function, we carried out in vitro molecular evolution beginning with a defective fd phage carrying a random polypeptide of 139 amino acids in place of the g3p minor coat protein D2 domain, which is essential for phage infection. After 20 cycles of random substitution at sites 12-130 of the initial random polypeptide and selection for infectivity, the selected phage showed a 1.7x10(4-fold increase in infectivity, defined as the number of infected cells per ml of phage suspension. Fitness was defined as the logarithm of infectivity, and we analyzed (1 the dependence of stationary fitness on library size, which increased gradually, and (2 the time course of changes in fitness in transitional phases, based on an original theory regarding the evolutionary dynamics in Kauffman's n-k fitness landscape model. In the landscape model, single mutations at single sites among n sites affect the contribution of k other sites to fitness. Based on the results of these analyses, k was estimated to be 18-24. According to the estimated parameters, the landscape was plotted as a smooth surface up to a relative fitness of 0.4 of the global peak, whereas the landscape had a highly rugged surface with many local peaks above this relative fitness value. Based on the landscapes of these two different surfaces, it appears possible for adaptive walks with only random substitutions to climb with relative ease up to the middle region of the fitness landscape from any primordial or random sequence, whereas an enormous range of sequence diversity is required to climb further up the rugged surface above the middle region.
Demersal fish assemblages on seamounts and other rugged features in the northeastern Caribbean
Quattrini, Andrea M.; Demopoulos, Amanda W. J.; Singer, Randal; Roa-Varon, Adela; Chaytor, Jason D.
2017-05-01
Recent investigations of demersal fish communities in deepwater (>50 m) habitats have considerably increased our knowledge of the factors that influence the assemblage structure of fishes across mesophotic to deep-sea depths. While different habitat types influence deepwater fish distribution, whether different types of rugged seafloor features provide functionally equivalent habitat for fishes is poorly understood. In the northeastern Caribbean, different types of rugged features (e.g., seamounts, banks, canyons) punctuate insular margins, and thus create a remarkable setting in which to compare demersal fish communities across various features. Concurrently, several water masses are vertically layered in the water column, creating strong stratification layers corresponding to specific abiotic conditions. In this study, we examined differences among fish assemblages across different features (e.g., seamount, canyon, bank/ridge) and water masses at depths ranging from 98 to 4060 m in the northeastern Caribbean. We conducted 26 remotely operated vehicle dives across 18 sites, identifying 156 species of which 42% of had not been previously recorded from particular depths or localities in the region. While rarefaction curves indicated fewer species at seamounts than at other features in the NE Caribbean, assemblage structure was similar among the different types of features. Thus, similar to seamount studies in other regions, seamounts in the Anegada Passage do not harbor distinct communities from other types of rugged features. Species assemblages, however, differed among depths, with zonation generally corresponding to water mass boundaries in the region. High species turnover occurred at depths <1200 m, and may be driven by changes in water mass characteristics including temperature (4.8-24.4 °C) and dissolved oxygen (2.2-9.5 mg per l). Our study suggests the importance of water masses in influencing community structure of benthic fauna, while considerably adding
Ben Khedher, Saoussen; Jaoua, Samir; Zouari, Nabil
2013-01-01
In order to overproduce bioinsecticides production by a sporeless Bacillus thuringiensis strain, an optimal composition of a cheap medium was defined using a response surface methodology. In a first step, a Plackett-Burman design used to evaluate the effects of eight medium components on delta-endotoxin production showed that starch, soya bean and sodium chloride exhibited significant effects on bioinsecticides production. In a second step, these parameters were selected for further optimisation by central composite design. The obtained results revealed that the optimum culture medium for delta-endotoxin production consists of 30 g L(-1) starch, 30 g L(-1) soya bean and 9 g L(-1) sodium chloride. When compared to the basal production medium, an improvement in delta-endotoxin production up to 50% was noted. Moreover, relative toxin yield of sporeless Bacillus thuringiensis S22 was improved markedly by using optimised cheap medium (148.5 mg delta-endotoxins per g starch) when compared to the yield obtained in the basal medium (94.46 mg delta-endotoxins per g starch). Therefore, the use of optimised culture cheap medium appeared to be a good alternative for a low cost production of sporeless Bacillus thuringiensis bioinsecticides at industrial scale which is of great importance in practical point of view.
Directory of Open Access Journals (Sweden)
Saoussen Ben Khedher
2013-09-01
Full Text Available In order to overproduce bioinsecticides production by a sporeless Bacillus thuringiensis strain, an optimal composition of a cheap medium was defined using a response surface methodology. In a first step, a Plackett-Burman design used to evaluate the effects of eight medium components on delta-endotoxin production showed that starch, soya bean and sodium chloride exhibited significant effects on bioinsecticides production. In a second step, these parameters were selected for further optimisation by central composite design. The obtained results revealed that the optimum culture medium for delta-endotoxin production consists of 30 g L-1 starch, 30 g L-1 soya bean and 9g L-1 sodium chloride. When compared to the basal production medium, an improvement in delta-endotoxin production up to 50% was noted. Moreover, relative toxin yield of sporeless Bacillus thuringiensis S22 was improved markedly by using optimised cheap medium (148.5 mg delta-endotoxins per g starch when compared to the yield obtained in the basal medium (94.46 mg delta-endotoxins per g starch. Therefore, the use of optimised culture cheap medium appeared to be a good alternative for a low cost production of sporeless Bacillus thuringiensis bioinsecticides at industrial scale which is of great importance in practical point of view.
Kim, M J; Kim, S A; Kang, Y S; Hwang, I G; Rhee, M S
2013-07-01
Aerobic plate counts (APC), coliforms, Bacillus cereus, Escherichia coli and eight foodborne pathogens were tested in 1008 cheap and junk foods, including candies, dried cakes, chewing gum, chocolate, dried and seasoned seafood, ice cream, and sugary foods. APCs were positive for 342 samples (33·9%), and the majority of the counts were 2-3 log CFU g(-1) or ml(-1) (average: 1·10 log CFU g(-1) or ml(-1) ). Most samples (97·3%) contained no coliforms (average: 0·07 log CFU g(-1) or ml(-1) ). Bacillus cereus was detected in 68 samples (average: 0·14 log CFU g(-1) or ml(-1) ). Escherichia coli and Listeria monocytogenes were detected in 6 and 1 samples, respectively, whereas other foodborne pathogens were not isolated. The highest bacterial counts were associated with dried and seasoned seafood products and dried cakes, suggesting that appropriate regulations of these food types should be considered. Cheap and junk foods were produced mainly in developing countries, but there were no significant differences in the bacterial counts among different countries of origin. The presence of foodborne pathogens may pose a risk for children. These results suggest that there is cause for deeper concern about the safety of these foods and that effective countermeasures should be established to improve their microbiological safety. Food safety is especially important for children, but only limited information is available about the microbiological quality of cheap and junk foods that are consumed frequently by primary schoolchildren (e.g. dried cakes, candies and chocolates). The present study investigated the microbial quality of cheap and junk foods, and our results indicate that these foods are a potential health risk for children, therefore, deeper concern about the safety of these foods and effective countermeasures should be established to improve their microbiological safety. The present study may contribute to the development of an appropriate child food
Preventing distortion of quick couplers of hoses of central pipe lines--a cheap and simple method.
Directory of Open Access Journals (Sweden)
Kamath S
1995-01-01
Full Text Available A cheap and practical approach of steel chains attached to the station outlet quick couplers helps in maintaining the shape of the quick couplers and ensures their effective functioning over a long period of time and avoids mishap of connection due to damage of these couplers.
Effect of food processing on degradation of hexachlorocyclohexane and its isomers in milk.
Singh, Sujatha; Nelapati, Krishnaiah
2017-03-01
To study the effect of different food processing techniques on the degradation of organochlorine compounds (α, β, ɣ and δ hexachlorocyclohexane isomers (HCH)) residues in both natural and fortified samples of milk. Raw milk samples are collected from the local areas of Hyderabad, India. Naturally and fortified milk samples (HCH) were subjected to various food processing techniques, pasteurization (63ºC for ½ h), sterilization (121ºC for 15 min) and boiling for 5 min and analyzed by gas chromatography with electron capture detector using quick, easy, cheap, effective, rugged and safe method for multiresidue analysis of pesticides in milk with slight modification. The final mean residual concentration of pesticide in milk after heat processing and percentage of degradation were calculated with respective treatments. Heat treatments are highly effective on reduction of mean residual concentration of HCH in milk. In which Sterilization and boiling proved to be more effective in degradation of HCH isomers.
Effects of Cheap Antidotes; Sodium Bicarbonate and Magnesium Sulfate in Organophosphorous Poisoning
International Nuclear Information System (INIS)
Balali-Mood, M.; Afshari, R.
2007-01-01
Organophosphorous (OP) compounds have been used as pesticides and chemical warfare nerve agents. Despite administration of well known antidotes (atropine and oximes), morbidity and mortality of OP poisoning were still high. Besides, oximes are very expensive and not available in most developing countries. It was thus aimed to study the effects of cheap available antidotes; sodium bicarbonate and magnesium sulfate in OP poisoning. In addition to the standard antidotal treatment, out of 117 patients (63M, 47F) aged 25.2 ± 9.5 years with moderate to severe acute OP pesticide poisoning 59 were given sodium bicarbonate 5 mEq/kg in 60 min. followed by 5-6 mEq/kg/day to obtain arterial blood pH of 7.45 to 7.55. Arterial blood pH increased significantly (p less than 0.01) to 7.48 ± 0.05 compared to the controls (7.32 ± 0.06). Morbidity based on hospitalization days reduced significantly (p less than 0.05) from 5.62 ± 3.4 in the controls to 3.1 ± 2.6 days in the sodium bicarbonate group. Total atropine dose was also significantly (p less than 0.05) lower in the test group. Mortality was lower, but not significantly due to the low numbers (5 and 2 of the controls and test group, respectively). Sodium bicarbonate appeared to be effective and could be added to the treatment regime of OP poisoning. Magnesium sulfate was administered four gram intravenously only for the first 24 hr of hospitalization day for the patients with moderate to severe OP poisoning in a pilot study. The results were promising and thus further investigations are continued.(author)
A more rugged ZnS(Ag) alpha scintillation detector
International Nuclear Information System (INIS)
McElhaney, S.A.; Ramsey, J.A.; Bauer, M.L.; Chiles, M.M.
1990-01-01
Conventional alpha scintillation detectors comprise a phosphor-coated light-pipe covered by a thin aluminized Mylar layer. This opaque radiation entrance window serves as a shield against ambient light entering the detector with minimum alpha attenuation. Unfortunately, Mylar is extremely fragile and easily punctured or torn by sticks, stones, and screws encountered during regular radiation surveys. The authors have been developing an alpha scintillation detector more rugged and durable than conventional models. This paper presents the scintillator assembly, which consists of a mixture of silver-activated zinc sulfide [ZnS(Ag)] and clear epoxy. The ZnS(Ag) scintillation powder is mixed with a low-viscosity, optically transparent epoxy and poured into a glass-smooth mold of desired shape and size
The parallel plate avalanche counter: a simple, rugged, imaging X-ray counter
International Nuclear Information System (INIS)
Joensen, K.D.; Budtz-Joergensen, C.; Bahnsen, A.; Madsen, M.M.; Olesen, C.; Schnopper, H.W.
1995-01-01
A two-dimensional parallel gap proportional counter has been developed at the Danish Space Research Institute. Imaging over the 120 mm diameter active area is obtained using the positive ion component of the avalanche signals as recorded by a system of wedge- and strip-electrodes. An electronically simple, but very effective background rejection is obtained by using the fast electron component of the avalanche signal. Gas gains up to 8x10 5 have been achieved. An energy-resolution of 16% and a sub-millimeter spatial resolution have been measured at 5.9 keV for an operating gas gain of 10 5 . In principle, the position coordinates are linear functions of electronic readouts. The present model, however, exhibits non-linearities, caused by imperfections in the wedge and strip-electrode pattern. These non-linearities are corrected by using a bilinear correction algorithm. We conclude that the rugged construction, the simple electronics, the effectiveness of the background rejection and the actual imaging performance makes this a very attractive laboratory detector for low and intermediate count rate imaging applications. ((orig.))
The behavior of Metropolis-coupled Markov chains when sampling rugged phylogenetic distributions.
Brown, Jeremy M; Thomson, Robert C
2018-02-15
Bayesian phylogenetic inference involves sampling from posterior distributions of trees, which sometimes exhibit local optima, or peaks, separated by regions of low posterior density. Markov chain Monte Carlo (MCMC) algorithms are the most widely used numerical method for generating samples from these posterior distributions, but they are susceptible to entrapment on individual optima in rugged distributions when they are unable to easily cross through or jump across regions of low posterior density. Ruggedness of posterior distributions can result from a variety of factors, including unmodeled variation in evolutionary processes and unrecognized variation in the true topology across sites or genes. Ruggedness can also become exaggerated when constraints are placed on topologies that require the presence or absence of particular bipartitions (often referred to as positive or negative constraints, respectively). These types of constraints are frequently employed when conducting tests of topological hypotheses (Bergsten et al. 2013; Brown and Thomson 2017). Negative constraints can lead to particularly rugged distributions when the data strongly support a forbidden clade, because monophyly of the clade can be disrupted by inserting outgroup taxa in many different ways. However, topological moves between the alternative disruptions are very difficult, because they require swaps between the inserted outgroup taxa while the data constrain taxa from the forbidden clade to remain close together on the tree. While this precise form of ruggedness is particular to negative constraints, trees with high posterior density can be separated by similarly complicated topological rearrangements, even in the absence of constraints.
Cheap type solar bioclimatic individual houses for residential areas
Directory of Open Access Journals (Sweden)
Mihailescu Teofil
2016-01-01
Full Text Available In the Romanian architectural practice for individual houses in residential areas, designing the architectural object in order to function together with the nature is neglected in the majority of the situations. This happens despite of a great variety of the solar bioclimatic solutions materialized in the traditional houses of all the Romanian geographical regions in a history of over 2000 years of traditional architecture. Unfortunately, in the local real estate realities, other choices are preferred in instead those of the solar bioclimatic architecture. The approach starts with a historical approach, analyzing several examples of traditional houses from all the regions of Romania, in order to identify the traditional bioclimatic solutions used to better adapt to the environment. This constitutes the source of inspiration for the modern cheap type solar bioclimatic houses presented. But a way of thinking should be changed for it, with the help of the Romanian state transformed in financial and legislative realities. These cheap type solar bioclimatic individual houses are destined for the middle class families and involve minimum costs for building and living, creating the best premises to efficiently use one or all of the complementary systems for producing, storage and/or transforming the energy from the environment (using solar, wind, water and/or earth energy.
Money talks? An experimental investigation of cheap talk and burned money
de Haan, T.; Offerman, T.; Sloof, R.
2015-01-01
We experimentally study the strategic transmission of information in a setting where both cheap talk and money can be used. Theoretically, many equilibria exist side by side, in which senders use either costless messages, money, or both. We find that senders prefer to communicate through costless
Shao, Gang; Agar, Jeffrey; Giese, Roger W
2017-07-14
Cooling a 1:1 (v/v) solution of acetonitrile and water at -16° C is known to result in two clear phases. We will refer to this event as "cold-induced aqueous acetonitrile phase separation (CIPS)". On a molar basis, acetonitrile is 71.7% and 13.6% in the upper and lower phases, respectively, in our study. The phase separation proceeds as a descending cloud of microdroplets. At the convenient temperature (typical freezer) employed here the lower phase is rather resistant to solidification, although it emerges from the freezer as a solid if various insoluble matter is present at the outset. In a preliminary way, we replaced the initial (salting-out) step of a representative QuEChERS procedure with CIPS, applying this modified procedure ("CIPS-QuEChERS") to a homogenate of salmon (and partly to beef). Three phases resulted, where only the upper, acetonitrile-rich phase is a liquid (that is completely clear). The middle phase comprises ice and precipitated lipids, while the lower phase is the residual matrix of undissolved salmon or meat. Treating the upper phase from salmon, after isolation, with anhydrous MgSO 4 and C18-Si (typical QuEChERS dispersive solid phase extraction sorbents), and injecting into a GC-MS in a nontargeted mode, gives two-fold more preliminary hits for chemicals, and also number of spiked pesticides recovered, relative to that from a comparable QuEChERS method. In part, this is because of much higher background signals in the latter case. Further study of CIPS-QuEChERS is encouraged, including taking advantage of other QuERChERS conditions. Copyright © 2017 Elsevier B.V. All rights reserved.
Money talks? An experimental investigation of cheap talk and burned money
de Haan, T.; Offerman, T.; Sloof, R.
2011-01-01
We experimentally study the strategic transmission of information in a setting where both cheap talk and money can be used for communication purposes. Theoretically a large number of equilibria exist side by side, in which senders either use costless messages, money, or a combination of the two. We
Money talks? An experimental investigation of cheap talk and burned money
de Haan, T.; Offerman, T.; Sloof, R.
2012-01-01
We experimentally study the strategic transmission of information in a setting where both cheap talk and money can be used for communication purposes. Theoretically a large number of equilibria exist side by side, in which senders either use costless messages, money, or a combination of the two. We
International Nuclear Information System (INIS)
McGibbon, A.L.
1976-01-01
Growing national interest in public safety has produced a sudden need for a type of radiation-monitoring equipment that doesn't exist anywhere commercially. An easily portable, very rugged, and completely self-contained instrument is required that can be set up quickly and virtually anywhere to detect and identify radioactive isotopes. The Electronics Engineering Department has responded to this need by designing and developing the first equipment that can fulfill all these requirements. This instrument, a 1024-channel gamma-ray spectrometer, has already gone into limited production to provide health physicists at LLL and other Energy Research and Development Administration (ERDA) laboratories with an effective tool for monitoring possible sources of radioactivity
International Nuclear Information System (INIS)
Dittmar, Michael
2013-01-01
Historic data from many countries demonstrate that on average no more than 50–70% of the uranium in a deposit could be mined. An analysis of more recent data from Canada and Australia leads to a mining model with an average deposit extraction lifetime of 10 ± 2 years. This simple model provides an accurate description of the extractable amount of uranium for the recent mining operations. Using this model for all larger existing and planned uranium mines up to 2030, a global uranium mining peak of at most 58 ± 4 ktons around the year 2015 is obtained. Thereafter we predict that uranium mine production will decline to at most 54 ± 5 ktons by 2025 and, with the decline steepening, to at most 41 ± 5 ktons around 2030. This amount will not be sufficient to fuel the existing and planned nuclear power plants during the next 10–20 years. In fact, we find that it will be difficult to avoid supply shortages even under a slow 1%/year worldwide nuclear energy phase-out scenario up to 2025. We thus suggest that a worldwide nuclear energy phase-out is in order. If such a slow global phase-out is not voluntarily effected, the end of the present cheap uranium supply situation will be unavoidable. The result will be that some countries will simply be unable to afford sufficient uranium fuel at that point, which implies involuntary and perhaps chaotic nuclear phase-outs in those countries involving brownouts, blackouts, and worse
The End of Cheap Oil: Economic, Social, and Political Change in the US and Former Soviet Union
Directory of Open Access Journals (Sweden)
Robert K. Kaufmann
2014-09-01
Full Text Available I use the quality and quantity of energy flows to interpret economic, social, and political changes in the US and Former Soviet Union. The economic successes of both the former Soviet Union (FSU and the US reflect an abundant supply of high quality energy. This abundance ended in the 1970s in the US and the 1980s in the Former Soviet Union. In the US, the end of cheap oil caused labor productivity to stagnate, which stopped on-going growth in wages and family incomes. To preserve the American Dream, which holds that each generation will be better off than the one that preceded it, women entered the workforce, income was transferred from saving to consumption, the US economy changed from a net creditor to a net debtor, and debt held by families and the Federal government increased. Despite efforts to hide the income effects, the end of cheap oil also is responsible for increasing income inequality. In the FSU, the end of abundant energy supplies meant that allocating the energy surplus among the domestic economy, subsidized exports to Eastern Europe, and hard currency sales to the West became a zero sum game. This contributed to the collapse of the Council for Mutual Economic Assistance (CMEA alliance and the FSU. If the US is able to extricate itself from personal and governmental debt, solving the social and political concerns about inequality is the next formidable challenge posed by the end of cheap oil.
The end of cheap oil: Current status and prospects
International Nuclear Information System (INIS)
Tsoskounoglou, Miltos; Ayerides, George; Tritopoulou, Efi
2008-01-01
This paper, analyses the factors impacting the price of crude oil in order to examine the likely evolution of the oil market and attempts to answer the question, whether cheap oil is already a thing of the past. Based on data made publicly available mostly by the major oil companies, it examines the effects of demand and supply, the evolution of world oil reserves, the trends in new discoveries of new oilfields, the evolution of world Gross Domestic Product (GDP), and the depletion of oil resources. The analysis concludes that the world peak in conventional oil production-the point beyond which oil production will irreversibly start declining-is approaching and will be reached, even according to the most optimistic scenarios, before 2040 and quite possibly much sooner. If the appropriate solutions for substituting crude oil and for conserving the use of energy are not implemented in time, then the current upward trend in oil prices is bound to continue
Formulation of cheap prawn diets and their biological evaluation on some penaeid prawns
Digital Repository Service at National Institute of Oceanography (India)
Goswami, U.; Goswami, S.C.
While using the cheap locally available wastes and raw materials, two compound diets have been formulated and prepared. Three species of penaeid prawns viz. Metapenaeus monoceros, M. affinis and Penaeus indicus were fed on these diets...
[Medical and dental digital photography. Choosing a cheap and user-friendly camera].
Chossegros, C; Guyot, L; Mantout, B; Cheynet, F; Olivi, P; Blanc, J-L
2010-04-01
Digital photography is more and more important in our everyday medical practice. Patient data, medico-legal proof, remote diagnosis, forums, and medical publications are some of the applications of digital photography in medical and dental fields. A lot of small, light, and cheap cameras are on the market. The main issue is to obtain good, reproducible, cheap, and easy-to-shoot pictures. Every medical situation, portrait in esthetic surgery, skin photography in dermatology, X-ray pictures or intra-oral pictures, for example, has its own requirements. For these reasons, we have tried to find an "ideal" compact digital camera. The Sony DSC-T90 (and its T900 counterpart with a wider screen) seems a good choice. Its small size makes it usable in every situation and its price is low. An external light source and a free photo software (XnView((R))) can be useful complementary tools. The main adjustments and expected results are discussed.
Lanzamiento de supermercados cheap en venezuela
Directory of Open Access Journals (Sweden)
Oscar A. Colmenares D.
2008-01-01
Full Text Available El presente caso de estudio se plantea en el contexto del sector de distribución de alimentos al detal en Venezuela en los años 2005 al 2007, el cual ha ostentado diversas mutaciones y cambios en función de las condiciones socioeconómicas del país y las tendencias globales. La cadena internacional de Supermercados Cheap, de origen tailandés, es una empresa dedicada a la distribución al menor de productos de consumo masivo, que estaba interesada en abrir operaciones comerciales en Latinoamérica tomando como país piloto a Venezuela. Para ello, quiere desarrollar una red de tiendas con marca y concepto propio adecuada a las características y exigencias del mercado local. En este sentido, debe diagnosticar el escenario de negocios y del mercado actual del sector y diseñar un plan de acción para cumplir con su objetivo.
Edwin, Lionel E.; Mazzoleni, Andre P.
2016-03-01
All planetary surface exploration missions thus far have employed traditional rovers with a rocker-bogie suspension. These rovers can navigate moderately rough and flat terrain, but are not designed to traverse rugged terrain with steep slopes. The fact is, however, that the most scientifically interesting missions require exploration platforms with capabilities for navigating such types of rugged terrain. This issue motivates the development of new kinds of rovers that take advantage of the latest advances in robotic technologies to traverse rugged terrain efficiently. This work analyzes one such rover concept called the Transforming Roving-Rolling Explorer (TRREx) that is principally aimed at addressing the above issue. Biologically inspired by the way the armadillo curls up into a ball when threatened, and the way the golden wheel spider uses the dynamic advantages of a sphere to roll down hills when escaping danger, the TRREx rover can traverse like a traditional 6-wheeled rover over conventional terrain, but can also transform itself into a sphere, when necessary, to travel down steep inclines, or navigate rough terrain. This paper investigates the mobility of the TRREx when it is in its rolling mode, i.e. when it is a sphere and can steer itself through actuations that shift its center of mass to achieve the desired direction of roll. A mathematical model describing the dynamics of the rover in this spherical configuration is presented, and actuated rolling is demonstrated through computer simulation. Parametric analyzes that investigate the rover's mobility as a function of its design parameters are also presented. This work highlights the contribution of the spherical rolling mode to the enhanced mobility of the TRREx rover and how it could enable challenging surface exploration missions in the future.
Partos, Timea R; Gilmore, Anna B; Hitchman, Sara C; Hiscock, Rosemary; Branston, J Robert; McNeill, Ann
2018-05-03
Raising tobacco prices is the most effective population-level intervention for reducing smoking, but this is undermined by the availability of cheap tobacco. This study monitors trends in cheap tobacco use among adult smokers in the United Kingdom between 2002 and 2014 via changes in product type, purchase source, and prices paid. Weighted data from 10 waves of the International Tobacco Control policy evaluation study were used. This is a longitudinal cohort study of adult smokers with replenishment; 6169 participants provided 15812 responses. Analyses contrasted (1) product type: roll-your-own (RYO) tobacco, factory-made packs (FM-P), and factory-made cartons (FM-C); (2) purchase source: UK store-based sources (e.g., supermarkets and convenience stores) with non-UK/nonstore sources representing tax avoidance/evasion (e.g., outside the UK, duty free, and informal sellers); and (3) prices paid (inflation-adjusted to 2014 values). Generalized estimating equations tested linear changes over time. (1) RYO use increased significantly over time as FM decreased. (2) UK store-based sources constituted approximately 80% of purchases over time, with no significant increases in tax avoidance/evasion. (3) Median RYO prices were less than half that of FM, with FM-C cheaper than FM-P. Non-UK/nonstore sources were cheapest. Price increases of all three product types from UK store-based sources from 2002 to 2014 were statistically significant but not substantial. Wide (and increasing for FM-P) price ranges meant each product type could be purchased in 2014 at prices below their 2002 medians from UK store-based sources. Options exist driving UK smokers to minimize their tobacco expenditure; smokers do so largely by purchasing cheap tobacco products from UK stores. The effectiveness of price increases as a deterrent to smoking is being undermined by the availability of cheap tobacco such as roll-your-own tobacco and cartons of packs of factory-made cigarettes. Wide price ranges
MÉTODO MULTIRRESÍDUO PARA DETERMINAÇÃO DE MICOTOXINAS EM VINHO POR UPLC-MS/MS
Laís Weber Righi
2013-01-01
Um método rápido usando cromatografia líquida de ultra eficiência acoplada a espectrometria de massas (UPLC-MS/MS) foi implementado e otimizado para proporcionar a determinação completa de 36 micotoxinas em amostras de vinhos. A extração foi realizada com acetonitrila, aplicando o método QuEChERS (Quick, Easy, Cheap, Effective, Rugged, Safe; em português: Rápido, Fácil, Barato, Efetivo, Robusto e Seguro) modificado. Tradicionalmente, o método QuEChERS é muito conhecido na determinação de múlt...
Partos, Timea R; Gilmore, Anna B; Hitchman, Sara C; Hiscock, Rosemary; Branston, J Robert; McNeill, Ann
2018-01-01
Abstract Introduction Raising tobacco prices is the most effective population-level intervention for reducing smoking, but this is undermined by the availability of cheap tobacco. This study monitors trends in cheap tobacco use among adult smokers in the United Kingdom between 2002 and 2014 via changes in product type, purchase source, and prices paid. Methods Weighted data from 10 waves of the International Tobacco Control policy evaluation study were used. This is a longitudinal cohort study of adult smokers with replenishment; 6169 participants provided 15812 responses. Analyses contrasted (1) product type: roll-your-own (RYO) tobacco, factory-made packs (FM-P), and factory-made cartons (FM-C); (2) purchase source: UK store-based sources (e.g., supermarkets and convenience stores) with non-UK/nonstore sources representing tax avoidance/evasion (e.g., outside the UK, duty free, and informal sellers); and (3) prices paid (inflation-adjusted to 2014 values). Generalized estimating equations tested linear changes over time. Results (1) RYO use increased significantly over time as FM decreased. (2) UK store-based sources constituted approximately 80% of purchases over time, with no significant increases in tax avoidance/evasion. (3) Median RYO prices were less than half that of FM, with FM-C cheaper than FM-P. Non-UK/nonstore sources were cheapest. Price increases of all three product types from UK store-based sources from 2002 to 2014 were statistically significant but not substantial. Wide (and increasing for FM-P) price ranges meant each product type could be purchased in 2014 at prices below their 2002 medians from UK store-based sources. Conclusions Options exist driving UK smokers to minimize their tobacco expenditure; smokers do so largely by purchasing cheap tobacco products from UK stores. Implications The effectiveness of price increases as a deterrent to smoking is being undermined by the availability of cheap tobacco such as roll-your-own tobacco and
Rugged, Low Cost, Environmental Sensors for a Turbulent World
Schulz, B.; Sandell, C. T.; Wickert, A. D.
2017-12-01
Ongoing scientific research and resource management require a diverse range of high-quality and low-cost sensors to maximize the number and type of measurements that can be obtained. To accomplish this, we have developed a series of diversified sensors for common environmental applications. The TP-DownHole is an ultra-compact temperature and pressure sensor designed for use in CMT (Continuous Multi-channel Tubing) multi-level wells. Its 1 mm water depth resolution, 30 cm altitude resolution, and rugged design make it ideal for both water level measurements and monitoring barometric pressure and associated temperature changes. The TP-DownHole sensor has also been incorporated into a self-contained, fully independent data recorder for extreme and remote environments. This device (the TP-Solo) is based around the TP-DownHole design, but has self-contained power and data storage and is designed to collect data independently for up to 6 months (logging at once an hour), creating a specialized tool for extreme environment data collection. To gather spectral information, we have also developed a very low cost photodiode-based Lux sensor to measure spectral irradiance; while this does not measure the entire solar radiation spectrum, simple modeling to rescale the remainder of the solar spectrum makes this a cost-effective alternative to a thermopile pyranometer. Lastly, we have developed an instrumentation amplifier which is designed to interface a wide range of sensitive instruments to common data logging systems, such as thermopile pyranometers, thermocouples, and many other analog output sensors. These three instruments are the first in a diverse family aimed to give researchers a set of powerful and low-cost tools for environmental instrumentation.
Modeling Top of Atmosphere Radiance over Heterogeneous Non-Lambertian Rugged Terrain
Directory of Open Access Journals (Sweden)
Alijafar Mousivand
2015-06-01
Full Text Available Topography affects the fraction of direct and diffuse radiation received on a pixel and changes the sun–target–sensor geometry, resulting in variations in the observed radiance. Retrieval of surface–atmosphere properties from top of atmosphere radiance may need to account for topographic effects. This study investigates how such effects can be taken into account for top of atmosphere radiance modeling. In this paper, a system for top of atmosphere radiance modeling over heterogeneous non-Lambertian rugged terrain through radiative transfer modeling is presented. The paper proposes an extension of “the four-stream radiative transfer theory” (Verhoef and Bach 2003, 2007 and 2012 mainly aimed at representing topography-induced contributions to the top of atmosphere radiance modeling. A detailed account for BRDF effects, adjacency effects and topography effects on the radiance modeling is given, in which sky-view factor and non-Lambertian reflected radiance from adjacent slopes are modeled precisely. The paper also provides a new formulation to derive the atmospheric coefficients from MODTRAN with only two model runs, to make it more computationally efficient and also avoiding the use of zero surface albedo as used in the four-stream radiative transfer theory. The modeling begins with four surface reflectance factors calculated by the Soil–Leaf–Canopy radiative transfer model SLC at the top of canopy and propagates them through the effects of the atmosphere, which is explained by six atmospheric coefficients, derived from MODTRAN radiative transfer code. The top of the atmosphere radiance is then convolved with the sensor characteristics to generate sensor-like radiance. Using a composite dataset, it has been shown that neglecting sky view factor and/or terrain reflected radiance can cause uncertainty in the forward TOA radiance modeling up to 5 (mW/m2·sr·nm. It has also been shown that this level of uncertainty can be translated
Predictable and Predictive Emotions:Explaining Cheap Signals and Trust Re-Extension
Directory of Open Access Journals (Sweden)
Eric eSchniter
2014-11-01
Full Text Available Despite normative predictions from economics and biology, unrelated strangers will often develop the trust necessary to reap gains from one-shot economic exchange opportunities. This appears to be especially true when declared intentions and emotions can be cheaply communicated. Perhaps even more puzzling to economists and biologists is the observation that anonymous and unrelated individuals, known to have breached trust, often make effective use of cheap signals, such as promises and apologies, to encourage trust re-extension. We used a pair of trust games with one-way communication and emotion surveys to investigate the role of emotions in regulating the propensity to message, apologize, re-extend trust, and demonstrate trustworthiness. This design allowed us to observe the endogenous emergence and natural distribution of trust-relevant behaviors, remedial strategies used by promise-breakers, their effects on behavior, and subsequent outcomes. We found that emotions triggered by interaction outcomes are predictable and also predict subsequent apology and trust re-extension. The role of emotions in behavioral regulation helps explain why messages are produced, when they can be trusted, and when trust will be re-extended.
Predictable and predictive emotions: explaining cheap signals and trust re-extension.
Schniter, Eric; Sheremeta, Roman M
2014-01-01
Despite normative predictions from economics and biology, unrelated strangers will often develop the trust necessary to reap gains from one-shot economic exchange opportunities. This appears to be especially true when declared intentions and emotions can be cheaply communicated. Perhaps even more puzzling to economists and biologists is the observation that anonymous and unrelated individuals, known to have breached trust, often make effective use of cheap signals, such as promises and apologies, to encourage trust re-extension. We used a pair of trust games with one-way communication and an emotion survey to investigate the role of emotions in regulating the propensity to message, apologize, re-extend trust, and demonstrate trustworthiness. This design allowed us to observe the endogenous emergence and natural distribution of trust-relevant behaviors, remedial strategies used by promise-breakers, their effects on behavior, and subsequent outcomes. We found that emotions triggered by interaction outcomes are predictable and also predict subsequent apology and trust re-extension. The role of emotions in behavioral regulation helps explain why messages are produced, when they can be trusted, and when trust will be re-extended.
Effects of glucose doping on the MgB{sub 2} superconductors using cheap crystalline boron
Energy Technology Data Exchange (ETDEWEB)
Parakkandy, Jafar Meethale [Department of Physics and Astronomy, College of Science, PO Box 2455, King Saud University, Riyadh 11451,Saudi Arabia (Saudi Arabia); Shahabuddin, Mohammed, E-mail: mshahab@ksu.edu.sa [Department of Physics and Astronomy, College of Science, PO Box 2455, King Saud University, Riyadh 11451,Saudi Arabia (Saudi Arabia); Shah, M. Shahabuddin; Alzayed, Nasser S.; Qaid, Salem A.S.; Madhar, Niyaz Ahmad; Ramay, Shahid M. [Department of Physics and Astronomy, College of Science, PO Box 2455, King Saud University, Riyadh 11451,Saudi Arabia (Saudi Arabia); Shar, Muhammad Ali [Mechanical Engineering Department, College of Engineering, P.O. Box 800, King Saud University, Riyadh 11421 (Saudi Arabia)
2015-12-15
Highlights: • First report on glucose doped MgB{sub 2} superconductor by single step dry mixing approach. • Cheap crystalline boron used for the sample preparation. • Microstructure and superconducting properties of the superconductors are discussed. • Less degradation in low field critical current density observed. • MgB{sub 2} with 2 at. % glucose doped showed the highest J{sub c}, ≈ 2 × 10{sup 4}A/cm{sup 2} for 20 K at 3 T. - Abstract: We report the effect of glucose (C{sub 6}H{sub 12}O{sub 6}) doping on the structural and electromagnetic properties of MgB{sub 2} superconductor fabricated by dry mixing using planetary ball milling. Herein, as-prepared bulk polycrystalline Mg (B{sub 1–x}C{sub x}) {sub 2} samples with different doping levels (x = 0, 2, 4, and 6 at. %) were systematically studied by X-ray diffraction, magnetic and resistivity measurements, and microstructure analysis. When carbon doped, the reduction in critical transition temperature and shrinkage in a-lattice were obviously observed. This resulted in structural distortion of the MgB{sub 2} lattice, and thereby, enhanced an impurity scattering. In addition to these, upper critical field and high-field critical current densities were also enhanced. On the other hand, both pinning force and low-field critical current density are decreased. The high field enhancement and low field degradation are due to increase in impurity scattering and decrease in pinning force respectively.
Caputi, Theodore L
2018-05-03
Online cigarette dealers have lower prices than brick-and-mortar retailers and advertise tax-free status.1-8 Previous studies show smokers search out these online alternatives at the time of a cigarette tax increase.9,10 However, these studies rely upon researchers' decision to consider a specific date and preclude the possibility that researchers focus on the wrong date. The purpose of this study is to introduce an unbiased methodology to the field of observing search patterns and to use this methodology to determine whether smokers search Google for "cheap cigarettes" at cigarette tax increases and, if so, whether the increased level of searches persists. Publicly available data from Google Trends is used to observe standardized search volumes for the term, "cheap cigarettes". Seasonal Hybrid Extreme Studentized Deviate and E-Divisive with Means tests were performed to observe spikes and mean level shifts in search volume. Of the twelve cigarette tax increases studied, ten showed spikes in searches for "cheap cigarettes" within two weeks of the tax increase. However, the mean level shifts did not occur for any cigarette tax increase. Searches for "cheap cigarettes" spike around the time of a cigarette tax increase, but the mean level of searches does not shift in response to a tax increase. The SHESD and EDM tests are unbiased methodologies that can be used to identify spikes and mean level shifts in time series data without an a priori date to be studied. SHESD and EDM affirm spikes in interest are related to tax increases. • Applies improved statistical techniques (SHESD and EDM) to Google search data related to cigarettes, reducing bias and increasing power • Contributes to the body of evidence that state and federal tax increases are associated with spikes in searches for cheap cigarettes and may be good dates for increased online health messaging related to tobacco.
Rugged Large Volume Injection for Sensitive Capillary LC-MS Environmental Monitoring
Directory of Open Access Journals (Sweden)
Hanne Roberg-Larsen
2017-08-01
Full Text Available A rugged and high throughput capillary column (cLC LC-MS switching platform using large volume injection and on-line automatic filtration and filter back-flush (AFFL solid phase extraction (SPE for analysis of environmental water samples with minimal sample preparation is presented. Although narrow columns and on-line sample preparation are used in the platform, high ruggedness is achieved e.g., injection of 100 non-filtrated water samples did not result in a pressure rise/clogging of the SPE/capillary columns (inner diameter 300 μm. In addition, satisfactory retention time stability and chromatographic resolution were also features of the system. The potential of the platform for environmental water samples was demonstrated with various pharmaceutical products, which had detection limits (LOD in the 0.05–12.5 ng/L range. Between-day and within-day repeatability of selected analytes were <20% RSD.
Challenges of using an AUV to find and map hydrothermal vent sites in deep and rugged terrains
McPhail, S.D.; Stevenson, P.; Pebody, M.; Furlong, M.; Perrett, J.; LeBas, T.
2010-01-01
In March 2010, the Autosub6000 AUV embarked on a cruise to discover, locate and map hydrothermal vent sites in an active spreading centre, the Cayman trough in the Caribbean sea. The environment provided the challenge of steep and rugged terrain together with deep water (in places greater than 5000 m). Autosub6000 is a flight class, hydrodynamically shaped AUV, with good endurance capability, making it well suited for searching for plume signals and mapping terrain over the required ...
Sugar cane leaf: a potential raw material for cheap grades of paper and board
Energy Technology Data Exchange (ETDEWEB)
Tiwary, K. N.; Kulkarni, A. Y.
1980-03-15
About 6 to 7 million tons of sugar cane leaves are available per year as agricultural residue and can be utilized for manufacture of cheap grades of paper and board. An unbleached yield of 56% could be obtained using 10% NaOH at a temperature of 170/sup 0/C with a bath ratio of 1 to 4 and cooking time of 10 min. Sulfate pulping with equivalent conditions gave a bleached pulp with comparatively higher brightness values, other properties remaining almost same. Bleaching of 10% soda pulp with 10 and 12% chlorine have given 42 and 40% yields at 71 to 72 and 77 to 78% Elrepho brightness, respectively. In case of 9% sulfate pulp the yields are 36 to 37% at 77 to 79% brightness when bleached with the same sequence as above with 10 to 10.5% chlorine. The pulps are strong for preparation of cheap grades of bleached as well as unbleached varieties of paper. Double fold and tear are however medium to low and hence need long fibered pulp blending to improve these characteristics.
Doubling the Performance-Cost Ratio of PV by Using Cheap Mirrors - a Secondary School Project
Breejen, H.; van Herwaarden, S.; Keijsers, B.; van Dijk, V.A.P.; van Sark, W.G.J.H.M.|info:eu-repo/dai/nl/074628526
2007-01-01
Reduction of cost is a major issue in the photovoltaics field. We have addressed this issue in a secondaryschool science project by considering the use of cheap mirrors in combination with solar panels, for application in developing countries. We have confirmed that it is possible to increase the
Augmenting short cheap talk scripts with a repeated opt-out reminder in choice experiment surveys
DEFF Research Database (Denmark)
Ladenburg, Jacob; Olsen, Søren Bøye
to choose the opt-out alternative if they find the experimentally designed alternatives too expensive. In an empirical Choice Experiment survey we find the Opt-Out Reminder to significantly reduce total WTP and to some extent also marginal WTP beyond the capability of the Cheap Talk applied without the Opt...
Compact, rugged in-chamber transmission spectrometers (7-28 keV) for the Sandia Z facility.
Sinars, D B; Wenger, D F; Pikuz, S A; Jones, B; Geissel, M; Hansen, S B; Coverdale, C A; Ampleford, D J; Cuneo, M E; McPherson, L A; Rochau, G A
2011-06-01
We describe a pair of time-integrated transmission spectrometers that are designed to survey 7-28 keV (1.9 to 0.43 Å) x-ray photons produced by experiments on the Sandia Z pulsed power facility. Each spectrometer uses a quartz 10-11 crystal in a Cauchois geometry with a slit to provide spatial resolution along one dimension. The spectrometers are located in the harsh environment of the Z vacuum chamber, which necessitates that their design be compact and rugged. Example data from calibration tests and Z experiments are shown that illustrate the utility of the instruments. © 2011 American Institute of Physics
International Nuclear Information System (INIS)
Boev, Blazho; Dimitrovska, Vasilka
2011-01-01
This paper represents the results of the ground and abrasive stone tools analyses based on the finds collected during the excavation of Rug Bair undertaken in 1970, and today stored in the Museum and Institute for Protection of Shtip. The studies were made possible with the help from the Faculty of Natural and Technical Sciences, Shtip, Republic of Macedonia. Through the stone material, an attempt was made a more comprehensive picture of the raw material, petrologic, technical and typo logical characteristics of the Neolithic stone industry at this site to be gained as well as its relationship with related simultaneously industries. (Author)
Ngaile, J. E.; Msaki, P. K.; Kazema, R. R.
2018-04-01
Contrast investigations of hysterosalpingography (HSG) and retrograde urethrography (RUG) fluoroscopy procedures remain the dominant diagnostic tools for the investigation of infertility in females and urethral strictures in males, respectively, owing to the scarcity and high cost of services of alternative diagnostic technologies. In light of the radiological risks associated with contrast based investigations of the genitourinary tract systems, there is a need to assess the magnitude of radiation burden imparted to patients undergoing HSG and RUG fluoroscopy procedures in Tanzania. The air kerma area product (KAP), fluoroscopy time, number of images, organ dose and effective dose to patients undergoing HSG and RUG procedures were obtained from four hospitals. The KAP was measured using a flat transmission ionization chamber, while the organ and effective doses were estimated using the knowledge of the patient characteristics, patient related exposure parameters, geometry of examination, KAP and Monte Carlo calculations (PCXMC). The median values of KAP for the HSG and RUG were 2.2 Gy cm2 and 3.3 Gy cm2, respectively. The median organ doses in the present study for the ovaries, urinary bladder and uterus for the HSG procedures, were 1.0 mGy, 4.0 mGy and 1.6 mGy, respectively, while for urinary bladder and testes of the RUG were 3.4 mGy and 5.9 mGy, respectively. The median values of effective doses for the HSG and RUG procedures were 0.65 mSv and 0.59 mSv, respectively. The median values of effective dose per hospital for the HSG and RUG procedures had a range of 1.6-2.8 mSv and 1.9-5.6 mSv, respectively, while the overall differences between individual effective doses across the four hospitals varied by factors of up to 22.0 and 46.7, respectively for the HSG and RUG procedures. The proposed diagnostic reference levels (DRLs) for the HSG and RUG were for KAP 2.8 Gy cm2 and 3.9 Gy cm2, for fluoroscopy time 0.8 min and 0.9 min, and for number of images 5 and 4
Lime Juice and Vinegar Injections as a Cheap and Natural Alternative to Control COTS Outbreaks.
Moutardier, Grégoire; Gereva, Sompert; Mills, Suzanne C; Adjeroud, Mehdi; Beldade, Ricardo; Ham, Jayven; Kaku, Rocky; Dumas, Pascal
2015-01-01
Outbreaks of the corallivorous crown-of-thorns seastar Acanthaster planci (COTS) represent one of the greatest disturbances to coral reef ecosystems in the Indo-Pacific, affecting not only coral reefs but also the coastal communities which rely on their resources. While injection approaches are increasingly used in an attempt to control COTS densities, most of them display severe drawbacks including logistical challenges, high residual environmental impacts or low cost-effectiveness. We tested a new alternative control method based upon acidic injections of cheap, 100% natural products. We investigated the lethal doses, intra- and inter-specific disease transmission and immune responses of COTS when injected with fresh lime juice (extracted from local Citrus arantifolia) and white spirit vinegar. High COTS mortality was achieved with small volumes: 10-20 ml per seastar induced death in 89%/97% of injected specimens after an average 34.3 h/29.8 h for lime juice and vinegar respectively. Highest efficiency was reached for both solutions with double shots of (2 × 10 ml) in two different areas on the body: 100% mortality occurred within 12-24 h, which is similar or faster compared with other current injection methods. Multiple immune measures suggested that death was very likely caused by pH stress from the acidic solutions rather than a bacterial infection. Contagion to either conspecifics or a variety of other reef species was not observed, even at COTS densities 15 times higher than the highest naturally reported. 10 to 20 l lime juice/vinegar could kill up to a thousand COTS at a cost of less than 0.05 USD per specimen; no permits or special handling procedures are required. We conclude that injections of lime juice and vinegar offer great advantages when compared to current best practises and constitute a cheap and natural option for all reefs affected by COTS.
A novel scheme for making cheap electricity with nuclear energy
International Nuclear Information System (INIS)
Pettibone, J.S.
1991-04-01
Nuclear fuels should produce cheaper electricity than coal, considering their high specific energy and low cost. To exploit these properties, the scheme proposed here replaces the expensive reactor/steam-turbine system with an engine in which the expansion of a gas heated by a nuclear explosion raises a mass of liquid, thereby producing stored hydraulic energy. This energy could be converted to electricity by hydroelectric generation with water as the working fluid or by magnetohydrodynamic (MHD) generation with molten metal. A rough cost analysis suggests the hydroelectric system could reduce the present cost of electricity by two-thirds, and the MHD system by even more. Such cheap power would make feasible large-scale electrolysis to produce hydrogen and other fuels and chemical raw materials. 2 refs., 1 fig
Identification of children with reading difficulties: Cheap can be adequate
DEFF Research Database (Denmark)
Poulsen, Mads; Nielsen, Anne-Mette Veber
Classification of reading difficulties: Cheap screening can be accurate Purpose: Three factors are important for identification of students in need of remedial instruction: accuracy, timeliness, and cost. The identification has to be accurate to be of any use, the identification has to be timely......, inexpensive testing. The present study investigated the classification accuracy of three screening models varying in timeliness and cost. Method: We compared the ROC statistics of three logistic models for predicting end of Grade 2 reading difficulties in a sample of 164 students: 1) an early, comprehensive...... model using a battery of Grade 0 tests, including phoneme awareness, rapid naming, and paired associate learning, 2) a late, comprehensive model adding reading measures from January of Grade 1, and 3) a late, inexpensive model using only group-administered reading measures from January of Grade 1...
Fusion energy: 'clean' nuclear power with cheap fuel
International Nuclear Information System (INIS)
Persson, H.
1976-01-01
Because of the world energy crisis the possible use of thermonuclear energy is exciting great interest, particularly in the United States. Of primary importance is that the fuel required is cheap and readily available - it is the world's water resources. The basic long standing fundamental problem is to produce a stable plasma; the difficulties and the reasons for them are discussed. Of the machines and methods designed to overcome the problem, to date the Russian-developed Tokamak appears the most likely to succeed. The confidence in this equipment is shown by the number under construction or design in the U.S.; brief descriptions are given of a number of 'tokamaks' being built by Government agencies and universities and by industry. The Energy Research and Development Administration (ERDA) hopes that some useful energy can be produced by 1985 and a 500MW generator by 1995-97. Of importance also to the understanding of the fusion reaction are fundamental investigations with, for instance, particle accelerators. Work at Oakridge, Livermore, Princeton and Brookhaven is discussed. Other experiments e.g. laser induced fusion, are also considered. (G.P.)
Jang, Kyung-In; Han, Sang Youn; Xu, Sheng; Mathewson, Kyle E.; Zhang, Yihui; Jeong, Jae-Woong; Kim, Gwang-Tae; Webb, R. Chad; Lee, Jung Woo; Dawidczyk, Thomas J.; Kim, Rak Hwan; Song, Young Min; Yeo, Woon-Hong; Kim, Stanley; Cheng, Huanyu; Rhee, Sang Il; Chung, Jeahoon; Kim, Byunggik; Chung, Ha Uk; Lee, Dongjun; Yang, Yiyuan; Cho, Moongee; Gaspar, John G.; Carbonari, Ronald; Fabiani, Monica; Gratton, Gabriele; Huang, Yonggang; Rogers, John A.
2014-09-01
Research in stretchable electronics involves fundamental scientific topics relevant to applications with importance in human healthcare. Despite significant progress in active components, routes to mechanically robust construction are lacking. Here, we introduce materials and composite designs for thin, breathable, soft electronics that can adhere strongly to the skin, with the ability to be applied and removed hundreds of times without damaging the devices or the skin, even in regions with substantial topography and coverage of hair. The approach combines thin, ultralow modulus, cellular silicone materials with elastic, strain-limiting fabrics, to yield a compliant but rugged platform for stretchable electronics. Theoretical and experimental studies highlight the mechanics of adhesion and elastic deformation. Demonstrations include cutaneous optical, electrical and radio frequency sensors for measuring hydration state, electrophysiological activity, pulse and cerebral oximetry. Multipoint monitoring of a subject in an advanced driving simulator provides a practical example.
Jang, Kyung-In; Han, Sang Youn; Xu, Sheng; Mathewson, Kyle E; Zhang, Yihui; Jeong, Jae-Woong; Kim, Gwang-Tae; Webb, R Chad; Lee, Jung Woo; Dawidczyk, Thomas J; Kim, Rak Hwan; Song, Young Min; Yeo, Woon-Hong; Kim, Stanley; Cheng, Huanyu; Rhee, Sang Il; Chung, Jeahoon; Kim, Byunggik; Chung, Ha Uk; Lee, Dongjun; Yang, Yiyuan; Cho, Moongee; Gaspar, John G; Carbonari, Ronald; Fabiani, Monica; Gratton, Gabriele; Huang, Yonggang; Rogers, John A
2014-09-03
Research in stretchable electronics involves fundamental scientific topics relevant to applications with importance in human healthcare. Despite significant progress in active components, routes to mechanically robust construction are lacking. Here, we introduce materials and composite designs for thin, breathable, soft electronics that can adhere strongly to the skin, with the ability to be applied and removed hundreds of times without damaging the devices or the skin, even in regions with substantial topography and coverage of hair. The approach combines thin, ultralow modulus, cellular silicone materials with elastic, strain-limiting fabrics, to yield a compliant but rugged platform for stretchable electronics. Theoretical and experimental studies highlight the mechanics of adhesion and elastic deformation. Demonstrations include cutaneous optical, electrical and radio frequency sensors for measuring hydration state, electrophysiological activity, pulse and cerebral oximetry. Multipoint monitoring of a subject in an advanced driving simulator provides a practical example.
Hu, Mingfeng; Liu, Xingang; Dong, Fengshou; Xu, Jun; Li, Shasha; Xu, Hanqing; Zheng, Yongquan
2015-05-15
A rapid, effective and sensitive method to quantitatively determine ametoctradin residue in apple, cucumber, cabbage, tomato and grape was developed and validated using ultra-performance liquid chromatography coupled with tandem mass spectrometry (UPLC-MS/MS). The target compound was determined in less than 5.0 min using an electrospray ionisation source in positive mode (ESI+). The limit of detection was below 0.043 μg kg(-1), whereas the limits of quantification did not exceed 0.135 μg kg(-1) in all five matrices. The method showed excellent linearity (R(2)>0.9969) for the target compound. Recovery studies were performed in all matrices at three spiked levels (1, 10 and 100 μg L(-1)). The mean recoveries from five matrices ranged from 81.81% to 100.1%, with intra-day relative standard deviations (RSDr) in the range of 0.65-7.88% for the test compound. This method will be useful for the quick and routine detection of ametoctradin residues in potato, grape, cucumber, apple and tomato. Copyright © 2014 Elsevier Ltd. All rights reserved.
Kim, Sung-Woo; Abd El-Aty, A M; Rahman, Md Musfiqur; Choi, Jeong-Heui; Choi, Ok-Ja; Rhee, Gyu-Seek; Chang, Moon-Ik; Kim, Heejung; Abid, Morad D N; Shin, Sung Chul; Shim, Jae-Han
2015-07-01
Following quick, easy, cheap, effective, rugged and safe (QuEChERS) and LC/MS/MS analysis, pyridaben residual levels were determined in unprocessed and processed hot pepper fruit and leaves. The linearities were satisfactory with determination coefficients (R(2)) in excess of 0.995 in processed and unprocessed pepper fruit and leaves. Recoveries at various concentrations were 79.9-105.1% with relative standard deviations ≤15%. The limits of quantitation of 0.003-0.012 mg/kg were very low compared with the maximum residue limits (2-5 mg/kg) set by the Ministry of Food and Drug Safety, Republic of Korea. The effects of various household processes, including washing, blanching, frying and drying under different conditions (water volume, blanching time and temperature) on residual concentrations were evaluated. Both washing and blanching (in combination with high water volume and time factor) significantly reduced residue levels in hot pepper fruit and leaves compared with other processes. In sum, the developed method was satisfactory and could be used to accurately detect residues in unprocessed and processed pepper fruit and leaves. It is recommended that pepper fruit/leaves be blanched after washing before being consumed to protect consumers from the negative health effects of detected pesticide residues. Copyright © 2014 John Wiley & Sons, Ltd.
Zhang, Yaohai; Zhang, Xuelian; Jiao, Bining
2014-09-15
Dispersive liquid-liquid microextraction (DLLME) sample preparation and the quick, easy, cheap, effective, rugged and safe (QuEChERS) method combined with DLLME were developed and compared for the analysis of ten pyrethroids in various fruit juices using gas chromatography-electron capture detection (GC-ECD). QuEChERS-DLLME method has found its widespread applications to all the fruit juices including those samples with more complex matrices (orange, lemon, kiwi and mango) while DLLME was confined to the fruit juices with simpler matrices (apple, pear, grape and peach). The two methods provided acceptable recoveries and repeatability. In addition, the applicabilities of two methods were demonstrated with the real samples and further confirmed by gas chromatography-mass spectrometry (GC-MS). Copyright © 2014. Published by Elsevier Ltd.
Institute of Scientific and Technical Information of China (English)
刘红伟; 刘洪; 李博; 王鑫; 佟小龙; 刘钦
2011-01-01
Pre-stack reverse time migration (RTM) for rugged topography is a very useful tool for seismic imaging in the areas with rugged surface topography andcomplex subsurface structures. In this paper, we illustrate the implementation process of RTM for rugged topography. For the difficulty in dealing with the rugged free boundary condition with the finite difference method, we employ a simplified boundary condition which can avoid the abundant logical judgment. On this basis, we use the Graphic Processing Unit (GPU) algorithm to accelerate RTM and get an order of magnitude higher speedup ratio compared to the traditional CPU algoritm. The tests on synthetic data and the comparison with the pre-stack one-way wave method for rugged topography prove thai RTM does not have the imaging dip limit, and the imaging results for near surface structures and subsurface steep structures are significantly improved. The problems of imaging noise removal and massy memory demand of RTM have been stated previously and will not be discussed in this paper.%从起伏地表直接进行叠前逆时偏移是解决地表起伏大并且地下构造复杂这种双复杂结构地区成像问题的有力工具.本文给出了起伏地表直接进行叠前逆时偏移的实现过程,针对有限差分方法处理起伏地表自由边界条件的复杂性,采用了一种简化的自由边界条件,避免了大量的逻辑判断,在此基础上,采用图形处理器(Graphic Processing Unit,简称GPU)将算法加速,比传统的CPU计算速度提高了一个数量级.文中对理论模型进行了计算,并与起伏地表直接进行单程波叠前偏移方法做比较,结果表明:起伏地表叠前逆时偏移有效突破了成像倾角限制,对起伏地表浅层构造以及地下高陡构造成像效果显著提高.关于逆时偏移成像噪音去除以及存储量等问题,笔者已有文章介绍,本文将不再涉及.
Swarm Robotics, or: The Smartness of 'a bunch of cheap dumb things'
Directory of Open Access Journals (Sweden)
Sebastian Vehlken
2017-12-01
Full Text Available Not only recent Science Fiction – e.g., Star Trek Beyond (USA 2016 – celebrates the capacities of robot collectives. Also RoboCup, an annual robot soccer competition, or Harvard University’s Kilobot Project show stunning examples of the central idea behind Swarm Robotics: »[U]sing swarms is the same as getting a bunch of small cheap dumb things to do the same job as an expensive smart thing« (Beni/Wang 1989. This article examines some crucial aspects of the techno-history of a research field which intertwines engineering and biological knowledge and whose applications deal with compelling questions about synchronization and self-organization in changing environments – on the ground, in the air, and under water.
Energy Technology Data Exchange (ETDEWEB)
Ratajkiewicz, H.; Kierzek, R.; Raczkowski, M.; Hołodyńska-Kulas, A.; Łacka, A.; Wójtowicz, A.; Wachowiak, M.
2016-11-01
This study compared the effects of a proportionate spray volume (PSV) adjustment model and a fixed model (300 L/ha) on the infestation of processing tomato with potato late blight (Phytophthora infestans (Mont.) de Bary) (PLB) and azoxystrobin and chlorothalonil residues in fruits in three consecutive seasons. The fungicides were applied in alternating system with or without two spreader adjuvants. The proportionate spray volume adjustment model was based on the number of leaves on plants and spray volume index. The modified Quick, Easy, Cheap, Effective, Rugged, and Safe (QuEChERS) method was optimized and validated for extraction of azoxystrobin and chlorothalonil residue. Gas chromatography with a nitrogen and phosphorus detector and an electron capture detector were used for the analysis of fungicides. The results showed that higher fungicidal residues were connected with lower infestation of tomato with PLB. PSV adjustment model resulted in lower infestation of tomato than the fixed model (300 L/ha) when fungicides were applied at half the dose without adjuvants. Higher expected spray interception into the tomato canopy with the PSV system was recognized as the reasons of better control of PLB. The spreader adjuvants did not have positive effect on the biological efficacy of spray volume application systems. The results suggest that PSV adjustment model can be used to determine the spray volume for fungicide application for processing tomato crop. (Author)
Directory of Open Access Journals (Sweden)
Henryk Ratajkiewicz
2016-08-01
Full Text Available This study compared the effects of a proportionate spray volume (PSV adjustment model and a fixed model (300 L/ha on the infestation of processing tomato with potato late blight (Phytophthora infestans (Mont. de Bary (PLB and azoxystrobin and chlorothalonil residues in fruits in three consecutive seasons. The fungicides were applied in alternating system with or without two spreader adjuvants. The proportionate spray volume adjustment model was based on the number of leaves on plants and spray volume index. The modified Quick, Easy, Cheap, Effective, Rugged, and Safe (QuEChERS method was optimized and validated for extraction of azoxystrobin and chlorothalonil residue. Gas chromatography with a nitrogen and phosphorus detector and an electron capture detector were used for the analysis of fungicides. The results showed that higher fungicidal residues were connected with lower infestation of tomato with PLB. PSV adjustment model resulted in lower infestation of tomato than the fixed model (300 L/ha when fungicides were applied at half the dose without adjuvants. Higher expected spray interception into the tomato canopy with the PSV system was recognized as the reasons of better control of PLB. The spreader adjuvants did not have positive effect on the biological efficacy of spray volume application systems. The results suggest that PSV adjustment model can be used to determine the spray volume for fungicide application for processing tomato crop.
Chen, Yaling; Cao, Shurui; Zhang, Lei; Xi, Cunxian; Li, Xianliang; Chen, Zhiqiong; Wang, Guoming
2016-05-27
Size-controlled magnetite nanoparticles (Fe3O4) with 200-1000nm were synthesized by co-precipitation method. Then Fe3O4@SiO2@G@PIL was synthesized and used as modified QuEChERS adsorbent for the determination of preservatives in vegetables. The size of about 200nm of Fe3O4 in Fe3O4@SiO2@G@PIL was selected as optimum size to clean-up. It not only exerted the nanometer features of magnetic nanoparticles, but also displayed the large specific surface area of graphene (G) and the solvent effects of polymeric ionic liquids (PILs). Various experimental parameters have been investigated. Under the optimized conditions, a simple, rapid and effective method for the determination of 20 preservatives residues in vegetables was established by modified QuEChERS to gas chromatography/mass spectrometry (GC-MS) analysis. The good linearity with correlation coefficients (R(2)) of 0.9972-0.9999 was obtained over the range of 0.02-2.00mg/L for 20 preservatives. The detection limits of the proposed method for 20 preservatives ranged from 0.82 to 6.64μg/kg. The adsorbent was successfully applied for extraction and determination of preservatives in vegetable samples, which thus was time-saving with keeping good clean-up performance. Copyright © 2016 Elsevier B.V. All rights reserved.
Cheap imports next ordeal for Europe's high-cost producers
International Nuclear Information System (INIS)
Chynoweth, E.
1993-01-01
About one-third of Europe's 34 cracker and downstream units lost money in the final quarter of 1992, says Chem Systems (London). Average return on capital employed is negative - at the same level as in the gloomy days of the early 1980s - yet average operating rates are 80% now, compared with 65% a decade ago. Margins at what Chem Systems calls leader cracks (naphtha-based units that use good modern practices) are DM42/m.t. ethylene, DM100/m.t. less than they were in 1991. The consultant firm's recent report, European Petrochemical Strategy in the 1990s, suggests closure of 5%-10% of high-cost production. But, Chem Systems director Roger Longley states: We are not advocating wholesale closure. There are a small number (of plants) where additional investment would not payback that would be economical to shut. Cost reduction through mergers and acquisitions and operational changes is much more important, especially from an international aspect, Longley says. One thing people do not fully appreciate is that Europe is a high-cost region for petrochemical production, he adds. Traditionally, Europe exports 5% of its ethylene output, now it needs to tolerate cheap imports
Seki, Kazuhiko; Bagchi, Kaushik; Bagchi, Biman
2016-05-01
Diffusion in one dimensional rugged energy landscape (REL) is predicted to be pathologically different (from any higher dimension) with a much larger chance of encountering broken ergodicity [D. L. Stein and C. M. Newman, AIP Conf. Proc. 1479, 620 (2012)]. However, no quantitative study of this difference has been reported, despite the prevalence of multidimensional physical models in the literature (like a high dimensional funnel guiding protein folding/unfolding). Paradoxically, some theoretical studies of these phenomena still employ a one dimensional diffusion description for analytical tractability. We explore the dimensionality dependent diffusion on REL by carrying out an effective medium approximation based analytical calculations and compare them with the available computer simulation results. We find that at an intermediate level of ruggedness (assumed to have a Gaussian distribution), where diffusion is well-defined, the value of the effective diffusion coefficient depends on dimensionality and changes (increases) by several factors (˜5-10) in going from 1d to 2d. In contrast, the changes in subsequent transitions (like 2d to 3d and 3d to 4d and so on) are far more modest, of the order of 10-20% only. When ruggedness is given by random traps with an exponential distribution of barrier heights, the mean square displacement (MSD) is sub-diffusive (a well-known result), but the growth of MSD is described by different exponents in one and higher dimensions. The reason for such strong ruggedness induced retardation in the case of one dimensional REL is discussed. We also discuss the special limiting case of infinite dimension (d = ∞) where the effective medium approximation becomes exact and where theoretical results become simple. We discuss, for the first time, the role of spatial correlation in the landscape on diffusion of a random walker.
Achieving cheap clean energy for all in the 21^st Century?
Gupta, Rajan
2006-11-01
Energy is essential for modern life and is a critical resource that we take for granted. Unfortunately, we are increasingly confronted by many unsettling questions: Is there enough cheap oil and gas remaining and should we start changing our life styles towards energy efficiency? What will be the price of oil and gas next year and will we face shortages? Are rising prices reflective of greed and manipulation or geopolitics or of real constraints? Will renewable sources provide a significant fraction of our energy needs? Is global warming already happening and is it a result of our ``addiction to oil''? If the answer to these is ``yes'', then what can we, as individuals, do to help ourselves, the nation, and the world? This talk will attempt to answer these questions by examining the global oil, gas and other resources, emerging constraints and opportunities, and geopolitics.
Directory of Open Access Journals (Sweden)
Norma Susana Pano-Farias
2017-07-01
Full Text Available In this paper a method of using the “quick, easy, cheap, effective, rugged, and safe” (QuEChERS extraction and gas chromatography coupled to mass spectrometry detection (GC–MS was developed for the analysis of five frequently applied pesticides in papaya and avocado. The selected pesticides, ametryn, atrazine, carbaryl, carbofuran, and methyl parathion, represent the most commonly used classes (carbamates, organophosphorous, and triazines. Optimum separation achieved the analysis of all pesticides in 0.99. The limits of detection (LOD and quantification (LOQ in papaya ranged from 0.03 mg/kg to 0.35 mg/kg and from 0.06 mg/kg to 0.75 mg/kg, respectively. Meanwhile for avocado, LOD values varied from 0.14 mg/kg to 0.28 mg/kg and LOQ values ranged from 0.22 mg/kg to 0.40 mg/kg. Recoveries obtained for each pesticide in both matrices ranged between 60.6% and 104.3%. The expanded uncertainty of the method was < 26% for all the pesticides in both fruits. Finally, the method was applied to other fruits.
Meyer, Peter; Green, Robert O.; Staenz, Karl; Itten, Klaus I.
1994-01-01
A geocoding procedure for remotely sensed data of airborne systems in rugged terrain is affected by several factors: buffeting of the aircraft by turbulence, variations in ground speed, changes in altitude, attitude variations, and surface topography. The current investigation was carried out with an Airborne Visible/Infrared Imaging Spectrometer (AVIRIS) scene of central Switzerland (Rigi) from NASA's Multi Aircraft Campaign (MAC) in Europe (1991). The parametric approach reconstructs for every pixel the observation geometry based on the flight line, aircraft attitude, and surface topography. To utilize the data for analysis of materials on the surface, the AVIRIS data are corrected to apparent reflectance using algorithms based on MODTRAN (moderate resolution transfer code).
Mendez, Alina Ramirez
2017-01-01
This dissertation argues that the agriculture industry in California’s Imperial Valley has enjoyed ample access to cheap labor since the mid-twentieth century because Mexicali, Baja California Norte, its Mexican neighbor, has subsidized the reproduction of a transborder labor force employed in agriculture but otherwise denied social membership in the United States. This subsidy from Mexicali to the Imperial Valley began in 1942 with the start of the Bracero Program and continued well past the...
Bertermann, David; Müller, Johannes; Galgaro, Antonio; Cultrera, Matteo; Bernardi, Adriana; Di Sipio, Eloisa
2016-04-01
The success and widespread diffusion of new sustainable technologies are always strictly related to their affordability. Nowadays the energy price fluctuations and the economic crisis are jeopardizing the development and diffusion of renewable technologies and sources. With the aim of both reduce the overall costs of shallow geothermal systems and improve their installation safety, an European project has took place recently, under the Horizon 2020 EU Framework Programme for Research and Innovation. The acronym of this project is Cheap-GSHPs, meaning "cheap and efficient application of reliable ground source heat exchangers and pumps"; the CHEAP-GSHPs project involves 17 partners among 9 European countries such Belgium, France, Germany, Greece, Ireland, Italy, Romania, Spain, Switzerland. In order to achieve the planned targets, an holistic approach is adopted, where all involved elements that take part of shallow geothermal activities are here integrated. In order to reduce the drilling specific costs and for a solid planning basis the INSPIRE-conformal ESDAC data set PAR-MAT-DOM ("parent material dominant") was analysed and reinterpreted regarding the opportunities for cost reductions. Different ESDAC classification codes were analysed lithologically and sedimentologically in order to receive the most suitable drilling technique within different formations. Together with drilling companies this geological data set was translated into a geotechnical map which allows drilling companies the usage of the most efficient drilling within a certain type of underground. The scale of the created map is 1: 100,000 for all over Europe. This leads to cost reductions for the final consumers. Further there will be the definition of different heat conductivity classes based on the reinterpreted PAR-MAT-DOM data set which will provide underground information. These values will be reached by sampling data all over Europe and literature data. The samples will be measured by several
Design of a Simple and Cheap Water Electrolyser for the Production of Solar Hydrogen
Directory of Open Access Journals (Sweden)
Ram Prasad
2009-06-01
Full Text Available Commercially available conventional alkaline electrolyser and advanced polymer membrane electrolysers for water electrolysis are quite expensive. Taking into account this aspect, a very simple and cheap water electrolyser has been designed and fabricated utilising easily available economical materials for small scale production of hydrogen using renewable energy from photovoltaic panel. The construction details of the electrolyser with a schematic drawing of the experimental set-up for PV production of H2 are given. In order to fabricate the compact electrolyser, two coaxial tubular PVC pipes were used. The lower part of the inner pipe has fine perforations for the transport of ions through electrolyte between the electrodes. Two cylindrical electrodes, cathode and anode are kept in inner and outer pipes respectively. The performance of hydrogen production was measured using a photovoltaic panel directly connected to the electrolyser under atmospheric pressure and in 27wt% KOH solution. Flow rates of hydrogen and oxygen were measured using a digital flow meter. High purity fuel cell grade hydrogen (99.98% and oxygen (99.85% have been produced. The experimental results confirm that the present electrolyser has eligible properties for hydrogen production in remote areas. No such electrolyser has been reported prior to this work. Copyright (c 2009 by BCREC. All rights reserved.[Received: 20 May 2009, Revised: 14 August 2009, Accepted: 19 August 2009][How to Cite: R. Prasad. (2009. Design of a Simple and Cheap Water Electrolyser for the Production of Solar Hydrogen. Bulletin of Chemical Reaction Engineering and Catalysis, 4(1: 10-15. doi:10.9767/bcrec.4.1.7113.10-15][How to Link/ DOI: http://dx.doi.org/10.9767/bcrec.4.1.7113.10-15 || or local: http://ejournal.undip.ac.id/index.php/bcrec/article/view/7113 ]
Design of a Simple and Cheap Water Electrolyser for the Production of Solar Hydrogen
Directory of Open Access Journals (Sweden)
R. Prasad
2009-06-01
Full Text Available Commercially available conventional alkaline electrolyser and advanced polymer membrane electrolysers for water electrolysis are quite expensive. Taking into account this aspect, a very simple and cheap water electrolyser has been designed and fabricated utilising easily available economical materials for small scale production of hydrogen using renewable energy from photovoltaic panel. The construction details of the electrolyser with a schematic drawing of the experimental set-up for PV production of H2 are given. In order to fabricate the compact electrolyser, two coaxial tubular PVC pipes were used. The lower part of the inner pipe has fine perforations for the transport of ions through electrolyte between the electrodes. Two cylindrical electrodes, cathode and anode are kept in inner and outer pipes respectively. The performance of hydrogen production was measured using a photovoltaic panel directly connected to the electrolyser under atmospheric pressure and in 27wt% KOH solution. Flow rates of hydrogen and oxygen were measured using a digital flow meter. High purity fuel cell grade hydrogen (99.98% and oxygen (99.85% have been produced. The experimental results confirm that the present electrolyser has eligible properties for hydrogen production in remote areas. No such electrolyser has been reported prior to this work. Copyright (c 2009 by BCREC. All rights reserved.[Received: 20 May 2009, Revised: 14 August 2009, Accepted: 19 August 2009][How to Cite: R. Prasad. (2009. Design of a Simple and Cheap Water Electrolyser for the Production of Solar Hydrogen. Bulletin of Chemical Reaction Engineering and Catalysis, 4(1: 10-15. doi:10.9767/bcrec.4.1.21.10-15][How to Link/ DOI: http://dx.doi.org/10.9767/bcrec.4.1.21.10-15
Tsartsali, Niki; Samanidou, Victoria F
2015-01-01
A quick, easy, cheap, effective, rugged, and safe (QuEChERS) dispersive extraction method is proposed herein for the isolation and cleanup of melamine and cyromazine from chicken egg yolk. Analytes are determined by high-performance liquid chromatography using photodiode array detector after separation on a LiChroCART® (250 × 4 mm)-LiChrospher® RP-8e, 5 μm analytical column using a mobile phase of 0.1% trifluoracetic acid and methanol (80:20 v/v) delivered isocratically at a flow rate of 1 mL/minute. Extraction of isolated compounds was achieved by methanol and acetonitrile mixture (1:1 v/v). Recovery rates ranged between 74.5% and 115.8%. The method was validated in terms of 657/2002/EC decision. The within-laboratory reproducibility, expressed as a relative standard deviation, was evaporation temperature, and vortex time.
Upgrading of citric acid production from cheap carbohydrate sources as affected by aspergillus
International Nuclear Information System (INIS)
Elbatal, A.I.; Khalaf, S.A.; Khalil, A.H.
1995-01-01
Five strains of aspergillus niger (EMCC 102, EMCC 104, EMCC 111, EMCC 132 and EMCC 147) were for citric acid production at different incubation period using different cheap carbohydrate substrates, such as beet, cane and citrus molasses and milk whey. A. niger EMCC 111 was found to be the most potent strain for citric acid production from beet molasses after 11 days of incubation at 30 degree. The studies concerning molasses concentration and nitrogen sources (inorganic and organic sources with different concentration, revealed that 30 g% beet molasses and ammonium sulfate with 0.05 g% as N 2 content, gave the highest production of citric acid. Gamma irradiated inocula of A. niger EMCC 111 at doses (0.05-0.8 KGy), showed that the dose 0.4 KGy was the optimum for maximum citric acid production. 8 tabs
The End of Cheap Oil: Economic, Social, and Political Change in the US and Former Soviet Union
Kaufmann, Robert
2014-01-01
I use the quality and quantity of energy flows to interpret economic, social, and political changes in the US and Former Soviet Union. The economic successes of both the former Soviet Union (FSU) and the US reflect an abundant supply of high quality energy. This abundance ended in the 1970s in the US and the 1980s in the Former Soviet Union. In the US, the end of cheap oil caused labor productivity to stagnate, which stopped on-going growth in wages and family incomes. To preserve the Ameri...
New trends in sample preparation techniques for environmental analysis.
Ribeiro, Cláudia; Ribeiro, Ana Rita; Maia, Alexandra S; Gonçalves, Virgínia M F; Tiritan, Maria Elizabeth
2014-01-01
Environmental samples include a wide variety of complex matrices, with low concentrations of analytes and presence of several interferences. Sample preparation is a critical step and the main source of uncertainties in the analysis of environmental samples, and it is usually laborious, high cost, time consuming, and polluting. In this context, there is increasing interest in developing faster, cost-effective, and environmentally friendly sample preparation techniques. Recently, new methods have been developed and optimized in order to miniaturize extraction steps, to reduce solvent consumption or become solventless, and to automate systems. This review attempts to present an overview of the fundamentals, procedure, and application of the most recently developed sample preparation techniques for the extraction, cleanup, and concentration of organic pollutants from environmental samples. These techniques include: solid phase microextraction, on-line solid phase extraction, microextraction by packed sorbent, dispersive liquid-liquid microextraction, and QuEChERS (Quick, Easy, Cheap, Effective, Rugged and Safe).
A rugged 650 V SOI-based high-voltage half-bridge IGBT gate driver IC for motor drive applications
Hua, Qing; Li, Zehong; Zhang, Bo; Chen, Weizhong; Huang, Xiangjun; Feng, Yuxiang
2015-05-01
This paper proposes a rugged high-voltage N-channel insulated gate bipolar transistor (IGBT) gate driver integrated circuit. The device integrates a high-side and a low-side output stages on a single chip, which is designed specifically for motor drive applications. High-voltage level shift technology enables the high-side stage of this device to operate up to 650 V. The logic inputs are complementary metal oxide semiconductor (CMOS)/transistor transistor logic compatible down to 3.3 V. Undervoltage protection functionality with hysteresis characteristic has also been integrated to enhance the device reliability. The device is fabricated in a 1.0 μm, 650 V high-voltage bipolar CMOS double-diffused metal oxide semiconductor (BCD) on silicon-on-insulator (SOI) process. Deep trench dielectric isolation technology is employed to provide complete electrical isolation with advantages such as reduced parasitic effects, excellent noise immunity and low leakage current. Experimental results show that the isolation voltage of this device can be up to approximately 779 V at 25°C, and the leakage current is only 5 nA at 650 V, which is 15% higher and 67% lower than the conventional ones. In addition, it delivers an excellent thermal stability and needs very low quiescent current and offers a high gate driver capability which is needed to adequately drive IGBTs that have large input capacitances.
Cerqueira, Maristela B R; Caldas, Sergiane S; Primel, Ednei G
2014-04-04
Recent studies have shown a decrease in the concentration of pesticides, pharmaceuticals and personal care products (PCPs) in water after treatment. A possible explanation for this phenomenon is that these compounds may adhere to the sludge; however, investigation of these compounds in drinking water treatment sludge has been scarce. The sludge generated by drinking water treatment plants during flocculation and decantation steps should get some special attention not only because it has been classified as non-inert waste but also because it is a very complex matrix, consisting essentially of inorganic (sand, argil and silt) and organic (humic substances) compounds. In the first step of this study, three QuEChERS methods were used, and then compared, for the extraction of pesticides (atrazine, simazine, clomazone and tebuconazole), pharmaceuticals (amitriptyline, caffeine, diclofenac and ibuprofen) and PCPs (methylparaben, propylparaben, triclocarban and bisphenol A) from drinking water treatment sludge. Afterwards, the study of different sorbents in the dispersive solid phase extraction (d-SPE) step was evaluated. Finally, a new QuEChERS method employing chitin, obtained from shrimp shell waste, was performed in the d-SPE step. After having been optimized, the method showed limits of quantification (LOQ) between 1 and 50 μg kg(-1) and the analytical curves showed r values higher than 0.98, when liquid chromatography tandem mass spectrometry was employed. Recoveries ranged between 50 and 120% with RSD≤15%. The matrix effect was evaluated and compensated with matrix-matched calibration. The method was applied to drinking water treatment sludge samples and methylparaben and tebuconazole were found in concentration
Bioinformatics: Cheap and robust method to explore biomaterial from Indonesia biodiversity
Widodo
2015-02-01
Indonesia has a huge amount of biodiversity, which may contain many biomaterials for pharmaceutical application. These resources potency should be explored to discover new drugs for human wealth. However, the bioactive screening using conventional methods is very expensive and time-consuming. Therefore, we developed a methodology for screening the potential of natural resources based on bioinformatics. The method is developed based on the fact that organisms in the same taxon will have similar genes, metabolism and secondary metabolites product. Then we employ bioinformatics to explore the potency of biomaterial from Indonesia biodiversity by comparing species with the well-known taxon containing the active compound through published paper or chemical database. Then we analyze drug-likeness, bioactivity and the target proteins of the active compound based on their molecular structure. The target protein was examined their interaction with other proteins in the cell to determine action mechanism of the active compounds in the cellular level, as well as to predict its side effects and toxicity. By using this method, we succeeded to screen anti-cancer, immunomodulators and anti-inflammation from Indonesia biodiversity. For example, we found anticancer from marine invertebrate by employing the method. The anti-cancer was explore based on the isolated compounds of marine invertebrate from published article and database, and then identified the protein target, followed by molecular pathway analysis. The data suggested that the active compound of the invertebrate able to kill cancer cell. Further, we collect and extract the active compound from the invertebrate, and then examined the activity on cancer cell (MCF7). The MTT result showed that the methanol extract of marine invertebrate was highly potent in killing MCF7 cells. Therefore, we concluded that bioinformatics is cheap and robust way to explore bioactive from Indonesia biodiversity for source of drug and another
Giacinti, Géraldine; Raynaud, Christine; Capblancq, Sophie; Simon, Valérie
2017-02-03
The sample matrix can enhance the gas chromatography signal of pesticide residues relative to that obtained with the same concentration of pesticide in solvent. This paper is related to negative matrix effects observed in coupled gas chromatography-mass spectrometry ion trap (GC/MS 2 ) quantification of pesticides in concentrated extracts of apple peel prepared by the Quick Easy Cheap Effective Rugged and Safe (QuEChERS) method. It is focused on the pesticides most frequently used on the apple varieties studied, throughout the crop cycle, right up to harvest, to combat pests and diseases and to improve fruit storage properties. Extracts from the fleshy receptacle (flesh), the epiderm (peel) and fruit of three apple varieties were studied by high-performance thin-layer chromatography hyphenated with UV-vis light detection (HPTLC/UV visible). The peel extracts had high concentrations of triterpenic acids (oleanolic and ursolic acids), reaching 25mgkg -1 , whereas these compounds were not detected in the flesh extracts (<0.05mgkg -1 ). A significant relationship has been found between the levels of these molecules and negative matrix effects in GC/MS 2 . The differences in the behavior of pesticides with respect to matrix effects can be accounted for by the physicochemical characteristics of the molecules (lone pairs, labile hydrogen, conjugation). The HPTLC/UV visible method developed here for the characterization of QuEChERS extracts acts as a complementary clean-up method, aimed to decrease the negative matrix effects of such extracts. Copyright © 2016 Elsevier B.V. All rights reserved.
Vrabec, Marko; Dolžan, Erazem
2016-04-01
The undergraduate field course in Geological Mapping at the University of Ljubljana involves 20-40 students per year, which precludes the use of specialized rugged digital field equipment as the costs would be way beyond the capabilities of the Department. A different mapping area is selected each year with the aim to provide typical conditions that a professional geologist might encounter when doing fieldwork in Slovenia, which includes rugged relief, dense tree cover, and moderately-well- to poorly-exposed bedrock due to vegetation and urbanization. It is therefore mandatory that the digital tools and workflows are combined with classical methods of fieldwork, since, for example, full-time precise GNSS positioning is not viable under such circumstances. Additionally, due to the prevailing combination of complex geological structure with generally poor exposure, students cannot be expected to produce line (vector) maps of geological contacts on the go, so there is no need for such functionality in hardware and software that we use in the field. Our workflow therefore still relies on paper base maps, but is strongly complemented with digital tools to provide robust positioning, track recording, and acquisition of various point-based data. Primary field hardware are students' Android-based smartphones and optionally tablets. For our purposes, the built-in GNSS chips provide adequate positioning precision most of the time, particularly if they are GLONASS-capable. We use Oruxmaps, a powerful free offline map viewer for the Android platform, which facilitates the use of custom-made geopositioned maps. For digital base maps, which we prepare in free Windows QGIS software, we use scanned topographic maps provided by the National Geodetic Authority, but also other maps such as aerial imagery, processed Digital Elevation Models, scans of existing geological maps, etc. Point data, like important outcrop locations or structural measurements, are entered into Oruxmaps as
Salvia, Marie-Virginie; Cren-Olivé, Cécile; Vulliet, Emmanuelle
2013-11-08
Numerous chemical products are dispersed in our environment. Many of them are recognized as harmful to humans and the ecosystem. Among these harmful substances are antibiotics and steroid hormones. Currently, very few data are available on the presence and fate of these substances in the environment, in particular for solid matrices, mainly due to a lack of analytical methodologies. Indeed, soil is a very complex matrix, and the nature and composition of the soil has a significant impact on the extraction efficiency and the sensitivity of the method. For this reason a statistical approach was performed to study the influence of soil parameters (clay, silt, sand and organic carbon percentages and cation exchange capacity (CEC)) on recoveries and matrix effects of various pharmaceuticals and steroids. Thus, an analysis of covariance (ANCOVA) was performed when several substances were analyzed simultaneously, whereas a Pearson correlation was used to study the compounds individually. To the best of our knowledge, this study is the first time such an experiment was performed. The results showed that clay and organic carbon percentages as well as the CEC have an impact on the recoveries of most of the target substances, the variables being anti-correlated. This result suggests that the compounds are trapped in soils with high levels of clay and organic carbon and a high CEC. For the matrix effects, it was shown that the organic carbon content has a significant effect on steroid hormones and penicillin G matrix effects (positive correlation). Finally, interaction effects (first order) were evaluated. This latter point corresponds to the crossed effects that occur between explanatory variables (soil parameters). Indeed, the value taken by an explanatory variable can have an influence on the effect that another explanatory variable has on a dependent variable. For instance, it was shown that some parameters (silt, sand) have an impact on the effect that clay content has on
Ma, Guicen; Zhang, Minglu; Zhu, Li; Chen, Hongping; Liu, Xin; Lu, Chengyin
2018-01-05
Amine-functional reduced graphene oxide (amine-rGO) with different carbon chain length amino groups were successfully synthesized. The graphene oxides (GO) reduction as well as amino grafting were achieved simultaneously in one step via a facile solvothermal synthetic strategy. The obtained materials were characterized by X-ray diffraction, Raman spectroscopy, Fourier-transform infrared spectrometry and X-ray photoelectron spectroscopy to confirm the modification of GO with different amino groups. The adsorption performance of catechins and caffeine from tea acetonitrile extracts on different amine functional rGO samples were evaluated. It was found that tributylamine-functional rGO (tri-BuA-rGO) exhibited the highest adsorption ability for catechins and caffeine compared to GO and other amino group functional rGO samples. It was worth to note that the adsorption capacity of catechins on tri-BuA-rGO was 11 times higher than that of GO (203.7mgg -1 vs 18.7mgg -1 ). Electrostatic interaction, π-π interaction and surface hydrophilic-hydrophobic properties of tri-BuA-rGO played important roles in the adsorption of catechins as well as caffeine. The gravimetric analysis confirmed that the tri-BuA-rGO achieved the highest efficient cleanup preformance compared with traditional dispersive solid phase extraction (dSPE) adsorbents like primary-secondary amine (PSA), graphitized carbon black (GCB) or C18. A multi-pesticides analysis method based on tri-BuA-rGO is validated on 33 representative pesticides in tea using gas chromatography coupled to tandem mass spectrometry or high-performance liquid chromatography coupled with tandem mass spectrometry. The analysis method gave a high coefficient of determination (r 2 >0.99) for each pesticide and satisfactory recoveries in a range of 72.1-120.5%. Our study demonstrated that amine functional rGO as a new type of QuEChERS adsorbent is expected to be widely applied for analysis of pesticides at trace levels. Copyright © 2017 Elsevier B.V. All rights reserved.
Worldwide cheap and heavy oil productions: A long-term energy model
International Nuclear Information System (INIS)
Guseo, Renato
2011-01-01
Crude oil, natural gas liquids, heavy oils, deepwater oils, and polar oils are non-renewable energy resources with increasing extraction costs. Two major definitions emerge: regular or 'cheap' oil and non-conventional or 'heavy' oil. Peaking time in conventional oil production has been a recent focus of debate. For two decades, non-conventional oils have been mixed with regular crude oil. Peaking time estimation and the rate at which production may be expected to decline, following the peak, are more difficult to determine. We propose a two-wave model for world oil production pattern and forecasting, based on the diffusion of innovation theories: a sequential multi-Bass model. Historical well-known shocks are confirmed, and new peaking times for crude oil and mixed oil are determined with corresponding depletion rates. In the final section, possible ties between the dynamics of oil extraction and refining capacities are discussed as a predictive symptom of an imminent mixed oil peak in 2016. - Highlights: → Production of conventional and non-conventional oils in aggregate time series. → Decomposition modelling and forecasting with a multi-regime model. → Diffusion of innovation theories and appropriateness of applying Bass concepts to the extraction of oil resources. → Partially overlapping oil extraction processes. → Refining capacities and dynamics of oil extraction.
Li, Hui; Jiang, Zejun; Cao, Xiaolin; Su, Hang; Shao, Hua; Jin, Fen; Abd El-Aty, A M; Wang, Jing
2017-12-15
Herein, an accurate and reliable isotope-labelled internal standard method was developed and validated for simultaneous determination of three polar pesticide adjuvants, namely 2-pyrrolidone, N-methyl-2-pyrrolidone, and N-ethyl-2-pyrrolidone in plant-derived agro-products. Matrices, including apple, cabbage, tomato, cucumber, rice, and wheat were extracted with a modified quick, easy, cheap, effective, rugged, and safe "QuEChERS" method and purified with a new clean-up sorbent (Z-Sep). A hydrophilic interaction liquid chromatography column (HILIC), exhibiting a lipophilic-hydrophilic character, was used to separate the three analytes over 10min using liquid chromatography-tandem mass spectrometry (LC-MS/MS). Matrix effects in various matrices were evaluated and an isotope-labelled internal standard method was employed to compensate for ion enhancement/suppression effects. At three fortification levels (2.0, 5.0, and 20.0μg/kg), the mean recoveries ranged from 78.5 to 112.1% with relative standard deviations (RSDs)determination of the three tested pesticide adjuvant residues in agro-products of plant origin. Copyright © 2017 Elsevier B.V. All rights reserved.
Tiryaki, Osman
2016-10-02
This study was undertaken to validate the "quick, easy, cheap, effective, rugged and safe" (QuEChERS) method using Golden Delicious and Starking Delicious apple matrices spiked at 0.1 maximum residue limit (MRL), 1.0 MRL and 10 MRL levels of the four pesticides (chlorpyrifos, dimethoate, indoxacarb and imidacloprid). For the extraction and cleanup, original QuEChERS method was followed, then the samples were subjected to liquid chromatography-triple quadrupole mass spectrometry (LC-MS/MS) for chromatographic analyses. According to t test, matrix effect was not significant for chlorpyrifos in both sample matrices, but it was significant for dimethoate, indoxacarb and imidacloprid in both sample matrices. Thus, matrix-matched calibration (MC) was used to compensate matrix effect and quantifications were carried out by using MC. The overall recovery of the method was 90.15% with a relative standard deviation of 13.27% (n = 330). Estimated method detection limit of analytes blew the MRLs. Some other parameters of the method validation, such as recovery, precision, accuracy and linearity were found to be within the required ranges.
Singh, Shiv; Srivastava, Anshuman; Singh, Sheelendra Pratap
2018-03-01
Phenolic resin based activated carbon fibers (ACFs) were applied for the first time as a reversed-dispersive solid-phase extraction (r-DSPE) sorbent. A modified quick, easy, cheap, effective, rugged, and safe (QuEChERS) method was applied to determine 26 pesticides (organophosphates, organochlorines, synthetic pyrethroids, and herbicides) in different complex matrices, including cauliflower, cucumber, banana, apple, wheat, and black gram. Different physicochemical characterization techniques were used to investigate the engineering and structural properties of the r-DSPE sorbent. All the chromatographic analyses were performed with a gas chromatograph equipped with an electron capture detector. The recoveries of all 26 pesticides were acceptable (70-120%), with relative standard deviations of less than 15%. The limit of detection and the limit of quantification were 1.13-5.48 ng/g and 3.42-16.60 ng/g, respectively. In the original QuEChERS method, primary secondary amine is extensively used as the r-DSPE sorbent in the cleanup process, but it is eightfold more expensive than the ACFs used in this study. Therefore, the modified QuEChERS method using ACFs during the cleanup process is more efficient, cheaper, and more robust to determine pesticides from different types of matrices, including vegetables, grains, and fruits, and ACFs could be used as a cost-effective alternative to primary secondary amine. Graphical Abstract Sample clean-up using PSA and ACF as r-DSPE sorbent in QuEChERS method.
DEFF Research Database (Denmark)
Nielsen, Kristian Fog; Ngemela, Archard Ferdinand; Jensen, Lene Bai
2015-01-01
A method was developed for simultaneous determination of the mycotoxins: ochratoxin A (OTA) and fumonisins B2 (FB2), B4 (FB4), and B6 (FB6) in green, roasted, and instant coffee. Extraction was performed by QuEChERS (quick, easy, cheap, effective, rugged, and safe) under acidic conditions followed....../kg and the highest with 21 μg/kg. None of the 25 instant coffee samples contained OTA above the EU regulatory level of 10 μg/kg. Nonetheless, the toxin could be detected in 56% of the analyzed instant coffee samples. Fumonisins were not detected in any of the roasted or instant coffee samples (n = 82). However......, in the green coffee samples (n = 18) almost half of the samples were positive with a maximum value of 164 μg/kg (sum of FB2, FB4, and FB6). This discrepancy between green coffee and processed coffees indicated that the fumonisins decompose during the roasting process, which was confirmed in roasting...
Review of sample preparation techniques for the analysis of pesticide residues in soil.
Tadeo, José L; Pérez, Rosa Ana; Albero, Beatriz; García-Valcárcel, Ana I; Sánchez-Brunete, Consuelo
2012-01-01
This paper reviews the sample preparation techniques used for the analysis of pesticides in soil. The present status and recent advances made during the last 5 years in these methods are discussed. The analysis of pesticide residues in soil requires the extraction of analytes from this matrix, followed by a cleanup procedure, when necessary, prior to their instrumental determination. The optimization of sample preparation is a very important part of the method development that can reduce the analysis time, the amount of solvent, and the size of samples. This review considers all aspects of sample preparation, including extraction and cleanup. Classical extraction techniques, such as shaking, Soxhlet, and ultrasonic-assisted extraction, and modern techniques like pressurized liquid extraction, microwave-assisted extraction, solid-phase microextraction and QuEChERS (Quick, Easy, Cheap, Effective, Rugged, and Safe) are reviewed. The different cleanup strategies applied for the purification of soil extracts are also discussed. In addition, the application of these techniques to environmental studies is considered.
Pang, Nannan; Wang, Tielong; Hu, Jiye
2016-01-01
A versatile liquid chromatography tandem mass spectrometry method with modified QuEChERS (quick, easy, cheap, effective, rugged, and safe) sample preparation was developed for the determination of rimsulfuron, mesotrione, fluroxypyr-meptyl, and fluroxypyr. By adjusting the amount of graphitized carbon black, the herbicide analytes could be quantified with satisfactory recoveries in the range of 80-110%. A dissipation kinetics study conducted under open field conditions at two sites during 2014 showed first order equations with half-lives between 0.6d and 3.6d, illustrating an appropriate degree of stability and safety. The dissipation kinetics were different in the different matrices. Although the herbicides had higher initial residues in straw than those in soil, they degraded faster in straw. The terminal residues for the herbicides formulated in two water dispersible granules were all below maximum residue limits. These results not only gave insights about the analytes but also contributed to environmental protection and food safety. Copyright © 2015 Elsevier Ltd. All rights reserved.
Determination of bromothalonil residues and degradation in apple and soil by QuEChERS and GC-MS/MS.
Liu, Huijun; Guo, Baoyuan; Wang, Huili; Li, Jianzhong; Zheng, Lin
2014-04-01
The dissipation and residues of bromothalonil in apple and soil under field condition were analyzed by QuEChERS (quick, easy, cheap, effective, rugged and safe) combined with gas chromatography-mass spectrometer method. The recoveries were ranged from 80.8 % to 106 % with coefficient variation for repeatability ranged from 3.08 % to 7.09 % at fortification levels of 0.02, 0.04 and 0.2 mg/kg in apple and soil. The limit of quantification of the method was 0.31 μg/kg. The dissipation rates of bromothalonil followed the first-order kinetics and the half-lives were from 3.61 to 3.98 days in apple and from 4.65 to 9.29 days in soil. In apple, the terminal residues of bromothalonil were below the China maximum residue limit (0.2 mg/kg) after 7 days of application. This work contributed to provide the basic information for a safe usage of bromothalonil in apple orchard and preventing health problem from consumers in China.
Sun, Juan; Li, Weixi; Zhang, Yan; Hu, Xuexu; Wu, Li; Wang, Bujun
2016-01-01
A method based on the QuEChERS (quick, easy, cheap, effective, rugged, and safe) purification combined with ultrahigh performance liquid chromatography tandem mass spectrometry (UPLC–MS/MS), was optimized for the simultaneous quantification of 25 mycotoxins in cereals. Samples were extracted with a solution containing 80% acetonitrile and 0.1% formic acid, and purified with QuEChERS before being separated by a C18 column. The mass spectrometry was conducted by using positive electrospray ionization (ESI+) and multiple reaction monitoring (MRM) models. The method gave good linear relations with regression coefficients ranging from 0.9950 to 0.9999. The detection limits ranged from 0.03 to 15.0 µg·kg−1, and the average recovery at three different concentrations ranged from 60.2% to 115.8%, with relative standard deviations (RSD%) varying from 0.7% to 19.6% for the 25 mycotoxins. The method is simple, rapid, accurate, and an improvement compared with the existing methods published so far. PMID:27983693
Sun, Caixia; Cang, Tao; Wang, Zhiwei; Wang, Xinquan; Yu, Ruixian; Wang, Qiang; Zhao, Xueping
2015-05-01
The health risk to humans of pesticide application on minor crops, such as strawberry, requires quantification. Here, the dissipation and residual levels of three fungicides (pyraclostrobin, myclobutanil, and difenoconazole) were studied for strawberry under greenhouse conditions using high-performance liquid chromatography (HPLC)-tandem mass spectrometry after Quick, Easy, Cheap, Effective, Rugged, and Safe extraction. This method was validated using blank samples, with all mean recoveries of these three fungicides exceeding 80%. The residues of all three fungicides dissipated following first-order kinetics. The half-lives of pyraclostrobin, myclobutanil, and difenoconazole were 1.69, 3.30, and 3.65 days following one time application and 1.73, 5.78, and 6.30 days following two times applications, respectively. Fungicide residue was determined by comparing the estimated daily intake of the three fungicides against the acceptable daily intake. The results indicate that the potential health risk of the three fungicides was not significant in strawberry when following good agricultural practices (GAP) under greenhouse conditions.
Park, Ki Hun; Choi, Jeong-Heui; Abd El-Aty, A M; Cho, Soon-Kil; Park, Jong-Hyouk; Kwon, Ki Sung; Park, Hee Ra; Kim, Hyung Soo; Shin, Ho-Chul; Kim, Mi Ra; Shim, Jae-Han
2012-12-01
A rapid, specific, and sensitive method based on liquid chromatography-electrospray ionization tandem mass spectrometry (LC-ESI-MS/MS) in the positive ion mode using multiple reaction monitoring (MRM) was developed and validated to quantify flumethasone residues in beef muscle. Methods were compared between the original as well as the EN quick, easy, cheap, effective, rugged, and safe (QuEChERS)-based extraction. Good linearity was achieved at concentration levels of 5-30 μg/kg. Estimated recovery rates at spiking levels of 5 and 10 μg/kg ranged from 72.1 to 84.6%, with relative standard deviations (RSDs)noise ratios (S/Ns) of 3 and 10, respectively. The method was successfully applied to analyze real samples obtained from large markets throughout the Korean Peninsula. The method proved to be sensitive and reliable and, thus, rendered an appropriate means for residue analysis studies. Copyright © 2012 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Daniel J Kvitek
2011-04-01
Full Text Available The fitness landscape captures the relationship between genotype and evolutionary fitness and is a pervasive metaphor used to describe the possible evolutionary trajectories of adaptation. However, little is known about the actual shape of fitness landscapes, including whether valleys of low fitness create local fitness optima, acting as barriers to adaptive change. Here we provide evidence of a rugged molecular fitness landscape arising during an evolution experiment in an asexual population of Saccharomyces cerevisiae. We identify the mutations that arose during the evolution using whole-genome sequencing and use competitive fitness assays to describe the mutations individually responsible for adaptation. In addition, we find that a fitness valley between two adaptive mutations in the genes MTH1 and HXT6/HXT7 is caused by reciprocal sign epistasis, where the fitness cost of the double mutant prohibits the two mutations from being selected in the same genetic background. The constraint enforced by reciprocal sign epistasis causes the mutations to remain mutually exclusive during the experiment, even though adaptive mutations in these two genes occur several times in independent lineages during the experiment. Our results show that epistasis plays a key role during adaptation and that inter-genic interactions can act as barriers between adaptive solutions. These results also provide a new interpretation on the classic Dobzhansky-Muller model of reproductive isolation and display some surprising parallels with mutations in genes often associated with tumors.
Pyrethroid insecticides are used extensively in agriculture and they, as well as their environmental degradates, may remain as residues on food products such as fruits and vegetables. Since pyrethroid degradates can be identical to the urinary markers used in human biomonitoring ...
Andrade, G C R M; Monteiro, S H; Francisco, J G; Figueiredo, L A; Botelho, R G; Tornisielo, V L
2015-05-15
A quick and sensitive liquid chromatography-electrospray ionization tandem mass spectrometry method, using dynamic multiple reaction monitoring and a 1.8-μm particle size analytical column, was developed to determine 57 pesticides in tomato in a 13-min run. QuEChERS (quick, easy, cheap, effective, rugged, and safe) method for samples preparations and validations was carried out in compliance with EU SANCO guidelines. The method was applied to 58 tomato samples. More than 84% of the compounds investigated showed limits of detection equal to or lower than 5 mg kg(-1). A mild (50%) matrix effect was observed for 72%, 25%, and 3% of the pesticides studied, respectively. Eighty-one percent of the pesticides showed recoveries ranging between 70% and 120%. Twelve pesticides were detected in 35 samples, all below the maximum residue levels permitted in the Brazilian legislation; 15 samples exceeded the maximum residue levels established by the EU legislation for methamidophos; and 10 exceeded limits for acephate and four for bromuconazole. Copyright © 2014 Elsevier Ltd. All rights reserved.
Combination of QuEChERS and DLLME for GC-MS determination of pesticide residues in orange samples.
Andraščíková, Mária; Hrouzková, Svetlana; Cunha, Sara C
2013-01-01
A new method combining QuEChERS (quick, easy, cheap, effective, rugged and safe) and DLLME (dispersive liquid-liquid microextraction) followed by gas chromatography-mass spectrometry with selected ion monitoring (SIM) was developed for the simultaneous determination of 19 pesticides from nine chemical groups exhibiting or suspected to exhibit endocrine-disrupting properties in orange samples. Acetonitrile extract obtained from QuEChERS extraction was used for DLLME as dispersive solvent and carbon tetrachloride as extractive solvent to increase the enrichment factor of the extraction procedure. The effect of several extraction parameters, such as volume extract achieved by the QuEChERS method and subsequently used for DLLME, selection of extractive solvent and its volume, was tested. Under optimum conditions, good linearity, satisfactory recoveries and repeatability were obtained. Limits of quantification (LOQs) achieved (ranging from 0.02 to 47 ng/g) were below the maximum residue limits established by the European Union. The proposed method was applied to the monitoring of pesticide residue levels in oranges commercialised in Portugal.
Matrix-Matching as an Improvement Strategy for the Detection of Pesticide Residues.
Giacinti, Géraldine; Raynaud, Christine; Capblancq, Sophie; Simon, Valérie
2016-05-01
More than 90% of the pesticides residues in apples are located in the peel. We developed a gas chromatography/ion trap tandem mass spectrometry method for investigating all detectable residues in the peel of 3 apple varieties. Sample preparation is based on the use of the Quick Easy Cheap Effective Rugged and Safe method on the whole fruit, the flesh, and the peel. Pesticide residues were quantified with solvent-matched and matrix-matched standards, by spiking apple sample extracts. Matrix effects dependent on the type of extract (fruit, flesh, or peel) and the apple variety were detected. The best data processing methods involved normalizing matrix effect rates by matrix-matched internal/external calibration. Boscalid, captan, chlorpyrifos, fludioxonil, and pyraclostrobin were the most frequently detected pesticides. However, their concentrations in the whole fruit were below European maximum residue levels. Despite negative matrix effects, the residues in peel were detected at concentrations up to 10 times higher than those in whole fruits. Consequently, other pesticide residues present at concentrations below the limit of quantification in the whole fruit were detected in the peel. © 2016 Institute of Food Technologists®
Directory of Open Access Journals (Sweden)
Shashank Yeshwant Kothari
2017-05-01
Full Text Available BACKGROUND Removal of a part of a limb through one or more bones termed amputation is done for various causes. Properly performed amputation is a reconstructive procedure. Effective postoperative rehabilitation reduces disability and helps in proper shaping of the residual limb leading to final prosthetic fitment. The aim of the study is to compare effect of rigid dressing and Immediate Postoperative Prosthesis (IPOP using a simple and cheap pylon developed by the first author with soft dressing in respect of stump maturation and function in lower limb amputees. MATERIALS AND METHODS Fifty one patients with lower limb amputations were included in the study and randomised into two groups. Twenty four patients completed follow-up in the study group of rigid dressing with early postoperative prosthetic fitting while twenty patients completed with soft dressing. Stump maturation as measured by girth and volumetric assessment and complications of residual pain and phantom pain were compared at six weeks and twelve weeks with baseline data. Statistical Analysis- Done with SPSS for Windows version 17. Independent-T test was used for comparison of continuous variables and Chi-square and Fischer exact test was used for comparison of dichotomous responses. Settings and Design- The study was done in a multispecialty teaching hospital of a metro city. It was a well-structured comparative study done after addressing all safety and ethical issues. RESULTS Stump maturation was significantly better and the stump complications reduced in the study group. CONCLUSION Rigid dressing with IPOP has proven to be significantly superior to soft dressing in terms of maturation of stump and residual complications in lower limb amputations.
Cu{sub 2}O/TiO{sub 2} heterostructures on a DVD as easy&cheap photoelectrochemical sensors
Energy Technology Data Exchange (ETDEWEB)
Zanatta, Michele; Calvillo, Laura; Zheng, Jian; Rizzi, Gian Andrea, E-mail: gianandrea.rizzi@unipd.it; Durante, Christian; Giallongo, Giuseppe; Chirkov, Dymitrov; Colazzo, Luciano; Marega, Carla; Gennaro, Armando; Granozzi, Gaetano
2016-03-31
Cu{sub 2}O nanoparticles have been grown by pulse-electrochemical deposition on a Digital Versatile Disk (DVD) which acts as a nanostructured electrode. Prior to Cu{sub 2}O deposition, the silver-coated rectangular-shaped grooves of the disassembled DVD were coated with a TiO{sub 2} thin film by a modified sol–gel method, where oxalic acid is used in place of the usual mineral acids to peptize the precipitated hydrous titania formed from the hydrolysis of titanium iso-propoxide. This procedure leaves no inorganic residues after UV-curing, resulting in a high quality film, mainly composed of TiO{sub 2}-anatase. As demonstrated by Atomic Force Microscopy (AFM) measurements, the DVD grooves are filled by a 120–130 nm thick TiO{sub 2} film, while the thickness of the TiO{sub 2} deposit on the crests is only ca. 50 nm. This inhomogeneous thickness leads to an inhomogeneous electric field when the DVD is used as an electrode for depositing Cu{sub 2}O nanoparticles, which eventually leads to the growth of Cu{sub 2}O nanoparticles only on the DVD crests. A highly regular and reproducible Cu{sub 2}O/TiO{sub 2} stripe-like heterostructure is obtained where both semiconducting oxides are aside. This system has been characterized by Scanning Electron Microscopy (SEM), Atomic Force Microscopy (AFM), X-ray photoemission spectroscopy (XPS), Diffuse Reflectance Infrared Fourier Transform (DRIFT) spectroscopy, Raman spectroscopy and photocurrent measurements. A possible use of this easy&cheap electrode as a visible light responsive sensor to water soluble organics in basic solution is suggested. - Highlights: • A commercial DVD is recycled to prepare cheap photo-electrochemical sensors. • The sensing elements are Cu{sub 2}O nanostripes grown on a nanostructured TiO{sub 2} thin film obtained at room temperature. • Water soluble organics can be detected by dissolved O{sub 2} activation with visible light.
Directory of Open Access Journals (Sweden)
Aaron A Rowe
Full Text Available Although potentiostats are the foundation of modern electrochemical research, they have seen relatively little application in resource poor settings, such as undergraduate laboratory courses and the developing world. One reason for the low penetration of potentiostats is their cost, as even the least expensive commercially available laboratory potentiostats sell for more than one thousand dollars. An inexpensive electrochemical workstation could thus prove useful in educational labs, and increase access to electrochemistry-based analytical techniques for food, drug and environmental monitoring. With these motivations in mind, we describe here the CheapStat, an inexpensive (<$80, open-source (software and hardware, hand-held potentiostat that can be constructed by anyone who is proficient at assembling circuits. This device supports a number of potential waveforms necessary to perform cyclic, square wave, linear sweep and anodic stripping voltammetry. As we demonstrate, it is suitable for a wide range of applications ranging from food- and drug-quality testing to environmental monitoring, rapid DNA detection, and educational exercises. The device's schematics, parts lists, circuit board layout files, sample experiments, and detailed assembly instructions are available in the supporting information and are released under an open hardware license.
How cheap is soaring flight in raptors? A preliminary investigation in freely-flying vultures.
Duriez, Olivier; Kato, Akiko; Tromp, Clara; Dell'Omo, Giacomo; Vyssotski, Alexei L; Sarrazin, François; Ropert-Coudert, Yan
2014-01-01
Measuring the costs of soaring, gliding and flapping flight in raptors is challenging, but essential for understanding their ecology. Among raptors, vultures are scavengers that have evolved highly efficient soaring-gliding flight techniques to minimize energy costs to find unpredictable food resources. Using electrocardiogram, GPS and accelerometer bio-loggers, we report the heart rate (HR) of captive griffon vultures (Gyps fulvus and G. himalayensis) trained for freely-flying. HR increased three-fold at take-off (characterized by prolonged flapping flight) and landing (>300 beats-per-minute, (bpm)) compared to baseline levels (80-100 bpm). However, within 10 minutes after the initial flapping phase, HR in soaring/gliding flight dropped to values similar to baseline levels, i.e. slightly lower than theoretically expected. However, the extremely rapid decrease in HR was unexpected, when compared with other marine gliders, such as albatrosses. Weather conditions influenced flight performance and HR was noticeably higher during cloudy compared to sunny conditions when prolonged soaring flight is made easier by thermal ascending air currents. Soaring as a cheap locomotory mode is a crucial adaptation for vultures who spend so long on the wing for wide-ranging movements to find food.
International Nuclear Information System (INIS)
Bonanno, A; Sapia, P; Bozzo, G
2017-01-01
In this work, we present a coherent sequence of experiments on electromagnetic (EM) induction and eddy currents, appropriate for university undergraduate students, based on a magnet falling through a drilled aluminum disk. The sequence, leveraging on the didactical interplay between the EM and mechanical aspects of the experiments, allows us to exploit the students’ awareness of mechanics to elicit their comprehension of EM phenomena. The proposed experiments feature two kinds of measurements: (i) kinematic measurements (performed by means of high-speed video analysis) give information on the system’s kinematics and, via appropriate numerical data processing, allow us to get dynamic information, in particular on energy dissipation; (ii) induced electromagnetic field (EMF) measurements (by using a homemade multi-coil sensor connected to a cheap data acquisition system) allow us to quantitatively determine the inductive effects of the moving magnet on its neighborhood. The comparison between experimental results and the predictions from an appropriate theoretical model (of the dissipative coupling between the moving magnet and the conducting disk) offers many educational hints on relevant topics related to EM induction, such as Maxwell’s displacement current, magnetic field flux variation, and the conceptual link between induced EMF and induced currents. Moreover, the didactical activity gives students the opportunity to be trained in video analysis, data acquisition and numerical data processing. (paper)
Amar, Natalie; Peretz, Avi; Gerchman, Yoram
2017-02-01
Helicobacter pylori is the most frequent and persistent bacterial infection worldwide, and a risk factor for active gastritis, peptic ulcers, mucosa-associated lymphoid tissue lymphoma, and gastric cancer. Although combined antibiotics treatment is effective cases of antibiotic resistance are reported at an alarming rate. The H. pylori urease enzyme is essential for the bacteria establishment in the gastric mucosa, resulting urease inhibitors being sought after as effective and specific anti- H. pylori treatment. To-date, screening assays are based mostly on the analog plant urease enzyme but difference in properties of the plant and bacterial enzymes hamper these efforts. We have developed a screening assay based on recombinant Escherichia coli expressing native H. pylori urease, and validated this assay using thiourea and a methanolic extract of Pistacia atlantica. The assay demonstrated the thiourea and the extract to be potent urease inhibitors, with the extract having strong bacteriostatic activity against clinical isolates of H. pylori, including such with antibiotic resistance. The extract was also found to be neutral toward common probiotic bacteria, supporting its specificity and compatibility with digestive system desired microflora and suggesting it could be a good source for anti-H. pylori compounds. The assay has proven to be cheap, simple and native alternative to the plant enzyme based assay and could allow for high throughput screening for new urease inhibitors and could expedite screening and development of novel, better H. pylori remedies helping us to combat this infection. Copyright © 2016 Elsevier B.V. All rights reserved.
Directory of Open Access Journals (Sweden)
Marilda Chiarello
Full Text Available In present times, the Brazil is in the middle of the largest pesticide consumers worldwide, which demands proper control of environmental contamination. This study evaluated herbicides, acaricide, insecticides and fungicides in water and sediment carried-out from Lageado Tacongava hydrographic basin, Rio Grande do Sul, Brazil. For analysis, a QuEChERS (Quick, Easy, Cheap, Effective, Rugged and Safe, and/or SPE (Solid-Phase Extraction using HPLC (High Performance Liquid Chromatography with MS (Mass Detector was optimized. As result, the Linearity R2 > 0.99; Recuperation between 78 a 117%; and RSD < 20% for the 70 compounds simultaneously analyzed. The Acetamiprid, Azoxystrobin, Bendiocarb, Fenamidone, metribuzin, Pendimethalin, pyridaben, Thiophanate-methyl and Truflumizole found in water, and Acetamiprid, Azoxystrobin, Bendiocarb, boscalid and thiophanate-methyl in sediment, at concentrations from 0.1 µg kg-1 to 39.6 µg kg-1. Standard of pesticide residues in water and sediment studies are needed to evaluate such contamination. Regional samplings standard, as was done here, will be useful in a future water resources contamination mapping.
Malhat, Farag; Boulangé, Julien; Abdelraheem, Ehab; Abd Allah, Osama; Abd El-Hamid, Rania; Abd El-Salam, Shokr
2017-08-15
A simple and rapid gas chromatography with flame photometric detector (GC-FPD) determination method was developed to detect residue levels and investigate the dissipation pattern and safe use of fenitrothion in tomatoes. A modified quick, easy, cheap, effective, rugged, and safe (QuEChERS) using an ethyl acetate-based extraction, followed by a dispersive solid-phase extraction (d-SPE) with primary-secondary amine (PSA) and graphite carbon black (GCB) for clean up, was applied prior to GC-FPD analysis. The method showed satisfactory linearity, recovery and precision. The limits of detection (LOD) and quantification (LOQ) were 0.005 and 0.01mg/kg, respectively. The residue levels of fenitrothion were best described by first order kinetics with a half-life of 2.2days in tomatoes. The potential health risks posed by fenitrothion were not significant, based on supervised residue trial data. The current findings could provide guidance for safe and reasonable use of fenitrothion in tomatoes and prevent health problems to consumers. Copyright © 2017 Elsevier Ltd. All rights reserved.
Murillo Pulgarín, José A; García Bermejo, Luisa F; Durán, Armando Carrasquero
2018-03-07
High-performance liquid chromatography (HPLC) was used to separate oxamyl from other pesticides in drinking water and tomato paste. The eluate emerging from the column tail was mixed with an alkaline solution of Co 2+ in EDTA and irradiated with UV light to induce photolysis of the carbamate in order to obtain free radicals and other reactive species that oxidize luminol and produce chemiluminescence (CL) as a result. The intensity of the CL signal was monitored in the form of chromatographic peaks. Under the optimum operating conditions for the HPLC-UV-CL system, the analyte concentration was linearly related to peak area. The limit of detection as determined in accordance with the IUPAC criterion was 0.17 mg L -1 . Oxamyl was successfully extracted with recoveries of 88.7-103.1% from spiked tomato paste by using a simple QuEChERS (Quick, Easy, Cheap, Effective, Rugged, and Safe) sample preparation approach. Similar recoveries were obtained from drinking water samples spiked with oxamyl concentrations above the LOD. The proposed method is a simple, fast, accurate choice for quantifying this pesticide.
Fernandes, Virginia C; Domingues, Valentina F; Mateus, Nuno; Delerue-Matos, Cristina
2011-07-27
A rapid, specific, and sensitive method based on the Quick Easy Cheap Effective Rugged and Safe (QuEChERS) method and a cleanup using dispersive solid-phase extraction with MgSO(4), PSA, and C18 sorbents has been developed for the routine analysis of 14 pesticides in strawberries. The analyses were performed by three different analytical methodologies: gas chromatography (GC) with electron capture detection (ECD), mass spectrometry (MS), and tandem mass spectrometry (MS/MS). The recoveries for all the pesticides studied were from 46 to 128%, with relative standard deviation of residue limits (MRL) accepted in Portugal for organochlorine pesticides (OCP). A survey study of strawberries produced in Portugal in the years 2009-2010 obtained from organic farming (OF) and integrated pest management (IPM) was developed. Lindane and β-endosulfan were detected above the MRL in OF and IPM. Other OCP (aldrin, o,p'-DDT and their metabolites, and methoxychlor) were found below the MRL. The OCP residues detected decreased from 2009 to 2010. The QuEChERS method was successfully applied to the analysis of strawberry samples.
Dissipation, transfer and safety evaluation of emamectin benzoate in tea.
Zhou, Li; Luo, Fengjian; Zhang, Xinzhong; Jiang, Yaping; Lou, Zhengyun; Chen, Zongmao
2016-07-01
The dissipation and residue of emamectin benzoate in tea leaves and the residue transfer from tea leaves to tea brew were investigated by modified QuEChERS (quick, easy, cheap, effective, rugged and safe) combined with ultra performance liquid chromatography tandem mass (UPLC-MS/MS). The average recoveries ranged 85.3-101.3% with relative standard deviation (RSD) less than 15%. The limits of quantification (LOQ) were 0.005mgkg(-1) in tea leaves and 0.0004mgL(-1) in brew. Emamectin benzoate dissipated rapidly in tea with half-life (t1/2) of 1.0-1.3days. The terminal residues of emamectin benzoate were less than 0.062mgkg(-1). The leaching rate of emamectin benzoate from freshly-made tea to brew was emamectin benzoate at the recommended dosage was negligible to humans depending on risk quotient (RQ) value, that was lower than 1 significantly. This study could provide guidance for the safe use of emamectin benzoate and serve as a reference for the establishment of maximum residue limits (MRLs) in China. Copyright © 2016. Published by Elsevier Ltd.
Pyrethroid insecticides are used extensively in agriculture, and they, as well as their environmental degradates, may remain as residues on foods such as fruits and vegetables. Since pyrethroid degradates can be identical to the urinary markers used in human biomonitoring, it is ...
Andújar Márquez, José Manuel; Martínez Bohórquez, Miguel Ángel; Gómez Melgar, Sergio
2017-09-03
This paper deals with the thermal transmittance measurement focused on buildings and specifically in building energy retrofitting. Today, if many thermal transmittance measurements in a short time are needed, the current devices, based on the measurement of the heat flow through the wall, cannot carry out them, except if a great amount of devices are used at once along with intensive and tedious post-processing and analysis work. In this paper, from well-known physical laws, authors develop a methodology based on three temperatures measurements, which is implemented by a novel thermal transmittance metre. The paper shows its development step by step. As a result the developed device is modular, scalable, and fully wireless; it is capable of taking as many measurements at once as user needs. The developed system is compared working together on a same test to the currently used one based on heat flow. The results show that the developed metre allows carrying out thermal transmittance measurements in buildings in a cheap, quick, reliable and simple way.
Domínguez, Elena; Romaní, Aloia; Alonso, José Luis; Parajó, Juan Carlos; Yáñez, Remedios
2014-12-01
Acacia dealbata wood (an invasive species) was subjected to fractionation with glycerol (a cheap industrial by-product), and the resulting solid phase was used as a substrate for enzymatic hydrolysis. Glycerol fractionation allowed an extensive delignification while preserving cellulose in solid phase. The solids from the fractionation stage showed high susceptibility to enzymatic hydrolysis. Solids obtained under selected fractionation conditions (glycerol content of media, 80 wt%; duration, 1h; liquid to solid ratio, 6 g/g; alkaline and neutral washing stages) were subjected to enzymatic saccharification to achieve glucose concentrations up to 85.40 g/L, with almost complete cellulose conversion into glucose. The results confirmed the potential of glycerol as a fractionation agent for biorefineries. Copyright © 2014 Elsevier Ltd. All rights reserved.
International Nuclear Information System (INIS)
Zachariasova, M.; Lacina, O.; Malachova, A.; Kostelanska, M.; Poustka, J.; Godula, M.; Hajslova, J.
2010-01-01
Rapid, simple and cost-effective analytical methods with performance characteristics matching regulatory requirements are needed for effective control of occurrence of Fusarium toxins in cereals and cereal-based products to which they might be transferred during processing. Within this study, two alternative approaches enabling retrospective data analysis and identification of unknown signals in sample extracts have been implemented and validated for determination of 11 major Fusarium toxins. In both cases, ultra-high performance liquid chromatography (U-HPLC) coupled with high resolution mass spectrometry (HR MS) was employed. 13 C isotopically labeled surrogates as well as matrix-matched standards were employed for quantification. As far as time of flight mass analyzer (TOF-MS) was a detection tool, the use of modified QuEChERS (quick easy cheap effective rugged and safe) sample preparation procedure, widely employed in multi-pesticides residue analysis, was shown as an optimal approach to obtain low detection limits. The second challenging alternative, enabling direct analysis of crude extract, was the use of mass analyzer based on Orbitrap technology. In addition to demonstration of full compliance of the new methods with Commission Regulation (EC) No. 401/2006, also their potential to be used for confirmatory purposes according to Commission Decision 2002/657/EC has been critically assessed.
Pliakas, T; Lock, K; Jones, A; Aalders, S; Egan, M
2018-02-13
'Reducing the Strength' (RtS) is a public health initiative encouraging retailers to voluntarily stop selling cheap, strong beers/ciders (≥6.5% alcohol by volume). This study evaluates the impact of RtS initiatives on alcohol availability and purchasing in three English counties with a combined population of 3.62 million people. We used a multiple baseline time-series design to examine retail data over 29 months from a supermarket chain that experienced a two-wave, area-based role out of RtS: initially 54 stores (W1), then another 77 stores (W2). We measured impacts on units of alcohol sold (primary outcome: beers/ciders; secondary outcome: all alcoholic products), economic impacts on alcohol sales and substitution effects. We observed a non-significant W1 increase (+3.7%, 95% CI: -11.2, 21.0) and W2 decrease (-6.8%, 95% CI: -20.5, 9.4) in the primary outcome. We observed a significant W2 decrease in units sold across all alcohol products (-10.5%, 95% CI: -19.2, -0.9). The direction of effect between waves was inconsistent for all outcomes, including alcohol sales, with no evidence of substitution effects. In the UK, voluntary RtS initiatives appear to have little or no impact on reducing alcohol availability and purchase from the broader population of supermarket customers. © The Author(s) 2018. Published by Oxford University Press on behalf of Faculty of Public Health. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com
Effective and cheap X-ray television detector
International Nuclear Information System (INIS)
Artem'ev, A.N.; Potlovskij, K.G.; Rezvov, V.A.; Yudin, L.I.
2002-01-01
The position sensitive detector (PSD) is designed for investigations with traditional X-ray tubes and synchrotron radiation from 3 to 30 keV. PSD consists of light-tight box, which transforms X-ray photons to light photons. Light photons are registered with the help of TV camera. Then an image is digitized and introduced into computer. Software provides registration of the dim beam images by means of accumulation of the information. Statistic processing of the image series allows to determine of the parameters of the image. Sensitivity is 41 phot/pixel. Spatial resolution is not worse then 400 μ [ru
International Nuclear Information System (INIS)
Petro Zoriy; Reinhold Flucht; Mechthild Burow; Peter Ostapczuk; Reinhard Lennartz; Myroslav Zoriy
2010-01-01
A robust analytical method has been developed in our laboratory for the separation of radionuclides by means of extraction chromatography using an automated separation system. The proposed method is both cheap and simple and provides the advantageous, rapid and accurate separation of the element of interest. The automated separation system enables a shorter separation time by maintaining a constant flow rate of solution and by avoiding clogging or bubbling in the chromatographic column. The present separation method was tested with two types of samples (water and urine) using UTEVA-, TRU- and Sr-specific resins for the separation of U, Th, Am, Pu and Sr. The total separation time for one radionuclide ranged from 60 to 100 min with the separation yield ranging from 68 to 98% depending on the elements separated. We used ICP-QMS, multi-low-level counter and alpha spectroscopy to measure the corresponding elements. (author)
Jiang, Ze-Jun; Cao, Xiao-Lin; Li, Hui; Zhang, Chan; Abd El-Aty, A M; Jin, Fen; Shao, Hua; Jin, Mao-Jun; Wang, Shan-Shan; She, Yong-Xin; Wang, Jing
2017-11-24
In the present study, a quick and sensitive method was developed for simultaneous determination of nonylphenol ethoxylates (NPxEOs) and octylphenol ethoxylates (OPxEOs) (x=2-20) in three leafy vegetables, including cabbage, lettuce, and spinach using a modified "QuEChERS" method and ultra-high performance supercritical fluid chromatography-tandem mass spectrometry (UHPSFC-MS/MS) with scheduled multiple reaction monitoring (MRM). Under optimized conditions, the 38 target analytes were analyzed within a short period of time (5 min). The linearities of the matrix-matched standard calibrations were satisfactory with coefficients of determination (R 2 )>0.99 and the limits of detection (LOD) and quantification (LOQ) were in between 0.02-0.27 and 0.18-1.75μgkg -1 , respectively. The recovery of all target analytes spiked at three (low, medium, and high) fortification levels in various leafy vegetables were ranged from 72.8-122.6% with relative standard deviation (RSD) ≤18.3%. The method was successfully applied to market samples and the target analytes were found in all monitored samples, with total concentrations of 0-8.67μgkg -1 and 15.75-95.75μgkg -1 for OPxEOs and NPxEOs (x=2-20), respectively. In conclusion, the newly developed UHPSFC-ESI-MS/MS method is rapid and versatile and could be extrapolated for qualitative and quantitative analysis of APxEOs in other leafy vegetables. Copyright © 2017 Elsevier B.V. All rights reserved.
Weak data do not make a free lunch, only a cheap meal
Energy Technology Data Exchange (ETDEWEB)
Luo, Zhipu [National Cancer Institute, Argonne National Laboratory, Argonne, IL 90439 (United States); Rajashankar, Kanagalaghatta [Cornell University, Argonne National Laboratory, Argonne, IL 60439 (United States); Dauter, Zbigniew, E-mail: dauter@anl.gov [National Cancer Institute, Argonne National Laboratory, Argonne, IL 90439 (United States)
2014-02-01
Refinement and analysis of four structures with various data resolution cutoffs suggests that at present there are no reliable criteria for judging the diffraction data resolution limit and the condition I/σ(I) = 2.0 is reasonable. However, extending the limit by about 0.2 Å beyond the resolution defined by this threshold does not deteriorate the quality of refined structures and in some cases may be beneficial. Four data sets were processed at resolutions significantly exceeding the criteria traditionally used for estimating the diffraction data resolution limit. The analysis of these data and the corresponding model-quality indicators suggests that the criteria of resolution limits widely adopted in the past may be somewhat conservative. Various parameters, such as R{sub merge} and I/σ(I), optical resolution and the correlation coefficients CC{sub 1/2} and CC*, can be used for judging the internal data quality, whereas the reliability factors R and R{sub free} as well as the maximum-likelihood target values and real-space map correlation coefficients can be used to estimate the agreement between the data and the refined model. However, none of these criteria provide a reliable estimate of the data resolution cutoff limit. The analysis suggests that extension of the maximum resolution by about 0.2 Å beyond the currently adopted limit where the I/σ(I) value drops to 2.0 does not degrade the quality of the refined structural models, but may sometimes be advantageous. Such an extension may be particularly beneficial for significantly anisotropic diffraction. Extension of the maximum resolution at the stage of data collection and structure refinement is cheap in terms of the required effort and is definitely more advisable than accepting a too conservative resolution cutoff, which is unfortunately quite frequent among the crystal structures deposited in the Protein Data Bank.
Weak data do not make a free lunch, only a cheap meal
International Nuclear Information System (INIS)
Luo, Zhipu; Rajashankar, Kanagalaghatta; Dauter, Zbigniew
2014-01-01
Refinement and analysis of four structures with various data resolution cutoffs suggests that at present there are no reliable criteria for judging the diffraction data resolution limit and the condition I/σ(I) = 2.0 is reasonable. However, extending the limit by about 0.2 Å beyond the resolution defined by this threshold does not deteriorate the quality of refined structures and in some cases may be beneficial. Four data sets were processed at resolutions significantly exceeding the criteria traditionally used for estimating the diffraction data resolution limit. The analysis of these data and the corresponding model-quality indicators suggests that the criteria of resolution limits widely adopted in the past may be somewhat conservative. Various parameters, such as R merge and I/σ(I), optical resolution and the correlation coefficients CC 1/2 and CC*, can be used for judging the internal data quality, whereas the reliability factors R and R free as well as the maximum-likelihood target values and real-space map correlation coefficients can be used to estimate the agreement between the data and the refined model. However, none of these criteria provide a reliable estimate of the data resolution cutoff limit. The analysis suggests that extension of the maximum resolution by about 0.2 Å beyond the currently adopted limit where the I/σ(I) value drops to 2.0 does not degrade the quality of the refined structural models, but may sometimes be advantageous. Such an extension may be particularly beneficial for significantly anisotropic diffraction. Extension of the maximum resolution at the stage of data collection and structure refinement is cheap in terms of the required effort and is definitely more advisable than accepting a too conservative resolution cutoff, which is unfortunately quite frequent among the crystal structures deposited in the Protein Data Bank
Plantinga, Mirjam
2006-01-01
Employee Motivation and Employee Performance in Child Care: The Effects of the Introduction of Market Focus on Employees in the Dutch Child-Care Sector Mirjam Plantinga (RUG) This research describes and explains the effects of the introduction of market forces in the Dutch child-care sector on
Gravity Terrain Effect of the Seafloor Topography in Taiwan
Directory of Open Access Journals (Sweden)
Lun-Tao Tong Tai-Rong Guo
2007-01-01
Full Text Available Gravity terrain correction is used to compensate for the gravitational effects of the topography residual to the Bouguer plate. The seafloor topography off the eastern offshore of Taiwan is extremely rugged, and the depth of the sea bottom could be greater than 5000 m. In order to evaluate the terrain effect caused by the seafloor topography, a modern computer algorithm is used to calculate the terrain correction based on the digital elevation model (DEM.
Santilio, Angela; Stefanelli, Patrizia; Dommarco, Roberto
2009-08-01
A fast, simple and inexpensive method has been developed for the analysis of phenoxy acid herbicides: 2,4-dichlorophenoxyacetic acid (2,4-D), 4-chloro-2-methylphenoxyacetic acid (MCPA), 2-(4-chloro-o-tolyloxy)propionic acid (MCPP), 2-(4-aryloxyphenoxy)propionic acid (Fluazifop) and 2-(4-aryloxyphenoxy)propionic acid (Haloxyfop) in carrots and apples by liquid chromatography coupled to triple quadrupole mass spectrometry (LC/MS/MS). The compounds were analyzed by QuEChERS (quick, easy, cheap, effective, rugged, safe) methodology without cleanup. The recoveries were performed at two spiked levels (0.05 and 0.5 mg/kg) for both matrices with six replicates for each level. The mean recoveries ranged from 70-92% for both apples and carrots. The precision of the method expressed as relative standard deviation (RSD%) was found to be in the range 3-15%. For all compounds, good linearity (r(2) > 0.99) was obtained over the range of concentration from 0.05 micro g/mL to 0.5 micro g/mL, corresponding to the pesticide concentrations of 0.05 mg/kg and 0.5 mg/kg, respectively. The determination limits (LOQs) ranged from 0.01 ng/mL to 1.3 ng/mL in solvent, whereas, the LOQs calculated in matrix ranged from 0.05 ng/g to 21.0 ng/g for apples and from 0.06 ng/g to 10.2 ng/g for carrots. The developed methodology combines the advantages of both QuEChERS and LC/MS/MS producing a very rapid, sensitive and cheap method useful for the routine analytical laboratories.
[Simultaneous determination of 6 neonicotinoid residues in soil using DLLME-HPLC and UV].
Sun, Bao-li; Shan, Hong; Li, Yan-hua; Zeng, Ya-ling; Shen, Xiu-li; Tong, Cheng-feng
2013-09-01
A simple, cheap and rugged method was developed for simultaneous deter mination of 6 neonicotinoid residues in soil, including imidacloprid, acetamiprid, thiamethoxam, thiacloprid, clothianidin and nitenpyram. The soil sample was produced by dispersive liquid-liquid micro-extraction (DLLME) after extracted by the mixed solution of acetonitrile and CH2Cl2 (2:1, phi). The analytes were separated by HPLC with Alltima C18 column (4.6 mm x 250 mm, 5 microm) and detected by PDA at 260 nm. External standard method was used for quantification. The results showed that good linearity was obtained with correlation coefficients between 0.9982 and 0.9999 in the range of 0.5-200 microg x L(-1). The limits of detection (LODs) were in the range between 0.0005 and 0.003 microg x mL(-1) (S/N = 3). The method was validated with five soil samples spiked at three fortification levels (0.05, 0.1, 1.0 mg x kg(-1)) and recoveries were in the range of 55.3%-95.6% with RSD of 1.4%-7.0%. The effect of clean-up was evaluated by UV spectra and demonstrated that the method established is effective. In conclusion, this method is competent for the simultaneous analysis of 6 neonicotinoid residues in soil.
Han, Lijun; Sapozhnikova, Yelena; Lehotay, Steven J
2014-05-27
A new method of sample preparation was developed and is reported for the first time. The approach combines in-vial filtration with dispersive solid-phase extraction (d-SPE) in a fast and convenient cleanup of QuEChERS (quick, easy, cheap, effective, rugged, and safe) extracts. The method was applied to simultaneous analysis of 42 diverse pesticides and 17 environmental contaminants, including polycyclic aromatic hydrocarbons, polychlorinated biphenyls (PCBs), and flame retardants, in shrimp as the sample matrix. Final extracts were analyzed by both low-pressure gas chromatography - triple quadrupole tandem mass spectrometry (LPGC-MS/MS), and high-performance liquid chromatography - triple quadrupole tandem mass spectrometry (HPLC-MS/MS) to provide a wide scope of analysis for targeted analytes. During method development, several different commercial sorbents for d-SPE were investigated and compared with respect to analyte recoveries. The method was validated at 10, 50, and 100 ng g(-1) spiking levels (10-fold lower for PCBs), and the results for nearly all analytes were between 70 and 115% recoveries with ≤17% relative standard deviations. The method was shown to be simple, fast, and effective for multi-application analysis of chemical residues in the representative food and environmental marker matrix. Copyright © 2014. Published by Elsevier B.V.
The telescopic tourist's guide to the Moon
May, Andrew
2017-01-01
Whether you’re interested in visiting Apollo landing sites or the locations of classic sci-fi movies, this is the tourist guide for you! This tourist guide has a twist – it is a guide to a whole different world, which you can visit from the comfort of your backyard with the aid of nothing more sophisticated than an inexpensive telescope. It tells you the best times to view the Moon, the most exciting sights to look out for, and the best equipment to use, allowing you to snap stunning photographs as well as view the sights with your own eyes. Have you ever been inspired by stunning images from the Hubble telescope, or the magic of sci-fi special effects, only to look through a small backyard telescope at the disappointing white dot of a planet or faint blur of a galaxy? Yet the Moon is different. Seen through even a relatively cheap telescope, it springs into life like a real place, with mountains and valleys and rugged craters. With a bit of imagination, you can even picture yourself as a sightseeing visi...
Jia, Wei; Ling, Yun; Lin, Yuanhui; Chang, James; Chu, Xiaogang
2014-04-04
A new method combining QuEChERS with ultrahigh-performance liquid chromatography and electrospray ionization quadrupole Orbitrap high-resolution mass spectrometry (UHPLC/ESI Q-Orbitrap) was developed for the highly accurate and sensitive screening of 43 antioxidants, preservatives and synthetic sweeteners in dairy products. Response surface methodology was employed to optimize a quick, easy, cheap, effective, rugged, and safe (QuEChERS) sample preparation method for the determination of 42 different analytes in dairy products for the first time. After optimization, the maximum predicted recovery was 99.33% rate for aspartame under the optimized conditions of 10 mL acetionitrile, 1.52 g sodium acetate, 410 mg PSA and 404 mgC18. For the matrices studied, the recovery rates of the other 42 compounds ranged from 89.4% to 108.2%, with coefficient of variation 0.999. The limits of detection for the analytes are in the range 0.0001-3.6 μg kg(-1). This method has been successfully applied on screening of antioxidants, preservatives and synthetic sweeteners in commercial dairy product samples, and it is very useful for fast screening of different food additives. Copyright © 2014 Elsevier B.V. All rights reserved.
Ruan, Chunqiang; Zhao, Xiang; Liu, Chenglan
2015-09-01
In this study, a simple and low-organic-solvent-consuming method combining an acetonitrile-partitioning extraction procedure followed by "quick, easy, cheap, effective, rugged and safe" cleanup with ionic-liquid-based dispersive liquid-liquid microextraction and high-performance liquid chromatography with diode array detection was developed for the determination of diflubenzuron and chlorbenzuron in grapes and pears. Ionic-liquid-based dispersive liquid-liquid microextraction was performed using the ionic liquid 1-hexyl-3-methylimidazolium hexafluorophosphate as the extractive solvent and acetonitrile extract as the dispersive solvent. The main factors influencing the efficiency of the dispersive liquid-liquid microextraction were evaluated, including the extractive solvent type and volume and the dispersive solvent volume. The validation parameters indicated the suitability of the method for routine analyses of benzoylurea insecticides in a large number of samples. The relative recoveries at three spiked levels ranged between 98.6 and 109.3% with relative standard deviations of less than 5.2%. The limit of detection was 0.005 mg/kg for the two insecticides. The proposed method was successfully used for the rapid determination of diflubenzuron and chlorbenzuron residues in real fruit samples. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Luo, Zhoufei; Lu, Jing; Li, Haipu; Tu, Yi; Wan, Yuehao; Yang, Zhaoguang
2018-09-15
A new, sensitive, and rapid method based on the Quick, Easy, Cheap, Effective, Rugged and Safe (QuEChERS) approach and air-assisted liquid-liquid microextraction (AALLME) technology was developed for the determination of 20 endocrine-disrupting compounds (EDCs) in fish by high-performance liquid chromatography-tandem mass spectrometry. The method first integrates AALLME into QuEChERS to achieve clean-up and enrichment of the EDCs in one step. A self-made glass tube was enfolded with plasticine to withstand the high centrifugal force. The established method was developed by optimization of the parameters. High linearities (R 2 > 0.9924) and recoveries (78.2-118.6%) at three spiked levels (5, 10, and 20 ng g -1 ), and low relative standard deviation values (1.1-14.5%) and limits of detection (0.03-0.80 ng g -1 ) were obtained. The method comparison shows that the proposed method is superior as it involves less organic solvent usage, simple operation and high efficiency. This method was successfully applied to different fishes for analyzing EDCs. Copyright © 2018 Elsevier Ltd. All rights reserved.
Xu, Jiao-Jiao; Zhou, Jian; Huang, Bai-Fen; Cai, Zeng-Xuan; Xu, Xiao-Min; Ren, Yi-Ping
2016-06-01
A simple and reliable method of ultra high performance liquid chromatography coupled with photo-diode array detection has been proposed for the simultaneous determination of deoxynivalenol and its acetylated derivatives in wheat flour and rice, especially focusing on the optimization of sample extraction, cleanup, and chromatographic separation conditions. Sample pretreatment consisted of a first step using a quick, easy, cheap, effective, rugged, and safe based extraction procedure and a subsequent cleanup step based on solid-phase extraction. The method was extensively validated in wheat flour and rice, obtaining satisfactory analytical performance with good linearity (R(2) ≥ 0.999), acceptable recoveries (80.0-104.4%), and repeatability (RSDs 1.3-10.7%). The limits of detection (21.7-57.4 μg/kg) and quantitation (72.3-191.4 μg/kg) for deoxynivalenols were lower than those usually permitted by various countries' legislation in these food matrices. The method was applied to 34 wheat and rice samples. The results were further compared with results of ultra high performance liquid chromatography with electrospray ionization tandem mass spectrometry. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Cunha, Sara C; Lehotay, Steven J; Mastovska, Katerina; Fernandes, José O; Beatriz, Maria; Oliveira, P P
2007-03-01
This paper describes the use of a quick, easy, cheap, effective, rugged, and safe (QuEChERS) method for extraction and cleanup of 16 pesticide residues of interest in olives and olive oil. These products contain a high lipid content, which can adversely affect pesticide recoveries and harm traditional chromatographic systems. For extraction, the main factors (oil and water content) were studied and optimized in experiments to maximize pesticide recoveries. Dispersive SPE with different sorbents was also investigated to minimize matrix coextractives and interferences. For analysis, a new automated DSI device was tested in GC-MS to avoid nonvolatile coextractives from contaminating the instrument. LC-MS/MS with positive ESI was used for those pesticides that were difficult to detect by GC-MS. The final method was validated for olives in terms of recoveries, repeatabilities, and reproducibilities using both detection techniques. The results demonstrated that the method achieved acceptable quantitative recoveries of 70-109% with RSDs < 20% for DSI-GC-MS and 88-130% with RSDs < 10% for LC-MS/MS, and LOQ at or below the regulatory maximum residue limits for the pesticides were achieved.
Zhang, Xiaona; Niu, Jiahua; Zhang, Xiaoting; Xiao, Rui; Lu, Minghua; Cai, Zongwei
2017-03-01
In this research, a modified Quick, Easy, Cheap, Effective, Rugged and Safe (QuEChERS) method based on graphene oxide@SiO 2 (SiO 2 @GO) nanocomposite as adsorbent of dispersive solid-phase extraction (dSPE) combined with high performance liquid chromatography (HPLC) for the analysis of four plant hormones in different plants was established. The as-prepared SiO 2 @GO was characterized by scanning electron microscopy, transmission electron microscopy and infrared spectroscopy. The experimental conditions for dSPE, including the ratio of material to liquid, pH of sample, adsorption and desorption time, desorption temperature as well as desorption solution, were investigated. The detection limits for the analysis of indole-3-acetic acid, indole-3-butyric acid, 1-naphthylacetic acid and abscisic acid were achieved below 0.05μgmL -1 . The established method was applied to the analysis of the plant hormones in fruits, vegetables and other food samples. The obtained results indicated that the method was sensitive, accurate, convenient and quick, which provided an alternative analytical approach for plant hormones in complex matrices. Copyright © 2017 Elsevier B.V. All rights reserved.
Pyraclostrobin wash-off from sugarcane leaves and aerobic dissipation in agricultural soil.
Fulcher, James M; Wayment, Darcey G; White, Paul M; Webber, Charles L
2014-03-12
To mitigate damage from the fungal sugarcane pathogen brown rust (Puccinia melanocephala), a Section 18 Emergency Use Label was put in place by the United States Environmental Protection Agency (U.S. EPA) for the application of pyraclostrobin (trade name Headline SC, produced by BASF, Research Triangle Park, NC) on sugarcane in 2008. To assess the dynamics of this fungicide in Louisiana soil, samples (n = 24) from a non-treated field were spiked with pyraclostrobin (3.1 μg g(-1)) and analyzed in laboratory conditions over the course of 63 days using quick, easy, cheap, effective, rugged, and safe (QuEChERS) dispersive solid-phase extraction/high-performance liquid chromatography with ultraviolet-visible detection (dSPE/HPLC-UV). Modeling was performed using Microsoft Excel to predict DTx values. Pyraclostrobin was found to follow biphasic kinetics with DT50 and DT90 values of 60 and 282 days, suggesting that it is moderately persistent to persistent in soils. Wash-off studies on sugarcane indicate that very little fungicide is in the wash-off after 48 h. If applied to sugarcane according to label recommendations, the fungicide should have minimal dissipation from rainfall events.
Fernandes, Virgínia C; Lehotay, Steven J; Geis-Asteggiante, Lucía; Kwon, Hyeyoung; Mol, Hans G J; van der Kamp, Henk; Mateus, Nuno; Domingues, Valentina F; Delerue-Matos, Cristina
2014-01-01
This study analysed 22 strawberry and soil samples after their collection over the course of 2 years to compare the residue profiles from organic farming with integrated pest management practices in Portugal. For sample preparation, we used the citrate-buffered version of the quick, easy, cheap, effective, rugged, and safe (QuEChERS) method. We applied three different methods for analysis: (1) 27 pesticides were targeted using LC-MS/MS; (2) 143 were targeted using low pressure GC-tandem mass spectrometry (LP-GC-MS/MS); and (3) more than 600 pesticides were screened in a targeted and untargeted approach using comprehensive, two-dimensional gas chromatography time-of-flight mass spectrometry (GC × GC-TOF-MS). Comparison was made of the analyses using the different methods for the shared samples. The results were similar, thereby providing satisfactory confirmation of both similarly positive and negative findings. No pesticides were found in the organic-farmed samples. In samples from integrated pest management practices, nine pesticides were determined and confirmed to be present, ranging from 2 µg kg(-1) for fluazifop-p-butyl to 50 µg kg(-1) for fenpropathrin. Concentrations of residues in strawberries were less than European maximum residue limits.
Riedel, Melanie; Speer, Karl; Stuke, Sven; Schmeer, Karl
2010-01-01
Since 2003, two new multipesticide residue methods for screening crops for a large number of pesticides, developed by Klein and Alder and Anastassiades et al. (Quick, Easy, Cheap, Effective, Rugged, and Safe; QuEChERS), have been published. Our intention was to compare these two important methods on the basis of their extraction efficiency, reproducibility, ruggedness, ease of use, and speed. In total, 70 pesticides belonging to numerous different substance classes were analyzed at two concentration levels by applying both methods, using five different representative matrixes. In the case of the QuEChERS method, the results of the three sample preparation steps (crude extract, extract after SPE, and extract after SPE and acidification) were compared with each other and with the results obtained with the Klein and Alder method. The extraction efficiencies of the QuEChERS method were far higher, and the sample preparation was much quicker when the last two steps were omitted. In most cases, the extraction efficiencies after the first step were approximately 100%. With extraction efficiencies of mostly less than 70%, the Klein and Alder method did not compare favorably. Some analytes caused problems during evaluation, mostly due to matrix influences.
Cheap electricity from French tides
Andre, H.
1980-02-01
A tidal power plant built in Saint-Malo, France is examined, and some of the problems that have resulted in recent years are analyzed. These include mechanical problems due to turbine runner-blade seal failure and electrical problems involving electroerosion and structural station difficulties. the effects of tidal power plants on the environment are discussed, and it is noted that all possible side effects of the operations are very limited. Attention is given to the basic requirements for constructing power sites.
Bartle, S J; Thomson, D U; Gehring, R; van der Merwe, B. D.
2017-01-01
The effects of titanium dioxide coatings of bovine hides on light absorption and transdermal transfer of light-derived heat were investigated. Four hair-on rug hides from Holstein cattle were purchased. Twelve samples about 20 cm on a side were cut from each hide; nine from the black-colored areas,
Abdallah, H; Arnaudguilhem, C; Jaber, F; Lobinski, R
2014-08-15
A new high performance liquid chromatography-high resolution mass spectrometry (HPLC-HRMS) method was developed for a simultaneous multi-residue analysis of 22 sulfonamides (SAs) and their metabolites in edible animal (pig, beef, sheep and chicken) tissues. Sample preparation was optimized on the basis of the "QuEChERS" protocol. The analytes were identified using their LC retention times and accurate mass; the identification was further confirmed by multi-stage high mass accuracy (Pig kidney" with ǀ Z-scoreǀpig, beef, sheep, and chicken) allowing the simultaneous quantification of target sulfonamides at concentration levels above the MRL/2 and the identification of untargeted compounds such as N(4)-acetyl metabolites using multi-stage high mass accuracy mass spectrometry. Copyright © 2014 Elsevier B.V. All rights reserved.
Munaretto, Juliana S; Viera, Mariela de S; Martins, Manoel L; Adaime, Martha B; Zanella, Renato
2016-11-01
Most of the analytical methods currently applied in food control laboratories are focused on the determination of target compounds using LC coupled to tandem MS, which is an effective technique, but low-resolution MS is limited. Thus, a method for determination of pesticide multiresidues in fruits (pear, apple, and grape) using a modified quick, easy, cheap, effective, rugged, and safe method and LC coupled to quadrupole time-of-flight (Q-TOF) MS was developed and validated. The proposed method showed good linearity (r2 > 0.99) from 1 to 100 μg/L. Recoveries for blank samples spiked at 0.01, 0.04, and 0.10 mg/kg were between 66 and 122%, with RSDs apple, pear, and grape matrixes were 0.01 mg/kg for 112, 120, and 118 compounds, and 0.04 mg/kg for 22, 12, and 17 compounds, and average mass accuracy error was 3.2 ppm. LC with Q-TOF MS detection using protonated molecular ion and/or adducts and mass accuracy provided reliability for the method. The proposed method is effective for pesticide residue determination in apple, pear, and grape samples, proving that high-resolution MS using full scan mode can be a powerful and reliable technique for quantification purposes, being adequate for application in the surveillance of maximum residue limits set by different legislations.
Lachenmeier, Dirk W; Ganss, Sebastian; Rychlak, Bogumil; Rehm, Jürgen; Sulkowska, Urszula; Skiba, Michał; Zatonski, Witold
2009-10-01
The research aimed to study the quality of cheap alcohol products in Poland. These included unrecorded alcohols (i.e., home-produced or illegally imported), estimated to constitute more than 25% of total consumption and fruit wines. A sample of alcohol products (n = 52) was collected from local markets and chemical analyses were conducted. The parameters studied were alcoholic strength, volatiles (methanol, acetaldehyde, and higher alcohols), ethyl carbamate, inorganic elements, and food additives including preservatives, colors, and sweeteners. The compositions of the beverages were then toxicologically evaluated using international standards. With the exception of 1 fortified wine, the unrecorded alcohols were home-produced fruit-derived spirits (moonshine) and spirits imported from other countries. We did not detect any nonbeverage surrogate alcohol. The unrecorded spirits contained, on average, 45% vol of alcohol. However, some products with considerably higher alcoholic strengths were found (up to 85% vol) with no labeling of the content on the bottles. These products may cause more pronounced detrimental health effects (e.g., liver cirrhosis, injuries, some forms of malignant neoplasms, alcohol use disorders, and cardiovascular disease) than will commercial beverages, especially as the consumer may be unaware of the alcohol content consumed. Fruit wines containing between 9.5 and 12.2% vol alcohol showed problems in terms of their additive content and their labeling (e.g., sulfites, sorbic acid, saccharin, and artificial colors) and should be subjected to stricter control. Regarding the other components investigated, the suspected human carcinogens, acetaldehyde and ethyl carbamate, were found at levels relevant to public health concerns. While acetaldehyde is a typical constituent of fermented beverages, ethyl carbamate was found only in home-produced unrecorded alcohols derived from stone fruits with levels significantly above international guidelines. The
International Nuclear Information System (INIS)
Ageeva, V; Stratoudaki, T; Clark, M; Somekh, M G
2015-01-01
Cheap optical transducers (CHOTs) are patterns on the surface of a component activated by lasers to generate and detect ultrasound. Excited optically, with minimal surface impact, and fully customizable, CHOTs provide a simple alternative to conventional piezoelectric transducers, offering wireless, remote operation. Of particular interest is application of CHOTs for in-situ ultrasonic inspection of hard-to reach and complex-geometry components such as those of aero-engines. A suitable fabrication method has been developed to allow in-situ application of CHOTs onto large size and curved components, as well as those already in service, challenging for current laboratory-based micro-patterning methods. This work describes the fabrication of a transferable g-CHOT for generation of ultrasound. The g- CHOT has been made on an SU8 carrier film using a sacrificial polystyrene layer, allowing the transducer to be transferred from the substrate and subsequently delivered and applied to the surface of the sample in-situ. The functionality of the fabricated transducer is demonstrated by detection of the Surface Acoustic Waves (SAW) generated by the g-CHOT transferred onto glass and aluminium samples
EFFECT OF WATER BORNE DISEASES ON INDIAN ECONOMY: A COST- BENEFIT ANALYSIS
Directory of Open Access Journals (Sweden)
PATHAK Hemant
2015-06-01
Full Text Available This paper expressed the effect of water borne diseases, risk assessment and potential consequences on Indian economy. In Indian sub-continent higher burden of waterborne diseases due to a deteriorating public drinking water distribution system, increasing numbers of unregulated private water systems, and a limited, passive waterborne disease surveillance system. This shows that degraded water quality can contribute to water scarcity as it limits its availability for both human use and for the ecosystem. It isn’t cheap to treat water so that it is safe to drink. But it also isn’t cheap to treat everyone who becomes ill during a waterborne illness outbreak. As the level of protection becomes more effective, the cost of water treatment generally rises, as well. Unfortunately, government agencies generally attempt to minimize costs while the health effects have not been properly assessed.
Bergé, Alexandre; Vulliet, Emmanuelle
2015-10-01
The earthworm represents a kind of creature in contact with the soil surface and usually exposed to a variety of organic pollutants from human activities. Therefore, it can be considered as an organism of choice for identifying pollution or better understanding the input of contaminants in food chains in particular through the contributions of sludge. Moreover, the use of organisms such as soil invertebrates is to be developed for ecotoxicological risk assessment of pollutants. In this context, a simple, rapid and effective multi-residue method was developed for the determination of 31 compounds including 11 steroids, 14 veterinary antibiotics and 6 human contaminants (paracetamol, sulfamethoxazole, fluvoxamine, carbamazepine, ibuprofen, bisphenol A) in earthworm. The sample preparation procedure was based on a salting-out extraction with acetonitrile (QuEChERS approach) that was optimised with regard to the acetonitrile/water ratio used in the extraction step, the choice of the clean-up and the quantity of the matrix. The optimised extraction method exhibited recoveries that comprised between 44 and 98 % for all the tested compounds. The limits of detection of all compounds were below 14 ng g(-1) and the limits of quantification (LOQ) comprised between 1.6 and 40 ng g(-1) (wet weight). The method was therefore applied to determine the levels of pharmaceuticals and hormones in six earthworm samples collected in various soils. Concentrations up to 195 ng g(-1) for bisphenol A were determined, between a few nanograms per gram and 43.1 ng g(-1) (estriol) for hormones and between a few nanograms per gram and 73.5 ng g(-1) (florfenicol) for pharmaceuticals. Experiments were also conducted in laboratory conditions to evaluate the accumulation of the target substances by earthworm.
International Nuclear Information System (INIS)
Ngaile, J.E.; Msaki, P.K.; Kazema, R.R.
2017-01-01
The aim of this study was to assess the radiation burden imparted to patients from contrast-based X-ray fluoroscopy procedures in Tanzania. The effective doses (EDs) to patients from five contrast-based fluoroscopy procedures were obtained from four hospitals. The ED was estimated using the knowledge of the patient characteristics, patient-related exposure parameters, measurements of air kerma area product and PCXCM software. The median EDs for the barium swallow (BS), barium meal (BM), barium enema (BE), hysterosalpingography (HSG) and retrograde urethrography (RUG) were 0.50, 1.43, 2.83, 0.65 and 0.59 mSv, respectively. The median ED per hospital for the BS and BM procedures varied by factors of up to 9.9 and 4.2, respectively, while for the BE, HSG and RUG varied by factors of up to 2.3, 2.4 and 4.3, respectively. The overall differences between individual EDs across the four hospitals varied by factors of up to 53, 58.9 and 11.4 for the BS, BM and BE, respectively, while for the HSG and RUG differed by factors of up to 22 and 46.7, respectively. The mean EDs in this study were mostly lower than reported values from Spain, the UK, Ghana and Greece, while slightly higher than those reported from India. The observed wide variations of procedural protocols and patient doses within and across the hospitals; and the observed high patient doses in this study relative to those from the literature call for the need to standardize procedural protocols and optimize contrast-based fluoroscopy procedures. (authors)
Mu, Zhaobin; Feng, Xiaoxiao; Zhang, Yun; Zhang, Hongyan
2016-02-01
A multi-residue method based on modified QuEChERS (quick, easy, cheap, effective, rugged, and safe) sample preparation, followed by liquid chromatography tandem mass spectrometry (LC-MS/MS), was developed and validated for the determination of three selected fungicides (propiconazole, pyraclostrobin, and isopyrazam) in seven animal origin foods. The overall recoveries at the three spiking levels of 0.005, 0.05, and 0.5 mg kg(-1) spanned between 72.3 and 101.4% with relative standard deviation (RSD) values between 0.7 and 14.9%. The method shows good linearity in the concentrations between 0.001 and 1 mg L(-1) with the coefficient of determination (R (2)) value >0.99 for each target analyte. The limit of detections (LODs) for target analytes were between 0.04 and 1.26 μg kg(-1), and the limit of quantifications (LOQs) were between 0.13 and 4.20 μg kg(-1). The matrix effect for each individual compound was evaluated through the study of ratios of the areas obtained in solvent and matrix standards. The optimized method provided a negligible matrix effect for propiconazole within 20%, whereas for pyraclostrobin and isopyrazam, the matrix effect was relatively significant with a maximum value of 49.8%. The developed method has been successfully applied to the analysis of 210 animal origin samples obtained from 16 provinces of China. The results suggested that the developed method was satisfactory for trace analysis of three fungicides in animal origin foods.
Li, Minmin; Dai, Chao; Wang, Fengzhong; Kong, Zhiqiang; He, Yan; Huang, Ya Tao; Fan, Bei
2017-02-01
An effective analysis method was developed based on a chemometric tool for the simultaneous quantification of five different post-harvest pesticides (2,4-dichlorophenoxyacetic acid (2,4-D), carbendazim, thiabendazole, iprodione, and prochloraz) in fruits and vegetables. In the modified QuEChERS (quick, easy, cheap, effective, rugged and safe) method, the factors and responses for optimization of the extraction and cleanup analyses were compared using the Plackett-Burman (P-B) screening design. Furthermore, the significant factors (toluene percentage, hydrochloric acid (HCl) percentage, and graphitized carbon black (GCB) amount) were optimized using a central composite design (CCD) combined with Derringer’s desirability function (DF). The limits of quantification (LOQs) were estimated to be 1.0 μg/kg for 2,4-D, carbendazim, thiabendazole, and prochloraz, and 1.5 μg/kg for iprodione in food matrices. The mean recoveries were in the range of 70.4-113.9% with relative standard deviations (RSDs) of less than 16.9% at three spiking levels. The measurement uncertainty of the analytical method was determined using the bottom-up approach, which yielded an average value of 7.6%. Carbendazim was most frequently found in real samples analyzed using the developed method. Consequently, the analytical method can serve as an advantageous and rapid tool for determination of five preservative pesticides in fruits and vegetables.
Induction generator-induction motor wind-powered pumping system
Energy Technology Data Exchange (ETDEWEB)
Miranda, M.S.; Lyra, R.O.C.; Silva, S.R. [CPDEE - UFMG, Belo Horizonte (Brazil)
1997-12-31
The energy storage matter plays an important role in wind-electric conversion systems for isolated applications. Having that in mind, two different approaches can be basically considered: either the immediate conversion of the generated electric energy, as in a water pumping system or electric energy storage for later use, as in a battery charging system. Due to some features such as no need of an external reactive power source and, sometimes, a gearbox, permanent-magnet synchronous generators have been broadly used in low rated power isolated systems. Despite that, system performance can be affected when the generator is feeding an inductive load (e.g., an induction motor) under variable-speed-variable-frequency operational conditions. Since there is no effective flux control, motor overload may occur at high wind speeds. Thus, good system performance can be obtained through additional control devices which may increase system cost. Although being rugged and cheap, induction machines always work as a reactive power drain; therefore, they demand an external reactive power source. Considering that, reactive static compensators appear as an attractive alternative to the cost x performance problem. In addition to that, different control strategies can be used so that system performance can be improved.
Risk assessment and monitoring of dinotefuran and its metabolites for Chinese consumption of apples.
Yu, Weiwei; Huang, Min; Chen, Jiaojiao; Wu, Sizhuo; Zheng, Kunming; Zeng, Song; Zhang, Kankan; Hu, Deyu
2017-09-26
Residues of dinotefuran and its metabolites, 1-methyl-3-(tetrahydro-3-furylmethyl)urea (UF) and 1-methyl-3-(tetrahydro-3-furylmethyl)guanidine (DN), in apple were investigated using a "QuEChERS" (quick, easy, cheap, effective, rugged, safe) pretreatment and liquid chromatography-tandem mass spectrometry. Limits of detection (LODs) and quantification (LOQs) of dinotefuran, UF, and DN in apples were 0.011-0.960 and 0.037-3.200 μg/kg, respectively. The average recoveries of dinotefuran, UF, and DN in apple ranged from 70.0 to 83.6% with relative standard deviations less than 13%. A formulation of 20% water-dispersible dinotefuran granules was sprayed at 1-1.5-fold the recommended dose 3-4 times on apple trees. Total terminal residues of dinotefuran in apple were less than 2 mg/kg, which is the maximum residue limit (MRL) set by Japan. When following the recommended application guidelines, dinotefuran is unlikely to present significant health concerns to the Chinese population because the risk quotient (RQ) is less than 100%. This work could provide guidance for the safe use of dinotefuran and serve as a reference for the establishment of a maximum residue limit of dinotefuran in apple in China.
Directory of Open Access Journals (Sweden)
Niki Tsartsali
2015-01-01
Full Text Available A quick, easy, cheap, effective, rugged, and safe (QuEChERS dispersive extraction method is proposed herein for the isolation and cleanup of melamine and cyromazine from chicken egg yolk. Analytes are determined by high-performance liquid chromatography using photodiode array detector after separation on a LiChroCART® (250 × 4 mm–-LiChrospher® RP-8e, 5 µm analytical column using a mobile phase of 0.1% trifluoracetic acid and methanol (80:20 v/v delivered isocratically at a flow rate of 1 mL/minute. Extraction of isolated compounds was achieved by methanol and acetonitrile mixture (1:1 v/v. Recovery rates ranged between 74.5% and 115.8%. The method was validated in terms of 657/2002/EC decision. The within-laboratory reproducibility, expressed as a relative standard deviation, was <11%. Decision limits (CCalfa were 2.56 mg/kg for melamine and 0.22 mg/kg -1 for cyromazine, and the corresponding results for detection capability (CCbeta were 2.8 mg/kg for melamine and 0.24 mg/kg for cyromazine. Ruggedness was estimated according to the Youden approach studying egg yolk mass, sorbent mass, centrifugation time, organic solvents volume, evaporation temperature, and vortex time.
González-Curbelo, Miguel Ángel; Socas-Rodríguez, Bárbara; Herrero, Miguel; Herrera-Herrera, Antonio V; Hernández-Borges, Javier
2017-08-15
The dissipation/degradation of the pesticides dimethoate, terbufos, disulfoton, and pirimiphos-methyl were evaluated in milled toasted maize and wheat flour (gofio) during three months of storage. Their dissipation kinetics and residual levels were determined, as well as their possible decomposition into some of their main transformation products (disulfoton sulfoxide, terbufos sulfone and disulfoton sulfone). For this purpose, pesticide-free milled toasted maize and wheat samples were spiked with the pesticides, and they were then stored in the darkness at ambient temperature in a closed container to simulate current storage conditions of such packed food. A multiresidue analysis based on the QuEChERS (Quick, Easy, Cheap, Effective, Rugged and Safe) method was performed for the simultaneous determination of these pesticides and their metabolites. After three months of storage, the dissipation of residues ranged between 34% (pirimiphos-methyl) and 86% (disulfoton) for maize gofio and between 69% (terbufos) and 92% (disulfoton and pirimiphos-methyl) for wheat gofio. The results demonstrated that the degradation was slower in gofio than in wheat gofio and that none of the selected metabolites were detected in any of the samples. Dissipation curves of all studied pesticides fitted to a first-order decay curve in both types of cereals. Copyright © 2017 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Hong-Xia Zhao
2011-08-01
Full Text Available A rapid method has been developed based on the sample preparation procedure named as QuEChERS (Quick, Easy, Cheap, Effective, Rugged and Safe, combined with reversed-phase high performance liquid chromatography with fluorescence detector and C18 column after pre-column derivatization using o-phthalaldehyde and 2-mercaptoethanol to determine dopamine in porcine muscle. Methanol and deionized water (0.1% acetic acid, v/v with a ratio of 60:40 was used as mobile phase. The flow rate was 0.8 mL/min and dopamine was eluted within 15 min. The linearity range was 0.003â8 μg/mL with r=0.9992. The detection limit for dopamine was 4 μg/kg and the quantification limit was 9 μg/kg. Recovery studies were carried out at 0.1, 0.5 and 1.0 mg/kg fortification levels and the average recoveries obtained ranged from 90.4% to 98.2% with relative standard deviations between 3.5% and 8.1%. The method was found to be suitable for detection of dopamine in animal product tissues at the maximum residue level. Keywords: Liquid chromatography, Dopamine, o-phthalaldehyde, QuEChERS
Mekonen, Seblework; Ambelu, Argaw; Spanoghe, Pieter
2014-06-01
Samples of maize, teff, red pepper, and coffee (green bean and coffee bean with pulp) were collected from a local market in the Jimma Zone, Ethiopia. Samples were analyzed for the occurrence of cypermethrin, permethrin, deltamethrin, chlorpyrifos ethyl, DTT and its metabolites, and endosulfan (α, β). In the analytical procedure, the QuEChERS (Quick, Easy, Cheap, Effective, Rugged and Safe) extraction methodology with dispersive solid phase extraction clean up (d-SPE) technique was applied. Validation of the QuEChERS method was satisfactory. Recovery percentages of most pesticides were in the range of 70% to 120%, with good repeatability (%relative standard deviation coffee bean. Residues of DDT in coffee pulp significantly differed (p < 0.01) from other food items except for red pepper. The concentration of pesticides in the food items varied from 0.011 mg/kg to 1.115 mg/kg. All food items contained 1 or more pesticides. Two-thirds of the samples had residues below corresponding maximum residue limits, and the remaining one-third of samples were above the maximum residue limits. These results indicate the need for a good pesticide monitoring program to evaluate consumer risk for the Ethiopian people. © 2014 SETAC.
Residue dynamics of pyraclostrobin in peanut and field soil by QuEChERS and LC-MS/MS.
Zhang, Fengzu; Wang, Lei; Zhou, Li; Wu, Di; Pan, Hongji; Pan, Canping
2012-04-01
A modified QuEChERS-LC-MS/MS (acronym of quick, easy, cheap, effective, rugged and safe-liquid chromatography tandem mass spectrometry) method for the analysis of pyraclostrobin residue in peanut and soil was developed and validated. Pyraclostrobin residue dynamics and final residues in supervised field trials at Good Agricultural Practice (GAP) conditions in peanut and soil were studied. The limits of quantitation (LOQs) for pyraclostrobin in soil, plant, shell and peanut samples were 0.00057, 0.00026, 0.003 and 0.0037 mg kg(-1), respectively. At fortification levels of 0.005, 0.05 and 0.5 mg kg(-1) in all samples, it was shown that recoveries ranged from 80.3% to 109.4% with relative standard deviations of 1.1-8.2% (n=5). The dissipation experiments showed the half-lives (T(1/2)) of pyraclostrobin in soil and plants were 13.1-16.5 days and 10.3-11.2 days, respectively. At pre-harvest intervals (PHI) of 14, 21 and 28 days, pyraclostrobin residue were 0.005-0.20 mg kg(-1) in soil, 0.006-0.27 mg kg(-1) in plants, below 0.053 mg kg(-1) in shells and not detectable in peanuts. Crown Copyright © 2011. Published by Elsevier Inc. All rights reserved.
Grande-Martínez, Ángel; Arrebola, Francisco Javier; Moreno, Laura Díaz; Vidal, José Luis Martínez; Frenich, Antonia Garrido
2015-01-01
A rapid and sensitive multiresidue method was developed and validated for the determination of around 100 pesticides in dry samples (rice and wheat flour) by ultra-performance LC coupled to a triple quadrupole mass analyzer working in tandem mode (UPLC/QqQ-MS/MS). The sample preparation step was optimized for both matrixes. Pesticides were extracted from rice samples using aqueous ethyl acetate, while aqueous acetonitrile extraction [modified QuEChERS (quick, easy, cheap, effective, rugged, and safe) method] was used for wheat flour matrixes. In both cases the extracts were then cleaned up by dispersive solid phase extraction with MgSO4 and primary secondary amine+C18 sorbents. A further cleanup step with Florisil was necessary to remove fat in wheat flour. The method was validated at two concentration levels (3.6 and 40 μg/kg for most compounds), obtaining recoveries ranging from 70 to 120%, intraday and interday precision values≤20% expressed as RSDs, and expanded uncertainty values≤50%. The LOQ values ranged between 3.6 and 20 μg/kg, although it was set at 3.6 μg/kg for the majority of the pesticides. The method was applied to the analysis of 20 real samples, and no pesticides were detected.
International Nuclear Information System (INIS)
The subject is discussed under the following headings: introduction (historical and general); counting the costs; Hunterston 'A' - historical cost accounting versus current cost accounting; Hunterston 'B' - 'a catastrophe we must not repeat'; Torness - lessons not learned (query); the hidden costs; the future - insulation versus generation (query); conclusions - nuclear accountability. (U.K.)
Energy Technology Data Exchange (ETDEWEB)
Han, Xiao Xia [State Key Laboratory of Supramolecular Structure and Materials, Jilin University, 2699 Qianjin Street, Changchun 130012 (China); Institut für Chemie, Technische Universität Berlin, Sekr. PC14, Strasse des 17. Juni 135, D-10623 Berlin (Germany); Li, Junbo [State Key Laboratory of Supramolecular Structure and Materials, Jilin University, 2699 Qianjin Street, Changchun 130012 (China); Öner, Ibrahim Halil [Institut für Chemie, Technische Universität Berlin, Sekr. PC14, Strasse des 17. Juni 135, D-10623 Berlin (Germany); Zhao, Bing [State Key Laboratory of Supramolecular Structure and Materials, Jilin University, 2699 Qianjin Street, Changchun 130012 (China); Leimkühler, Silke [Institut für Biochemie und Biologie, Universität Potsdam, Karl-Liebknecht Straße 24-25, H. 25, Golm D-14476 (Germany); Hildebrandt, Peter [Institut für Chemie, Technische Universität Berlin, Sekr. PC14, Strasse des 17. Juni 135, D-10623 Berlin (Germany); Weidinger, Inez M., E-mail: i.weidinger@mailbox.tu-berlin.de [Institut für Chemie, Technische Universität Berlin, Sekr. PC14, Strasse des 17. Juni 135, D-10623 Berlin (Germany)
2016-10-19
Practical use of many bioelectronic and bioanalytical devices is limited by the need of expensive materials and time consuming fabrication. Here we demonstrate the use of nickel electrodes as a simple and cheap solid support material for bioelectronic applications. The naturally nanostructured electrodes showed a surprisingly high electromagnetic surface enhancement upon light illumination such that immobilization and electron transfer reactions of the model redox proteins cytochrome b{sub 5} (Cyt b{sub 5}) and cytochrome c (Cyt c) could be followed via surface enhanced resonance Raman spectroscopy. It could be shown that the nickel surface, when used as received, promotes a very efficient binding of the proteins upon preservation of their native structure. The immobilized redox proteins could efficiently exchange electrons with the electrode and could even act as an electron relay between the electrode and solubilized myoglobin. Our results open up new possibility for nickel electrodes as an exceptional good support for bioelectronic devices and biosensors on the one hand and for surface enhanced spectroscopic investigations on the other hand. - Highlights: • Nickel electrodes were used without further functionalization as supports for various redox proteins. • It was possible to monitor the immobilized proteins via surface enhanced Raman spectroscopy. • The native structure of the immobilized proteins was preserved and they could exchange electrons with the Ni electrode. • The immobilized redox proteins worked as an electron relay between electrode and solubilized myoglobin.
Bauer, Matthias
2017-01-01
Even low import tariff rates have a significant compounding effect on the final retail price of medicines, which in turn impacts on affordability. While much of the "access to affordable medicines" debate is about intellectual property rights (IPRs) and business practices of pharmaceutical manufacturers, import duties and national protectionism are swept under the political rug. In this paper, we provide a synopsis of tariff barriers for exports of pharmaceutical products to the world's major...
2012-07-30
... program management services for rugged laptop computers and rugged mobile devices. The worker group... of program management services for rugged laptop computers and rugged mobile devices, meet the worker... threatened to become totally or partially separated. Section 222(a)(2)(A)(i) has been met because the sales...
[On the Way to Culture-Sensitive Patient Information Materials: Results of a Focus Group Study].
Ries, Zivile; Frank, Fabian; Bermejo, Isaac; Kalaitsidou, Chariklia; Zill, Jördis; Dirmaier, Jörg; Härter, Martin; Bengel, Jürgen; Hölzel, Lars
2018-06-01
This study was part of a double-blind randomised controlled trial aimed to evaluate the effects of culture-sensitive patient information materials (PIM) compared with standard translated material. The study aimed to obtain the data for the development of culture sensitive PIM about unipolar depression for the 4 largest migrant groups in Germany (Turkish, Polish, Russian and Italian migration background). A qualitative study using 4 manual-based focus groups (FG), one for each migrant group, with 29 participants (9 with a Turkish (TüG), 8 with a Polish (PoG), 5 with a Russian (RuG) and 7 with an Italian (ItG) migration background) was conducted. The discussions were recorded, transcribed and analyzed using qualitative content analysis. 7 categories were identified. For the (1.) development of a good culture-sensitive PIM an easy language, a clear structure, an assessable extent of information and the avoidance of stereotypes were highlighted cross-culturally in all four FG. RuG and PoG had the largest (2.) lack of information about the German health care system. Concerning the (3.) illness perception RuG named problems with recognizing and understanding depression. PoG, RuG and TüG thematized (4.) feared consequences of the illness and of professional helpseeking. ItG, PoG, RuG had fears concerning (5.) psychotropic drugs as a result from insufficient knowledge about medication. For (6.) doctor-patient relationship cultural specifics were identified in RuG and TüG and for (7.) migration or culture specific reasons for depression in RuG, ItG and TüG. Although the identified categories were relevant for all or for the majority of migrant groups, for most categories specific cultural aspects were discovered. These findings show the importance of a culture sensitive adaptation of PIM. © Georg Thieme Verlag KG Stuttgart · New York.
Energy-Effective Rotation Equipment
Directory of Open Access Journals (Sweden)
V. G. Kascheev
2013-01-01
Full Text Available The article presents invention, which allows to create compact and cheap fog-forming devices for industrial hothouses (plants, greenhouses, storehouses, testing polygons and other Objects. Besides, this invention gives the possibilities to modernize the traversers of gas-water fire-fighting type AGVS-100 or AGVS-150, using turbojet engines. Utilization of fog-forming machines among fire-fighting devices will increase the effectiveness in fire-fighting of forest and industrial Objects and oil fields.
Directory of Open Access Journals (Sweden)
Biruk Ayenew
2012-10-01
Full Text Available Different mechanisms are tried so far to reduce the production cost of plant tissue culture through increasing multiplication rate and/or substituting expensive components for wider usage of the technology. Subsequently, replacing the most common gelling agent, agar, took an attention since higher proportion of media cost comes from it. Up to now different alternatives were tried though they have drawbacks due to their inherent chemical characteristics. Therefore the search for new alternatives like Enset ventricosum is important. Enset flour, ‘Bulla’, has been tried in this study for the first time to substitute agar and showed no significant difference for shoots number, root number, shoot height, leaf number and an associated fresh weight of the plantlets besides good gelling ability than Agar. Subsequently, ‘Bulla’ at 80g L-1 gelled well and gave 11.8 shoots with 0.95g and 13.33 roots having 1.37 cm length. This rate can also save up to 76 % cost of gelling though significant difference was found for root length of 3.23 cm with Agar, 8 g L-1. This indicates further study on biochemical and/ or hormonal activity and across crop genotypes to use ‘Bulla’ as a cheap alternative commercial gelling agent.
Directory of Open Access Journals (Sweden)
Mozhgan Jariani
2011-12-01
Conclusion: progressive muscle relaxation can reduce the amount of anxiety, and systolic and diastolic blood pressure of the patients with myocardial infarction hospitalized in CCU ward, therefore it can play an effective role as a supplement non-medicinal, simple and cheap treatment for these patients
Guo, Tianyang; Fang, Pingping; Jiang, Juanjuan; Zhang, Feng; Yong, Wei; Liu, Jiahui; Dong, Yiyang
2016-11-04
A rapid method to screen and quantify multi-class analytic targets in red wine has been developed by direct analysis in real time (DART) coupled with triple quadruple tandem mass spectrometry (QqQ-MS). A modified QuEChERS (Quick, Easy, Cheap, Effective, Rugged, and Safe) procedure was used for increasing analytical speed and reducing matrix effect, and the multiple reaction monitoring (MRM) in DART-MS/MS ensured accurate analysis. One bottle of wine containing 50 pesticides and 12 adulterants, i.e., preservatives, antioxidant, sweeteners, and azo dyes, could be totally determined less than 12min. This method exhibited proper linearity (R 2 ≥0.99) in the range of 1-1000ng/mL for pesticides and 10-5000ng/mL for adulterants. The limits of detection (LODs) were obtained in a 0.5-50ng/mL range for pesticides and 5-50ng/mL range for adulterants, and the limits of quantification (LOQs) were in a 1-100ng/mL range for pesticides and 10-250ng/mL range for adulterants. Three spiked levels for each analyte in wine were evaluated, and the recoveries were in a scope of 75-120%. The results demonstrated DART-MS/MS was a rapid and simple method, and could be applied to rapid analyze residual pesticides and illegal adulterants in a large quantities of red wine. Copyright © 2016 Elsevier B.V. All rights reserved.
Decrease of Pirimiphos-Methyl and Deltamethrin Residues in Stored Rice with Post-Harvest Treatment
Directory of Open Access Journals (Sweden)
Chuanshan Yu
2014-05-01
Full Text Available A modified quick, easy, cheap, effective, rugged (QuEChERS method with multi-walled carbon nanotubes (MWCNTs as reversed-dispersive solid phase extraction (r-DSPE material was applied to the analysis of pirimiphos-methyl and deltamethrin residues in stored rice. Two dustable powder (DP formulations (2% pirimiphos-methyl and deltamethrin DP; 5% pirimiphos-methyl DP were applied in simulated storehouse trials in the lab. The residues and dissipation of the two pesticides in stored rice were investigated. Slow dissipation of both pesticides was observed in stored rice. The half-lives of pirimiphos-methyl were 23.9–28.9 days, and those of deltamethrin were 23.9–24.8 days. Residues of pirimiphos-methyl from application rates of 4.5–6.75 a.i. mg/kg (active ingredient milligram per kilogram and 10–15 a.i. mg/kg were 1.6–3.8 mg/kg and 3.0–4.5 mg/kg at 60 days Pre-harvest Interval (PHI. Residues of deltamethrin from an application rate of 0.5–0.75 a.i. mg/kg were 0.13–0.14 mg/kg at 60 days PHI. Both pesticides residues were below the Maximum Residue Limits (MRLs established by the Codex Alimentarius Commission (CAC. Therefore, at the recommended dosages they are safe for use on stored rice.
Multi-residue method for the determination of antibiotics and some of their metabolites in seafood.
Serra-Compte, Albert; Álvarez-Muñoz, Diana; Rodríguez-Mozaz, Sara; Barceló, Damià
2017-06-01
The presence of antibiotics in seafood for human consumption may pose a risk for consumers. A methodology for the analysis of antibiotics in seafood based on QuEChERS (quick, easy, cheap, effective, rugged, and safe) extraction, followed by detection and quantification using liquid chromatography coupled to mass spectrometry was developed. The analytical method was evaluated for the determination of 23 antibiotics (including parent compounds and some metabolites) in fish, mussels and clams. Recoveries ranged between 30% and 70% for most of the compounds and method detection and quantification limits (MDLs and MQLs) were between 0.01 and 0.31 ng/g dry weigh (dw) and 0.02-1.03 ng/g (dw) respectively. Real seafood samples were analysed using this method. Nine antibiotics were found at levels above MDLs; however none of them exceed the maximum residue limits (MRL) established by the authorities. Tetracycline was the most ubiquitous compound, presenting also the highest concentration: 5.63 ng/g (dw) in fish from Netherlands. In addition, an alternative technique based on microbial growth inhibition was explored as semiquantitative detection method of antibiotics in seafood. This methodology could be applied as a fast screening technique for the detection of macrolides and β-lactams in seafood but further research is needed for other antibiotics families. Copyright © 2016 Elsevier Ltd. All rights reserved.
Park, Ki Hun; Choi, Jeong-Heui; Abd El-Aty, A M; Cho, Soon-Kil; Park, Jong-Hyouk; Kim, Bo Mi; Yang, Angel; Na, Tae Woong; Rahman, Musfiqur; Im, Geon-Jae; Shim, Jae-Han
2012-10-15
In this study, a simultaneous method was developed for the determination of spinetoram (XDE-175-J and XDE-175-L) and its demethyl metabolites (N-demethyl-175-J and N-demethyl-175-L) and formyl metabolites (N-formyl-175-J and N-formyl-175-L) in the minor crops; amaranth and parsley. The method uses quick, easy, cheap, effective, rugged, and safe (QuEChERS)-based extraction. Afterwards, the analytes were quantified and confirmed via liquid chromatography-electrospray ionisation tandem mass spectrometry (LC-ESI-MS/MS) in the positive ion mode using multiple reaction monitoring (MRM). Calibration curves were linear over the calibration ranges for all the analytes tested with r(2)>0.993. Limits of detection and quantitation were 0.01 and 0.03 mg/kg for all the tested analytes in amaranth and parsley, respectively. Recovery values, at spiking levels 0.05 and 0.25 mg/kg, ranged from 71.0% to 115.2% with relative standard deviations parsley. This method was applied to field-incurred samples and was shown to provide an adequate sensitivity and performance for the simultaneous determination of spinetoram and metabolites. To the best of our knowledge, this is the first time spinetoram and its metabolites were quantified using LC-MS/MS in minor crops. Copyright © 2012 Elsevier Ltd. All rights reserved.
Garrido Frenich, Antonia; Martín Fernández, María del Mar; Díaz Moreno, Laura; Martínez Vidal, Jose Lúis; López-Gutiérrez, Noelia
2012-01-01
A simple, rapid, and reliable multiresidue method to determine 84 pesticides in potato and carrot samples by ultra-performance liquid chromatography coupled to MS/MS has been developed and fully validated for routine analysis according to ISO/IEC 17025:2005. The method makes use of a buffered Quick, Easy, Cheap, Effective, Rugged, and Safe (QuEChERS) sample preparation procedure based on a single extraction with acidified acetonitrile, followed by partitioning with salts. Chromatographic conditions were optimized in order to achieve a rapid separation in the multiple reaction monitoring mode. Performance characteristics of the method, including an estimation of measurement uncertainty using validation data, are reported for both matrixes. Calibration curves were linear from 0.010 to 0.150 mg/kg for most compounds. The LOD and LOQ were 0.006 and 0.010 mg/kg, respectively, except for fluorocloridone, fluquinconazol, and hexitiazox, which were 0.030 and 0.050 mg/kg, respectively. Recoveries obtained were in the range 70-116%, with intraday precision values < or = 20% RSD and interday precision values < or = 25% RSD at two different concentration levels. The overall uncertainty of the method was estimated at two concentrations as being lower than 34% in all cases. The method has been applied to the analysis of 70 vegetable samples, and imidacloprid and linuron were the pesticides most frequently found in potato and carrot commodities, respectively.
Cheng, Yan; Nie, Xue-Mei; Wu, Han-Qiu; Hong, Yun-He; Yang, Bing-Cheng; Liu, Tong; Zhao, Dan; Wang, Jian-Feng; Yao, Gui-Hong; Zhang, Feng
2017-01-15
A simple and universal analytical method based on ultra-high performance liquid chromatography-tandem mass spectrometry (UHPLC-MS/MS) for high throughput screening of 21 bisphenols, bisphenols digycidyl ethers and their derivatives in dairy products was developed. Response Surface Methodology (RSM) was used to optimize sample preparation conditions based on a quick, easy, cheap, effective, rugged and safe (QuEChERS) method. The analytes were extracted by using 15 mL acetonitrile with 1% acetic acid, and the extracts were further purified by using 190 mg of C18 and 390 mg of PSA. The extracts were analyzed by UHPLC-MS/MS with electrospray ionization (ESI) source. Linearity was assessed by using matrix-matched standard calibration and good correlation coefficients (r 2 > 0.99) were obtained. The limits of quantitation (LOQs) for the analytes ranged from 0.02 to 5 μg kg -1 . The extraction recoveries were in a range of 88.2%-108.2%. Good method reproducibility in terms of intra- and inter-day precision was observed, yielding relative standard deviations (RSDs) less than 8.9% and 9.9%, respectively. The validation method results revealed that the proposed method was sensitive and reliable. Finally, this method was successfully applied to dairy product analysis. Copyright © 2016 Elsevier B.V. All rights reserved.
Kabir, Md Humayun; Abd El-Aty, A M; Kim, Sung-Woo; Lee, Han Sol; Rahman, Md Musfiqur; Lee, Young-Jun; Chung, Hyung Suk; Lieu, Truong; Choi, Jeong-Heui; Shin, Ho-Chul; Im, Geon-Jae; Hong, Su Myeong; Shim, Jae-Han
2016-11-01
This study was conducted to characterize the residual level and perform a risk assessment on buprofezin formulated as an emulsifiable concentrate, wettable powder, and suspension concentrate over various treatment schedules in plum (Prunus domestica). The samples were extracted with an AOAC quick, easy, cheap, effective, rugged, and safe, 'QuEChERS', method after major modifications. As intrinsic interferences were observed in blank plum samples following dispersive-solid phase extraction (consisting of primary secondary amine and C 18 sorbents), amino cartridges were used for solid-phase extraction. Analysis was carried out using liquid chromatography with diode array detection and confirmed by liquid chromatography-tandem mass spectrometry. The method showed excellent linearity with determination coefficient (R 2 = 1) and satisfactory recoveries (at two spiking levels, 0.5 and 2.5 mg/kg) between 90.98 and 94.74% with relative standard deviation (RSD) ≤8%. The limit of quantification (0.05 mg/kg) was considerably lower than the maximum residue limit (2 mg/kg) set by the Codex Alimentarius. Absolute residue levels for emulsifiable concentrates were highest, perhaps owing to the dilution rate and adjuvant. Notably, all formulation residues were lower than the maximum residue limit, and safety data proved that the fruits are safe for consumers. Copyright © 2016 John Wiley & Sons, Ltd. Copyright © 2016 John Wiley & Sons, Ltd.
Serach for polarization effects in the antiproton production process
It is proposed to study polarization effects in the production of antiprotons at the PS test beam line T11 at 3.5 GeV/c momentum. A polarization in the production process has never been studied but if existing it would allow for a rather simple and cheap way to generate a polarized antiproton beam with the existing facilities at CERN.
Kruisdijk, F.R.; Hendriksen, I.J.M.; Tak, E.C.P.M.; Beekman, A.T.F.; Hopman-Rock, M.
2012-01-01
Background: The societal and personal burden of depressive illness is considerable. Despite the developments in treatment strategies, the effectiveness of both medication and psychotherapy is not ideal. Physical activity, including exercise, is a relatively cheap and non-harmful lifestyle
Kruisdijk, F.R.; Hendriksen, I.J.M.; Tak, E.C.P.M.; Beekman, A.T.F.; Hopman-Rock, M.
2012-01-01
Background. The societal and personal burden of depressive illness is considerable. Despite the developments in treatment strategies, the effectiveness of both medication and psychotherapy is not ideal. Physical activity, including exercise, is a relatively cheap and non-harmful lifestyle
In vitro evaluation of the effect of aqueous extracts of Agave sisalana ...
African Journals Online (AJOL)
SARAH
2015-05-30
May 30, 2015 ... inhibitory concentration (MIC) of Agave sisalana extracts was 3% (PI ≤ 97%).For the C. citratus ... posts, lumbar support belts, rugs, slippers, and cloths (FAO .... statistical analysis revealed statistically significant differences ...
Simulation and Analysis of Topographic Effect on Land Surface Albedo over Mountainous Areas
Hao, D.; Wen, J.; Xiao, Q.
2017-12-01
Land surface albedo is one of the significant geophysical variables affecting the Earth's climate and controlling the surface radiation budget. Topography leads to the formation of shadows and the redistribution of incident radiation, which complicates the modeling and estimation of the land surface albedo. Some studies show that neglecting the topography effect may lead to significant bias in estimating the land surface albedo for the sloping terrain. However, for the composite sloping terrain, the topographic effects on the albedo remain unclear. Accurately estimating the sub-topographic effect on the land surface albedo over the composite sloping terrain presents a challenge for remote sensing modeling and applications. In our study, we focus on the development of a simplified estimation method for land surface albedo including black-sky albedo (BSA) and white-sky albedo (WSA) of the composite sloping terrain at a kilometer scale based on the fine scale DEM (30m) and quantitatively investigate and understand the topographic effects on the albedo. The albedo is affected by various factors such as solar zenith angle (SZA), solar azimuth angle (SAA), shadows, terrain occlusion, and slope and aspect distribution of the micro-slopes. When SZA is 30°, the absolute and relative deviations between the BSA of flat terrain and that of rugged terrain reaches 0.12 and 50%, respectively. When the mean slope of the terrain is 30.63° and SZA=30°, the absolute deviation of BSA caused by SAA can reach 0.04. The maximal relative and relative deviation between the WSA of flat terrain and that of rugged terrain reaches 0.08 and 50%. These results demonstrate that the topographic effect has to be taken into account in the albedo estimation.
Rasche, Claudia; Fournes, Britta; Dirks, Uwe; Speer, Karl
2015-07-17
Some steps of the QuEChERS method for the analysis of pesticides with GC-MS/MS in cereals and dried fruits were improved or simplified. For the latter, a mixing vessel with stator-rotor-system proved to be advantageous. The extraction procedure of dried fruits is much easier and safer than the Ultra Turrax and results in excellent validation data at a concentration level of 0.01mg/kg (116 of 118 analytes with recoveries in the range of 70-120%, 117 of 118 analytes with RSD 7%), predominantly organochlorines showed recoveries of apple purée extract in combination with analyte protectants, allowed for a qualitative and quantitative analysis of 120 pesticides in different matrix extracts (tomato, red pepper, sour cherries, dried apples, black currant powder, raisins, wheat flour, rolled oats, wheat germ). The analyte protectants leveled the differences in the matrix-induced protection effect of the analyzed extracts over a wide range. The majority of the pesticides were analyzed with good analytical results (recoveries in the range of 70-120% and RSD <20%). Copyright © 2015 Elsevier B.V. All rights reserved.
Loman, N.G.M. (Niek)
2012-01-01
Auteur: N.G.M. (Niek) Loman Begeleiders: Ing. H.W. (Pim) van den Dool, Discrete Technologie en Productie Automatisering, RUG Dr.ir. I. (Ingrid) ten Have MBA, Interfac. Opleidingsinst. Technische Bedrijfskunde, RUG Drs. C.M. (Karin) Ree, Bèta Wetenschapswinkel, Science & Society Group, RUG Drs. R.W.
Zhang, Liuyang; Gong, Hao
2015-01-01
Carbon-based substrates offer unprecedented advantages in lightweight supercapacitors. However, it is still challenging to achieve high coverage or loading. Different from the traditional belief that a lack of defects or functional groups is the cause of poor growth on carbon-based substrates, we reckon that the major cause is the discrepancy between the hydrophilic nature of the metal oxide/hydroxide and the hydrophobic nature of carbon. To solve this incompatibility, we introduced ethanol into the precursor solution. The method to synthesize nickel copper hydroxide on carbon fiber paper employs only water and ethanol, in addition to nickel acetate and copper acetate. The results revealed good growth and tight adhesion of active materials on carbon fiber paper substrates. The specific capacitance and energy density per total weight of the active material plus substrate (carbon fiber paper, current collector) reached 770 F g−1 and 33 Wh kg−1 (1798 F g−1 and 54 Wh kg−1 per weight of the active materials), owing to the high loading of active material and the light weight of carbon fiber paper. These results signified the achievability of light, cheap and high-performance supercapacitors by an environmental-friendly approach. PMID:26643665
Zhang, Liuyang; Gong, Hao
2015-12-01
Carbon-based substrates offer unprecedented advantages in lightweight supercapacitors. However, it is still challenging to achieve high coverage or loading. Different from the traditional belief that a lack of defects or functional groups is the cause of poor growth on carbon-based substrates, we reckon that the major cause is the discrepancy between the hydrophilic nature of the metal oxide/hydroxide and the hydrophobic nature of carbon. To solve this incompatibility, we introduced ethanol into the precursor solution. The method to synthesize nickel copper hydroxide on carbon fiber paper employs only water and ethanol, in addition to nickel acetate and copper acetate. The results revealed good growth and tight adhesion of active materials on carbon fiber paper substrates. The specific capacitance and energy density per total weight of the active material plus substrate (carbon fiber paper, current collector) reached 770 F g-1 and 33 Wh kg-1 (1798 F g-1 and 54 Wh kg-1 per weight of the active materials), owing to the high loading of active material and the light weight of carbon fiber paper. These results signified the achievability of light, cheap and high-performance supercapacitors by an environmental-friendly approach.
Urinary tract infection after retrograde urethrogram in children: A multicenter study.
Malhotra, Neha R; Green, Jared R; Rigsby, Cynthia K; Holl, Jane L; Cheng, Earl Y; Johnson, Emilie K
2017-12-01
The risk of post-procedural urinary tract infection (ppUTI) after retrograde urethrogram (RUG) has not been well quantified. Prophylactic antibiotics may reduce the risk, but must be weighed against the risks of antibiotic resistance. Prior research has shown that this risk is variable after voiding cystourethrogram (0-42% reported ppUTI rate) and appears to be low after urodynamics (0-4.8%) but this risk has not been well documented for patients undergoing RUG. We aimed to (1) describe the rate of ppUTI after RUG, and (2) examine factors associated with use of antibiotics at the time of RUG. We conducted a retrospective cohort study of children undergoing RUG at two hospitals January 1, 2004, to December 31, 2014. ppUTI within 7 days was measured. Antibiotic prophylaxis was determined. Relationships between clinical characteristics and receipt of pre-procedure antibiotics were evaluated using univariate statistics. Forty-two patients (100% male, median age 11.7 years) underwent 47 RUGs. Indications included trauma (27%), hypospadias (17%), and non-hypospadias (27%) stricture. Study indication and antibiotic administration practices are illustrated in the Figure. Three patients (6.4%) had a history of posterior urethral valves (PUV); one had neurogenic bladder (NGB) (2.4%). Two (4%) studies were performed within 30 days of a clinical UTI and 11% had a positive urinalysis or culture within 30 days pre-RUG. UTI in the 30 days before RUG was not associated with antibiotic prescription (p > 0.99). One child (2.1%; 95% CI 0-6.3%) had a ppUTI: a 7-year-old, uncircumcised male with a history of PUV and voiding dysfunction who was asymptomatic at the time of RUG. Although the risk of ppUTI after RUG appears to be low, the rare occurrence of an iatrogenic UTI can lead to high cost and patient morbidity, particularly in cases similar to our patients who required inpatient admission for intravenous antibiotics. To help balance the risk of UTI with the associated healthcare
Mountain Biking: Does Rough Terrain Make Rugged Riders?
Cinque, Chris
1987-01-01
No formal research has been conducted on the training effects and injury risks of all-terrain bicycles in mountain biking, but experience indicates they are apparently safe and may provide greater fitness benefits than traditional bicycles. The bicycles are described, and their apparent benefits are discussed. (MT)
Managing Chemotherapy Side Effects: Nerve Changes
... Nerve Changes Try these tips from others: “Prevent falls.” l Move rugs out of your path so you won’t trip. l Put up rails on the walls and in the bathroom. l Put bathmats in the shower and bathtub. l Wear sturdy shoes. l Use a cane. “Take extra care in the kitchen and shower.” ...
Caparros Megido, Rudy; Alabi, Taofic; Nieus, Clément; Blecker, Christophe; Danthine, Sabine; Bogaert, Jan; Haubruge, Éric; Francis, Frédéric
2016-01-30
The health status of the indigenous people of Ratanakiri Province, Cambodia, is significantly lower compared with that of the rest of the nation. The domestication and mass production of insects may represent a sustainable, cost effective and high quality alternative source of protein to traditional livestock. This study aimed to optimise a cheap and residential cricket breeding system based on unused wild resources. The development of crickets, Teleogryllus testaceus (Walker), under seven diets composed of taro aerial parts, young cassava leaves, young cashew leaves and brown rice flour (with or without banana slices), versus a traditionally used broiler feed diet was studied. Cricket mortality was low in all diets, except the two cashew-based diets. Total biomass was significantly higher under the broiler feed, in addition to the two diets containing a combination of cassava leaf powder and brown rice. Yet, crickets fed with the taro diet had the highest percentage of protein. Concerning the breeding system cost, units using cassava leaves were the cheapest. Diets based on cassava leaves seem to be the most promising. Nevertheless, to produce crickets with a high body mass and a high protein level, a new experiments must be devised in which cassava leaf maturity will be adapted to fit with the cricket growth stage. Moreover, to reduce the cost of the breeding units, handmade local products should be used instead of purchased components. © 2015 Society of Chemical Industry.
Comparison of radiographic and sonographic urethrography for assessing urethral strictures
International Nuclear Information System (INIS)
Babnik Peskar, Darja; Visnar Perovic, Alenka
2004-01-01
The aim of this study was to compare radiourethrography (RUG) and sonourethrography (SUG) for assessment of urethral strictures and to evaluate whether RUG underestimates stricture length, as has been reported. Fifty-one men with suspected urethral strictures were evaluated by both methods performed consecutively. Stricture lengths and diameters measured by RUG were significantly greater (mean 22%, 30%) than those measured by SUG because of radiographic magnification. Both methods, however, detected a similar percentage lumen reduction and similarly graded stricture severity. Equally significant non-correlation between both methods for length measurements in the bulbar and penile urethra (p 2 =0.33 and 0.34, respectively) supported radiographic magnification. Previous inaccuracies appear to relate to RUG measurements of the central tight stricture (mean 44% of the entire length in our series), not the full stricture length. Use of sonographic contrast medium intra-urethrally improved the definition of long narrow strictures. The SUG gave information about peri-urethral tissues not provided by RUG. Once radiographic magnification was taken into account, there were no major differences in the assessment of urethral strictures by both methods. With correct measurement methods, RUG does not underestimate stricture length. For full assessment, the combination of RUG and SUG, which gives information about peri-urethral disease, is optimal in many patients. (orig.)
Al Naggar, Yahya; Codling, Garry; Vogt, Anja; Naiem, Elsaied; Mona, Mohamed; Seif, Amal; Giesy, John P
2015-04-01
There is no clear single factor to date that explains colony loss in bees, but one factor proposed is the wide-spread application of agrochemicals. Concentrations of 14 organophosphorous insecticides (OPs) in honey bees (Apis mellifera) and hive matrices (honey and pollen) were measured to assess their hazard to honey bees. Samples were collected during spring and summer of 2013, from 5 provinces in the middle delta of Egypt. LC/MS-MS was used to identify and quantify individual OPs by use of a modified Quick Easy Cheap Effective Rugged Safe (QuEChERS) method. Pesticides were detected more frequently in samples collected during summer. Pollen contained the greatest concentrations of OPs. Profenofos, chlorpyrifos, malation and diazinon were the most frequently detected OPs. In contrast, ethoprop, phorate, coumaphos and chlorpyrifos-oxon were not detected. A toxic units approach, with lethality as the endpoint was used in an additive model to assess the cumulative potential for adverse effects posed by OPs. Hazard quotients (HQs) in honey and pollen ranged from 0.01-0.05 during spring and from 0.02-0.08 during summer, respectively. HQs based on lethality due to direct exposure of adult worker bees to OPs during spring and summer ranged from 0.04 to 0.1 for best and worst case respectively. It is concluded that direct exposure and/or dietary exposure to OPs in honey and pollen pose little threat due to lethality of bees in Egypt. Copyright © 2014 Elsevier Inc. All rights reserved.
Howard, A.F.V.; Adongo, E.A.; Vulule, J.; Githure, J.
2011-01-01
More focus is given to mosquito larval control due to the necessity to use several control techniques together in integrated vector management programmes. Botanical products are thought to be able to provide effective, sustainable and cheap mosquito larval control tools. However, bio-larvicides like
Terris-Prestholt, Fern; Vickerman, Peter; Torres-Rueda, Sergio; Santesso, Nancy; Sweeney, Sedona; Mallma, Patricia; Shelley, Katharine D; Garcia, Patricia J; Bronzan, Rachel; Gill, Michelle M; Broutet, Nathalie; Wi, Teodora; Watts, Charlotte; Mabey, David; Peeling, Rosanna W; Newman, Lori
2015-06-01
Rapid plasma reagin (RPR) is frequently used to test women for maternal syphilis. Rapid syphilis immunochromatographic strip tests detecting only Treponema pallidum antibodies (single RSTs) or both treponemal and non-treponemal antibodies (dual RSTs) are now available. This study assessed the cost-effectiveness of algorithms using these tests to screen pregnant women. Observed costs of maternal syphilis screening and treatment using clinic-based RPR and single RSTs in 20 clinics across Peru, Tanzania, and Zambia were used to model the cost-effectiveness of algorithms using combinations of RPR, single, and dual RSTs, and no and mass treatment. Sensitivity analyses determined drivers of key results. Although this analysis found screening using RPR to be relatively cheap, most (>70%) true cases went untreated. Algorithms using single RSTs were the most cost-effective in all observed settings, followed by dual RSTs, which became the most cost-effective if dual RST costs were halved. Single test algorithms dominated most sequential testing algorithms, although sequential algorithms reduced overtreatment. Mass treatment was relatively cheap and effective in the absence of screening supplies, though treated many uninfected women. This analysis highlights the advantages of introducing RSTs in three diverse settings. The results should be applicable to other similar settings. Copyright © 2015 International Federation of Gynecology and Obstetrics. All rights reserved.
Rice, William E
2004-12-01
A sub-surface desert water harvester was constructed in the sagebrush steppe habitat of south-central Idaho, U.S.A. The desert water harvester utilizes a buried micro-catchment and three buried storage tanks to augment water for wildlife during the dry season. In this region, mean annual precipitation (MAP) ranges between about 150-250 mm (6"-10"), 70% of which falls during the cold season, November to May. Mid-summer through early autumn, June through October, is the dry portion of the year. During this period, the sub-surface water harvester provides supplemental water for wildlife for 30-90 days, depending upon the precipitation that year. The desert water harvester is constructed with commonly available, "over the counter" materials. The micro-catchment is made of a square-shaped, 20 mL. "PERMALON" polyethylene pond liner (approximately 22.9 m x 22.9 m = 523 m2) buried at a depth of about 60 cm. A PVC pipe connects the harvester with two storage tanks and a drinking trough. The total capacity of the water harvester is about 4777 L (1262 U.S. gallons) which includes three underground storage tanks, a trough and pipes. The drinking trough is refined with an access ramp for birds and small animals. The technology is simple, cheap, and durable and can be adapted to other uses, e.g. drip irrigation, short-term water for small livestock, poultry farming etc. The desert water harvester can be used to concentrate and collect water from precipitation and run-off in semi-arid and arid regions. Water harvested in such a relatively small area will not impact the ground water table but it should help to grow small areas of crops or vegetables to aid villagers in self-sufficiency.
CsI calorimeter with 3-D position resolution
International Nuclear Information System (INIS)
Schopper, F.; Andritschke, R.; Shaw, H.; Nefzger, C.; Zoglauer, A.; Schoenfelder, V.; Kanbach, G.
2000-01-01
New γ-ray calorimeter have been developed for the MEGA Compton camera. They consist of arrays of small CsI(Tl) scintillator bars read out by Silicon PIN-diodes and low noise, self-triggering frontend electronics. The length of the bars (the thickness of the calorimeter) can be varied for different applications to fit the stopping power needed and the light loss tolerable. In this paper we present calibration results from 2 cm long bars with diodes on one side, and 8 cm long bars with diodes on two opposite sides. Double-sided readout gives 3-D information of interactions which will be used to overcome the limited position resolution in Anger-cameras at high energies. Simpler detection devices like Anger-cameras might finally resolve only the centre of gravity. As events from γ-rays with energies of MeV do extend over several cm, it is a prerequisite for an imaging device to resolve the interaction structure in detail. Combining CsI(Tl) scintillators, Silicon PIN-photodiodes and frontend electronics inside the housing results in a cheap rugged design. While the development in our institute is mainly done for the Compton camera prototype, many other applications are conceivable
The hidden cost of Canmada's cheap power
International Nuclear Information System (INIS)
Raphals, P.
1992-01-01
The environmental impacts from the expansion of the James Bay Hydroelectric Scheme in Northern Quebec are discussed. The current project provides 10 GW equivalent to forty percent of Hydro-Quebec's total capacity. The two proposed expansions account for over 11 GW but impinge upon the native Crees' land. Other topics discussed include the legal implications of previous agreements, mercury levels in fish, effects on the diversity of flora, fauna and fish and the gigantic earthworks which dam construction requires. (UK)
DEFF Research Database (Denmark)
Billinger, Stephan; Stieglitz, Nils; Schumacher, Terry
2014-01-01
This paper presents findings from a laboratory experiment on human decision-making in a complex combinatorial task. We find strong evidence for a behavioral model of adaptive search. Success narrows down search to the neighborhood of the status quo, while failure promotes gradually more explorative...... for local improvements too early. We derive stylized decision rules that generate the search behavior observed in the experiment and discuss the implications of our findings for individual decision-making and organizational search....
Li, Jian; Chen, Tian; Wang, Yuwei; Shi, Zhixiong; Zhou, Xianqing; Sun, Zhiwei; Wang, Dejun; Wu, Yongning
2017-02-01
Two simplified sample preparation procedures for simultaneous extraction and clean-up of tetrabromobisphenol A, α-, β-, and γ-hexabromocyclododecane and polybrominated diphenyl ethers in human serum were developed and validated. The first procedure was based on solid-phase extraction. Sample extraction, purification, and lipid removal were carried out directly on an Oasis HLB cartridge. The second procedure was a quick, easy, cheap, effective, rugged, and safe-based approach using octadecyl-modified silica particles as a sorbent. After sample extraction and cleanup, tetrabromobisphenol A/hexabromocyclododecane was separated from polybrominated diphenyl ethers by using a Si-based cartridge. Tetrabromobisphenol A and hexabromocyclododecane were then detected by high-performance liquid chromatography coupled to tandem mass spectrometry, while polybrominated diphenyl ethers were detected by gas chromatography coupled to tandem mass spectrometry. The results of the spike recovery test using fetal bovine serum showed that the average recoveries of the analytes ranged from 87.3 to 115.3% with relative standard deviations equal to or lower than 13.4 %. Limits of detection of the analytes were in the range of 0.4-19 pg/mL except for decabromodiphenyl ether. The developed method was successfully applied to routine analysis of human serum samples from occupational workers and the general population. Extremely high serum polybrominated diphenyl ethers levels up to 3.32 × 10 4 ng/g lipid weight were found in occupational workers. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Dissipation and Residues of Dichlorprop-P and Bentazone in Wheat-Field Ecosystem
Directory of Open Access Journals (Sweden)
Xiaoxiao Feng
2016-05-01
Full Text Available Dichlorprop-P and bentazone have been widely used in the prevention and control of weeds in wheat field ecosystems. There is a concern that pesticide residues and metabolites remain on or in the wheat. Thus, the study of the determination and monitoring of their residues in wheat has important significance. A rapid, simple and reliable QuEChERS (Quick, Easy, Cheap, Effective, Rugged and Safe method was modified, developed and validated for the determination of dichlorprop-P, bentazone and its metabolites (6-hydroxy-bentazone and 8-hydroxy-bentazone in wheat (wheat plants, wheat straw and grains of wheat using high-performance liquid chromatography coupled with tandem mass spectrometry (HPLC-MS/MS. The average recoveries of this method ranged from 72.9% to 108.7%, and the limits of quantification (LOQs were 2.5–12 μg/kg. The dissipation and final residue of four compounds in three provinces (Shandong, Jiangsu and Heilongjiang in China were studied. The trial results showed that the half-lives of dichlorprop-P and bentazone were 1.9–2.5 days and 0.5–2.4 days in wheat plants, respectively. The terminal residues in grains of wheat and wheat straw at harvest were all much below the maximum residue limit (MRL of 0.2 mg/kg for dichlorprop-P and 0.1 mg/kg for bentazone established by the European Union (EU, Regulation No. 396/2005.
Kapoor, Upasana; Srivastava, M K; Srivastava, Ashutosh Kumar; Patel, D K; Garg, Veena; Srivastava, L P
2013-03-01
A total of 250 samples-including fruits, fruit juices, and baby foods (50 samples each), vegetables (70 samples), and cereals (30 samples)-were collected from Lucknow, India, and analyzed for the presence of imidacloprid residues. The QuEChERS (quick, easy, cheap, effective, rugged, and safe) method of extraction coupled with high-performance liquid chromatographic analysis were carried out, and imidacloprid residues were qualitatively confirmed by liquid chromatography-mass spectrometry. Imidacloprid was not detected in samples of fruit juices and baby foods. It was, however, detected in 38 samples of fruits, vegetables, and cereals, which is about 15.20% of the total samples. Of samples of fruits, 22% showed the presence of imidacloprid, and 2% of samples showed residues above the maximal residue limit. Although imidacloprid was detected in 24% of vegetable samples, only 5.71% showed the presence of imidacloprid above the maximal residue limit. However, 33% of cereal samples showed the presence of imidacloprid, and about 3% of samples were above the maximal residue limit. The calculated estimated daily intake ranged between 0.004 and 0.131 µg/kg body weight, and the hazard indices ranged from 0.007 to 0.218 for these food commodities. It is therefore indicated that lifetime consumption of vegetables, fruits, fruit juices, baby foods, wheat, rice, and pulses may not pose a health hazard for the population of Lucknow because the hazard indices for imidacloprid residues were below one. Copyright © 2012 SETAC.
Cang, Tao; Sun, Caixia; Zhao, Hua; Tang, Tao; Zhang, Changpeng; Yu, Ruixian; Wang, Xinquan; Wang, Qiang; Dai, Fen; Zhao, Xueping
2018-02-01
A risk assessment for imidacloprid applied on strawberries under different conditions was performed after residue determination using the quick, cheap, effective, rugged, and safe (QuEChERS) method. The application conditions were varied according to the applied dosage, addition of a plant oil or organosilicon surfactant, water volume, and sprayer type. The degradation dynamics of imidacloprid on strawberries followed first-order kinetics. At applied doses of 30-60 g a.i. ha -1 , the half-lives of imidacloprid were 2.89-3.46, 1.98-3.65, and 2.57-2.77 days after application without a surfactant or with a plant oil or organosilicon surfactant, respectively. For water volumes of 112.5, 225, 450, 675, and 900 L ha -1 , the half-lives of imidacloprid applied in the presence of the plant oil surfactant were 3.30, 7.70, 5.33, 7.70, and 6.30 days, respectively. The half-lives after application with a knapsack mist duster, electric sprayer, and manual sprayer were 2.16, 5.77, and 7.70 days, respectively. The health risk assessment revealed risk quotients less than 1 in all cases, indicating that the application of imidacloprid poses a low health risk to humans after a pre-harvest interval of 10 days under our application conditions. The risk assessment results can provide reference data for setting a reasonable maximum residue limit for imidacloprid on strawberries in China.
Arrebola-Liébanas, Francisco Javier; Abdo, María Angeles Herrera; Moreno, José Luis Fernandez; Martínez-Vidal, José L; Frenich, Antonia Garrido
2014-01-01
A simple and fast method has been developed for determining relevant quaternary ammonium compounds in cucumber and orange samples. The target compounds were benzoalkonium chloride (BAC-10, BAC-12, BAC-14, and BAC-16), didecyldimethylammonium chloride, and benzethonium chloride, all frequently used biocides in the agrifood industry. An extraction based on the buffered Quick, Easy, Cheap, Effective, Rugged, and Safe method and determination by ultra-performance LC/MS/MS that eluted the biocides in less than 5 min were used. The method was fully validated and implemented in a UNE-EN-ISO/IEC 17025 accredited laboratory for its application to the analysis of real samples. Performance characteristics of the method are reported, including an estimation of measurement uncertainty. Calibration curves were set between 0.01 and 0.150 mg/kg, LOD values were always between 0.4 and 1.0 microg/kg, LOQ values were in the range 1-4 microg/kg, recovery was between 81 and 115%, intraday and interday precision were always lower than 17% (expressed as RSD), and expanded uncertainty was always lower than 40%. The validation was accomplished for the two studied matrixes at spiking concentrations of 0.011 and 0.050 mg/kg. The method has been applied to the analysis of 30 cucumber and orange samples that were found to contain concentrations of BAC-12 that ranged between 0.015 and 0.210 mg/kg and of BAC-14 between 0.018 and 0.081 mg/kg.
Qin, Yuhong; Zhang, Jingru; Zhang, Yuan; Li, Fangbing; Han, Yongtao; Zou, Nan; Xu, Haowei; Qian, Meiyuan; Pan, Canping
2016-09-02
An automated multi-plug filtration cleanup (m-PFC) method on modified QuEChERS (quick, easy, cheap, effective, rugged, and safe) extracts was developed. The automatic device was aimed to reduce labor-consuming manual operation workload in the cleanup steps. It could control the volume and the speed of pulling and pushing cycles accurately. In this work, m-PFC was based on multi-walled carbon nanotubes (MWCNTs) mixed with other sorbents and anhydrous magnesium sulfate (MgSO4) in a packed tip for analysis of pesticide multi-residues in crop commodities followed by liquid chromatography with tandem mass spectrometric (LC-MS/MS) detection. It was validated by analyzing 25 pesticides in six representative matrices spiked at two concentration levels of 10 and 100μg/kg. Salts, sorbents, m-PFC procedure, automated pulling and pushing volume, automated pulling speed, and pushing speed for each matrix were optimized. After optimization, two general automated m-PFC methods were introduced to relatively simple (apple, citrus fruit, peanut) and relatively complex (spinach, leek, green tea) matrices. Spike recoveries were within 83 and 108% and 1-14% RSD for most analytes in the tested matrices. Matrix-matched calibrations were performed with the coefficients of determination >0.997 between concentration levels of 10 and 1000μg/kg. The developed method was successfully applied to the determination of pesticide residues in market samples. Copyright © 2016 Elsevier B.V. All rights reserved.
Rahman, Md Musfiqur; Farha, Waziha; Abd El-Aty, A M; Kabir, Md Humayun; Im, So Jeong; Jung, Da-I; Choi, Jeong-Heui; Kim, Sung-Woo; Son, Young Wook; Kwon, Chan-Hyeok; Shin, Ho-Chul; Shim, Jae-Han
2015-05-01
A simultaneous method was developed to analyse thiamethoxam and its metabolite clothianidin in Swiss chard using tandem mass spectrometry (in the positive electrospray ionisation mode using multiple reaction monitoring mode) to estimate the dissipation pattern and the pre-harvest residue limit (PHRL). Thiamethoxam (10%, WG) was sprayed on Swiss chard grown in two different areas under greenhouse conditions at the recommended dose rate of 10 g/20 L water. Samples were collected randomly up to 14 days post-application, extracted using quick, easy, cheap, effective, rugged, safe (QuEChERS) acetate-buffered method and purified via a dispersive solid phase extraction (d-SPE) procedure. Matrix matched calibration showed good linearity with determination coefficients (R(2)) ⩾ 0.998. The limits of detection (LOD) and quantification (LOQ) were 0.007 and 0.02 mg/kg. The method was validated in triplicate at two different spiked concentration levels. Good recoveries (n=3) of 87.48-105.61% with relative standard deviations (RSDs) < 10 were obtained for both analytes. The rate of disappearance of total thiamethoxam residues in/on Swiss chard was best described by first-order kinetics with half-lives of 6.3 and 4.2 days. We predicted from the PHRL curves that if the residues were <19.21 or 26.98 mg/kg at 10 days before harvest, then total thiamethoxam concentrations would be below the maximum residue limits during harvest. Copyright © 2014 Elsevier Ltd. All rights reserved.
Dong, Bizhang; Zhao, Qing; Hu, Jiye
2015-12-01
Residue analysis of emamectin benzoate and lufenuron in cabbage matrices and soil was developed using a quick, easy, cheap, effective, rugged, and safe (QuEChERS) method and ultra high-performance liquid chromatography tandem mass spectrometry (UPLC-MS/MS). The samples were extracted with 1% acetic acid in acetonitrile (v/v) or 1% acetic acid in acetonitrile/water (5:1, v/v) and cleaned up by dispersive solid-phase extraction. Mean recoveries and relative standard deviations (RSDs) in all samples ranged 87.8-100.0 % and 3.6-12.6% for emamectin benzoate and 87.8-104.8 % and 6.2-11.5% for lufenuron, respectively. The validated method was used to evaluate the dissipation rate of emamectin benzoate and lufenuron in cabbage and soil as well as the residual levels in harvested cabbage and soil at different preharvest intervals (PHI). The half-lives of emamectin benzoate and lufenuron were 1.08-2.70 and 1.74-5.04 days in cabbage, and 1.42-4.01 and 0.94-6.18 days in soil, respectively. The terminal residues were below the China maximum residue limits (MRLs) at 3 days for emamectin benzoate (0.1 mg kg(-1)) and European Union MRLs at 5 days for lufenuron (0.5 mg kg(-1)), which suggested that 5 days could be recommended as the PHI for the commercial formulation of emamectin benzoate and lufenuron application in the Chinese cabbage field.
Kang, Di; Zhang, Haizhen; Chen, Yuling; Wang, Fei; Shi, Lihong; Hu, Deyu; Zhang, Kankan
2017-11-01
An optimized quick, easy, cheap, effective, rugged and safe method for the simultaneous determination of difenoconazole, trifloxystrobin and its metabolite trifloxystrobin acid residues in watermelon and soil was developed and validated by gas chromatography with tandem mass spectrometry. The samples were extracted with acetonitrile (1% formic acid) and cleaned up by dispersive solid-phase extraction with octadecylsilane sorbent. The limit of quantification of the method was 0.01 mg/kg, and the limit of detection was 0.003 mg/kg for all three analytes. The recoveries of the fungicides in watermelon, pulp and soil were 72.32-99.20% for difenoconazole, 74.68-87.72% for trifloxystrobin and 78.59-92.66% for trifloxystrobin acid with relative standard deviations of 1.34-14.04%. The dissipation dynamics of difenoconazole and trifloxystrobin in watermelon and soil followed the first-order kinetics with half-lives of 3.2-8.8 days in both locations. The final residue levels of difenoconazole and trifloxystrobin were below 0.1 mg/kg (maximum residue level [MRL] set by China) and 0.2 mg/kg (MRL set by European Union), respectively, in pulp samples collected 14 days after the last application. These results could help Chinese authorities to establish MRL of trifloxystrobin in watermelon and provide guidance for the safe and proper application of both fungicides on watermelon. Copyright © 2017 John Wiley & Sons, Ltd.
The effect of seeding with bacteria on biogas production rate
Energy Technology Data Exchange (ETDEWEB)
Dangoggo, S.M. [Usmanu Danfodiyo University, Sokoto (Nigeria). Dept. of Chemistry; Aliyu, M.; Atiku, A.T. [Usmanu Danfodiyo University, Sokoto (Nigeria). Energy Research Centre
1996-09-01
Biogas as a clean and cheap fuel is studied with the aim of determining the effect of seeding with bacteria on its production rate using four different substrates. The seeding with four different digesters was carried out with 5g of digested cowdung sludge obtained from a working digester. Results indicate that of all the substrates used for the studies, ipomea asarifobia produced the highest amount of biogas over a period of 40 days. (Author)
Blackburn, Steven; Higginbottom, Adele; Taylor, Robert; Bird, Jo; Østerås, Nina; Hagen, Kåre Birger; Edwards, John J; Jordan, Kelvin P; Jinks, Clare; Dziedzic, Krysia
2016-01-01
People with osteoarthritis desire high quality care, support and information. However, the quality of care for people with OA in general practice is not routinely collected. Quality Indicators can be used to benefit patients by measuring whether minimum standards of quality care are being met from a patient perspective. The aim of this study was to describe how a Research User Group (RUG) worked alongside researchers to co-produce a set of self-reported quality indicators for people with osteoarthritis when visiting their general practitioner or practice nurse (primary care). These were required in the MOSAICS study, which developed and evaluated a new model of supported self-management of OA to implement the NICE quality standards for OA. This article describes the public involvement in the MOSAICS study. This was 1) the co-development by RUG members and researchers of an Osteoarthritis Quality Indicators United Kingdom (OA QI (UK)) questionnaire for use in primary care, and 2) the comparison of the OA QI (UK) with a similar questionnaire developed in Norway. This study shows how important and effective a research user group can be in working with researchers in developing quality care indicators for osteoarthritis for use in a research study and, potentially, routine use in primary care. The questionnaire is intended to benefit patients by enabling the assessment of the quality of primary care for osteoarthritis from a patient's perspective. The OA QI (UK) has been used to examine differences in the quality of osteoarthritis care in four European countries. Background People with osteoarthritis (OA) desire high quality care, support and information about OA. However, the quality of care for people with OA in general practice is not routinely collected. Quality Indicators (QI) can be used to benefit patients by measuring whether minimum standards of quality care (e.g. NICE quality standards) are being met from a patient perspective. A Research User Group (RUG
Gun, Aburrahman; Ozer, Mehmet Kaya; Bilgic, Sedat; Kocaman, Nevin; Ozan, Gonca
2016-01-01
Fructose corn syrup is cheap sweetener and prolongs the shelf life of products, but fructose intake causes hyperinsulinemia, hypertriglyceridemia, and hypertension. All of them are referred to as metabolic syndrome and they are risk factors for cardiovascular diseases. Hence, the harmful effects of increased fructose intake on health and their prevention should take greater consideration. Caffeic Acid Phenethyl Ester (CAPE) has beneficial effects on metabolic syndrome and vascular function wh...
Wu, Meng; Liu, Jia; Li, Weitao; Liu, Ming; Jiang, Chunyu; Li, Zhongpei
2017-10-01
Chlorantraniliprole (CAP) is a newly developed insecticide widely used in rice fields in China. There has been few studies evaluating the toxicological effects of CAP on soil-associated microbes. An 85-day microcosm experiment was performed to reveal the dissipation dynamics of CAP in three types of paddy soils in subtropical China. The effects of CAP on microbial activities (microbial biomass carbon-MBC, basal soil respiration-BSR, microbial metabolic quotient-qCO 2 , acid phosphatase and sucrose invertase activities) in the soils were periodically evaluated. Microbial phospholipid fatty acid (PLFA) analysis was used to evaluate the change of soil microbial community composition on day 14 and 50 of the experiment. CAP residues were extracted using the quick, easy, cheap, effective, rugged, and safe (QuChERS) method and quantification was measured by high performance liquid chromatography (HPLC). The half-lives (DT 50 ) of CAP were in the range of 41.0-53.0 days in the three soils. The results showed that CAP did not impart negative effects on MBC during the incubation. CAP inhibited BSR, qCO 2 , acid phosphatase and sucrose invertase activities in the first 14 days of incubation in all the soils. After day 14, the soil microbial parameters of CAP-treated soils became statistically at par with their controls. Principal component analysis (PCA) determining abundance of biomarker PLFAs indicated that the application of CAP significantly changed the compositions of microbial communities in all three paddy soils on day 14 but the compositions of soil microbial communities recovered by day 50. This study indicates that CAP does not ultimately impair microbial activities and microbial compositions of these three paddy soil types. Copyright © 2017 Elsevier Inc. All rights reserved.
Wang, Zhaoyang; He, Wen; Zhang, Xudong; Yue, Yuanzheng; Liu, Jinhua; Zhang, Chuanjiang; Fang, Leyong
2017-10-01
The Li3V2(PO4)3/phosphorus-doped carbon (LVP/P-C) nanocomposites with multilevel structures (such as spheroidal, foam, prism and flower-like structures) are synthesized via one-pot in-situ synthesis using hybrid vanadium metal-organic frameworks (V-MOFs) as precursor. The structure and morphology of the LVP/P-C nanocomposites were characterized by scanning electron microscopy, transmission electron microscopy, Raman, X-ray diffraction and element mapping. The results show that the multilevel structures are generated from the assemblies of the hybrid surfactant templates in the glass fiber drawing wastewater (GFDW) and the hybrid V-MOFs. The structure of LVP/P-C nanocomposite is controlled by V-MOFs. The nanocomposites exhibit a long service life, a discharge capacity of 65 mA h g-1 at 10 C with 90% capacity retention after 1100 cycles. The high cycling stability is attributed to the multilevel structures, which is ideal for making rechargeable lithium ion batteries. More importantly, our results have demonstrated that GFDW can be transformed into treasure of multilevel structure nanocomposites for cheap Li ion batteries.
Increasing tobacco taxes : A cheap tool to increase public health
van Baal, Pieter H. M.; Brouwer, Werner B. F.; Hoogenveen, Rudolf T.; Feenstra, Talitha L.
Introduction: Several studies have estimated health effects resulting from tobacco tax increases. However, studies on the cost effectiveness of tobacco taxes are scarce. The aim of this study was to estimate the cost effectiveness of tobacco tax increases from a health care perspective, explicitly
Camino-Sánchez, F J; Zafra-Gómez, A; Oliver-Rodríguez, B; Ballesteros, O; Navalón, A; Crovetto, G; Vílchez, J L
2010-11-01
A rapid, simple and sensitive multi-residue method was developed and validated for the simultaneous quantification and confirmation of 69 pesticides in fruit and vegetables using liquid chromatography-tandem mass spectrometry (LC-MS/MS). The samples were extracted following the quick, easy, cheap, effective, rugged and safe method known as QuEChERS. Mass spectrometric conditions were individually optimised for each analyte in order to achieve maximum sensitivity in multiple reaction monitoring (MRM) mode. Using the developed chromatographic conditions, 69 pesticides can be separated in less than 17 min. Two selected reaction monitoring (SRM) assays were used for each pesticide to obtain simultaneous quantification and identification in one run. With this method in SRM mode, more than 150 pesticides can be analysed and quantified, but their confirmation is not possible in all cases according to the European regulations on pesticide residues. Nine common representative matrices (zucchini, melon, cucumber, watermelon, tomato, garlic, eggplant, lettuce and pepper) were selected to investigate the effect of different matrices on recovery and precision. Mean recoveries ranged from 70% to 120%, with relative standard deviations (RSDs) lower than 20% for all the pesticides. The proposed method was applied to the analysis of more than 2000 vegetable samples from the extensive greenhouse cultivation in the province of Almeria, Spain, during one year. The methodology combines the advantages of both QuEChERS and LC-MS/MS producing a very rapid, sensitive, accurate and reliable procedure that can be applied in routine analytical laboratories. The method was validated and accredited according to UNE-EN-ISO/IEC 17025:2005 international standard (accreditation number 278/LE1027).
Energy Technology Data Exchange (ETDEWEB)
Han, Lijun [College of Science, China Agricultural University, Beijing (China); Sapozhnikova, Yelena [U.S. Dept. of Agriculture, Agricultural Research Service, Eastern Regional Research Center, 600 East Mermaid Lane, Wyndmoor, PA 19038 (United States); Lehotay, Steven J., E-mail: Steven.Lehotay@ars.usda.gov [U.S. Dept. of Agriculture, Agricultural Research Service, Eastern Regional Research Center, 600 East Mermaid Lane, Wyndmoor, PA 19038 (United States)
2014-05-01
Highlights: • The first report that combines in-vial filtration and dispersive-SPE for sample cleanup. • The unique application of ammonium formate for salting-out partitioning in QuEChERS. • Evaluations of a new zirconium-based and a non-friable GCB sorbent for d-SPE cleanup. • A new analytical method for 59 pesticides and environmental pollutants in shrimp. Abstract: A new method of sample preparation was developed and is reported for the first time. The approach combines in-vial filtration with dispersive solid-phase extraction (d-SPE) in a fast and convenient cleanup of QuEChERS (quick, easy, cheap, effective, rugged, and safe) extracts. The method was applied to simultaneous analysis of 42 diverse pesticides and 17 environmental contaminants, including polycyclic aromatic hydrocarbons, polychlorinated biphenyls (PCBs), and flame retardants, in shrimp as the sample matrix. Final extracts were analyzed by both low-pressure gas chromatography – triple quadrupole tandem mass spectrometry (LPGC-MS/MS), and high-performance liquid chromatography – triple quadrupole tandem mass spectrometry (HPLC-MS/MS) to provide a wide scope of analysis for targeted analytes. During method development, several different commercial sorbents for d-SPE were investigated and compared with respect to analyte recoveries. The method was validated at 10, 50, and 100 ng g⁻¹ spiking levels (10-fold lower for PCBs), and the results for nearly all analytes were between 70 and 115% recoveries with ≤17% relative standard deviations. The method was shown to be simple, fast, and effective for multi-application analysis of chemical residues in the representative food and environmental marker matrix.
Prodhan, M D H; Papadakis, Emmanouil-N; Papadopoulou-Mourkidou, Euphemia
2016-09-01
To estimate the variability of pesticide residue levels present in cauliflower units, a total of 142 samples were collected from a field trial of a cooperative farmer, and 120 samples were collected from different market places in Thessaloniki, Greece. The collected samples were extracted using the quick, easy, cheap, effective, rugged, and safe (QuEChERS) extraction technique, and the residues were determined by liquid chromatography-tandem mass spectrometry. The developed method was validated by evaluating the accuracy, precision, linearity, limit of detection (LOD), and limit of quantification (LOQ). The average recoveries for all the analytes, derived from the data of control samples fortified at 0.01, 0.05, 0.1, and 0.2 mg/kg, ranged from 74 to 110% with a relative standard deviation of ≤8%. The correlation coefficient (R(2)) was ≥0.997 for all the analytes using matrix-matched calibration standards. The LOD values ranged from 0.001 to 0.003 mg/kg, and the LOQ was determined at 0.01 mg/kg for all the sought analytes. The matrix effect was found to be at a considerable level, especially for cypermethrin and deltamethrin, amounting to +90% and +145%, respectively. For the field samples, the unit-to-unit variability factors (VFs) calculated for cypermethrin and deltamethrin were 2.38 and 2.32, respectively, while the average VF for the market basket samples was 5.11. In the market basket samples, residues of cypermethrin, deltamethrin, chlorpyrifos, and indoxacarb were found at levels ≥LOQ and their respective VFs were 7.12, 5.67, 5.28, and 2.40.
Analysis of persistent organic pollutants (POPs) in sediments by GC/ECD generated by nuclide 63Ni
International Nuclear Information System (INIS)
Mesquita, Katia A.; Amaral, Priscila O.; Bustillos, José O. V.
2017-01-01
Persistent Organic Pollutants (POPs) are toxic organic compounds resistant to environmental degradation. Besides, POPs bioaccumulation with potential significant impacts on human health and the environment. The Global Monitoring Plan (GMP) under the Stockholm Convention on POPs is a program that enables collection of comparable monitoring data from all regions of the world to assess the effectiveness in minimizing human and environmental exposure to POPs. The scope of this work is to develop and validate a method for the extraction and determination of POPs in sediments collected at Billings dam locate in São Paulo Metropolitan City. The compounds studied in this work are: Aldrin (C 12 H 8 C l6 ), DDD (C 14 H 10 C l4 ), DDE (C 14 H 8 Cl l4) , DDT (C 14 H 9 C l5 ), Dieldrin (C 12 H 8 C l6 O), Endrin (C 12 H 8 Cl 6 O) and Heptachlor (C 10 H 5 C l7 ). This work use the QuEChERS extraction method (Quick, Easy, Cheap, Effective, Rugged, and Safe) for sediment samples and the analysis of the compounds were carried out by gas chromatography with the electron capture detector (GC/ECD). The ECD detector ionizes the analytes by the beta particles from the nuclide sources 63 Ni within carrier gas N 2 . The electrons produced in this process are collected, create an amplified current, and generating the chromatographic peak. The recovery of this method obtained values between 57% and 65% and the Relative Standard Deviation (RSD) values are between 1 and 4%. Details of the analytical method beside quantitative analyses data are presented in this work. (author)
DEFF Research Database (Denmark)
Jensen, Carsten Lynge; Hansen, Lars Gårn; Fjordbak, Troels
on metered electricity consumption for different types of households. We find effects for single men and couples without children, while we find no effect for single women and households with children. We suggest that this could be because of differences in saving potential (e.g. some households do not have......Experimental evidence of the effect of providing cheap energy saving technology to households is sparse. We present results from a field experiment in which autopoweroff plugs are provided free of charge to randomly selected households. We use propensity score matching to find treatment effects...... increase efficiency of programmes....
Environmentally friendly AND cheap?
2009-01-01
In the context of the initiative to make CERN a greener laboratory (see the Word from the DG in issue 20-21/2009 of the Bulletin), the Safety Commission’s General Safety Group has acquired CERN’s first electric bicycle. Picture of a cyclist wearing personal protective equipment riding the new bike at CERN.What with the Medical Service’s "Be active" health campaign, the emphasis placed on two-wheel safety this spring and the sheds for two-wheeled vehicles that are springing up all over the CERN site, it’s time to get on your bike… or one of the bikes available to the personnel, such as the DG/SCG’s new electric cycle. On Tuesday, 21 July, Building 57 welcomed CERN’s first electric bicycle, and the message to the DG/SCG group is clear: "Use it rather than taking one of the CERN cars as often as you can". With this new means of transport that’s easy on the environment (no direct gas emissions) as well as on the walle...
Cheap Oil and the Impact on Rebuilding Syria
2015-10-30
Syrian energy infrastructure will not be cost effective in the current oil pricing environment. I will present a quick overview of oil’s historic role...in the Syrian economy, followed by a synopsis of the current state of Syria’s oil infrastructure . An analysis of the impact of low oil prices on...similarities between countries, a specific comparison will be made to Yemen in an effort to predict the challenges that Syria will face when entering the
Modeling the flow of glaciers in steep terrains
DEFF Research Database (Denmark)
Egholm, D.L.; Knudsen, Mads Faurschou; Clark, Chris D.
2011-01-01
sliding, and to the interaction with topography through glacial erosion. Standard models capable of simulating mountain range–scale glaciations build on the so-called shallow ice approximation, which, among other parameters, neglects the longitudinal and transverse stress gradients, and therefore fails...... to capture the full effects of the rugged topography and related feedbacks between erosion by glacial sliding and the extent and style of glaciation. Here we present and test a new depth-integrated model framework which, on the one hand, takes into account the “higher-order” effects related to steep......The rugged topography of mountain ranges represents a special challenge to computational ice sheet models simulating past or present glaciations. In mountainous regions, the topography steers glaciers through relatively narrow and steep valleys, and as a consequence hereof, the flow rate of alpine...
Al-Alam, Josephine; Fajloun, Ziad; Chbani, Asma; Millet, Maurice
2017-08-01
An optimized analytical method was developed for the simultaneous analysis of 90 pesticides, 16 polycyclic aromatic hydrocarbons, and 22 polychlorinated biphenyls. The method was based on quick, easy, cheap, effective, rugged, and safe (QuEChERS) extraction using acetonitrile followed by a dispersive solid-phase extraction cleanup using primary-secondary amine and octadecyl (C 18 ). The extract obtained was concentrated by evaporation and then reconstituted with acetonitrile to prepare it for chromatographic analysis by liquid chromatography-triple-quadrupole tandem mass spectrometry and gas chromatography-ion-trap tandem mass spectrometry, which was preceded by a preconcentration step using solid-phase microextraction with appropriate fibers. The combination of the two extraction steps ensured efficient extract cleanup. The use of the two analytical instruments allowed the analysis of a large number of pollutants with a high reliability rate. The method developed was validated for linearity, which was studied with use of matrix-matched calibration curves in the concentration range between 10 and 3000 ng g -1 . The correlation coefficient (R 2 ) obtained was higher than 0.98 for most of the target compounds, with a relative standard deviation lower than 20% for repeatability and reproducibility. The limits of detection and quantification were lower than 20 and 60 ng g -1 respectively for the compounds analyzed, and the recoveries were between 60% and 103% for most compounds. Finally, the method was tested for its efficiency on real samples by the analysis of three honey samples in which seven pesticides and nine polycyclic aromatic hydrocarbons were determined. Graphical Abstract ᅟ.
Wang, Jian; Chow, Willis; Chang, James; Wong, Jon W
2014-10-22
This paper presents an application of ultrahigh-performance liquid chromatography electrospray ionization quadrupole Orbitrap high-resolution mass spectrometry (UHPLC/ESI Q-Orbitrap MS) for the determination of 451 pesticide residues in fruits and vegetables. Pesticides were extracted from samples using the QuEChERS (quick, easy, cheap, effective, rugged, and safe) procedure. UHPLC/ESI Q-Orbitrap MS in full MS scan mode acquired full MS data for quantification, and UHPLC/ESI Q-Orbitrap Full MS/dd-MS(2) (i.e., data-dependent scan mode) obtained product ion spectra for identification. UHPLC/ESI Q-Orbitrap MS quantification was achieved using matrix-matched standard calibration curves along with the use of isotopically labeled standards or a chemical analogue as internal standards to achieve optimal method accuracy. The method performance characteristics include overall recovery, intermediate precision, and measurement uncertainty evaluated according to a nested experimental design. For the 10 matrices studied, 94.5% of the pesticides in fruits and 90.7% in vegetables had recoveries between 81 and 110%; 99.3% of the pesticides in fruits and 99.1% of the pesticides in vegetables had an intermediate precision of ≤20%; and 97.8% of the pesticides in fruits and 96.4% of the pesticides in vegetables showed measurement uncertainty of ≤50%. Overall, the UHPLC/ESI Q-Orbitrap MS demonstrated acceptable performance for the quantification of pesticide residues in fruits and vegetables. The UHPLC/ESI Q-Orbitrap Full MS/dd-MS(2) along with library matching showed great potential for identification and is being investigated further for routine practice.
Monitoring of Pesticide Residues in Commonly Used Fruits and Vegetables in Kuwait.
Jallow, Mustapha F A; Awadh, Dawood G; Albaho, Mohammed S; Devi, Vimala Y; Ahmad, Nisar
2017-07-25
The presence of pesticide residues in primary and derived agricultural products raises serious health concerns for consumers. The aim of this study was to assess the level of pesticide residues in commonly consumed fruits and vegetables in Kuwait. A total of 150 samples of different fresh vegetables and fruits were analyzed for the presence of 34 pesticides using the quick easy cheap effective rugged and safe (QuEChERS) multi-residue extraction, followed by gas chromatography-mass spectrometry (GC-MS) or liquid chromatography-tandem mass spectrometry (LC - MS / MS). Pesticide residues above the maximum residue limits (MRL) were detected in 21% of the samples and 79% of the samples had no residues of the pesticides surveyed or contained residues below the MRL. Multiple residues were present in 40% of the samples with two to four pesticides, and four samples were contaminated with more than four pesticide residues. Of the pesticides investigated, 16 were detected, of which imidacloprid, deltamethrin, cypermethrin, malathion, acetamiprid, monocrotophos, chlorpyrifos-methyl, and diazinon exceeded their MRLs. Aldrin, an organochlorine pesticide, was detected in one apple sample, with residues below the MRL. The results indicate the occurrence of pesticide residues in commonly consumed fruits and vegetables in Kuwait, and pointed to an urgent need to develop comprehensive intervention measures to reduce the potential health risk to consumers. The need for the regular monitoring of pesticide residues and the sensitization of farmers to better pesticide safety practices, especially the need to adhere to recommended pre-harvest intervals is recommended.
Monitoring of Pesticide Residues in Commonly Used Fruits and Vegetables in Kuwait
Directory of Open Access Journals (Sweden)
Mustapha F. A. Jallow
2017-07-01
Full Text Available The presence of pesticide residues in primary and derived agricultural products raises serious health concerns for consumers. The aim of this study was to assess the level of pesticide residues in commonly consumed fruits and vegetables in Kuwait. A total of 150 samples of different fresh vegetables and fruits were analyzed for the presence of 34 pesticides using the quick easy cheap effective rugged and safe (QuEChERS multi-residue extraction, followed by gas chromatography-mass spectrometry (GC-MS or liquid chromatography-tandem mass spectrometry (LC-MS/MS. Pesticide residues above the maximum residue limits (MRL were detected in 21% of the samples and 79% of the samples had no residues of the pesticides surveyed or contained residues below the MRL. Multiple residues were present in 40% of the samples with two to four pesticides, and four samples were contaminated with more than four pesticide residues. Of the pesticides investigated, 16 were detected, of which imidacloprid, deltamethrin, cypermethrin, malathion, acetamiprid, monocrotophos, chlorpyrifos-methyl, and diazinon exceeded their MRLs. Aldrin, an organochlorine pesticide, was detected in one apple sample, with residues below the MRL. The results indicate the occurrence of pesticide residues in commonly consumed fruits and vegetables in Kuwait, and pointed to an urgent need to develop comprehensive intervention measures to reduce the potential health risk to consumers. The need for the regular monitoring of pesticide residues and the sensitization of farmers to better pesticide safety practices, especially the need to adhere to recommended pre-harvest intervals is recommended.
Cunha, S C; Trabalón, L; Jacobs, S; Castro, M; Fernandez-Tejedor, M; Granby, K; Verbeke, W; Kwadijk, C; Ferrari, F; Robbens, J; Sioen, I; Pocurull, E; Marques, A; Fernandes, J O; Domingo, J L
2018-02-01
In the framework of the FP7 ECsafeSeafood project, 62 seafood samples commercialized in Europe Union from several representative species - mackerel, tuna, salmon, seabream, cod, monkfish, crab, shrimp, octopus, perch and plaice - were analysed for residues of 21 personal care products (PCPs), including 11 UV-filters (UV-Fs) and 10 musk fragrances (musks). PCPs analysis were performed by Quick, Easy, Cheap, Effective Rugged, Safe (QuEChERS), combined with liquid-liquid extraction (LLE) or dispersive solid-phase extraction (dSPE), followed by gas chromatography-tandem mass spectrometry (GC-MS/MS). The results showed the presence in a wide range of samples of nine out of eleven UV-Fs compounds analysed, namely 2-ethylhexyl salicylate (EHS), 2-ethylhexyl,4-methoxycinnamate (EHMC), 4-methylbenzylidenecamphor (4-MBC), benzophenone-1 (BP1), benzophenone-3 (BP3), isoamyl-4-methoxycinnamate (IMC), 2,2'-dihydroxy-4,4'-dimethoxybenzophenone (DHMB), homosalate (HS), and octocrylene (OC), whereas galaxolide (HHCB), galaxolide lactone (HHCB-lactone), and tonalide (AHTN) were the most found musks. The potential risks to human health associated with the exposure to eight of the more prevalent PCPs - EHS, EHMC, 4-MBC, BP1, BP3, IMC, HHCB, and AHTN - through seafood consumption were assessed for consumers from five European countries (Belgium, Ireland, Italy, Portugal and Spain). Results showed that the human exposure to UV-Fs and musks estimated from the concentration values found in seafood and the daily consumption of concerned seafood species, were far below toxicological reference values. Copyright © 2017 Elsevier Inc. All rights reserved.
Ponce-Robles, Laura; Rivas, Gracia; Esteban, Belen; Oller, Isabel; Malato, Sixto; Agüera, Ana
2017-10-01
An analytical method was developed and validated for the determination of ten pesticides in sewage sludge coming from an agro-food industry. The method was based on the application of Quick, Easy, Cheap, Effective, Rugged, and Safe (QuEChERS) extraction for solid sewage sludge and SPE extraction for sludge aqueous phase, followed by liquid chromatography (LC) coupled to hybrid quadrupole/linear ion trap mass spectrometry (QqLIT-MS). The QuEChERS method was reported 14 years ago and nowadays is mainly applied to the analysis of pesticides in food. More recent applications have been reported in other matrices as sewage sludge, but the complexity of the matrix makes necessary the optimization of the cleanup step to improve the efficiency of the analysis. With this aim, several dispersive solid-phase extraction cleanup sorbents were tested, choosing C18 + PSA as a d-SPE sorbent. The proposed method was satisfactorily validated for most compounds investigated, showing recoveries higher than 80% in most cases, with the only exception of prochloraz (71%) at low concentration level. Limits of quantification were lower than 40 ng l -1 in the aqueous phase and below 40 ng g -1 in the solid phase for the majority of the analytes. The method was applied to solid sludge and the sludge aqueous phase coming from an agro-food industry which processes fruits and vegetables. Graphical abstract Application of LC/MS/MS advanced analytical techniques for determination of pesticides contained in sewage sludge.
Determination of Twenty Organophosphorus Pesticides in Wheat Samples from Different Regions of Iran
Directory of Open Access Journals (Sweden)
Attaollah Shakoori *
2017-09-01
Full Text Available Background: Organophosphorus pesticides are widely used in agriculture, homes, gardens, and veterinary practices. Extensive application of pesticides in agriculture often results in residues of these compounds being absorbed into the foods, including wheat. The aim of this study was to evaluate the residue levels of 20 organophosphorus pesticides in wheat samples collected from different regions of Iran. Methods: This research reports a rapid, specific and sensitive multiresidue method based on the Quick Easy Cheap Effective Rugged and Safe (QuEChERS sample preparation method and gas chromatography with mass spectrometric detection in the selected ion monitoring mode (GC–SIM–MS to evaluate 20 organophosphorus pesticides in wheat samples. Results: In the concentration range of 20-200 ng/g, the calibration curves for each analyte was linear with a determination coefficient (R2 of 0.993 to 0.999. The limits of detection (LODs and quantitation (LOQs were between 2.5-6.7 and 7.5-20 ng/g, respectively. The mean recoveries obtained for three fortification levels (25, 50 and 100 ng/g, five replicates each were 80-114% with a satisfactory precision (RSD<20%. 31.1% samples contained residues of one or more target compounds. Chlorpyrifos was the most common residue (17.8%, followed by pirimiphos-methyl (6.7%, diazinon (4.4%, chlorpyrifos-methyl (1.1% and malathion (1.1%. Conclusion: Among the detected pesticides, only diazinon and malathion are permitted pesticides for wheat production in Iran. However, their concentrations were below the maximum residue levels (MRLs established by the Iranian National Standard Organization (INSO.
International Nuclear Information System (INIS)
Qi, Peipei; Wang, Zhiwei; Yang, Guiling; Wang, Xinquan; Shang, Chunqing; Xu, Hao; Wang, Xiangyun; Zhang, Hu; Wang, Qiang
2015-01-01
The authors describe magnetite (Fe 3 O 4 ) nanoparticles modified with 3-(N,N-diethylamino) propyltrimethoxysilane (Fe 3 O 4 -PSA NPs) for use as a sorbent for dispersive solid phase extraction of pesticide residues. The Fe 3 O 4 -PSA NPs were prepared by silanizing Fe 3 O 4 NPs and modifying them with 3-(N,N-diethylamino) propyltrimethoxysilane. Field-emission scanning electron microscopy, FTIR and zeta potential measurements were employed to characterize the modified NPs. They were then used as an adsorbent to remove acidic interferences (such as malic acid and succinic acid), which are major interferences in LC-MS/MS analysis in causing ion suppression in the MS spectra of pesticides. In addition, graphitized carbon black (GCB) was used as an adsorbent to eliminate interferences by pigments. The use of Fe 3 O 4 -PSA NPs can replace time-consuming centrifugation as used in the so-called QuEChERS (quick, easy, cheap, effective, rugged and safe) method. This improvement is particularly significant in high-throughput analysis. Following the optimization of the quantities of Fe 3 O 4 -PSA NPs and GCB, the method was applied to the determination of 56 pesticides in (spiked) fruits (apple, kiwi, orange and pear) by ultra-HPLC-MS/MS. The analytical ranges typically extend from 1 to 200 ng∙mL −1 , and recoveries range from 60.2 to 130 % at different concentrations of all four kinds of fruits. The LOQs for the pesticides are 10 ng∙kg −1 , which makes the method a viable tool for pesticide monitoring in fruits. (author)
Residue Levels and Risk Assessment of Pesticides in Pistachio Nuts in Iran
Directory of Open Access Journals (Sweden)
Azadeh Emami
2017-02-01
Full Text Available Background: Pistachio is one of the main nutrients, not only as a strategic crop but also as a main type of nut, in Iranians’ food cycle. The aim of this study was to measure the relative safety of Iranian pistachio based on the standard pesticide’s residue limits, which should be monitored and assessed in the cultivation of pistachio in order to confirm its public health. Methods: Fifty samples of pistachios of different brands were collected from Tehran markets in 2015. QuEChERS (Quick, Easy, Cheap, Effective, Rugged and Safe sampling method was used in order to determine the pesticide’s residue in the pistachio nuts by Gas chromatography/Mass spectrometry (GC/MS.The method was validated with related parameters. Recovery took place at five concentration rates (n=3 ranging from 81.40% to 93.08% with the majority of RelativeStandard Deviation being lower than 20%. Limits of detection and quantification for all the pesticides were 2µg/kg and10µg/kg, respectively. The validated method seemed to be appropriate for the analysis of pesticide’s residue in pistachio nuts. Results: Identified pesticides included Fenitrothion, Carbaryl and Diazinon. Detectable pesticide’s residue existed in 10% (5 samples of the samples. Conclusion: All the results were compared with the Iran’s National Standards and the European Maximum Residue Limits. As compared to the acceptable daily intake, the calculated daily intake of each pesticide was much lower than the standard level, which could not cause any public health problem.
Yang, Yi; Lu, Dan; Yin, Shuo; Yang, Danni; Chen, Yaling; Li, Yongxin; Sun, Chengjun
2018-04-01
An efficient ultrasound-assisted saponification was developed for simultaneous determination of vitamin E isomers in vegetable oil by high-performance liquid chromatography with fluorescence detection. The samples were saponified ultrasonically with potassium hydroxide solution for only 7 min, then the analytes were extracted with ether. Vitamin E isomers were separated on a C 18 column at 25°C with a mobile phase of methanol/acetonitrile (81:19, v/v) at a flow rate of 0.8 mL/min. Fluorescence detection was operated at 290 nm of excitation wavelength and 327 nm of emission wavelength. Under the optimized conditions, good linearities over the range of 0.001-8.00 μg/mL (r > 0.999) were obtained. Mean recoveries of the method were 88.0-106%, with intra- and interday RSDs less than 11.8 and 12.8%, respectively. The detection limits and quantification limits of the method were 0.30-1.8 and 1.0-6.1 μg/kg, respectively. The recoveries of this method were much higher than that of the quick, easy, cheap, effective, rugged, and safe method and direct dilution method, but were similar to those of hot saponification. This proposed method provides reliable, simple, and rapid quantification of vitamin E isomers in vegetable oils. Five kinds of vegetable oils were analyzed, the quantification results were within the ranges reported by other authors. © 2018 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Kong, Wei-Jun; Liu, Qiu-Tao; Kong, Dan-Dan; Liu, Qian-Zhen; Ma, Xin-Ping; Yang, Mei-Hua
2016-02-01
A method is described for multi-residue, high-throughput determination of trace levels of 22 organochlorine pesticides (OCPs) and 5 pyrethroid pesticides (PYPs) in Chinese medicinal (CM) health wines using a QuEChERS (quick, easy, cheap, effective, rugged, and safe) based extraction method and gas chromatography-electron capture detection (GC-ECD). Several parameters were optimized to improve preparation and separation time while still maintaining high sensitivity. Validation tests of spiked samples showed good linearities for 27 pesticides (R = 0.9909-0.9996) over wide concentration ranges. Limits of detection (LODs) and quantification (LOQs) were measured at ng/L levels, 0.06-2 ng/L and 0.2-6 ng/L for OCPs and 0.02-3 ng/L and 0.06-7 ng/L for PYPs, respectively. Inter- and intra-day precision tests showed variations of 0.65-9.89% for OCPs and 0.98-13.99% for PYPs, respectively. Average recoveries were in the range of 47.74-120.31%, with relative standard deviations below 20%. The developed method was then applied to analyze 80 CM wine samples. Beta-BHC (Benzene hexachloride) was the most frequently detected pesticide at concentration levels of 5.67-31.55 mg/L, followed by delta-BHC, trans-chlordane, gamma-BHC, and alpha-BHC. The validated method is simple and economical, with adequate sensitivity for trace levels of multi-class pesticides. It could be adopted by laboratories for this and other types of complex matrices analysis.
Hydration-coupled protein boson peak measured by incoherent neutron scattering
International Nuclear Information System (INIS)
Nakagawa, Hiroshi; Kataoka, Mikio; Joti, Yasumasa; Kitao, Akio; Shibata, Kaoru; Tokuhisa, Atsushi; Tsukushi, Itaru; Go, Nobuhiro
2006-01-01
The boson peak of a protein was examined in relation to hydration using staphylococcal nuclease. Although the boson peak is commonly observed in synthetic polymers, glassy materials and amorphous materials, the origin of the boson peak is not fully understood. The motions that contribute to the peak are harmonic vibrations. Upon hydration the peak frequency shifts to a higher frequency and the effective force constant of the vibration increases at low temperatures, suggesting that the protein energy surface is modified. Hydration of the protein leads to a more rugged surface and the vibrational motions are trapped within the local minimum at cryogenic temperatures. The origin of the protein boson peak may be related to this rugged energy surface
Effect of variety mixtures on cowpea (Vigna unguiculata) vegetable ...
African Journals Online (AJOL)
jokonya
AN EVALUATION OF SIX COWPEA VARIETIES GROWN ... provide cheap sources of protein, micronutrients and mineral elements that can ... traditional vegetables is that, these leafy vegetables are present in most home ..... REFERENCES. 1.
The effects of radiation on aluminium alloys in the core of energy nuclear reactors
International Nuclear Information System (INIS)
Petrossian, V.G.
1995-01-01
One of the attractive directions in the worldwide practice of nuclear installations is the replacement of expensive zirconium alloy with more cheap materials, particularly aluminium allo. For Heat Supply Nuclear Plants (HSNP) with approximately 473 K core temperatures, the use of heat-resistant aluminium alloys seems to be reasonable. The present work is concerned with the studies on radiation effects on aluminium alloy, and interaction between the alloy and coolant in the reactor core. (author). 2 refs., 3 figs., 1 tab
The pin detector - a simple, robust, cheap and effective nuclear radiation detector
International Nuclear Information System (INIS)
Bateman, J.E.
1984-01-01
The development of a series of radiation detectors bases on the point anode is reported. Using readily available preformed pins from a variety of electrical connectors as the anodes, a family of devices has been created with useful properties as X-ray detectors, radiation monitors and internal beta counters. A wide variety of gas fillings can be used, argon/CH 4 premix being the most convenient. The structures are robust and call for no precision alignments so keeping costs down. Performance of the devices in respect of sensitivity and pulse height resolution is comparable to that of conventional wire counters. (author)
Embedded audio without beeps: synthesis and sound effects from cheap to steep
DEFF Research Database (Denmark)
Møbius, Nikolaj; Overholt, Dan
2015-01-01
, and wireless devices for the control of sound or music generated remotely. For example, studio creations can synthesize sound directly with an Arduino or a more powerful "Create USB Interface" board via Direct Digital Synthesis. Alternatively, they can control a program such as Pure Data (or other common...
Energy Technology Data Exchange (ETDEWEB)
Mesquita, Katia A.; Amaral, Priscila O.; Bustillos, José O. V., E-mail: ovega@ipen.br [Instituto de Pesquisas Energéticas e Nucleares (IPEN/CNEN-SP), São Paulo, SP (Brazil)
2017-07-01
Persistent Organic Pollutants (POPs) are toxic organic compounds resistant to environmental degradation. Besides, POPs bioaccumulation with potential significant impacts on human health and the environment. The Global Monitoring Plan (GMP) under the Stockholm Convention on POPs is a program that enables collection of comparable monitoring data from all regions of the world to assess the effectiveness in minimizing human and environmental exposure to POPs. The scope of this work is to develop and validate a method for the extraction and determination of POPs in sediments collected at Billings dam locate in São Paulo Metropolitan City. The compounds studied in this work are: Aldrin (C{sub 12}H{sub 8}C{sub l6}), DDD (C{sub 14}H{sub 10}C{sub l4}), DDE (C{sub 14}H{sub 8}Cl{sub l4)}, DDT (C{sub 14}H{sub 9}C{sub l5}), Dieldrin (C{sub 12}H{sub 8}C{sub l6}O), Endrin (C{sub 12}H{sub 8}Cl{sub 6}O) and Heptachlor (C{sub 10}H{sub 5}C{sub l7}). This work use the QuEChERS extraction method (Quick, Easy, Cheap, Effective, Rugged, and Safe) for sediment samples and the analysis of the compounds were carried out by gas chromatography with the electron capture detector (GC/ECD). The ECD detector ionizes the analytes by the beta particles from the nuclide sources {sup 63}Ni within carrier gas N{sub 2}. The electrons produced in this process are collected, create an amplified current, and generating the chromatographic peak. The recovery of this method obtained values between 57% and 65% and the Relative Standard Deviation (RSD) values are between 1 and 4%. Details of the analytical method beside quantitative analyses data are presented in this work. (author)
Castro, M; Fernandes, J O; Pena, A; Cunha, S C
2018-07-01
The increasing production and consumption of Personal Care Products (PCPs), containing UV-filters and musk fragrances, has led to its widespread presence in the aquatic environment which can cause harmful effects to the aquatic organisms due to its intrinsic toxicity. This study aims to evaluate the degree of contamination of wild mussels along the entire Portuguese coastline, continually exposed in their habitat to different contaminants. For this purpose, approximately 1000 mussel specimens were sampled during one year in seven different locations, along the Portuguese coastline. Simultaneous quantification of five UV-filters and seven musks in mussels was achieved by a Quick, Easy, Cheap, Effective, Rugged and Safe (QuEChERS) extraction procedure combined with dispersive liquid-liquid microextraction (DLLME) followed by gas chromatography with mass spectrometry (GC-MS) analysis. Ten out of the twelve target analytes were found in the analysed samples, highlighting the presence of AHTN (tonalide), EHS (2-ethylhexylsalicylate) and EHMC (2-ethylhexyl 4-methoxycinnamate) in all positive samples (93%). Overall, the results obtained indicate a widespread contamination of wild mussels along Portuguese coastline, all over the year. UV-filters were more frequently detected (90%) than musk fragrances (70%) and also quantified at higher levels, with average total concentrations reaching 1155.8 ng/g (dw) against 397.7 ng/g (dw) respectively. A high correlation was observed between the most densely populated and industrialized locations and the higher levels of musks and UV-filters found. In other hand, lower levels of PCPs were found in protected areas. As expected, an increase in UV-filters levels was observed after the summer, likely due to the intense period of recreational activities. Copyright © 2018 Elsevier Ltd. All rights reserved.
Bruzzoniti, Maria Concetta; Checchini, Leonardo; De Carlo, Rosa Maria; Orlandini, Serena; Rivoira, Luca; Del Bubba, Massimo
2014-07-01
Quick, Easy, Cheap, Effective, Rugged, and Safe (QuEChERS) is an extraction and clean-up technique originally developed for recovering pesticide residues from fruits and vegetables. Since its introduction, and until December 2013, about 700 papers have been published using the QuEChERS technique, according to a literature overview carried out using SciFinder, Elsevier SciVerse, and Google search engines. Most of these papers were dedicated to pesticide multiresidue analysis in food matrices, and this topic has been thoroughly reviewed over recent years. The QuEChERS approach is now rapidly developing beyond its original field of application to analytes other than pesticides, and matrices other than food, such as biological fluids and non-edible plants, including Chinese medicinal plants. Recently, the QuEChERS concept has spread to environmental applications by analyzing not only pesticides but also other compounds of environmental concern in soil, sediments, and water. To the best of our knowledge, QuEChERS environmental applications have not been reviewed so far; therefore, in this contribution, after a general discussion on the evolution and changes of the original QuEChERS method, a critical survey of the literature regarding environmental applications of conventional and modified QuEChERS methodology is provided. The overall recoveries obtained with QuEChERS and other extraction approaches (e.g., accelerated solvent extraction, ultrasonic solvent extraction, liquid/solid extraction, and soxhlet extraction) were compared, providing evidence for QuEChERS higher recoveries for various classes of compounds, such as biopesticides, chloroalkanes, phenols, and perfluoroalkyl substances. The role of physicochemical properties of soil (i.e., clay and organic carbon content, as well as cation exchange capacity) and target analytes (i.e., log KOW, water solubility, and vapor pressure) were also evaluated in order to interpret recovery and matrix effect data.
Dubey, J K; Patyal, S K; Sharma, Ajay
2018-03-19
In the present day scenario of increasing awareness and concern about the pesticides, it is very important to ensure the quality of data being generated in pesticide residue analysis. To impart confidence in the products, terms like quality assurance and quality control are used as an integral part of quality management. In order to ensure better quality of results in pesticide residue analysis, validation of analytical methods to be used is extremely important. Keeping in view the importance of validation of method, the validation of QuEChERS (quick, easy, cheap, effective, rugged, and safe) a multiresidue method for extraction of 13 organochlorines and seven synthetic pyrethroids in fruits and vegetables followed by GC ECD for quantification was done so as to use this method for analysis of samples received in the laboratory. The method has been validated as per the Guidelines issued by SANCO (French words Sante for Health and Consommateurs for Consumers) in accordance with their document SANCO/XXXX/2013. Various parameters analyzed, viz., linearity, specificity, repeatability, reproducibility, and ruggedness were found to have acceptable values with a per cent RSD of less than 10%. Limit of quantification (LOQ) for the organochlorines was established to be 0.01 and 0.05 mg kg -1 for the synthetic pyrethroids. The uncertainty of the measurement (MU) for all these compounds ranged between 1 and 10%. The matrix-match calibration was used to compensate the matrix effect on the quantification of the compounds. The overall recovery of the method ranged between 80 and 120%. These results demonstrate the applicability and acceptability of this method in routine estimation of pesticide residues of these 20 pesticides in the fruits and vegetables by the laboratory.
Christia, C; Bizani, E; Christophoridis, C; Fytianos, K
2015-09-01
Acetate- and citrate-buffered quick, easy, cheap, effective, rugged, safe (QuEChERS) pretreatment methods were evaluated for the determination of various pesticides in peaches, grapes, apples, bananas, pears, and strawberries from various regions of Greece, using LC-MS/MS. The purposes of this study were (i) to evaluate which type of QuEChERS method was the most appropriate and effective for each matrix; (ii) to apply the selected QuEChERS method for each matrix, in order to detect and quantify pesticide residues in various fruit samples using UPLC-MS/MS; (iii) to examine the concentration distribution of pesticide classes among fruit originating from various areas; and (iv) to assess pesticide concentration distribution between peel and flesh of fruit in order to evaluate the penetration of pesticide residues in the fruit flesh. Acetate-buffered QuEChERS was found to be the most suitable technique for most of the fruit matrices. According to the recovery values at two different concentration levels, peaches should preferably be treated by the citrate-buffered type, whereas grapes, bananas, apples, pears, and strawberries are best treated by the acetate-buffered version, although the differences in efficiency were small. The addition of graphitized carbon black significantly decreases the recovery of specific pesticides in all matrices except for strawberries. The majority of values do not exceed the official maximum residue levels set by the European Commission. Organophosphates proved to be the most commonly detected category along with triazines-triazoles-conazoles group and by carbamates. Apples and pears seem to be the most contaminated fruit matrices among those tested. Distribution of pesticide classes shows variations between different regions, suggesting different pesticide application practices. In the case of peaches and pears, there is an equal distribution of detected pesticides between peel and flesh, indicating penetration of contaminants into the
Water Quality Management Studies. West Point Lake, Chattahoochee River, Alabama-Georgia.
1984-08-01
Dec. Jan. Feb. Mar. Alpr . May June July Aug. Sept. Oct. Nov. Dec. 30V 00 7. 5 ft0 25 CH-13 N Ahadkee Crook . .. -. S Apr. "%Y June July Rug. Sept...Jm I y %g Spt.Ot N- Jn Alpr . May June Jl jg t.O.Nv.acJn.Fob. Mar. Api.. May June July Aus. Sept. Oct. Nov. Dec. EXPLIRTION SI- LrNE OF EOIJRL DISSOLVED...Sept. Oct. Nov. Dec. 0 3 IL25 :* ..... C Alpr . May June July Rug. Sept. Oct. Nov. Dec. Jan. Feb. Mar. Apr. May June July Rug. Sept. Oct. Nov. Dec
Bang, Dae Young; Byeon, Seul Kee; Moon, Myeong Hee
2014-02-28
A simple and fast lipid extraction method from human blood plasma and urine is introduced in this study. The effective lipid extraction from biological systems with a minimization of the matrix effect is important for the successful qualitative and quantitative analysis of lipids in liquid chromatography-electrospray ionization-tandem mass spectrometry (LC-ESI-MS/MS). The method described here is based on the modification of the quick, easy, cheap, effective, rugged and safe (QuEChERS) extraction method, which was originally developed for pesticide residue analysis in food, for the purpose of isolating lipids from biological fluids. Applicability of QuEChERS method for lipids was evaluated by varying organic solvents for the extraction/partitioning of lipids in MgSO4/CH3COONa for the removal of water and by varying sorbents (primary secondary amines, graphitized carbon black, silica, strong anion exchange resins and C18 particles) for the dispersive solid-phase extraction (dSPE) step. This study shows that 2:1 (v/v) CHCl3/CH3OH is effective in the extraction/partitioning step and that 50mg of C18 particles (for 0.1mL plasma and 1mL of urine) are more suitable for sample cleanup for the dSPE step of the QuEChERS method. Matrix effects were calculated by comparing the recovery values of lipid standards spiked to both plasma and urine samples after extraction with those of the same standards in a neat solution using nanoflow LC-ESI-MS/MS, resulting in improved MS signals due to the decrease of the ion suppression compared to the conventional Folch method. The modified QuEChERS method was applied to lipid extracts from both human urine and plasma samples, demonstrating that it can be powerfully utilized for high-speed (<15min) preparation of lipids compared to the Folch method, with equivalent or slightly improved results in lipid identification using nLC-ESI-MS/MS. Copyright © 2014 Elsevier B.V. All rights reserved.
A New Method to Extract CSP Gather of Topography for Scattered Wave Imaging
Directory of Open Access Journals (Sweden)
Zhao Pan
2017-01-01
Full Text Available The seismic method is one of the major geophysical tools to study the structure of the earth. The extraction of the common scatter point (CSP gather is a critical step to accomplish the seismic imaging with a scattered wave. Conventionally, the CSP gather is obtained with the assumption that the earth surface is horizontal. However, errors are introduced to the final imaging result if the seismic traces obtained at the rugged surface are processed using the conventional method. Hence, we propose the method of the extraction of the CSP gather for the seismic data collected at the rugged surface. The proposed method is validated by two numerical examples and expected to reduce the effect of the topography on the scattered wave imaging.
The effect of feedback by SMS-text messages and email on household electricity consumption
DEFF Research Database (Denmark)
Gleerup, Maria; Larsen, Anders; Leth-Petersen, Søren
2010-01-01
This paper analyzes the effect of supplying feedback by text messages (SMS) and email about electricity consumption on the level of total household electricity consumption. An experiment was conducted in which 1,452 households were randomly allocated to three experimental groups and two control....... Results suggest that email and SMS messaging that communicated timely information about a household's 'exceptional' consumption periods (e.g. highest week of electricity use in past quarter) produced average reductions in total annual electricity use of about 3%. The feedback technology is cheap...
Tackling alcohol misuse: purchasing patterns affected by minimum pricing for alcohol.
Ludbrook, Anne; Petrie, Dennis; McKenzie, Lynda; Farrar, Shelley
2012-01-01
Alcohol consumption is associated with a range of health and social harms that increase with the level of consumption. Policy makers are interested in effective and cost-effective interventions to reduce alcohol consumption and associated harms. Economic theory and research evidence demonstrate that increasing price is effective at the population level. Price interventions that target heavier consumers of alcohol may be more effective at reducing alcohol-related harms with less impact on moderate consumers. Minimum pricing per unit of alcohol has been proposed on this basis but concerns have been expressed that 'moderate drinkers of modest means' will be unfairly penalized. If those on low incomes are disproportionately affected by a policy that removes very cheap alcohol from the market, the policy could be regressive. The effect on households' budgets will depend on who currently purchases cheaper products and the extent to which the resulting changes in prices will impact on their demand for alcohol. This paper focuses on the first of these points. This paper aims to identify patterns of purchasing of cheap off-trade alcohol products, focusing on income and the level of all alcohol purchased. Three years (2006-08) of UK household survey data were used. The Expenditure and Food Survey provides comprehensive 2-week data on household expenditure. Regression analyses were used to investigate the relationships between the purchase of cheap off-trade alcohol, household income levels and whether the household level of alcohol purchasing is categorized as moderate, hazardous or harmful, while controlling for other household and non-household characteristics. Predicted probabilities and quantities for cheap alcohol purchasing patterns were generated for all households. The descriptive statistics and regression analyses indicate that low-income households are not the predominant purchasers of any alcohol or even of cheap alcohol. Of those who do purchase off-trade alcohol
Determination of pesticide residue transfer rates (percent) from dried tea leaves to brewed tea.
Wang, Jian; Cheung, Wendy; Leung, Daniel
2014-01-29
This paper presents a study on pesticide residue transfer rates (%) from dried tea leaves to brewed tea. In the study, a brewing procedure simulated the preparation of a hot tea drink as in routine. After brewing, pesticide residues were extracted from brewed tea using a method known as QuEChERS (quick, easy, cheap, effective, rugged, and safe). An UHPLC/ESI-MS/MS method was developed and validated to identify and quantify up to 172 pesticides in both tea leaves and brewed tea samples. Quantification was achieved using matrix-matched standard calibration curves with isotopically labeled standards or a chemical analogue as internal standards, and the calibration curves consisted of six points (0.4, 2.0, 8.0, 16.0, 24.0, and 40.0 μg/L equivalent in sample). The method was validated at four concentration levels (4.0, 12, 20.0, and 32.0 μg/L equivalent in sample) using five different brewed tea matrices on two separate days per matrix. Method performance parameters included overall recovery, intermediate precision, and measurement uncertainty, which were evaluated according to a nested experimental design. Approximately, 95% of the pesticides studied had recoveries between 81 and 110%, intermediate precision ≤20%, and measurement uncertainty ≤40%. From a pilot study of 44 incurred tea samples, pesticide residues were examined for their ability to transfer from dried tea leaves to brewed tea. Each sample, both tea leaves and brewed tea, was analyzed in duplicate. Pesticides were found to have different transfer rates (%). For example, imidacloprid, methomyl, and carbendazim had transfer rates of 84.9, 83.4, and 92.4%, respectively.
Lucas, Derick; Neal-Kababick, James; Zweigenbaum, Jerry
2015-01-01
The compound yohimbine HCl has been restricted in Australia and categorized as a scheduled prescription drug in other parts of the world, including the United States where it is monographed as a drug in the U. S. Pharmacopeia. However, the bark of the yohimbe plant and its extract is considered a botanical that can be used as a dietary supplement in some parts of the world. For these reasons, methods to characterize the indole alkaloids of the bark and quantify yohimbine and its analogs are presented using accurate mass LC/quadrupole time-of-flight (QTOF)-MS and triple quadrupole LC/MS, respectively. Samples were extracted with a QuEChERS (Quick, Easy, Cheap, Effective, Rugged, and Safe) method to characterize and quantify the indole alkaloids. With the LC/QTOF-MS in auto MS/MS mode the indole alkaloids were identified, and the isomeric response of each could be used to determine whether the actual bark or extract was in samples of dietary supplements and not adulteration with yohimbine HCl. Analogs were identified and include yohimbic acid, methyl yohimbine, and hydroxyl yohimbine. Many isomers of each were also detected, but identified only by the number of chromatographic peaks. Quantification of yohimbine and ajmalicine spiked extracts showed recoveries of 99 to 103% with RSD of 3.6% or lower and LODs of less than 100 ppt. Calibration of the two standards gave r(2) = 0.9999 in a range from 0.1 to 100 ppb. Dietary supplements quantified for these two compounds showed a range from not detected to 3x the amounts found in the bark.
Eom, Taeyong; Cho, Hyun-Deok; Kim, Junghyun; Park, Mihee; An, Jinyoung; Kim, Moosung; Kim, Sheen-Hee; Han, Sang Beom
2017-11-01
A simple and rapid method for the simultaneous determination of 11 mycotoxins - aflatoxins B 1 , B 2 , G 1 and G 2 ; fumonisins B 1 , B 2 and B 3 ; ochratoxin A; zearalenone; deoxynivalenol; and T-2 toxin - in edible oils was established using liquid chromatography tandem mass spectrometry (LC-MS/MS). In this study, QuEChERS (Quick, Easy, Cheap, Effective, Rugged and Safe), QuEChERS with dispersive liquid-liquid microextraction, and solvent extraction were examined for sample preparation. Among these methods, solvent extraction with a mixture of formic acid/acetonitrile (5/95, v/v) successfully extracted all target mycotoxins. Subsequently, a defatting process using n-hexane was employed to remove the fats present in the edible oil samples. Mass spectrometry was carried out using electrospray ionisation in polarity switching mode with multiple reaction monitoring. The developed LC-MS/MS method was validated by assessing the specificity, linearity, recovery, limit of quantification (LOQ), accuracy and precision with reference to Commission Regulation (EC) 401/2006. Mycotoxin recoveries of 51.6-82.8% were achieved in addition to LOQs ranging from 0.025 ng/g to 1 ng/g. The edible oils proved to be relatively uncomplicated matrices and the developed method was applied to 9 edible oil samples, including soybean oil, corn oil and rice bran oil, to evaluate potential mycotoxin contamination. The levels of detection were significantly lower than the international regulatory standards. Therefore, we expect that our developed method, based on simple, two-step sample preparation process, will be suitable for the large-scale screening of mycotoxin contamination in edible oils.
González-Curbelo, Miguel Ángel; Lehotay, Steven J; Hernández-Borges, Javier; Rodríguez-Delgado, Miguel Ángel
2014-09-05
The "quick, easy, cheap, effective, rugged, and safe" (QuEChERS) approach to sample preparation is widely applied in pesticide residue analysis, but the use of magnesium sulfate and other nonvolatile compounds for salting out in the method is not ideal for mass spectrometry. In this study, we developed and evaluated three new different versions of the QuEChERS method using more volatile salts (ammonium chloride and ammonium formate and acetate buffers) to induce phase separation and extraction of 43 representative pesticide analytes of different classes. Fast low-pressure gas chromatography tandem mass spectrometry (LPGC-MS/MS) and liquid chromatography (LC)-MS/MS were used for analysis. The QuEChERS AOAC Official Method 2007.01 was also tested for comparison purposes. Of the studied methods, formate buffering using 7.5g of ammonium formate and 15mL of 5% (v/v) formic acid in acetonitrile for the extraction of 15g of sample (5g for wheat grain) provided the best performance and practical considerations. Method validation was carried out with and without the use of dispersive solid-phase extraction for cleanup, and no significant differences were observed for the majority of pesticides. The method was demonstrated in quantitative analysis for GC- and LC-amenable pesticides in 4 representative food matrices (apple, lemon, lettuce, and wheat grain). With the typical exceptions of certain pH-dependent and labile pesticides, 90-110% recoveries and Detection limits were mostly <5ng/g, which met the general need to determine pesticide concentrations as low as 10ng/g for monitoring purposes in food applications. Published by Elsevier B.V.
Albinet, A; Nalin, F; Tomaz, S; Beaumont, J; Lestremau, F
2014-05-01
An extraction procedure based on the Quick Easy Cheap Effective Rugged and Safe (QuEChERS) approach has been developed and used for analysis of particle-bound nitrated and oxygenated PAH derivatives (NPAH and OPAH, respectively). Several analytical conditions, for example GC injection temperature and MS detection settings, were optimized. This analytical procedure enabled simultaneous GC-NICIMS quantification of 32 NPAH and 32 OPAH (or other oxygenated compounds), including typical components of secondary organic aerosol (SOA) formed by photooxidation of PAH (e.g. 2-formyl-trans-cinnamaldehyde and 6H-dibenzo[b,d]pyran-6-one). The QuEChERS-like approach was optimized, including the nature of the extraction solvent, the sorbent used for clean-up, and extraction time. The final extraction procedure was based on brief mechanical agitation (vortex mixing for 1.5 min), with 7 mL acetonitrile as solvent. Because dispersive solid-phase extraction (d-SPE) did not provide satisfactory results, SPE using SiO2 was selected for sample purification. Identical results were obtained when the QuEChERS-like and traditional pressurised solvent extraction (PLE) procedures were compared for analysis of fortified ambient air particle samples. The procedure was validated by analysis of two aerosol standard reference materials (NIST SRM 1649b (urban dust) and SRM 2787 (fine particulate matter, extraction methods, including PLE, the QuEChERS-like procedure resulted in increased productivity and reduced extraction cost. This paper shows that QuEChERS-like extraction procedures can be suitably adapted for molecular chemical characterization of aerosol samples and could be extended to other categories of compound.
Regional forest and non-forest mapping using Envisat ASAR data
Ling, F.; Li, Z.Y.; Chen, E.X.; Huang, Y.P.; Tian, X.; Schmullius, C.; Leiterer, R.; Reiche, J.; Maurizio, S.
2012-01-01
Envisat Advanced Synthetic Aperture Radar (ASAR) dual-polarization data are shown to be effective for regional forest monitoring. To this scope, an automatic SAR image preprocessing procedure was developed using SRTM DEM and Landsat TM image for geocoding in rugged terrain and smooth terrain areas,
Cheap Thin Film Oxygen Membranes
DEFF Research Database (Denmark)
2009-01-01
The present invention provides a membrane, comprising a porous support layer a gas tight electronically and ionically conducting membrane layer and a catalyst layer, characterized in that the electronically and ionically conducting membrane layer is formed from a material having a crystallite...... structure with a crystal size of about 1 to 100 nm, and a method for producing same....
International Nuclear Information System (INIS)
Zagar, J.J.; Campbell, C.J.
1999-01-01
Easy to find 'conventional' oil in huge quantities has fueled and satisfied the World's thirst for energy this century. About 95% of all oil produced-and 90% of today's production---comes from this group of hydrocarbons. But the coming century of the new millennium will see the exit of conventional oil as a major player on the World's energy stage. Already, outside the Middle East, conventional oil production is on the decline. And the Middle East with its vast reservoirs of oil will soon reach the mid-point of depletion and begin its irreversible decline. Currently, one barrel of oil is being found for every four barrels that are produced. The Middle East now supplies 30% of the World's conventional oil production and that trend is rising because, unlike in the 1970s, no new major provinces, save perhaps the Caspian, are there to deliver flush production. The stage is now set for another 'energy crisis' starting with higher prices from Middle East control and followed by the onset of physical shortage around 2010. We face something new to human experience. (author)
International Nuclear Information System (INIS)
Haluza, I.
2006-01-01
Slovak farmers resemble the peasants from the film T he Magnificent Seven . They keep complaining about their fate but consider any innovation as an interference. And that is why they still have not started growing fast-growing wood although the number of heating plants processing bio-mass from forests and fields is growing. Natural gas is expensive and coal creates pollution. Energy from biomass is becoming a good business and also creates new business opportunities - growing the raw material it needs. Such heating plants usually use waste from wood processing companies and Slovak Forests (Lesy SR) has also started deliveries of chip wood from old forests. There are plantations of fast growing wood suitable for heat production of over 500-thousand hectares throughout the EU. This is about 10% of Slovakian's area where the first plantations are also already being set up. The first promising plantation project was launched this spring. And this is not a project launched and backed by a big company but a starting up businessman, Miroslav Forgac from Kosice. He founded his company, Forgim, last winter. Without big money involved and thank to a new business idea he managed to persuade farmers to set up the first plantations. He supplied the seedlings and the business has started with 75 ha of plantations around Trnava, Sala, Komarno, Lucenec, Poprad and Kosice. He is gradually signing contracts with other landowners and next year the area of plantations is set to grow by 1500 ha. Plantations of fast growing trees such as willow, poplar and acacia regenerate by new trees growing out of the roots of the old and from cut trees so from one seedling and one investment there can be several harvests. Swedish willows from Forgim regenerate 20 to 25 years after the first planting. And only then new seedlings have to be purchased. Using special machines that even cut the wood to wood chips the plantations can be 'harvested' every three years. Unlike crops, the fields do not require ploughing and are also less demanding as regards fertilizers and other chemical protection. The average yield from one hectare of such a plantation is 60 tons of wood chips every three years. At the current price of over 1000 Sk (25.31 EUR) per ton, the annual profit per hectare is about 18,000 Sk (473 EUR). (author)
Magnetic field effects in organic semiconductors : theory and simulations
Kersten, S.P.
2013-01-01
Organic semiconductors are a promising class of materials, offering several advantages over inorganic semiconductors. They are light, flexible, easy and cheap to produce, and easily chemically tunable. Organic semiconductors are currently used for lighting applications and in the displays of some
Effect of dry-heating with pectin on gelatinization properties of sweet ...
African Journals Online (AJOL)
... Group, Faculty of Pharmacy, University of Benin, Benin City, 300001 Nigeria. ... China is the world's largest producer of sweet ... nontoxic and is cheap to produce [2-4]. Starch ... Kansas, USA). ..... physicochemical properties of wheat starch.
Michael Sanders
2014-01-01
“Nudges" - small, usually cheap, interventions to alter the behaviour of individuals to improve their “health, wealth or happiness", are increasingly popular with governments and have thus far played a large role in the coalition government's attempts to encourage pro-social behaviour. The power of many of these nudges, such as the effect of priming in a trust-game type scenario, has been tested widely in the lab, but have proven difficult to replicate in the field. Although the laboratory al...
2014-03-01
have access to chargers , or spare batteries . The flight time limits were likely reached earlier than anticipated due to high winds and required...Left, shows Rugged Motor Driver. Right, shows microcontroller (Rugged Circuits , 2013... batteries , powertrain, autopilot, servos, and electronics impact equipment placement and CG. Weight placed outside the CG generates a moment and can
Effects of Toluene on Some Physicochemical Parameters of The ...
African Journals Online (AJOL)
ADOWIE PERE
aquatic organisms, decline in the type of exotic fish species and ... diet cannot be underestimated since it is a cheap source of protein in ... was then mixed with the stripped eggs to fertilize the eggs with the ..... Other organic toxic substances ...
Cheap diagnosis using structural modelling and fuzzy-logic based detection
DEFF Research Database (Denmark)
Izadi-Zamanabadi, Roozbeh; Blanke, Mogens; Katebi, Serajeddin
2003-01-01
relations for linear or non-linear dynamic behaviour, and combine this with fuzzy output observer design to provide an effective diagnostic approach. An adaptive neuro-fuzzy inference method is used. A fuzzy adaptive threshold is employed to cope with practical uncertainty. The methods are demonstrated...... using measurements on a ship propulsion system subject to simulated faults....
Estimation of effective thermal conductivity tensor from composite microstructure images
International Nuclear Information System (INIS)
Thomas, M; Boyard, N; Jarny, Y; Delaunay, D
2008-01-01
The determination of the effective thermal properties of inhomogeneous materials is a long-standing problem of continuously interest. The impressive number of methods developed to measure or estimate the thermal properties of composite materials clearly exhibits the importance given to their knowledge. Homogenization models are a cheap way to determine or predict them. Many different approaches of homogenization were developed, but the last advances are credited to numerical methods. In this study, a new computational model is developed to estimate the 2D thermal conductivity tensor and the thermal main directions of a pure carbon/epoxy unidirectional composite. This tool is based on real composite microstructure.
Effect of annealing on electrical properties of plasmatron deposited ZnO films
International Nuclear Information System (INIS)
Joa, Sang Beom; Penkov, Oteksiy V.; Plaksin, Vadim Yu; Mansur, Rakib; Kim, Ji Hun; Lee, Heon Ju
2009-01-01
Transparent conductive zinc oxide (ZnO) has been extensively studied in recent several years because they have very interesting properties. Besides this, zinc oxide is non-poisonous, abundant and cheap material. ZnO films are employed in different applications like transparent conductive layers in solar cells, protective coatings and so on. Wide industrial application of the ZnO films requires of development of cheap, effective and scalable technology. Typically used technology like RF sputtering, pyrolysis and metal-organic CVD don't completely satisfy the industrial requirements. In our previous publications the new perspective ZnO deposition technology based DC Arc Plasmatron was described. This technology has several advantages (low cost, high deposition rate, low substrate temperature). Currently, films deposited using this technology has can be used only as protective or insulation coatings because of very high resistance. Applying of plasmatron technology in the microelectronics or solar cell production requires the improvement of electrical properties of the films. This can be achieved by optimization of deposition parameters, using of doping, or by post-deposition treatment such as annealing, or by combination of mentioned. It was shown that proposed technology can be used for the deposition of pure ZnO film with good electrical and optical properties. Proposed technology has several disadvantages which can be overcome in the near-term outlook
Ballast water risk assessment in the North Sea
Meer, Ruurd van der
2012-01-01
Auteur: Ruurd van der Meer Centrum voor Energie en Milieukunde, IVEM Bèta 2012-03 EES-2012-134T ISBN (boek): 978-90-367-5528-3 ISBN (digitaal): 978-90-367-5529-0 Bèta Wetenschapswinkel Rijksuniversiteit Groningen Nijenborgh 4 9747 AG Groningen T: 050-363 41 32 E: c.m.ree@rug.nl W: www.rug.nl/wewi
Talk is cheap: Wireless communications changing the oilpatch
Energy Technology Data Exchange (ETDEWEB)
Stastny, P.
2004-03-01
The role of cellular phones and satellite phones in the oil and natural gas industry in Canada is discussed. Cellular phones are particularly well adapted to the remote environment in which much of the industry is situated. Satellite phones are less common but they are used to fill in the gaps where cellular networks are not available. In such situations the field worker is equipped with two phones, a cellular phone and a satellite phone, each with its own number, or he carries a Globalstar phone, which combines both under operating modes using the same telephone number. The most cost-effective communication in remote areas relies on a three-watt analog booster that connects to a cell phone; a digital three-watt booster is not far down the road as the ultimate means of communication in remote environments, particularly for handling data. The digital cellular network can reach a maximum threshold of 80,000 baud (versus only 9,600 baud for analog). The demand for wireless services for wireless e-mail and Web-assisted GPS position location applications, and the sheer number of people with cellular phones are the most significant drivers of the push towards digital networks. Digital picture cell phones are also likely to find applications in troubleshooting and other areas of the oilpatch. In some areas however, satellite phones may be the only option. The low earth orbit (LEO) Globalstar is a particularly good example of satellite phone systems; it offers significant advantages in terms of voice quality, with practically limitless geographic coverage. By contrast, GEO (Geostationary Earth Orbit) systems are better suited to handling high-speed data, television transmission and other wideband applications.
Performance of solar photovoltaic array fed water pumping system ...
African Journals Online (AJOL)
This paper discusses the design and performance analysis of a solar photovoltaic (SPV) array fed water pumping system utilizing a special class of highly rugged machine with simple drive system called switched reluctance motor (SRM) drive. The proposed method of water pumping system also provides the cost effective ...
Color effects from scattering on random surface structures in dielectrics
DEFF Research Database (Denmark)
Clausen, Jeppe; Christiansen, Alexander B; Garnæs, Jørgen
2012-01-01
We show that cheap large area color filters, based on surface scattering, can be fabricated in dielectric materials by replication of random structures in silicon. The specular transmittance of three different types of structures, corresponding to three different colors, have been characterized...
Effect of hexane extract of spinach in the removal of arsenic from rat
Directory of Open Access Journals (Sweden)
Badar Uddin Umar
2007-03-01
Full Text Available Extensive search is going on for a cheap, easily available and effective remedy of chronic arsenic poisoning. The present study was designed to find the effects of hexane extract of spinach in the removal of arsenic from arsenic treated rat. Rats were fed arsenic trioxide through Ryle’s tube for one month then they were fed on hexane extract (1-4% of spinach for another one month. Hexane extract of spinach decreased accumulated arsenic from rat liver, spleen, kidney, intestine, lungs and skin significantly. Besides, it reduced the oxidative stress caused by arsenic which was evident by decreased levels of malondialdehye (MDA in the above tissues. Hexane extract decreases both arsenic level and MDA level in rat tissues in dose dependent manner, which is more effective at lower doses.
Effect of hexane extract of spinach in the removal of arsenic from rat
Directory of Open Access Journals (Sweden)
Badar Uddin Umar
2007-06-01
Full Text Available Extensive search is going on for a cheap, easily available and effective remedy of chronic arsenic poisoning. The present study was designed to find the effects of hexane extract of spinach in the removal of arsenic from arsenic treated rat. Rats were fed arsenic trioxide through Ryle’s tube for one month then they were fed on hexane extract (1-4% of spinach for another one month. Hexane extract of spinach decreased accumulated arsenic from rat liver, spleen, kidney, intestine, lungs and skin significantly. Besides, it reduced the oxidative stress caused by arsenic which was evident by decreased levels of malondialdehyde (MDA in the above tissues. Hexane extract decreases both arsenic level and MDA level in rat tissues in dose dependent manner, which is more effective at lower doses.
2016-08-01
investments in the development of off-post housing, shopping facilities, dining facilities ( restaurants ), and other busi- nesses that provide...Regional Urban Growth model (RUG) (Westervelt 2011), the ERDC TR-16-1 35 Landuse Evolution and Impact Assessment Model (LEAM) (Deal 2004), and the U.S...Land Use Scenarios JCSG Joint Cross-Service Group KBDI Keetch-Byram Drought Index LEAM Land-use Evolution and impact Assessment Model MAC Maneuver
ANADOLU’DA ÜRETİLEN KİLİM MOTİFLERİNDEN BUKAĞI MOTİFİ VE BU MOTİFDEN ÇIKAN SERAMİK ÇALIŞMALAR
Directory of Open Access Journals (Sweden)
Kadir Sevim
2013-01-01
Full Text Available Rug" can be defined briefly as a name given to a kind of woven ground cloth. In various parts of the world, many people from different cultures use all kinds of woven products in their living spaces either for necessity or for decoration purposes. These woven products has a past transferred through generations Despite the changes in production techniques along with changing technology in our day, meaning in the ornaments has come to this day preserving its actual value.The ornaments used in rugs keep on being an inspiration to many artists. In this paper, commitment motive used in rugs will be defined and the ceramic samples made with the influence of this motive will be explained with their images.
1 The effectiveness of ultrasound in the diagnosis of bladder ...
African Journals Online (AJOL)
evaluating patients presenting with haematuria or suspected to have bladder tumours. It is cheap, ... world, transitional cell carcinoma (TCC) is the commonest, while in developing countries squamous cell ..... Fenlon, H., Bell, T., Ahari, H. & Hussain, S. (1997) Virtual cystoscopy: early clinical experience. Radiology 250 ...
Effect of using Geogebra on senior high school students ...
African Journals Online (AJOL)
kofi.mereku
Keywords GeoGebra; circle theorems; teaching geometry ... step towards the use of ICT in the teaching and learning of Mathematics which will be an ..... Despite the drawbacks of the traditional approach, it is cheap and does not require much rigorous ..... Assessment primary 3 and Primary 6 English and Mathematics.
Exploiting the Adaptation Dynamics to Predict the Distribution of Beneficial Fitness Effects.
Directory of Open Access Journals (Sweden)
Sona John
Full Text Available Adaptation of asexual populations is driven by beneficial mutations and therefore the dynamics of this process, besides other factors, depends on the distribution of beneficial fitness effects. It is known that on uncorrelated fitness landscapes, this distribution can only be of three types: truncated, exponential and power law. We performed extensive stochastic simulations to study the adaptation dynamics on rugged fitness landscapes, and identified two quantities that can be used to distinguish the underlying distribution of beneficial fitness effects. The first quantity studied here is the fitness difference between successive mutations that spread in the population, which is found to decrease in the case of truncated distributions, remains nearly a constant for exponentially decaying distributions and increases when the fitness distribution decays as a power law. The second quantity of interest, namely, the rate of change of fitness with time also shows quantitatively different behaviour for different beneficial fitness distributions. The patterns displayed by the two aforementioned quantities are found to hold good for both low and high mutation rates. We discuss how these patterns can be exploited to determine the distribution of beneficial fitness effects in microbial experiments.
Risk of DDT residue in maize consumed by infants as complementary diet in southwest Ethiopia.
Mekonen, Seblework; Lachat, Carl; Ambelu, Argaw; Steurbaut, Walter; Kolsteren, Patrick; Jacxsens, Liesbeth; Wondafrash, Mekitie; Houbraken, Michael; Spanoghe, Pieter
2015-04-01
Infants in Ethiopia are consuming food items such as maize as a complementary diet. However, this may expose infants to toxic contaminants like DDT. Maize samples were collected from the households visited during a consumption survey and from markets in Jimma zone, southwestern Ethiopia. The residues of total DDT and its metabolites were analyzed using the Quick, Easy, Cheap, Effective, Rugged and Safe (QuEChERS) method combined with dispersive solid phase extraction cleanup (d-SPE). Deterministic and probabilistic methods of analysis were applied to determine the consumer exposure of infants to total DDT. The results from the exposure assessment were compared with the health based guidance value in this case the provisional tolerable daily intake (PTDI). All maize samples (n=127) were contaminated by DDT, with a mean concentration of 1.770 mg/kg, which was far above the maximum residue limit (MRL). The mean and 97.5 percentile (P 97.5) estimated daily intake of total DDT for consumers were respectively 0.011 and 0.309 mg/kg bw/day for deterministic and 0.011 and 0.083 mg/kg bw/day for probabilistic exposure assessment. For total infant population (consumers and non-consumers), the 97.5 percentile estimated daily intake were 0.265 and 0.032 mg/kg bw/day from the deterministic and probabilistic exposure assessments, respectively. Health risk estimation revealed that, the mean and 97.5 percentile for consumers, and 97.5 percentile estimated daily intake of total DDT for total population were above the PTDI. Therefore, in Ethiopia, the use of maize as complementary food for infants may pose a health risk due to DDT residue. Copyright © 2014 Elsevier B.V. All rights reserved.
López-García, Marina; Romero-González, Roberto; Garrido Frenich, Antonia
2018-03-09
A new analytical method based on ultra-high performance liquid chromatography (UHPLC) coupled to Orbitrap high resolution mass spectrometry (Orbitrap-HRMS) has been developed for the determination of steroid hormones (hydrocortisone, cortisone, progesterone, prednisone, prednisolone, testosterone, melengesterol acetate, hydrocortisone-21-acetate, cortisone-21-acetate, testosterone propionate, 17α-methyltestosterone, 6α-methylprednisolone and medroxyprogesterone) and their metabolite (17α-hydroxyprogesterone) in three meat samples (chicken, pork and beef). Two different extraction approaches were tested (QuEChERS "quick, easy, cheap, effective, rugged and safe" and "dilute and shoot"), observing that the QuEChERS method provided the best results in terms of recovery. A clean-up step was applied comparing several sorbents, obtaining the best results when florisil and aluminum oxide were used. The optimized method was validated, obtaining suitable results for all validation parameters in the three meat matrices evaluated. Recovery values ranged from 70% to 103% (except for prednisone in beef samples), meanwhile repeatability and reproducibility were obtained at values lower than 18% and 21%, respectively. The limit of quantification (LOQ) was established for most of the compounds at 1.0 μg/kg, except for testosterone in chicken and hydrocortisone-21-acetate and cortisone-21-acetate in pork at 2.0 μg/kg. Decision limit (CCα) and detection capability (CCβ) values ranged from 1.0-2.7 μg/kg and 1.9-5.5 μg/kg, respectively, in the three matrices. Finally, thirty one meat samples were analyzed and two hormones, progesterone and hydrocortisone, were detected in a beef and pork sample at 1.7 and 2.8 μg/kg respectively. Copyright © 2018 Elsevier B.V. All rights reserved.
Nielsen, Kristian Fog; Ngemela, Archard Ferdinand; Jensen, Lene Bai; de Medeiros, Lívia Soman; Rasmussen, Peter Have
2015-01-28
A method was developed for simultaneous determination of the mycotoxins: ochratoxin A (OTA) and fumonisins B2 (FB2), B4 (FB4), and B6 (FB6) in green, roasted, and instant coffee. Extraction was performed by QuEChERS (quick, easy, cheap, effective, rugged, and safe) under acidic conditions followed by mixed-mode reversed phase-anion exchange solid phase extraction. OTA and FB2 were detected at levels down to 0.5 and 2 μg/kg by UHPLC-MS/MS and quantitated via isotope dilution using U-(13)C-labeled FB2 and OTA as internal standards. Mixing 20% isopropanol in the acetonitrile of the acidic UHPLC gradient system increased the signal intensity by 50% and decreased the ion-suppression with 50-75% in roasted coffee samples. About half of the roasted coffee samples (n = 57, from 9 countries) contained detectable levels of OTA, however, with only 5 samples above the EU regulatory limit of 5 μg/kg and the highest with 21 μg/kg. None of the 25 instant coffee samples contained OTA above the EU regulatory level of 10 μg/kg. Nonetheless, the toxin could be detected in 56% of the analyzed instant coffee samples. Fumonisins were not detected in any of the roasted or instant coffee samples (n = 82). However, in the green coffee samples (n = 18) almost half of the samples were positive with a maximum value of 164 μg/kg (sum of FB2, FB4, and FB6). This discrepancy between green coffee and processed coffees indicated that the fumonisins decompose during the roasting process, which was confirmed in roasting experiments. Here fumonisins could not be detected after roasting of the green, 164 μg/kg coffee, sample. Under the same conditions, OTA was reduced from 2.4 to 0.5 μg/kg.
Ramadan, Gouda; Al Jabir, Muna; Alabdulmalik, Najat; Mohammed, Ali
2016-05-01
Most countries have clearly defined regulations governing the use of pesticides in agricultural activity. The application of pesticides in agriculture usually leads to a residual amount of these pesticides on food products such as fruit and vegetables. The presence of pesticide residues on these foods destined for human consumption may pose food safety risks to consumers. To protect consumers, national authorities have established maximum limits for pesticide residues in foods. These limits can only be enforced if there are methods available to detect and monitor their concentrations in the applicable food products. To support the enforcement of this legislation, we have developed a multi-residue liquid chromatography-tandem mass spectrometry (LC-MS/MS) method for the analysis of 120 pesticide residues in apples and cucumbers which has been validated and implemented in the routine monitoring and surveillance programme for these pesticides. In this method, apple and cucumber samples are extracted using the QuEChERS method (quick, easy, cheap, effective, rugged, and safe) and the extracts were analyzed directly by LC-MS/MS. The mean recoveries at three different concentrations of 0.01 µg/g , 0.05 µg/g, and 0.1 µg/g over the analytical range varied between 70 and 120%. The repeatability of the method expressed as %RSD was less than 20%. The limit of detection (LOD) of the method ranged between 0.0014 and 0.0110 µg/g for apples and between 0.0012 and 0.0075 µg/g for cucumbers. The limit of quantification (LOQ) of the method was 0.01 µg/g for apples and cucumbers. The method has been used for the analysis of over 600 apple and 550 cucumber samples over the past two years. Copyright © 2016 John Wiley & Sons, Ltd. Copyright © 2016 John Wiley & Sons, Ltd.
Cheng, Zhipeng; Dong, Fengshou; Xu, Jun; Liu, Xingang; Wu, Xiaohu; Chen, Zenglong; Pan, Xinglu; Zheng, Yongquan
2016-02-26
In this study, the application of atmospheric pressure gas chromatography quadrupole-time-of-flight mass spectrometry (APGC-QTOF-MS) has been investigated for simultaneous determination of fifteen organochlorine pesticides in soil and water. Soft ionization of atmospheric pressure gas chromatography was evaluated by comparing with traditional more energetic electron impact ionization (EI). APGC-QTOF-MS showed a sensitivity enhancement by approximately 7-305 times. The QuEChERs (Quick, Easy, Cheap, Effective, Rugged, and Safe) method was used to pretreat the soil samples and solid phase extraction (SPE) cleanup was used for water samples. Precision, accuracy and stability experiments were undertaken to evaluate the feasibility of the method. The results showed that the mean recoveries for all the pesticides from the soil samples were 70.3-118.9% with 0.4-18.3% intra-day relative standard deviations (RSD) and 1.0-15.6% inter-day RSD at 10, 50 and 500 μg/L levels, while the mean recoveries of water samples were 70.0-118.0% with 1.1-17.8% intra-day RSD and 0.5-12.2% inter-day RSD at 0.1, 0.5 and 1.0 μg/L levels. Excellent linearity (0.9931 ≦ r(2)≤ 0.9999) was obtained for each pesticides in the soil and water matrix calibration curves within the range of 0.01-1.0mg/L. The limits of detection (LOD) for each of the 15 pesticides was less than 3.00 μg/L, while the limit of quantification (LOQ) was less than 9.99 μg/L in soil and water. Furthermore, the developed method was successfully applied to monitor the targeted pesticides in real soil and water samples. Copyright © 2016 Elsevier B.V. All rights reserved.
Genualdi, Susan; Nyman, Patricia; DeJager, Lowri
2017-01-01
Acid hydrolyzed vegetable protein (aHVP) is used for flavoring a wide variety of foods and also in the production of nonfermented soy sauce. During the production of aHVP, chloropropanols including 3-monochloropropane-1,2-diol (3-MCPD) and 1,3 dichloropropane-2-ol (1,3-DCP) can be formed through the reaction of the hydrochloric acid catalyst and residual fat and the reaction of 3-MCPD with acetic acid, respectively. 3-MCPD is a carcinogen, and 1,3-DCP has been classified as a genotoxic carcinogen. The European Union (EU) has set a maximum concentration of 0.02 mg/kg of 3-MCPD in aHVP, and the Food and Drug Administration (FDA) set a guidance limit of 1 mg/kg of 3-MCPD in aHVP. 1,3-DCP is not an approved food additive, and the Joint FAO/WHO Expert Committee on Food Additives (JEFCA) has set a limit at 0.005 mg/kg, which is close to the estimated method detection limit. Currently there are few analytical methods for the simultaneous determination of 3-MCPD and 1,3-DCP without derivatization due to differences in their physical chemical properties and reactivity. A new method was developed using QuEChERS (quick, easy, cheap, effective, rugged, and safe) with direct analysis of the extract without derivatization using gas chromatography–triple quadrupole mass spectrometry (GC-QQQ). Additionally, a market sampling of 60 soy sauce samples was performed in 2015 to determine if concentrations have changed since the FDA limit was set in 2008. The sampling results were compared between the new QuEChERS method and a method using phenylboronic acid (PBA) as a derivatizing agent for 3-MCPD analysis. The concentrations of 3-MCPD detected in soy sauce samples collected in 2015 (3-MCPD below current regulatory limits PMID:28064506
Genualdi, Susan; Nyman, Patricia; DeJager, Lowri
2017-02-01
Acid hydrolyzed vegetable protein (aHVP) is used for flavoring a wide variety of foods and also in the production of nonfermented soy sauce. During the production of aHVP, chloropropanols including 3-monochloropropane-1,2-diol (3-MCPD) and 1,3 dichloropropane-2-ol (1,3-DCP) can be formed through the reaction of the hydrochloric acid catalyst and residual fat and the reaction of 3-MCPD with acetic acid, respectively. 3-MCPD is a carcinogen, and 1,3-DCP has been classified as a genotoxic carcinogen. The European Union (EU) has set a maximum concentration of 0.02 mg/kg of 3-MCPD in aHVP, and the Food and Drug Administration (FDA) set a guidance limit of 1 mg/kg of 3-MCPD in aHVP. 1,3-DCP is not an approved food additive, and the Joint FAO/WHO Expert Committee on Food Additives (JEFCA) has set a limit at 0.005 mg/kg, which is close to the estimated method detection limit. Currently there are few analytical methods for the simultaneous determination of 3-MCPD and 1,3-DCP without derivatization due to differences in their physical chemical properties and reactivity. A new method was developed using QuEChERS (quick, easy, cheap, effective, rugged, and safe) with direct analysis of the extract without derivatization using gas chromatography-triple quadrupole mass spectrometry (GC-QQQ). Additionally, a market sampling of 60 soy sauce samples was performed in 2015 to determine if concentrations have changed since the FDA limit was set in 2008. The sampling results were compared between the new QuEChERS method and a method using phenylboronic acid (PBA) as a derivatizing agent for 3-MCPD analysis. The concentrations of 3-MCPD detected in soy sauce samples collected in 2015 (3-MCPD below current regulatory limits.
Evaluation of two fast and easy methods for pesticide residue analysis in fatty food matrixes.
Lehotay, Steven J; Mastovská, Katerina; Yun, Seon Jong
2005-01-01
Two rapid methods of sample preparation and analysis of fatty foods (e.g., milk, eggs, and avocado) were evaluated and compared for 32 pesticide residues representing a wide range of physicochemical properties. One method, dubbed the quick, easy, cheap, effective, rugged, and safe (QuEChERS) method for pesticide residue analysis, entailed extraction of 15 g sample with 15 mL acetonitrile (MeCN) containing 1% acetic acid followed by addition of 6 g anhydrous magnesium sulfate and 1.5 g sodium acetate. After centrifugation, 1 mL of the buffered MeCN extract underwent a cleanup step (in a technique known as dispersive solid-phase extraction) using 50 mg each of C18 and primary secondary amine sorbents plus 150 mg MgSO4. The second method incorporated a form of matrix solid-phase dispersion (MSPD), in which 0.5 g sample plus 2 g C18 and 2 g anhydrous sodium sulfate was mixed in a mortar and pestle and added above a 2 g Florisil column on a vacuum manifold. Then, 5 x 2 mL MeCN was used to elute the pesticide analytes from the sample into a collection tube, and the extract was concentrated to 0.5 mL by evaporation. Extracts in both methods were analyzed concurrently by gas chromatography/mass spectrometry and liquid chromatography/tandem mass spectrometry. The recoveries of semi-polar and polar pesticides were typically 100% in both methods (except that basic pesticides, such as thiabendazole and imazalil, were not recovered in the MSPD method), but recovery of nonpolar pesticides decreased as fat content of the sample increased. This trend was more pronounced in the QuEChERS method, in which case the most lipophilic analyte tested, hexachlorobenzene, gave 27 +/- 1% recovery (n=6) in avocado (15% fat) with a<10 ng/g limit of quantitation.
Sonourethrography in the evaluation of anterior urethral strictures
International Nuclear Information System (INIS)
Kim, Jong Chul; Kwag, Jin Geun
1994-01-01
To determine the reliability of sonourethrography (SUG) in the evaluation of male anterior urethral strictures. Both SUG with retrograde saline infusion and retrograde urethrography (RUG) were performed in 5 young normal volunteers and 20 patients with symptoms of impaired urine flow. Those findings were compared with urethroscopic and operative findings in all patients. SUG was more accurate in the evaluation of the stricture length and degree than RUG in 7 patients with anterior urethral strictures, when compared with their subsequent open urethroplasty findings. Only SUG could classify the degree of spongiofibrosis surrounding the strictures in 15 patients. So, SUG was diagnostically as efficacious as or, superior to, RUG in all 20 patients. SUG can be used as one of complementary and reliable tools for diagnosis, evaluation and follow-up of anterior urethral strictures
Zebrafish embryos as models for embryotoxic and teratological effects of chemicals.
Yang, Lixin; Ho, Nga Yu; Alshut, Rüdiger; Legradi, J.B.; Weiss, Carsten; Reischl, Markus; Mikut, Ralf; Liebel, Urban; Müller, Ferenc; Strähle, Uwe
2009-01-01
The experimental virtues of the zebrafish embryo such as small size, development outside of the mother, cheap maintenance of the adult made the zebrafish an excellent model for phenotypic genetic and more recently also chemical screens. The availability of a genome sequence and several thousand
Czech Academy of Sciences Publication Activity Database
Blume, A.; Ortmann, Andreas
2007-01-01
Roč. 132, č. 1 (2007), s. 274-290 ISSN 0022-0531 Institutional research plan: CEZ:MSM0021620846 Keywords : coordination games * order-statistic games * cheap talk Subject RIV: AH - Economics Impact factor: 1.353, year: 2007
Arling, Greg; Kane, Robert L; Mueller, Christine; Lewis, Teresa
2007-01-01
Objective To explain variation in direct care resource use (RU) of nursing home residents based on the Resource Utilization Groups III (RUG-III) classification system and other resident- and unit-level explanatory variables. Data Sources/Study Setting Primary data were collected on 5,314 nursing home residents in 156 nursing units in 105 facilities from four states (CO, IN, MN, MS) from 1998 to 2004. Study Design Nurses and other direct care staff recorded resident-specific and other time caring for all residents on sampled nursing units. Care time was linked to resident data from the Minimum Data Set assessment instrument. Major variables were: RUG-III group (34-group), other health and functional conditions, licensed and other professional minutes per day, unlicensed minutes per day, and direct care RU (wage-weighted minutes). Resident- and unit-level relationships were examined through hierarchical linear modeling. Data Collection/Extraction Methods Time study data were recorded with hand-held computers, verified for accuracy by project staff at the data collection sites and then merged into resident and unit-level data sets. Principal Findings Resident care time and RU varied between and within nursing units. RUG-III group was related to RU; variables such as length of stay and unit percentage of high acuity residents also were significantly related. Case-mix indices (CMIs) constructed from study data displayed much less variation across RUG-III groups than CMIs from earlier time studies. Conclusions Results from earlier time studies may not be representative of care patterns of Medicaid and private pay residents. New RUG-III CMIs should be developed to better reflect the relative costs of caring for these residents. PMID:17362220
Gebauer, D; Cziuk, N
1988-01-01
Biomechanical loading of total knee and hip replacement is one of the essential factors which limit the longterm-function of the implant components. A simple and cheap safety provision to avoid mechanical overload seems to be wearing of shock-absorbing shoes. The performed study analyzes the effect of that type of shoe. For judgement the parameters: energy absorption while slow shock, damping while hard shock and safety against sliding were taken. The experiments showed the shock-absorbing shoe is an easy, inexpensive, but very efficient protection measure to improve the longterm-stability of endoprosthesis of the lower extremity.
Cheap two axis sun following device
International Nuclear Information System (INIS)
Roth, P.; Georgiev, A.; Boudinov, H.
2005-01-01
A sun following system was constructed and tested. The tracker gives the possibility for automatic measuring of direct solar radiation with a phetylureum. The mechanism is operated by a digital program in the control system, situated separately from the mechanical part. The position of the sun is calculated, and the pointing errors appearing during its daily work are stored for later analysis. Additionally, in the active operation mode, the tracker uses the signal of a sun detecting linear sensor to control the pointing. Two stepper motors move the instrument platform, keeping the sun's beam at the center of the sensor. The mechanism was created at the Laboratory 'Evaluation Solar' of the Technical University Faradaic Santa Maria (UTFSM) in Valparaiso, Chile. The experiments show good results. The described sun tracker gives similar results as the Swiss sun tracker INTRA at a very much lower price
Cheap Words: A Paperback Dictionary Roundup.
Kister, Ken
1979-01-01
Surveys currently available paperback editions in three classes of dictionaries: collegiate, abridged, and pocket. A general discussion distinguishes among the classes and offers seven consumer tips, followed by an annotated listing of dictionaries now available. (SW)
Cheap oil. Good news - for most
Lorié, J.
2014-01-01
- The oil price has fallen by 40% in recent months, as a result of increasing oil supply, and is expected to be in the range of USD 70 - 80 per barrel in 2015. - The global economy is set to benefit, as are oil importing regions such as Europe and Asia. - Oil exporting countries like Brazil, Russia
Commercial space development needs cheap launchers
Benson, James William
1998-01-01
SpaceDev is in the market for a deep space launch, and we are not going to pay $50 million for it. There is an ongoing debate about the elasticity of demand related to launch costs. On the one hand there are the ``big iron'' NASA and DoD contractors who say that there is no market for small or inexpensive launchers, that lowering launch costs will not result in significantly more launches, and that the current uncompetitive pricing scheme is appropriate. On the other hand are commercial companies which compete in the real world, and who say that there would be innumerable new launches if prices were to drop dramatically. I participated directly in the microcomputer revolution, and saw first hand what happened to the big iron computer companies who failed to see or heed the handwriting on the wall. We are at the same stage in the space access revolution that personal computers were in the late '70s and early '80s. The global economy is about to be changed in ways that are just as unpredictable as those changes wrought after the introduction of the personal computer. Companies which fail to innovate and keep producing only big iron will suffer the same fate as IBM and all the now-extinct mainframe and minicomputer companies. A few will remain, but with a small share of the market, never again to be in a position to dominate.
The last season of cheap electricity
International Nuclear Information System (INIS)
Marcan, P.; Mucka, F.
2007-01-01
The former 'Mr. SuperCEZ', as the Czech media often used to call Jaroslav Mil, claims he is not a nuclear fundamentalist. But in his opinion without the use of nuclear energy, Europe must expect an increase in the electricity price. The experience of the former director of CEZ caught the attention of the Italian directors of Enel and so he is now a member of the Board of Directors of Slovenske elektrarne. He criticises EU measures that do not offer a solution for either the energy sector or environment protection but make investments in the replacement of decommissioned European power stations uncertain. He says he is not an uncritical advocate of nuclear power, but in his opinion we do not have much choice. Energy consumption is growing fast and resources are being depleted. And if Europe does not want to become dependent on Russia there is no other option. Unless we want Putin's vision to come true: coal and nuclear resources will be kept by Russia for internal use and gas is for export. In the opinion of J. Mil, politicians are often populists and are only doing their jobs. They think in terms of 4-year election periods and then only in the better cases. He recalls that in 2000 politicians seriously considered the possibility of closing down the Temelin nuclear power station in the Czech Republic. As long as there is electricity in the sockets and the bulbs are glowing there is no crisis. The crisis will come when there is no electricity. He stresses that there will always be electricity but for a different price. He mentioned emission permits as an example of the attitude politicians have. This is a useless measure that only supports big business available to a narrow circle which does not help the environment at all. The Kyoto protocol without China, Brazil, India and the USA is a nightmare and does not solve anything in his opinion. (authors)
"Dirt Cheap" Project Teaches Soils Engineering
Roman, Harry T.
2010-01-01
This article describes a soil-testing activity that enables students to learn some interesting and useful things about how soil behaves under varied conditions. It offers a great way to give them a practical pre-engineering experience and will show them how engineers think about construction and how local soils influence building design. The…
A Self-Assessment of Cultural Competence in Military Mental Health Providers
2008-01-31
little of his/her personal information), a focus on rugged individualism (versus collectivism), autonomy (versus interdependence), emphasis on long-range...increased perceived counselor empathy. In a similar study, Lowe (2005) examined the effect of integrating Asian collectivist values into counseling...a collectivist or individualistic approach to counseling. Counselors using the collectivist approach (i.e., making at least five statements
Ligand-Doped Copper Oxo-hydroxide Nanoparticles are Effective Antimicrobials
Bastos, Carlos A. P.; Faria, Nuno; Ivask, Angela; Bondarenko, Olesja M.; Kahru, Anne; Powell, Jonathan
2018-04-01
Bacterial resistance to antimicrobial therapies is an increasing clinical problem. This is as true for topical applications as it is for systemic therapy. Topically, copper ions may be effective and cheap antimicrobials that act through multiple pathways thereby limiting opportunities to bacteria for resistance. However, the chemistry of copper does not lend itself to facile formulations that will readily release copper ions at biologically compatible pHs. Here, we have developed nanoparticulate copper hydroxide adipate tartrate (CHAT) as a cheap, safe, and readily synthesised material that should enable antimicrobial copper ion release in an infected wound environment. First, we synthesised CHAT and showed that this had disperse aquated particle sizes of 2-5 nm and a mean zeta potential of - 40 mV. Next, when diluted into bacterial medium, CHAT demonstrated similar efficacy to copper chloride against Escherichia coli and Staphylococcus aureus, with dose-dependent activity occurring mostly around 12.5-50 mg/L of copper. Indeed, at these levels, CHAT very rapidly dissolved and, as confirmed by a bacterial copper biosensor, showed identical intracellular loading to copper ions derived from copper chloride. However, when formulated at 250 mg/L in a topically applied matrix, namely hydroxyethyl cellulose, the benefit of CHAT over copper chloride was apparent. The former yielded rapid sustained release of copper within the bactericidal range, but the copper chloride, which formed insoluble precipitates at such concentration and pH, achieved a maximum release of 10 ± 7 mg/L copper by 24 h. We provide a practical formulation for topical copper-based antimicrobial therapy. Further studies, especially in vivo, are merited.
Chitosan application in maize ( Zea mays ) to counteract the effects ...
African Journals Online (AJOL)
There are several strategies for managing the problem, but in the future, people will prefer the cleaner and cheaper technology. The use of elicitors for protection of corn can be considered a cheap and clean technology. Chitosan elicitor is a linear polysaccharide produced commercially by deacetylation of chitin. It has been ...
Cheap oil benefits coal on the short term, not the long
Energy Technology Data Exchange (ETDEWEB)
Soras, C.G.; Stodden, J.R.
1986-03-01
This is a brief article describing the effects of the declining price of oil on the coal industry. The oil price explosion from 1973-1979 is described along with the present day situation. Oil consumption in the US and the general drop in production worldwide is represented. It is concluded that the coal industry will benefit in the short term from the present crisis but stands to make some losses in the long run.
Ginting, Nurzainah; Pase, E.
2018-03-01
This study aims to examine the effect of incubation times of sago waste by local microorganism (MOL) “Ginta” to the crude protein and crude fiber content in relation to finding a cheap and good quality ruminants feed alternative. Incubation times were 0 hours to 144 hours. The data obtained were analyzed using Completely Randomize Design consisting of seven treatments and three replications. The result showed that the duration of incubation of sago waste by local microorganism (MOL) “Ginta” caused pH reduction, improved crude protein and crude fiber content. pH reduction was from 7.03 at 0 hour to 4.05 at 144 hours incubation. The highest increased in crude protein was H6U3 (5.58%) : 144 hours incubation and the lowest was H0U2 (3.22%) : 0 hour incubation while the highest crude fiber was H0U1 (19.99%) : 0 hour incubation and the lowest was H6U3 (18.23%) : 144 hours incubation. It can be concluded that incubation of sago waste triggered lower pH, higher crude protein and lower crude fiber than uninoculated. A recommendation could be given on using MOL ‘Ginta” in order to produce a cheap and good quality ruminans feed alternative.
Rapid, easy, and cheap randomization: prospective evaluation in a study cohort
Directory of Open Access Journals (Sweden)
Parker Melissa J
2012-06-01
Full Text Available Abstract Background When planning a randomized controlled trial (RCT, investigators must select randomization and allocation procedures based upon a variety of factors. While third party randomization is cited as being among the most desirable randomization processes, many third party randomization procedures are neither feasible nor cost-effective for small RCTs, including pilot RCTs. In this study we present our experience with a third party randomization and allocation procedure that utilizes current technology to achieve randomization in a rapid, reliable, and cost-effective manner. Methods This method was developed by the investigators for use in a small 48-participant parallel group RCT with four study arms. As a nested study, the reliability of this randomization procedure was prospectively evaluated in this cohort. The primary outcome of this nested study was the proportion of subjects for whom allocation information was obtained by the Research Assistant within 15 min of the initial participant randomization request. A secondary outcome was the average time for communicating participant group assignment back to the Research Assistant. Descriptive information regarding any failed attempts at participant randomization as well as costs attributable to use of this method were also recorded. Statistical analyses included the calculation of simple proportions and descriptive statistics. Results Forty-eight participants were successfully randomized and group allocation instruction was received for 46 (96% within 15 min of the Research Assistant placing the initial randomization request. Time elapsed in minutes until receipt of participant allocation instruction was Mean (SD 3.1 +/− 3.6; Median (IQR 2 (2,3; Range (1–20 for the entire cohort of 48. For the two participants for whom group allocation information was not received by the Research Assistant within the 15-min pass threshold, this information was obtained following a second
H.A. Hong; E.J.M. Rooijakkers; N.T. Ke; J.M. Groen (Jan); A.D.M.E. Osterhaus (Albert)
1994-01-01
textabstractSince rabies is still a major cause of human death in many developing countries and the implementation of recommended post-exposure prophylaxis by vaccination and specific immunoglobulin therapy is largely hampered by its high cost, the development of cheap rabies vaccines and
Directory of Open Access Journals (Sweden)
Rajesh K. Singh
2018-01-01
Full Text Available A new, facile, cost-effective and environment-friendly protocol is reported for the synthesis of 1-amidoalkyl-2-naphthols exploring tannic acid as a novel, cheap and biodegradable catalyst. β-naphthol is condensed with substituted aromatic aldehydes and various amides using catalytic amount of tannic acid in the absence of solvent under thermal (hot plate and oil bath and microwave irradiation techniques. This green protocol offers many advantages such as short reaction time, use of environment-friendly and cheap catalyst and good to excellent yields.
Xanadu Is Old, Rugged And Low-lying
Wood, Charles; Kirk, R. L.; Stofan, E.; Stiles, B.; Zebker, H.; Ostro, S.; Radebaugh, J.; Lorenz, R. D.; Callahan, P.; Wall, S.
2007-10-01
Xanadu was the first surface feature discovered on Titan. It is anomalously bright in the IR, and is also radar bright with unusual physical properties. Xanadu is continent size ( 4000 km wide) with a sharp boundary to the west against the dark dunes of Shangri-La, and less distinct boundaries in other areas. Because of its size and reflectivity it had been proposed that Xanadu is an elevated continent. But it is not. A new topography-from-SAR technique shows that along the T13 Radar swath which completely transects Xanadu, the average topographic elevation is indistinguishable from that of the surrounding terrain. There are many mountains with peaks locally rising up to 1-2 km, but the average elevation of the T13 pass is 200 m +/- 300 m lower than the radius of Titan. The highest point is near the swath center. Photogeologic interpretation suggests that Xanadu slopes to the south; three major river systems begin in the north and flow southward. The lack of significant average elevation means that it is not necessary to create models to explain how Xanadu is dynamically supported. Its eroded-looking terrain, large number of possible eroded impact craters, dune encroachment on its western edge, and apparent detached patches of similar material near its margins all suggest that Xanadu is a relict terrain, currently being disaggregated. The only sign of current activity is the river channels. We speculate that Xanadu was originally a landform of higher elevation (2 km higher if the mountain tops are remnants of an original surface) that has been modified by erosion and/or isostatic adjustment. If the observed river systems have eroded and removed the putative higher terrain there may be significant sediment deposits in the central or southern parts of Xanadu, and/or this material may have been redistributed by winds.
Rugged, remotely maintainable pipetter using microprocessor control
International Nuclear Information System (INIS)
Dykes, F.W.; Shurtliff, R.M.; Henscheid, J.P.; Baldwin, J.M.
1979-01-01
At the Idaho Chemical Processing Plant (ICPP), the chemical analysis of future nuclear fuel reprocessing solutions will require improved analytical apparatus. Remote pipetters are crucial components in the analysis procedures. Major improvements required for a new pipetter were: greater accuracy for better accounting of fissile material, greater corrosion resistance to handle new fuel reprocessing schemes, and drastic reduction in contact maintenance to reduce personnel radiation exposure to as low as reasonably achievable. The 20-year old Model B pipetter was used as the basis for an improved design. The existing pipetters are positive displacement, servo-controlled units developed from Oak Ridge National Laboratory (ORNL) designs created at the time the ICPP was built. The new pipetter is identified as the Model C
Cost-effective on-site screening for anaemia in pregnancy in primary ...
African Journals Online (AJOL)
syphilis serology. Results are returned days or weeks later depending on local circumstances.2 For some mobile clinics in rural areas, this delay may be as long as a month. On-site screening for ... probably anaemic still require a diagnostic test to determine ... accurate and cheap screening for and diagnosis of anaemia,.
Govindarajan, Marimuthu; Hoti, S L; Benelli, Giovanni
2016-12-01
Mosquito (Diptera: Culicidae) vectors are solely responsible for transmitting important diseases such as malaria, dengue, chikungunya, Japanese encephalitis, lymphatic filariasis and Zika virus. Eco-friendly control tools of Culicidae vectors are a priority. In this study, we proposed a facile fabrication process of poly-disperse and stable silver nanoparticles (Ag NPs) using a cheap leaf extract of Ichnocarpus frutescens (Apocyanaceae). Bio-reduced Ag NPs were characterized by UV-vis spectrophotometry, Fourier transform infrared spectroscopy (FTIR), X-ray diffraction analysis (XRD), atomic force microscopy (AFM), scanning electron microscopy (SEM) and transmission electron microscopy (TEM). The acute toxicity of I. frutescens leaf extract and green-synthesized Ag NPs was evaluated against larvae of the malaria vector Anopheles subpictus, the dengue vector Aedes albopictus and the Japanese encephalitis vector Culex tritaeniorhynchus. Compared to the leaf aqueous extract, Ag NPs showed higher toxicity against A. subpictus, A. albopictus, and C. tritaeniorhynchus with LC 50 values of 14.22, 15.84 and 17.26μg/mL, respectively. Ag NPs were found safer to non-target mosquito predators Anisops bouvieri, Diplonychus indicus and Gambusia affinis, with LC 50 values ranging from 636.61 to 2098.61μg/mL. Overall, this research firstly shed light on the mosquitocidal potential of I. frutescens, a potential bio-resource for rapid, cheap and effective synthesis of poly-disperse and highly stable silver nanocrystals. Copyright © 2016 Elsevier Inc. All rights reserved.
International Nuclear Information System (INIS)
Opare-Boafo, Maame Serwa
2016-07-01
Vegetables play an important role in human nutrition and health. Pesticides are extensively used by vegetable farmers in crop production and this may contaminate the crop. Traditional method of washing vegetables prior to consumption has been assumed to reduce pesticide residues. The study seeks to assess the effect of washing with various solutions and with boiling on the concentration of pesticide residues in vegetables and to estimate the potential human health risk associated with pesticide ingestion via vegetable diet using the Quick, Easy, Cheap, Effective, Rugged and Safe (QuEChERS) method. Results of the study indicated that the farmers involved in vegetable farming in the Akwapim North Municipality are in the middle age group and use pesticides in their farming activities. Majority (65%) of them have no formal training in pesticide usage and apply pesticides in mixtures made of combinations of up to four (4) pesticides in a single tank mixture. The farmers do not use any protective clothing and stores agrochemicals in multipurpose storage structures together with food containers and farm implements. As a result of pesticide exposure, 67% of farmers experienced various kinds of discomfort including headache, tingling or burning of skin, irritation of eyes or skin. Chloropyrifos residue was the only pesticide residue that gave positive detection in the analysed vegetable samples. The raw (non-spiked) vegetable samples (cabbage, lettuce and squash) had 0.29 mg kg -1 , 0.19 mg kg -1 and 0.14 mg kg -1 of Chloropyrifos residue in cabbage, squash and lettuce respectively. The level of chloropyrifos residues detected in raw cabbage samples from the study area was below the maximum permissible limit (MPLs) of 1 mg/kg (Codex, 2003) but the residues found in raw squash was above the maximum permissible limit of 0.01 mg/kg and that of lettuce was also above the maximum permissible limit (0.05mg/kg). Washing of vegetables vigorously in water for 2 minutes before
Synergistic Effect of Cu2O and Urea as Modifiers of TiO2 for Enhanced Visible Light Activity
Directory of Open Access Journals (Sweden)
Marcin Janczarek
2018-06-01
Full Text Available Low cost compounds, i.e., Cu2O and urea, were used as TiO2 modifiers to introduce visible light activity. Simple and cheap methods were applied to synthesize an efficient and stable nanocomposite photocatalytic material. First, the core-shell structure TiO2–polytriazine derivatives were prepared. Thereafter, Cu2O was added as the second semiconductor to form a dual heterojunction system. Enhanced visible light activity was found for the above-mentioned nanocomposite, confirming a synergistic effect of Cu2O and urea (via polytriazine derivatives on titania surface. Two possible mechanisms of visible light activity of the considered material were proposed regarding the type II heterojunction and Z-scheme through the essential improvement of the charge separation effect.
CT urethrography. New imaging technique of the urethra
International Nuclear Information System (INIS)
Takeyama, Nobuyuki; Munechika, Hirotsugu
2005-01-01
The purpose of the study is to assess the usefulness of CT urethrography for evaluation of the posterior urethra and surrounding structures. The CT images were performed with 4 channel multidetector row CT unit. Twenty-six cases (12 cases of CT urethrography and 14 cases of conventional urethrography) were included in this study. 3D-volume rendering (VR) images and VR-multiplaner reconstruction (MPR) sagittal images were compared with conventional retrograde urethrography (RUG) images to evaluate the following anatomical structures; the inferior wall of bladder, the neck of bladder, the posterior urethra, and the prostate. Two radiologists undertook a task of evaluation of the images. There was no significant difference in image quality between RUG and 3D-VR. However, VR-MPR sagittal images were significantly better than RUG or 3D-VR images in any anatomical structures set up beforehand for evaluation. CT urerthrography was useful for evaluation of the posterior urethra and surrounding structures. (author)
The effect of house design and environment on fungal movement in homes of bronchial asthma patients.
Takatori, K; Saito, A; Yasueda, H; Akiyama, K
2001-01-01
The effect of house building design and environment on the fungal movement in the houses of 41 bronchial asthma (BA) patients has been investigated by examining house dust. The presence and composition of fungi were determined and compared in relation to building structure, house age, size of living room, main flooring material, presence of a living-room rug or air purifier, and frequency of vacuum cleaning. Among these elements, fungal CFU apparently varied only between building structure: wooden-board houses had significantly higher numbers of fungi than reinforced concrete houses (p prefabricated houses had significantly higher numbers of fungi than reinforced concrete houses (p < 0.05). Classification of the types of fungi present in the house dust of BA patients showed that, regardless of the building designs, there were high levels of osmophilic fungi (group A) and fungi that survive at relatively dry conditions (group B), whereas fungi that survive in very wet conditions (group D) were present at low frequency.
International Nuclear Information System (INIS)
Seki, Kazuhiko; Tachiya, M.
2007-01-01
In the present paper the authors present a theoretical model to explain the kinetics involving the induction period observed by Irie et al. [Nature (London) 420, 759 (2002)] for photoisomerization of diarylethene derivatives dispersed on polymer films at a single molecular level. In the model we assume that both ground state and excited state free energy landscapes which result from the interaction between the photochromic molecule and the surrounding polymer are rugged and have several local minima along the pathway to the critical point at which isomerization actually occurs. We assume that after one photoexcitation a fraction of the photochromic molecule moves to a new local minimum and stays there, although the other fraction returns to the original local minimum. The former effect is referred to as the memory effect. After repeated photoexcitations the photochromic molecule moves gradually from one local minimum to another in the pathway to the isomerization point. It finally reaches the isomerization point, where isomerization occurs. Their model successfully reproduces the kinetics of photoisomerization of diarylethene derivatives dispersed on polymer films observed experimentally
Effect of Alkali treatments on physical and Mechanical strength of Pineapple leaf fibres
Asim, M.; Jawaid, M.; Abdan, K.; Nasir, M.
2018-01-01
Pineapple leaf fibre (PALF) is a waste material of pineapple plants. PALF is abundant in amount for industrial purpose, cheap, easily available, high specific strength and stiffness. PALF is contributing a sustainable development in bio-composites as reinforcement material. However, natural fibres are not fully compatible with matrix due to hydrophilic in nature. To enhance the compatibility with matrix, fibres are modified its surface to make good interfacial bonding with matrix. In this research, PALF is treated with 3% and 6% concentration of NaOH for 3h, 6h 9h, and 12h soaking time. Surface modification of fibres was investigated by using scanning electron microscopy. Single fibre test and diameter of PALF fibres were evaluated the effects of NaOH treatments.
Protein (Cyanobacteria): 652400470 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available rug ABC transporter ATP-binding protein Planktothrix prolifica MNWAIEVKDSASMSSLNPVVATQNLGKFYRTGFWMNQKIESLKSC...QMRQYSKGMLQRVGMAQALINNPEVVFLDEPMSGLDPMGRYQIREIILSLKAQNKTVFFNSHVLSDVEKICDRIAILAEGE
productivity growth in food crop production in imo state, nigeria
African Journals Online (AJOL)
Prof. Adipala Ekwamu
Agriculture plays pivotal roles in Nigeria including food security, employment, foreign exchange earnings and ... Key Words: Productivity decomposition, scale effect, allocative efficiency ... and subsidies in the form of cheap credit was.
International Nuclear Information System (INIS)
El-ghar, Mohamed Abou; Osman, Yasser; Elbaz, Elsayed; Refiae, Huda; El-Diasty, Tarek
2010-01-01
Objectives: To compare the accuracy of magnetic resonance (MR) urethrogram versus combined RUG and sonourethrography (SUG) in diagnosis urethral stricture with evaluation of their impact in management choice. Material and methods: From March 2006 through February 2007; 30 male patients (mean age, 45 ± 18 years, range 15-75) with clinically suspected urethral stricture. All patients underwent RUG, SUG and MR urethrogram. Results: The final diagnosis of the 30 cases included in our study, after endoscopy and surgical management, was classified into two main groups either isolated stricture (20 cases) or associated with other pathologies (9 cases). There was one case with normal urethral caliber at endoscopy. For the anterior stricture the sensitivity, specificity and overall accuracy of RUG was 91%, 90% and 90%, respectively and for the posterior stricture it was 89%, 91.7% and 90%, respectively. At SUG, all cases of anterior were detected with 100% accuracy while for cases of posterior stricture, the overall accuracy was 60%. MR urethrogram diagnosed all the cases of anterior and posterior stricture with exact delineation of its length except one case of normal caliber was diagnosed falsely at MR as anterior short segment urethral with 100% sensitivity, 91.7% specificity and 95% overall accuracy. Conclusion: MR urethrogram has comparable results with the combined RUG and SUG in diagnosing the anterior and posterior urethral strictures as regard the site and extension and degree of spongiofibrosis but MR is superior in diagnosis of associated pathologies with stricture.
Expansionary economic effects of energy conversion under stagnation
International Nuclear Information System (INIS)
Ono, Yoshiyasu
2013-01-01
After the Fukushima disaster, energy conversion such as nuclear power phaseout and deployment of renewable energy or survival of nuclear power had been actively argued pro and con. Both sides admitted extra costs were needed but their economic effects would be contrary dependent on business state. Under better economy, extra costs would be actual burden of total economy. Under stagnation as was long in Japan at present, extra costs brought about expansion of employment and economy with simulated consumption increase. Industry conversion would occur such industry intensively using power would depreciate and energy conserved industry would grow. Difference of power use intensity between industries made difficult in energy conversion because present Japanese industry constitution was mostly formed based on cheap power cost for industry use. Even taking account of international competition, the same would be true by adjusting finance balance sheet and currency exchange rate. (T. Tanaka)
Directory of Open Access Journals (Sweden)
Balamurugan Chandramohan
2016-06-01
Conclusions: Overall, this study suggests that the methanolic fractions of neem cake may be considered as a new and cheap source of highly effective compounds against the rural malaria vector An. culicifacies.
Effect of Hydrochloric Acid Concentration on the Conversion of Sugarcane Bagasse to Levulinic Acid
Anggorowati, Heni; Jamilatun, Siti; Cahyono, Rochim B.; Budiman, Arief
2018-01-01
Levulinic acid is a new green platform chemical used to the synthesis of a variety of materials for numerous applications such as fuel additives, polymers and resins. It can be produced using renewable resources such as biomass like sugarcane bagasse which are cheap and widely available as waste in Indonesia. In this study, sugarcane bagasse was hydrolyzed using hydrochloric acid with a solid liquid ratio 1:10. The effects of hydrochloric acid concentration at temperature of 180 °C and reaction time of 30 min were studied. The presence of levulinic acid in product of hydrolysis was measured with gas chromatography (GC). It was found that the highest concentration of levulinic acid was obtained at 1 M hydrochloric acid in 25.56 yield%.
Prins, M.W.; Voropai, D.A.; Laarhoven, C.J.H.M. van; Akkersdijk, W.L.
2013-01-01
The main complication of surgery for inguinal hernia is chronic postoperative pain. This is often reported following the Lichtenstein procedure. A new, open surgical technique for the repair of inguinal hernia has been developed. This procedure is called the transrectus sheath preperitoneal
Prins, M W Wiesje; Voropai, D A Dasha; van Laarhoven, C J H M Kees; Akkersdijk, Willem L
2013-01-01
The main complication of surgery for inguinal hernia is chronic postoperative pain. This is often reported following the Lichtenstein procedure. A new, open surgical technique for the repair of inguinal hernia has been developed. This procedure is called the transrectus sheath preperitoneal procedure (TREPP). At TREPP a lightweight mesh with a ring made of memory metal is introduced into the preperitoneal space through the transrectus sheath. The first results of this operative technique are very promising: short operation time, short learning curve and not many patients with chronic postoperative pain. In a randomised, multi-centre study which will start mid-2013 (ISRCTN18591339), the TREPP procedure is compared with the transinguinal preperitoneal procedure. The primary outcome measure of this study is chronic postoperative pain.
Providing free autopoweroff plugs
DEFF Research Database (Denmark)
Jensen, Carsten Lynge; Hansen, Lars Gårn; Fjordbak, Troels
2012-01-01
Experimental evidence of the effect of providing households with cheap energy saving technology is sparse. We present results from a field experiment in which autopoweroff plugs were provided free of charge to randomly selected households. We use propensity score matching to find treatment effects...
Abundant and cheap petroleum until what date?
International Nuclear Information System (INIS)
Anon.
1996-01-01
Here is an economic analysis about the petroleum market. With the increasing demand in petroleum and the limited possibilities of supply, it should be obvious to increase the petroleum prices and to make investments in research and development to find new reserves or to increase the production capacities, without these options the demand could exceed the supply and strong tensions could appear in some years. (N.C.)
Stack 'em deep and teach 'em cheap
DEFF Research Database (Denmark)
Agerdal-Hjermind, Annette; Johansen, Trine Susanne; Clausen, Mads
2011-01-01
The Department of Business Communication (BCOM) is expected to reduce teaching related costs. In our paper, we address this challenge by highlighting options available such as usage of student teaching assistants, increase in class size and the creation of online learning environments, and discuss...
Cheap electricity with autonomous solar cell systems
International Nuclear Information System (INIS)
Ouwens, C.D.
1993-01-01
A comparison has been made between the costs of an autonomous solar cell system and a centralized electricity supply system. In both cases investment costs are the main issue. It is shown that for households in densely populated sunny areas, the use of autonomous solar cell systems is - even with today's market prices - only as expensive or even cheaper than a grid connection, as long as efficient electric appliances are used. The modular nature of solar cell systems makes it possible to start with any number of appliances, depending on the amount of money available to be spent. (author)
Chitosan Effects on Plant Systems
Directory of Open Access Journals (Sweden)
Massimo Malerba
2016-06-01
Full Text Available Chitosan (CHT is a natural, safe, and cheap product of chitin deacetylation, widely used by several industries because of its interesting features. The availability of industrial quantities of CHT in the late 1980s enabled it to be tested in agriculture. CHT has been proven to stimulate plant growth, to protect the safety of edible products, and to induce abiotic and biotic stress tolerance in various horticultural commodities. The stimulating effect of different enzyme activities to detoxify reactive oxygen species suggests the involvement of hydrogen peroxide and nitric oxide in CHT signaling. CHT could also interact with chromatin and directly affect gene expression. Recent innovative uses of CHT include synthesis of CHT nanoparticles as a valuable delivery system for fertilizers, herbicides, pesticides, and micronutrients for crop growth promotion by a balanced and sustained nutrition. In addition, CHT nanoparticles can safely deliver genetic material for plant transformation. This review presents an overview on the status of the use of CHT in plant systems. Attention was given to the research that suggested the use of CHT for sustainable crop productivity.
Monetary Policies And Credit Financing As Factors In Agricultural ...
African Journals Online (AJOL)
Global Journal of Agricultural Sciences ... cheap interest rate polices has negative effect on credit supply while policies associated with plough ... credit was influenced mainly by the availability of credit subsidies and availability of guarantees.
African Journals Online (AJOL)
OLUWOLE
Agro-Science Journal of Tropical Agriculture, Food, Environment and Extension. Volume 9 Number 1 ... of persistent dumping of cheap subsidized food imports from developed ... independence of the inefficiency effects in the two estimation ...
artocarpus altilis proving its worth in toxic metal removal
African Journals Online (AJOL)
DR. AMINU
2012-12-02
Dec 2, 2012 ... INTRODUCTION. Research to ensure clean and healthy environment ... products as effective and cheap methods of isolating .... about 2h, diluted and thoroughly mixed with KBr ..... Concise inorganic chemistry, 5th edn.
Anisja, D. H.; Indrani, D. J.; Herda, E.
2017-08-01
Nanotechnology developments in dentistry have resulted in the development of nano-ionomer, a new restorative material. The surface roughness of restorative materials can increase bacteria adhesion and lead to poor oral hygiene. Abrasive agents in toothpaste can alter tooth and restorative material surfaces. The aim of this study is to identify the effect of brushing with nano calcium carbonate, and calcium carbonate toothpaste on surface roughness of nano-ionomer. Eighteen nano-ionomer specimens were brushed with Aquabidest (doubledistilled water), nano calcium carbonate and calcium carbonate toothpaste. Brushing lasted 30 minutes, and the roughness value (Ra) was measured after each 10 minute segment using a surface roughness tester. The data was analyzed using repeated ANOVA and one-way ANOVA test. The value of nano-ionomer surface roughness increased significantly (p<0.05) after 20 minutes of brushing with the nano calcium carbonate toothpaste. Brushing with calcium carbonate toothpaste leaves nano-ionomer surfaces more rugged than brushing with nano calcium carbonate toothpaste.
Silverman, David
2007-01-01
In this book, the author shows how good research can be methodologically inventive, empirically rigorous, theoretically-alive and practically relevant. Using materials ranging from photographs to novels and newspaper stories this book demonstrates that getting to grips with these issues means asking fundamental questions about how we are…
Assessing climate change effects on mountain ecosystems using integrated models: A case study
Fagre, Daniel B.; Running, Steven W.; Keane, Robert E.; Peterson, David L.
2005-01-01
Mountain systems are characterized by strong environmental gradients, rugged topography and extreme spatial heterogeneity in ecosystem structure and composition. Consequently, most mountainous areas have relatively high rates of endemism and biodiversity, and function as species refugia in many areas of the world. Mountains have long been recognized as critical entities in regional climatic and hydrological dynamics but their importance as terrestrial carbon stores has only been recently underscored (Schimel et al. 2002; this volume). Mountain ecosystems, therefore, are globally important as well as unusually complex. These ecosystems challenge our ability to understand their dynamics and predict their response to climatic variability and global-scale environmental change.
An Investigation on the Cognitive Effects of Emoji Usage in Text
DEFF Research Database (Denmark)
Ousterhout, Thomas Kenneth
Face-to-face communication is multimodal involving at least the auditory (speech) and the visual (gestures such as head movements, facial expressions and hand gestures) modalities. While multimodal signals are produced naturally in face-to-face communication, they are not so easily provided...... of a medical EEG equipment with a cheap commercial EEG device. Simple words and emojis produce semantic priming despite being different channels within the same modality and seem to corroborate with how we behave in face-to-face communication. Merging words with emojis also produced semantic congruity effects...... in written computer-mediated communication, and especially in instant messaging. The visual nonverbal cues are not available and there is a great potential for miscommunication. The growing use of emojis, pictures or short videos of facial expressions and symbols of various types, are a means to replace non...
Effects of conductive fillers on temperature distribution of asphalt pavements
International Nuclear Information System (INIS)
Chen Mingyu; Wu Shaopeng; Zhang Yuan; Wang Hong
2010-01-01
The sun provides a cheap and abundant source of clean and renewable energy. Solar cells have been used to capture this energy and generate electricity. A more useful form of the solar cell would be asphalt pavements, which get heated up by solar radiation. Graphite powders are utilized as thermal conductive fillers to make an asphalt collector conductive so as to improve the efficiency of the asphalt collector. Accounting for the important application conditions and evaluating the effects of the heat conductive materials and the solar energy absorbability of the conductive asphalt collector, a finite element model has been developed to predict temperature distributions in the conductive asphalt solar collector. In this study, an experimental validation exercise was conducted using the measured data taken from full-depth asphalt slabs. Validation results showed that the model can satisfactorily predict the temperature distributions in asphalt concrete slabs. The optimal depth is 25-50 mm for placing pipes that serve as the heat exchanger. Meanwhile, the effect of the surroundings on the solar energy potential of the asphalt collector was noticeable.
3D display considerations for rugged airborne environments
Barnidge, Tracy J.; Tchon, Joseph L.
2015-05-01
The KC-46 is the next generation, multi-role, aerial refueling tanker aircraft being developed by Boeing for the United States Air Force. Rockwell Collins has developed the Remote Vision System (RVS) that supports aerial refueling operations under a variety of conditions. The system utilizes large-area, high-resolution 3D displays linked with remote sensors to enhance the operator's visual acuity for precise aerial refueling control. This paper reviews the design considerations, trade-offs, and other factors related to the selection and ruggedization of the 3D display technology for this military application.
Experimental Rugged Fitness Landscape in Protein Sequence Space
HAYASHI, Yuuki; 相田, 拓洋; TOYOTA, Hitoshi; 伏見, 譲; URABE, Itaru; YOMO, Tetsuya
2006-01-01
The fitness landscape in sequence space determines the process of biomolecular evolution. To plot the fitness landscape of protein function, we carried out in vitro molecular evolution beginning with a defective fd phage carrying a random polypeptide of 139 amino acids in place of the g3p minor coat protein D2 domain, which is essential for phage infection. After 20 cycles of random substitution at sites 12-130 of the initial random polypeptide and selection for infectivity, the selected phag...
Radioactive decontamination methods and their effectiveness as a function of terrain
Energy Technology Data Exchange (ETDEWEB)
Straume, T; Kellner, C R; Oswald, K M [California Univ., Mercury, NV (USA). Lawrence Radiation Lab.
1978-08-01
A large area of rugged terrain on the Nevada Test Site was contaminated following a spill of radioactively contaminated drilling mud. The contamination was shown to consist of /sup 103/Ru and /sup 106/(Ru-Rh) with total estimated activity at release time of 38 and 6 Ci, respectively. Several decontamination methods were used and their effectiveness assessed by determining the fraction of radioactivity remaining (FR) following each. In flat areas, the front end loader was by far the most efficient method, removing large quantities of dirt in relatively short periods of time. FRs of 10-/sup 22/ were achieved. In canyon areas, flushing with water was most effective on rocky surfaces with FRs of 10/sup -3/, while shoveling and bagging in evaporated mud collection ponds worked well and resulted in FRs of 10/sup -2/. The FR in rocky cracks was about 10/sup -1/ following flushing with water. In Locations where radioactive mud/water had not penetrated the ground surface to more than 1-2in., such as fine grain, flat compact dirt, vacuuming was very effective achieving FRs of 10/sup -3/. However, unless the contaminated area was very small (e.g. dropping from front end loading operations), vacuuming was too slow to be of practical value. Under the supervision of experienced radiation monitors, the radioactive mud spill area was safely cleaned up using, for the most part, standard earth moving equipment and personnel untrained in decontamination procedures.
Radioactive decontamination methods and their effectiveness as a function of terrain
International Nuclear Information System (INIS)
Straume, T.; Kellner, C.R.; Oswald, K.M.
1978-01-01
A large area of rugged terrain on the Nevada Test Site was contaminated following a spill of radioactively contaminated drilling mud. The contamination was shown to consist of 103 Ru and 106 [Ru-Rh] with total estimated activity at release time of 38 and 6 Ci, respectively. Several decontamination methods were used and their effectiveness assessed by determining the fraction of radioactivity remaining (FR) following each. In flat areas, the front end loader was by far the most efficient method, removing large quantities of dirt in relatively short periods of time. FRs of 10- 22 were achieved. In canyon areas, flushing with water was most effective on rocky surfaces with FRs of 10 -3 , while shoveling and bagging in evaporated mud collection ponds worked well and resulted in FRs of 10 -2 . The FR in rocky cracks was about 10 -1 following flushing with water. In Locations where radioactive mud/water had not penetrated the ground surface to more than 1-2in., such as fine grain, flat compact dirt, vacuuming was very effective achieving FRs of 10 -3 . However, unless the contaminated area was very small (e.g. dropping from front end loading operations), vacuuming was too slow to be of practical value. Under the supervision of experienced radiation monitors, the radioactive mud spill area was safely cleaned up using, for the most part, standard earth moving equipment and personnel untrained in decontamination procedures. (author)
Against the Corporal Punishment of Children
Clark, John
2004-01-01
John Wilson suggests there are six advantages for corporal punishment: cheap and easy to administer, effective deterrent, effective reform, adjustable pain, fair because of similar dislike of pain, no permanent damage. None of these survive close scrutiny. An alternative, deontological argument against corporal punishment is proposed building on…
The evaluation of effectiveness of 3DCA using vacuum bag(Vac-Lock) for patient immobilization device
International Nuclear Information System (INIS)
Lee, Young Chul; Lee, Chul Bin; Kang, No Hyun; Kim, Dong Euk; Lee, Jung Yong; Jeong, In Pyo
2004-01-01
Patient immobilization is crucial factor for radiation therapy. Generally, we have been used vacuum bag immobilization device(Vac-Lock) for whole body immobilization. In order to easily set up of vacuum bag(Vac-Lock), we made a 3DCA(3-Dimensional Conformal Accessory). The purpose of this study is evaluation of effectiveness of 3DCA using Vack-Lock for patient immobilization. We made 3DCA(3-Dimensional Conformal Accessory) tool of wooden boards. The reasons to choice of wooden boards are its easily handling nature and cheap expenses. (1) We reduced man power from 5-6 persons to 1 person to make immobilizations, (2) Shortened work time from 1 hour to within 10 minutes. (3) Avoid a collision to treatment gantry head. (4) Its shapes are smart and clean. We have made and used 3DCA(3-Dimensional Conformal Accessory) tool was very effective and convenience for the patients and users.
Directory of Open Access Journals (Sweden)
E. SHARABIANLOU
1971-07-01
Full Text Available An ana lysis was made o r the eff ect o n the eyes o f severa l types of d rug. Ad ren ergic. parusymp.uholitic. an ti-adrenergic. psycho tro pic. diuret ic and cort ico id d rugs as wel1 as an ti-depressants. vusod ilata to rs and ca rd io-to nics were among the vario us prod ucts stud ied . The resul ts of Ihis ~l n al "'s is showed th.u before these PI'OdUCb :Irc used . a careful examinat ion o f the eves ions.
Shugarman, L R; Fries, B E; James, M
1999-01-01
Admission cohorts from the Michigan Medicaid Home and Community-Based Waiver program and Ohio nursing homes were compared on measures of resource utilization including a modified Resource Utilization Groups (RUG-III) system, Activities of Daily Living (ADLs), and overall case mix. We found that, contrary to previous research, the two samples were remarkably similar across RUG-III categories. However, the nursing home sample was more functionally impaired on measures of ADL functioning and overall case mix. Results of this study may inform policymakers and providers of the potential for maintaining the appropriate population in the home with government-funded home care.
International Nuclear Information System (INIS)
Sapozhnikova, Yelena; Lehotay, Steven J.
2013-01-01
Highlights: ► A method for analysis of POPs and novel flame retardants in catfish was developed. ► The method is based on a QuEChERS extraction, d-SPE clean-up and low pressure GC/MS–MS. ► The method validation demonstrated good recoveries and low detection limits. ► The method was successfully applied for analysis of catfish samples from the market. - Abstract: A multi-class, multi-residue method for the analysis of 13 novel flame retardants, 18 representative pesticides, 14 polychlorinated biphenyl (PCB) congeners, 16 polycyclic aromatic hydrocarbons (PAHs), and 7 polybrominated diphenyl ether (PBDE) congeners in catfish muscle was developed and evaluated using fast low pressure gas chromatography triple quadrupole tandem mass spectrometry (LP-GC/MS–MS). The method was based on a QuEChERS (quick, easy, cheap, effective, rugged, safe) extraction with acetonitrile and dispersive solid-phase extraction (d-SPE) clean-up with zirconium-based sorbent prior to LP-GC/MS–MS analysis. The developed method was evaluated at 4 spiking levels and further validated by analysis of NIST Standard Reference Materials (SRMs) 1974B and 1947. Sample preparation for a batch of 10 homogenized samples took about 1 h/analyst, and LP-GC/MS–MS analysis provided fast separation of multiple analytes within 9 min achieving high throughput. With the use of isotopically labeled internal standards, recoveries of all but one analyte were between 70 and 120% with relative standard deviations less than 20% (n = 5). The measured values for both SRMs agreed with certified/reference values (72–119% accuracy) for the majority of analytes. The detection limits were 0.1–0.5 ng g −1 for PCBs, 0.5–10 ng g −1 for PBDEs, 0.5–5 ng g −1 for select pesticides and PAHs and 1–10 ng g −1 for flame retardants. The developed method was successfully applied for analysis of catfish samples from the market.
Effects of confinement & surface roughness in electrorheological flows
Helal, Ahmed; Telleria, Maria J.; Wang, Julie; Strauss, Marc; Murphy, Mike; McKinley, Gareth; Hosoi, A. E.
2014-11-01
Electrorheological (ER) fluids are dielectric suspensions that exhibit a fast, reversible change in rheological properties with the application of an external electric field. Upon the application of the electric field, the material develops a field-dependent yield stress that is typically modeled using a Bingham plastic model. ER fluids are promising for designing small, cheap and rapidly actuated hydraulic devices such as rapidly-switchable valves, where fluid flowing in a microchannel can be arrested by applying an external electric field. In the lubrication limit, for a Bingham plastic fluid, the maximum pressure the channel can hold, before yielding, is a function of the field-dependent yield stress, the length of the channel and the electrode gap. In practice, the finite width of the channel and the surface roughness of the electrodes could affect the maximum yield pressure but a quantitative understanding of these effects is currently lacking. In this study, we experimentally investigate the effects of the channel aspect ratio (width/height) and the effects of electrode roughness on the performance of ER valves. Based on this quantitative analysis, we formulate new performance metrics for ER valves as well as design rules for ER valves that will help guide and optimize future designs.
International Nuclear Information System (INIS)
Zora Jandrić, Zora; Frew, Russell; Abrahim, Aiman; Maestroni, Britt; Ochoa, Victoria
2014-01-01
honey valued for its non-peroxide antimicrobial activity (NPA).The NPA is thought to be due to high levels of methyl glyoxal (MGO) and it is the manuka honey with high levels of MGO that fail the C4 sugar adulteration test. Work by FEPL indicates that this is partly due to the beekeeping practice of feeding sugar to bees during the winter. However, that does not explain the late season failures, or that the extent of failure increases as manuka honey ages. The MGO levels in manuka increase with age and it has been shown that high MGO is correlated with high apparent C4 sugar content. Current research in this field in FEPL is focused on modifying the AOAC method to overcome these false positives in the C4 sugar adulteration. A method has been developed for the removal of MGO prior to the purification of the protein that is measured as internal standard. It is hoped that the removal of the MGO will eliminate the interference in the isotope test. Tests are now underway to establish the optimum conditions for the removal of MGO and to show that the additional procedure does not affect the isotopic composition of the purified protein. Once those tasks are completed the work will move to the validation stage and involve other laboratories to test the procedure. The FEPL is currently carrying out a study on method validation for the detection of several pesticides in potato samples. The extraction and clean-up method used is known as the Quick, Easy, Cheap, Effective Rugged and Safe (QuEchERS) for pesticide residue determination, and uses a gas chromatograph coupled to a mass selective detector (GC-MSD) for analyte separation and detection. According to the SANCO document (SANCO/12571/2013), matrix effects should be assessed at the initial method validation stage. Therefore as part of the calibration strategies for our method both matrix-matched and solvent calibrators were prepared
DEFF Research Database (Denmark)
Phillips, Andrew; Cambiano, Valentina; Nakagawa, Fumiyo
2014-01-01
BACKGROUND: To guide future need for cheap resistance tests for use in low income settings, we assessed cost-effectiveness of drug resistance testing as part of monitoring of people on first line ART - with switching from first to second line ART being conditional on NNRTI drug resistance mutations...... being identified. METHODS: An individual level simulation model of HIV transmission, progression and the effect of ART which accounts for adherence and resistance development was used to compare outcomes of various potential monitoring strategies in a typical low income setting in sub-Saharan Africa....... Underlying monitoring strategies considered were based on clinical disease, CD4 count or viral load. Within each we considered a strategy in which no further measures are performed, one with a viral load measure to confirm failure, and one with both a viral load measure and a resistance test. Predicted...
Vijayakumar, S; Vaseeharan, B; Malaikozhundan, B; Gopi, N; Ekambaram, P; Pachaiappan, R; Velusamy, P; Murugan, K; Benelli, G; Suresh Kumar, R; Suriyanarayanamoorthy, M
2017-01-01
Botanical-mediated synthesis of nanomaterials is currently emerging as a cheap and eco-friendly nanotechnology, since it does not involve the use of toxic chemicals. In the present study, we focused on the synthesis of gold nanoparticles using the aqueous peel extract of Musa paradisiaca (MPPE-AuNPs) following a facile and cheap fabrication process. The green synthesized MPPE-AuNPs were bio-physically characterized by UV-Vis spectroscopy, FTIR, XRD, TEM, Zeta potential analysis and EDX. MPPE-AuNPs were crystalline in nature, spherical to triangular in shape, with particle size ranging within 50 nm. The biofilm inhibition activity of MPPE-AuNPs was higher against multiple antibiotic resistant (MARS) Gram-positive Enterococcus faecalis. Light and confocal laser scanning microscopic observations evidenced that the MPPE-AuNPs effectively inhibited the biofilm of E. faecalis when tested at 100 μg mL -1 . Cytotoxicity studies demonstrated that MPPE-AuNPs were effective in inhibiting the viability of human A549 lung cancer cells at higher concentrations of 100 μg mL -1 . The morphological changes in the MPPE-AuNPs treated A549 lung cancer cells were visualized under phase-contrast microscopy. Furthermore, the ecotoxicity of MPPE-AuNPs on the freshwater micro crustacean Ceriodaphnia cornuta were evaluated. Notably, no mortality was recorded in MPPE-AuNPs treated C. cornuta at 250 μg mL -1 . This study concludes that MPPE-AuNPs are non-toxic, eco-friendly and act as a multipurpose potential biomaterial for biomedical applications. Copyright © 2016 Elsevier Ltd. All rights reserved.
Ginneken, van V.; Palstra, A.P.; Nieveen, M.; Berg, van den J.H.J.; Flik, G.; Spanings, F.A.; Niemantsverdriet, P.; Thillart, van den G.; Murk, A.J.
2009-01-01
Organochlorine compounds were widely used after the Second World War because they were cheap to produce and useful for many purposes, such as in agriculture for insecticides, in public health to control disease insect vectors and in industry (Pelletier et al. 2002). It is estimated that 16¿30% of
Effect of the Solvent Temperatures on Dynamics of Serine Protease Proteinase K
Directory of Open Access Journals (Sweden)
Peng Sang
2016-02-01
Full Text Available To obtain detailed information about the effect of the solvent temperatures on protein dynamics, multiple long molecular dynamics (MD simulations of serine protease proteinase K with the solute and solvent coupled to different temperatures (either 300 or 180 K have been performed. Comparative analyses demonstrate that the internal flexibility and mobility of proteinase K are strongly dependent on the solvent temperatures but weakly on the protein temperatures. The constructed free energy landscapes (FELs at the high solvent temperatures exhibit a more rugged surface, broader spanning range, and higher minimum free energy level than do those at the low solvent temperatures. Comparison between the dynamic hydrogen bond (HB numbers reveals that the high solvent temperatures intensify the competitive HB interactions between water molecules and protein surface atoms, and this in turn exacerbates the competitive HB interactions between protein internal atoms, thus enhancing the conformational flexibility and facilitating the collective motions of the protein. A refined FEL model was proposed to explain the role of the solvent mobility in facilitating the cascade amplification of microscopic motions of atoms and atomic groups into the global collective motions of the protein.
Determination of levels of copper in Kamiti river along coffee farms ...
African Journals Online (AJOL)
Copper‐based fungicides are extensively used in the control of coffee pests and diseases because they are relatively cheap and effective. This practice presents serious environmental implications owing to the toxic nature of copper. We report here an assessment on the effects of the use of copper‐based fungicides on ...
Nsor-Atindana, John; Zhong, Fang; Mothibe, Kebitsamang Joseph
2012-10-01
Three dietary fiber (DF) powders; soluble dietary fiber (SDF), insoluble dietary fiber (IDF) and total dietary fiber (TDF) were prepared from cocoa bean shells (CBS) by enzymatic treatment. These DFs were evaluated for their effects on glucose adsorption, glucose diffusion, starch hydrolysis, cholesterol binding, sodium cholate binding and oil binding capacities using in vitro model systems by simulating gastric intestinal conditions. The results showed that SDF generally exhibited significantly (p 0.05) glucose dialysis retardation index (GDRI) and oil binding capacity, when compared with IDF and TDF which both showed similar effects. Moreover, it was discovered that the three CBS dietary fiber powders contained intrinsic antioxidants (phenolic compounds). The study suggested that CBS could be an alternative cheap source of DF with additional benefits. Thus, CBS fibers could be incorporated as low calorie bulk ingredients in high-fiber diet to reduce calorie and cholesterol levels and control blood glucose level.
Pd@[nBu₄][Br] as a Simple Catalytic System for N-Alkylation Reactions with Alcohols.
Cacciuttolo, Bastien; Pascu, Oana; Aymonier, Cyril; Pucheault, Mathieu
2016-08-10
Palladium nanoparticles, simply and briefly generated in commercial and cheap onium salts using supercritical carbon dioxide, have been found to be an effective catalytic system for additive free N-alkylation reaction using alcohols via cascade oxidation/condensation/reduction steps.
African Journals Online (AJOL)
raoul
2011-05-31
May 31, 2011 ... Pearson´s correlation between GBCI35 and GBCI40 (indirect ... of being safe, cheap, non invasive and does not make use of ionizing radiation. ..... A, & Blaszzcynska, M. Effect Cigraette smoking on Gallbladder Emptying and ...
International Nuclear Information System (INIS)
Roupioz, L; Nerry, F; Jia, L; Menenti, M
2014-01-01
The Qinghai-Tibetan Plateau is characterised by a very strong relief which affects albedo retrieval from satellite data. The objective of this study is to highlight the effects of sub-pixel topography and to account for those effects when retrieving land surface albedo from geostationary satellite FengYun-2D (FY-2D) data with 1.25km spatial resolution using the high spatial resolution (30 m) data of the Digital Elevation Model (DEM) from ASTER. The methodology integrates the effects of sub-pixel topography on the estimation of the total irradiance received at the surface, allowing the computation of the topographically corrected surface reflectance. Furthermore, surface albedo is estimated by applying the parametric BRDF (Bidirectional Reflectance Distribution Function) model called RPV (Rahman-Pinty-Verstraete) to the terrain corrected surface reflectance. The results, evaluated against ground measurements collected over several experimental sites on the Qinghai-Tibetan Plateau, document the advantage of integrating the sub-pixel topography effects in the land surface reflectance at 1km resolution to estimate the land surface albedo. The results obtained after using sub-pixel topographic correction are compared with the ones obtained after using pixel level topographic correction. The preliminary results imply that, in highly rugged terrain, the sub-pixel topography correction method gives more accurate results. The pixel level correction tends to overestimate surface albedo
Health effects of energy development
International Nuclear Information System (INIS)
Myers, D.K.; Newcombe, H.B.
1980-01-01
Our accumulated technology has added roughly 50 years to the average life span of a human being in North America. Most of this increase in life span has occurred within the last 100 years. Cheap and safe supplies of energy are required for the industrial prosperity that has made this possible. The best estimates available all indicate that nuclear power and natural gas are the safest forms of contemporary energy production. The largest potential radiation hazard to which we are currently exposed appears to derive from our houses; increased attention by public health authorities to the control of this particular hazard may be warranted. (Auth)
Stock, Wendy A.; Ward, Kevin; Folsom, Justin; Borrenpohl, Teresa; Mumford, Sophie; Pershin, Zach; Carriere, Danielle; Smart, Heather
2013-01-01
The authors examine the impacts of enrollment in a voluntary one-credit recitation class for ECON 101 students, focusing on course grades, course retention, and outcomes in later economics courses. The recitation classes were taught by undergraduate peer leaders with experience in upper-level microeconomics. Instead of being paid, the peer leaders…
Directory of Open Access Journals (Sweden)
Mathias Ahii Chia
2016-03-01
Full Text Available The application of synthetic algaecides for the control of algae produces by-products that are sometimes toxic to the environment. There is a need for natural and cheap alternatives to synthetic algaecides. In the present study, we investigated the potential of aqueous crude extract of Azadirachta indica to inhibit the growth of Scenedesmus quadricauda. Phytochemical screening of the extract revealed the presence of groups of bioactive compounds that are capable of inhibiting microalgal growth. Chlorophyll a concentration, dry weight production and cell density of microalga decreased with increasing crude extract concentration. After three days of exposure, the 1000 mg/L extract concentration resulted in complete growth inhibition and cell lysis. Furthermore, the ability of S. quadricauda to form multi-celled coenobial structures was compromised in a concentration dependent manner. In general, catalase and peroxidase activities of the microalga were upregulated with increasing extract concentration. These results imply that aqueous neem extract may provide a cheap and ecofriendly alternative for the control of microalgae in aquatic ecosystems.
Alkali Metal-O2 Batteries. Performance and Lifetime Limiting Effects
DEFF Research Database (Denmark)
Knudsen, Kristian Bastholm
The rechargeable Na-O2 and Li-O2 batteries are attractive battery technologies as they potentially are very cheap and as they theoretically possess about 3 and 10 times higher energy density than the current Li-ion technologies. This PhD thesis is dedicated to studying the effects that limit cell...... product, Li2O2, was investigated. This was done by using of a conventional three electrode cell in which the heterogeneous electron transfer rate of three different redox couples were studied on Li2O2 coated glassy carbon electrodes to provide a measure of the conductivity of the Li2O2 layers. Charge....... The capacitance of the cathode was shown to be sensitive to the thickness of the deposited Li2O2 layer. These investigations also explored the influence of the composition of the electrolyte and conditions, which favors a solution mediated Li2O2 deposition mechanism. On charge, an electrochemical “safe” operating...
THERMODYNAMIC ASSESSMENT OF ANIONIC LIGANDS ...
African Journals Online (AJOL)
DJFLEX
2010-06-30
Jun 30, 2010 ... adsorbent in adsorption studies of Co2+, Cd2+ and Ni2+ ions. The effects of pH ... devising cheap and affordable alternatives is highly desirable. ... present in the substrate giving it a positively charged ion. .... Heavy Metal Ions.
Directory of Open Access Journals (Sweden)
MT Ghaneian
2014-11-01
Conclusion: Melia azedarach ash is an effective adsorbent in removal of hexavalent chromium from synthetic electroplating industries wastewater. In addition, the use of this biosorbent in preparation and application aspects is simple and cheap compared to many other natural and man-made adsorbent.
Pd@[nBu4][Br] as a Simple Catalytic System for N-Alkylation Reactions with Alcohols
Directory of Open Access Journals (Sweden)
Bastien Cacciuttolo
2016-08-01
Full Text Available Palladium nanoparticles, simply and briefly generated in commercial and cheap onium salts using supercritical carbon dioxide, have been found to be an effective catalytic system for additive free N-alkylation reaction using alcohols via cascade oxidation/condensation/reduction steps.
Morphologic and thermophysical characteristics of lava flows southwest of Arsia Mons, Mars
Crown, David A.; Ramsey, Michael S.
2017-08-01
The morphologic and thermophysical characteristics of part of the extensive lava flow fields southwest of Arsia Mons (22.5-27.5°S, 120-130°W) have been examined using a combination of orbital VNIR and TIR datasets. THEMIS images provide context for the regional geology and record diurnal temperature variability that is diverse and unusual for flow surfaces in such close proximity. CTX images were used to distinguish dominant flow types and assess local age relationships between individual lava flows. CTX and HiRISE images provide detailed information on flow surface textures and document aeolian effects as they reveal fine-grained deposits in many low-lying areas of the flow surfaces as well as small patches of transverse aeolian ridges. Although this region is generally dust-covered and has a lower overall thermal inertia, the THEMIS data indicate subtle spectral variations within the population of lava flows studied. These variations could be due to compositional differences among the flows or related to mixing of flow and aeolian materials. Specific results regarding flow morphology include: a) Two main lava flow types (bright, rugged and dark, smooth as observed in CTX images) dominate the southwest Arsia Mons/NE Daedalia Planum region; b) the bright, rugged flows have knobby, ridged, and/or platy surface textures, commonly have medial channel/levee systems, and may have broad distal lobes; c) the dark, smooth flows extend from distributary systems that consist of combinations of lava channels, lava tubes, and/or sinuous ridges and plateaus; and d) steep-sided, terraced margins, digitate breakout lobes, and smooth-surfaced plateaus along lava channel/tube systems are interpreted as signatures of flow inflation within the dark, smooth flow type. These flows exhibit smoother upper surfaces, are thinner, and have more numerous, smaller lobes, which, along with their the channel-/tube-fed nature, indicate a lower viscosity lava than for the bright, rugged flows
Light harvesting by dye linked conducting polymers
DEFF Research Database (Denmark)
Nielsen, Kim Troensegaard
2006-01-01
The fact that the fossil fuel is finite and that the detrimental long-term effects of letting CO2 into our atmosphere exist, have created an enormous interest in developing new, cheap, renewable and less polluting energy resources. One of the most obviousabundant sources of energy in the solar...... system is the sun. Unfortunately the well developed silicon solar cells are very costly to produce. In an attempt to produce cheap and flexible solar cells, plastic solar cells have received a lot of attention inthe last decades. There are still a lot of parameters to optimize if the plastic solar cell...... an nconductor and a pconductor. The facts that the charge carrier separation only happens at the heterojunctionslimits the thickness of the active layer in solar cells and thereby the effectiveness of the solar cells. In this project the charge carrier separation is attempted optimized by making plastic solar...
DEFF Research Database (Denmark)
Hain, Daniel; Mas Tur, Elena
In this paper, we investigate which characteristics of technological and financial systems might be conductive for technological change. We are particularly in how the interplay between capabilities, resources and networks among investors with the complexity and maturity of technologies affect...... rates of technological change and diversity, and prevents technologies from getting stuck in the financial “valley of death”. In a next step, we introduce investor networks and allow agents to co-invest together in order to pool financial resources and get access to their forecasting capability...... in a specific technological domain. We compare which investor network structures lead to the high rates of technological change and diversity on a given technology landscape. Results from a Monte Carlo simulation indicate networked investor population to outperform the case of isolated stand-alone investors...
REMOVAL OF ANIONIC SURFACTANTS FROM WASTEWATER BY MAGNETIC MINERAL SORBENTS
Directory of Open Access Journals (Sweden)
Oksana Vladimirova Makarchuk
2016-07-01
Full Text Available The simplest and most effective method of removing low concentrations of anionic surfactants such as sodium dodecyl benzenesulfonate (SDBS and sodium lauryl sulfate (SLS is adsorption. Among adsorbents the natural clays are cheap and promising for these purposes. However, there are significant difficulties in removal of spent sorbent after the adsorption process. So, the creation of magnetic sorbents that can be effectively removed from water after sorption by magnetic separation will be a successful decision. The aim of this investigation is the creation of cheap and efficient magnetic sorbents based on natural clays and magnetite for anionic surfactant removal from wastewater. We have synthesized a series of magnetic sorbents from different natural clays with a content of magnetite from 2 to 10 wt%. The ability of magnetic sorbents to remove SDBS and SLS from aqueous solutions has been studied for different adsorbate concentrations by varying the amount of adsorbent, temperature and shaking time. Thermodynamic parameters were calculated from the slope and intercept of the linear plots of ln K against 1/T. Analysis of adsorption results obtained at different temperatures showed that the adsorption pattern on magnetic sorbents correspond to the Langmuir isotherm. It is shown that with increasing the content of magnetite in the magnetic sorbents improves not only their separation from water by magnetic separation, but adsorption capacity to SDBS and SLS. Thus, we obtained of cheap magnetic sorbents based on natural clays and magnetite by the easy way, which not only quickly separated from the solution by magnetic separation, but effectively remove anionic surfactants.
Usability Testing: Too Early? Too Much Talking? Too Many Problems?
DEFF Research Database (Denmark)
Hertzum, Morten
2016-01-01
Usability testing has evolved in response to a search for tests that are cheap, early, easy, and fast. In addition, it accords with a situational definition of usability, such as the one propounded by ISO. By approaching usability from an organizational perspective, this author argues that usabil......Usability testing has evolved in response to a search for tests that are cheap, early, easy, and fast. In addition, it accords with a situational definition of usability, such as the one propounded by ISO. By approaching usability from an organizational perspective, this author argues...... that usability should (also) be evaluated late, that usability professionals should be wary of thinking aloud, and that they should focus more on effects achievement than problem detection....
Carbonized cellulose paper as an effective interlayer in lithium-sulfur batteries
International Nuclear Information System (INIS)
Li, Shiqi; Ren, Guofeng; Hoque, Md Nadim Ferdous; Dong, Zhihua; Warzywoda, Juliusz; Fan, Zhaoyang
2017-01-01
Highlights: • A facile and economical method to fabricate interlayer for high-performance lithium-sulfur battery was demonstrated. • The performance of lithium-sulfur batteries without and with interlayer was compared. • The mechanism for the function of interlayer was explained. - Abstract: One of the several challenging problems hampering lithium-sulfur (Li-S) battery development is the so-called shuttling effect of the highly soluble intermediates (Li_2S_8–Li_2S_6). Using an interlayer inserted between the sulfur cathode and the separator to capture and trap these soluble intermediates has been found effective in diminishing this effect. Previously, most reported interlayer membranes were synthesized in a complex and expensive process, and might not be suitable for practical cheap batteries. Herein, a facile method is reported to pyrolyze the commonly used cellulose filter paper into highly flexible and conductive carbon fiber paper. When used as an interlayer, such a carbon paper can improve the cell capacity by several folds through trapping the soluble polysulfides. The enhanced electronic conductivity of the cathode, due to the interlayer, also significantly improves the cell rate performance. In addition, it was demonstrated that such an interlayer can also effectively mitigate the self-discharge problem of the Li-S batteries. This study indicates that the cost-effective pyrolyzed cellulose paper has potential as interlayer for practical Li-S batteries.
Carbonized cellulose paper as an effective interlayer in lithium-sulfur batteries
Energy Technology Data Exchange (ETDEWEB)
Li, Shiqi; Ren, Guofeng; Hoque, Md Nadim Ferdous [Department of Electrical and Computer Engineering and Nano Tech Center, Texas Tech University, Lubbock, TX 79409 (United States); Dong, Zhihua [Hangzhou Dianzi University, No. 1158, 2nd Street, Xiasha Higher Education District, Hangzhou City, Zhejiang Province (China); Warzywoda, Juliusz [Materials Characterization Center, Whitacre College of Engineering, Texas Tech University, Lubbock, TX 79409 (United States); Fan, Zhaoyang, E-mail: zhaoyang.fan@ttu.edu [Department of Electrical and Computer Engineering and Nano Tech Center, Texas Tech University, Lubbock, TX 79409 (United States)
2017-02-28
Highlights: • A facile and economical method to fabricate interlayer for high-performance lithium-sulfur battery was demonstrated. • The performance of lithium-sulfur batteries without and with interlayer was compared. • The mechanism for the function of interlayer was explained. - Abstract: One of the several challenging problems hampering lithium-sulfur (Li-S) battery development is the so-called shuttling effect of the highly soluble intermediates (Li{sub 2}S{sub 8}–Li{sub 2}S{sub 6}). Using an interlayer inserted between the sulfur cathode and the separator to capture and trap these soluble intermediates has been found effective in diminishing this effect. Previously, most reported interlayer membranes were synthesized in a complex and expensive process, and might not be suitable for practical cheap batteries. Herein, a facile method is reported to pyrolyze the commonly used cellulose filter paper into highly flexible and conductive carbon fiber paper. When used as an interlayer, such a carbon paper can improve the cell capacity by several folds through trapping the soluble polysulfides. The enhanced electronic conductivity of the cathode, due to the interlayer, also significantly improves the cell rate performance. In addition, it was demonstrated that such an interlayer can also effectively mitigate the self-discharge problem of the Li-S batteries. This study indicates that the cost-effective pyrolyzed cellulose paper has potential as interlayer for practical Li-S batteries.
CSIR Research Space (South Africa)
Grindley, SA
1988-12-01
Full Text Available convenient and, in the short-term, cheap conduit for stormwater from new development should be halted. More effective means of conducting stormwater to the sea from new developments on both sides of the valley should be investigated. To allow new developments...
DEFF Research Database (Denmark)
Guo, Feng; Chen, Jingling; Zhang, Minwei
2016-01-01
Developing a photocatalyst with the necessary characteristics of being cheap, efficient and robust for visible-light-driven water splitting remains a serious challenge within the photocatalysis field. Herein, an effective strategy, deprotonating g-C3N4 with Na ions from low-cost precursors...
Broersma, M.J.; Graham, T.S.
2013-01-01
Twitter has become a convenient, cheap and effective beat for journalists in search of news and information. Reporters today increasingly aggregate information online and embed it in journalism discourse. In this paper, we analyse how tweets have increasingly been included as quotes in newspaper
Fluoride removal from rural spring water using wood ash
CSIR Research Space (South Africa)
Makhado, R
2006-05-01
Full Text Available This paper presents an overview of a report on an investigation on the use of cheap wood ash as an effective means of removing excess fluoride from drinking water used by an impoverished rural community of the Didi village in Limpopo province....
A Secondary-Control Based Fault Current Limiter for Four-Wire Three Phase Inverter-Interfaced DGs
DEFF Research Database (Denmark)
Beheshtaein, Siavash; Savaghebi, Mehdi; Guerrero, Josep M.
2017-01-01
Fault current limiters (FCLs) are one class of solutions to cope with the upcoming challenges in microgrid protection. Considering high penetration of distributed generations (DGs) in microgrids, the necessity of designing cheap and effective FCL is getting higher. This paper attempts to fill thi...
African Journals Online (AJOL)
The early result calls for a closer look at this cheap, safe and effective means of handling .... daily intramuscular injection of 75mg of diclofenac over the guide wire with ... the application of two distal 4.5mm AO cortical screws operation and was ...
On the effects of scale for ecosystem services mapping.
Grêt-Regamey, Adrienne; Weibel, Bettina; Bagstad, Kenneth J; Ferrari, Marika; Geneletti, Davide; Klug, Hermann; Schirpke, Uta; Tappeiner, Ulrike
2014-01-01
Ecosystems provide life-sustaining services upon which human civilization depends, but their degradation largely continues unabated. Spatially explicit information on ecosystem services (ES) provision is required to better guide decision making, particularly for mountain systems, which are characterized by vertical gradients and isolation with high topographic complexity, making them particularly sensitive to global change. But while spatially explicit ES quantification and valuation allows the identification of areas of abundant or limited supply of and demand for ES, the accuracy and usefulness of the information varies considerably depending on the scale and methods used. Using four case studies from mountainous regions in Europe and the U.S., we quantify information gains and losses when mapping five ES - carbon sequestration, flood regulation, agricultural production, timber harvest, and scenic beauty - at coarse and fine resolution (250 m vs. 25 m in Europe and 300 m vs. 30 m in the U.S.). We analyze the effects of scale on ES estimates and their spatial pattern and show how these effects are related to different ES, terrain structure and model properties. ES estimates differ substantially between the fine and coarse resolution analyses in all case studies and across all services. This scale effect is not equally strong for all ES. We show that spatially explicit information about non-clustered, isolated ES tends to be lost at coarse resolution and against expectation, mainly in less rugged terrain, which calls for finer resolution assessments in such contexts. The effect of terrain ruggedness is also related to model properties such as dependency on land use-land cover data. We close with recommendations for mapping ES to make the resulting maps more comparable, and suggest a four-step approach to address the issue of scale when mapping ES that can deliver information to support ES-based decision making with greater accuracy and reliability.
On the effects of scale for ecosystem services mapping.
Directory of Open Access Journals (Sweden)
Adrienne Grêt-Regamey
Full Text Available Ecosystems provide life-sustaining services upon which human civilization depends, but their degradation largely continues unabated. Spatially explicit information on ecosystem services (ES provision is required to better guide decision making, particularly for mountain systems, which are characterized by vertical gradients and isolation with high topographic complexity, making them particularly sensitive to global change. But while spatially explicit ES quantification and valuation allows the identification of areas of abundant or limited supply of and demand for ES, the accuracy and usefulness of the information varies considerably depending on the scale and methods used. Using four case studies from mountainous regions in Europe and the U.S., we quantify information gains and losses when mapping five ES - carbon sequestration, flood regulation, agricultural production, timber harvest, and scenic beauty - at coarse and fine resolution (250 m vs. 25 m in Europe and 300 m vs. 30 m in the U.S.. We analyze the effects of scale on ES estimates and their spatial pattern and show how these effects are related to different ES, terrain structure and model properties. ES estimates differ substantially between the fine and coarse resolution analyses in all case studies and across all services. This scale effect is not equally strong for all ES. We show that spatially explicit information about non-clustered, isolated ES tends to be lost at coarse resolution and against expectation, mainly in less rugged terrain, which calls for finer resolution assessments in such contexts. The effect of terrain ruggedness is also related to model properties such as dependency on land use-land cover data. We close with recommendations for mapping ES to make the resulting maps more comparable, and suggest a four-step approach to address the issue of scale when mapping ES that can deliver information to support ES-based decision making with greater accuracy and reliability.
On the effects of scale for ecosystem services mapping
Grêt-Regamey, Adrienne; Weibel, Bettina; Bagstad, Kenneth J.; Ferrari, Marika; Geneletti, Davide; Klug, Hermann; Schirpke, Uta; Tappeiner, Ulrike
2014-01-01
Ecosystems provide life-sustaining services upon which human civilization depends, but their degradation largely continues unabated. Spatially explicit information on ecosystem services (ES) provision is required to better guide decision making, particularly for mountain systems, which are characterized by vertical gradients and isolation with high topographic complexity, making them particularly sensitive to global change. But while spatially explicit ES quantification and valuation allows the identification of areas of abundant or limited supply of and demand for ES, the accuracy and usefulness of the information varies considerably depending on the scale and methods used. Using four case studies from mountainous regions in Europe and the U.S., we quantify information gains and losses when mapping five ES - carbon sequestration, flood regulation, agricultural production, timber harvest, and scenic beauty - at coarse and fine resolution (250 m vs. 25 m in Europe and 300 m vs. 30 m in the U.S.). We analyze the effects of scale on ES estimates and their spatial pattern and show how these effects are related to different ES, terrain structure and model properties. ES estimates differ substantially between the fine and coarse resolution analyses in all case studies and across all services. This scale effect is not equally strong for all ES. We show that spatially explicit information about non-clustered, isolated ES tends to be lost at coarse resolution and against expectation, mainly in less rugged terrain, which calls for finer resolution assessments in such contexts. The effect of terrain ruggedness is also related to model properties such as dependency on land use-land cover data. We close with recommendations for mapping ES to make the resulting maps more comparable, and suggest a four-step approach to address the issue of scale when mapping ES that can deliver information to support ES-based decision making with greater accuracy and reliability.
Limits on the Power of Cryptographic Cheap Talk
DEFF Research Database (Denmark)
Hubacek, Pavel; Nielsen, Jesper Buus; Rosen, Alon
2013-01-01
solutions so far were either sequentially unstable, or were restricted to a limited class of correlated equilibria (specifically, those that do not dominate any NE, and hence playing them does not offer a clear advantage over playing any NE). In the context of computational NE, we classify necessary...
Next big thing in physics not coming cheap
Overbye, Dennis
2007-01-01
"The price of exploring inner space just went up. At a news conference in Beijing an international consortium of physicists released the first detailed design of whant they believe will be the Next Big Thing in physics. A machine 20 miles long.......would cost about $6.7 billion and 13'000 person-years of labor to build the machine, the group reported." (1 page)
Resisting inequality but loving those cheap ironed shirts
DEFF Research Database (Denmark)
Schliewe, Sanna
2017-01-01
This chapter is based on empirical findings from a longitudinal study of Danish expatriates and their domestic staff in New Delhi. The premise is that most Danish expatriates strongly react—or resist—when they move to India and encounter what they experience as obvious inequality or inhumane work...... expatriates to justify their reactions and actions as employers. Thus, they seem to re-narrate their novel practices into frameworks that fit their prior value system, rather than transforming it....
Heading for the hills: risk avoidance drives den site selection in African wild dogs.
Jackson, Craig R; Power, R John; Groom, Rosemary J; Masenga, Emmanuel H; Mjingo, Ernest E; Fyumagwa, Robert D; Røskaft, Eivin; Davies-Mostert, Harriet
2014-01-01
Compared to their main competitors, African wild dogs (Lycaon pictus) have inferior competitive abilities and interspecific competition is a serious fitness-limiting factor. Lions (Panthera leo) are the dominant large carnivore in African savannah ecosystems and wild dogs avoid them both spatially and temporally. Wild dog young are particularly vulnerable and suffer high rates of mortality from lions. Since lions do not utilize all parts of the landscape with an equal intensity, spatial variation in lion densities can be exploited by wild dogs both during their general ranging behaviour, but more specifically when they are confined to a den with vulnerable young. Since patches of rugged terrain are associated with lower lion densities, we hypothesized that these comparatively safe habitats should be selected by wild dogs for denning. We investigated the relationship between the distribution of 100 wild dog den sites and the occurrence of rugged terrain in four wild dog populations located in Tanzania, Zimbabwe and South Africa. A terrain ruggedness index was derived from a 90 m digital elevation model and used to map terrain ruggedness at each site. We compared characteristics of actual and potential (random) den sites to determine how wild dogs select den sites. The distributions of wild dog dens were strongly associated with rugged terrain and wild dogs actively selected terrain that was more rugged than that available on average. The likelihood of encountering lions is reduced in these habitats, minimizing the risk to both adults and pups. Our findings have important implications for the conservation management of the species, especially when assessing habitat suitability for potential reintroductions. The simple technique used to assess terrain ruggedness may be useful to investigate habitat suitability, and even predict highly suitable denning areas, across large landscapes.
Heading for the hills: risk avoidance drives den site selection in African wild dogs.
Directory of Open Access Journals (Sweden)
Craig R Jackson
Full Text Available Compared to their main competitors, African wild dogs (Lycaon pictus have inferior competitive abilities and interspecific competition is a serious fitness-limiting factor. Lions (Panthera leo are the dominant large carnivore in African savannah ecosystems and wild dogs avoid them both spatially and temporally. Wild dog young are particularly vulnerable and suffer high rates of mortality from lions. Since lions do not utilize all parts of the landscape with an equal intensity, spatial variation in lion densities can be exploited by wild dogs both during their general ranging behaviour, but more specifically when they are confined to a den with vulnerable young. Since patches of rugged terrain are associated with lower lion densities, we hypothesized that these comparatively safe habitats should be selected by wild dogs for denning. We investigated the relationship between the distribution of 100 wild dog den sites and the occurrence of rugged terrain in four wild dog populations located in Tanzania, Zimbabwe and South Africa. A terrain ruggedness index was derived from a 90 m digital elevation model and used to map terrain ruggedness at each site. We compared characteristics of actual and potential (random den sites to determine how wild dogs select den sites. The distributions of wild dog dens were strongly associated with rugged terrain and wild dogs actively selected terrain that was more rugged than that available on average. The likelihood of encountering lions is reduced in these habitats, minimizing the risk to both adults and pups. Our findings have important implications for the conservation management of the species, especially when assessing habitat suitability for potential reintroductions. The simple technique used to assess terrain ruggedness may be useful to investigate habitat suitability, and even predict highly suitable denning areas, across large landscapes.
Sheet, Debdoot
2016-01-01
How would you provide effective and affordable health care in a country of more than 1.25 billion where there are only 0.7 physicians for every 1,000 people [1]? The Revised National Tuberculosis Control Program (RNTCP) and the Karnataka Internet-Assisted Diagnosis of Retinopathy of Prematurity (KIDROP) service are two notable efforts designed to deliver care across India, in both urban and rural areas and from the country?s flat plains to its rugged mountainous and desert regions.
Optical Remote Sensing Laboratory
Federal Laboratory Consortium — The Optical Remote Sensing Laboratory deploys rugged, cutting-edge electro-optical instrumentation for the collection of various event signatures, with expertise in...
International Nuclear Information System (INIS)
Hiti, K.; Faschinger, C.; Haller-Schober, E.M.; Walochnik, J.; Aspoeck, H.; Hiti, B.
2003-01-01
Microbially contaminated contact lens storage cases are considered to be a predisposing risk factor for Acanthamoeba keratitis. What kind of effect does microwave irradiation have on contact lens cases contaminated with Acanthamoeba cysts and trophozoites? Different types of contact lens cases were contaminated with trophozoites and cysts of three different Acanthamoeba species (A. hatchetti, A. castellanii, A. comandoni) and exposed to microwave irradiation for 3, 5 and 8 minutes respectively. One of the three test series was run with dehydrated cysts. After an irradiation period of 3 minutes under humid conditions cysts and trophozoites of all three strains were completely destroyed. Dehydrated cysts of A. hatchetti and A. castellanii were not killed by irradiation. There were no negative effects of irradiation on the contact lens cases themselves. Acanthamoeba cysts and trophozoites are effectively killed by microwave irradiation on condition that irradiation takes place in humid conditions. This can be easily achieved by filling the contact lens storage cases with tap water. We recommend microwave irradiation as a cheap and save method for the sterilization of contact lens cases in order to avoid a possible Acanthamoeba infection of the eye. (author)
Tan, Yusuf Ziya; Ozdemir, Semra; Temiz, Ahmet; Celik, Fatmanur
2015-05-01
The positive changes in human behavior caused by relaxing music demonstrate the psychological effect of music on human body. A meta-analytical study has shown that relaxing music affects blood pressure and heart rate in coronary heart patients and cancer patients. The aim of our study is to research whether there is a significant effect on heart rate and heart rate variability due to listening to relaxing music during ECG GATED MPS imaging under gamma camera. The music group (n = 50 patients) could choose from 15 different musical types including folk music (no lyric). The other 50 patients were placed in a "no music group" and did not get headphones or any music. There was a statistically significant reduction in the heart rate of patients in the music group compared to those in the control group. Relaxing music provides great benefits to both patient and clinician. There is close relationship between relaxing music and health procedure, can use every area of the health noninvasiv, safe, cheap and is a method don't have side effect. Copyright © 2015 Elsevier Ltd. All rights reserved.
Effectiveness of Iron Filings in Arsenate and Arsenite Removal from Drinking Water
Directory of Open Access Journals (Sweden)
AliReza Asgari
2009-09-01
Full Text Available Groundwater contamination with arsenic (As has been recognized as a serious problem and there are various reports from different regions, especially from Kurdistan Providence, indicating the presence of As in the from of arsenate and arsenite in water recourses. Removal of these compounds can be accomplished by various methods but they are all expensive. In this study, three concentrations (0.5, 1, and 1 mg/L of iron filings (0.25, 0.5, 1 and 1.5 grams were used as a cheap and available material for adsorption of As and the effects of contact time and pH as well as chloride and sulfate ion concentrations on removal efficiency were determined. Description of adsorption isotherms (Ferundlich and Langmuir was accomplished. Finally, the data obtained were analyzed using the Excel softwere. The results indicate that iron filings show a high capability in adsorbing both arsenate and arsenic compounds from polluted water samples at pH 7 over a short contact time of 30 minutes. In fact, this cheap adsorbent shows good treatment when used at doses as low as 1g/L with no considerable interference by interfering anions (SO42- and Cl-. It appears that the absorbability of both arsenate and arsenite by iron filings can be expressed by Ferundlich isotherm with R2>0.96, whereas arsenate adsorption (with a R2 value of more than 0.96 can be better described by Langmuir isotherm than arsenite (with R2 value of more than 0.91. Results also indicate that the amount of iron added to water is much more than the standard value of 0.3mg/L set for dinking water. Nevertheless, this method has far greater advantages in terms of costs and availability than similar methods. Besides, as removal by this method is efficient without pH modification, iron filing treatment of drinking water may, therefore, be recomnended as a convenient solution to the problem of water resources polluted with As in Iran.
Directory of Open Access Journals (Sweden)
Hadeed Ahmed Sher
2016-07-01
Full Text Available Induction motors are widely used in industrial power plants due to their robustness, reliability and high performance under variable operating conditions in the electrical power system. Modern industrial progress is dependent on these ruggedly constructed induction motors. Almost every sophisticated process of the industry is based on induction motors. Most of these motors are controlled by means of inverters that change the line frequency. The change in parameters of inverter makes it possible to control the motor according to the design requirements. The reliability of inverter based motor control is an important issue for industrial applications and therefore, it becomes very vital for design engineers to have comprehensive analysis of the inverter fed induction machine. This paper investigates one of the faults that may occur on the DC link of an inverter fed induction motor. The effect of the capacitor short circuit is presented in this paper. It also deals with the effects of short circuited capacitor on freewheeling diode. DC link capacitors are well designed and even the probability of capacitor failure is high, it is always a rare case if they puncture, however this analysis will add to the reliability of the induction machine under variable operating condition.
A silicon diode for fast neutron dosimetry
International Nuclear Information System (INIS)
Anon.
1983-01-01
The effect of fast neutrons on both animate and inanimate objects, including human beings, can be extremely serious and cumulative. There is thus a need for a small, simple and cheap component which will provide a permanent or semi-permanent record of the accumulated fast neutron dose
Using a Raspberry Pi as a Versatile and Inexpensive Display Device
Directory of Open Access Journals (Sweden)
Edward Iglesias
2013-07-01
Full Text Available This article covers the process by which a library took some unused equipment and added a cheap computing device to produce very inexpensive but effective electronic signage. Hardware and software issues as well as a step-by-step guide through the process are included.
Bossen, D.; Kloek, C.; Snippe, H.W.; Dekker, J.; Bakker, D. de; Veenhof, C.
2016-01-01
Background Exercise therapy in patients with hip and/or knee osteoarthritis is effective in reducing pain, increasing physical activity and physical functioning, but costly and a burden for the health care budget. A web-based intervention is cheap in comparison to face-to-face
How project approach influences adoption of SWC by farmers, examples from southern Mali
Bodnar, F.; Schrader, T.; Campen, Van W.
2006-01-01
Choices in project approach affect the continuation of soil and water conservation (SWC) after project withdrawal, and thus the sustainability and cost effectiveness of the project. A SWC project was carried out in southern Mali between 1986 and 1998. Its features were the promotion of cheap and
A Low-cost Vehicle Tracking Platform using Secure SMS
DEFF Research Database (Denmark)
Jacobsen, Rune Hylsberg; Aliu, Drini; Ebeid, Emad Samuel Malki
2017-01-01
as the in-vehicle device. Furthermore, a cloud web-platform is built involving the de-facto modern web-applications standards and carefully tailored concerning the security aspects. The cost-effectiveness of our solution results from the use of COTS components, open source software, and cheap SMS...
Sonourethrography of anterior urethral strictures: assessment of length and degree
International Nuclear Information System (INIS)
Kim, Jong Chul; Jeong, Youn Sin
1994-01-01
We reviewed out experience of sonourethrography(SUG) in male anterior urethral strictures to correlate the stricture length and degree seen on SUG with those on urethroscopy, surgery or biopsy. During the recent 6 years,both the retrograde urethrography (RUG) and SUG were preformed in 50 occasions for 47 patients with anteriorurethral stricture, that were subsequently evaluated urethroscopically or at surgery. As a whole, the length of the stricture seen on SUG did not correlate very well with that seen on RGU (r2=0.71, p<0.005). Considering the data from the operation as the gold standard, SUG was more accurate than RUG in depicting the exact stricturelength (r2=0.97 and 0.75 respectively,p<0.005). The shorter the lesion, the more accurate the data obtained.Although SUG certainly identified periurethral tissue, it was not adequate in predicting the depth of spongiofibrosis compared with full-depth biopsies in 20 patients. In conclusion, SUG, a dynamic study, accurately defined the stricture site, number and calibre. When compared with RUG, SUG was more accurate in the measurement of stricture length and in the demonstration of periurethral tissue, making it a valuable method in the evaluation of patients with suspected anterior urethral strictures
The microassay on a card: A rugged, portable immunoassay
Kidwell, David
1991-01-01
The Microassay on a Card (MAC) is a portable, hand-held, non-instrumental immunoassay that can test for the presence of a wide variety of substances in the environment. The MAC is a simple device to use. A drop of test solution is placed on one side of the card and within five minutes a color is developed on the other side in proportion to the amount of substance in the test solution, with sensitivity approaching 10 ng/ml. The MAC is self-contained and self-timed; no reagents or timing is necessary. The MAC may be configured with multiple wells to provide simultaneous testing for multiple species. As envisioned, the MAC will be employed first as an on-site screen for drugs of abuse in urine or saliva. If the MAC can be used as a screen of saliva for drugs of abuse, it could be applied to driving while intoxicated, use of drugs on the job, or testing of the identity of seized materials. With appropriate modifications, the MAC also could be used to test for environmental toxins or pollutants.
Rugged Packaging for Damage Resistant Inertial Fusion Energy Optics
Energy Technology Data Exchange (ETDEWEB)
Stelmack, Larry
2003-11-17
The development of practical fusion energy plants based on inertial confinement with ultraviolet laser beams requires durable, stable final optics that will withstand the harsh fusion environment. Aluminum-coated reflective surfaces are fragile, and require hard overcoatings resistant to contamination, with low optical losses at 248.4 nanometers for use with high-power KrF excimer lasers. This program addresses the definition of requirements for IFE optics protective coatings, the conceptual design of the required deposition equipment according to accepted contamination control principles, and the deposition and evaluation of diamondlike carbon (DLC) test coatings. DLC coatings deposited by Plasma Immersion Ion Processing were adherent and abrasion-resistant, but their UV optical losses must be further reduced to allow their use as protective coatings for IFE final optics. Deposition equipment for coating high-performance IFE final optics must be designed, constructed, and operated with contamination control as a high priority.
Under the Rug: Substance Abuse and the Mature Woman.
Columbia Univ., New York, NY. National Center on Addiction and Substance Abuse.
This report follows an extensive survey of primary care physicians (N=400) about the problem of substance abuse in women over the age of 59. Research has shown that an individual who reaches the age of 21 without smoking, using drugs, or abusing alcohol is virtually never at risk to abuse these substances. The only exception occurs with mature…
Ombuds’ corner: Do not put things under the rug!
Vincent Vuillemin
2012-01-01
In this series, the Bulletin aims to explain the role of the Ombuds at CERN by presenting practical examples of misunderstandings that could have been resolved by the Ombuds if he had been contacted earlier. Please note that, in all the situations we present, the names are fictitious and used only to improve clarity. Due to his technical expertise and a mastery in his domain of activity, Jim* was nominated supervisor of his Unit at CERN. In fact, he was considered perhaps the only person who could face, along with his team, the great challenges of a very complicated technical development, and succeed in overcoming all the difficulties. Jim really believed in his strategy, so he developed on his own a solid plan of action He set strict milestones for the project and the ways to operate, so that the overall project could be done on time and budget. Of course he counted on everyone in the team to be fully dedicated to his master plan. His management applauded his work and was confident that th...
Highly passable propulsive device for UGVs on rugged terrain
Directory of Open Access Journals (Sweden)
Gradetsky Valery
2018-01-01
Full Text Available One of the priority functional tasks of both industrial and mobile robotics is to perform operations for moving payloads in space. Typically, researchers pay attention to control the movement of the robot on different soils. It is necessary to underline the specificity of the movements of mobile robots, the main functional purpose of which is the movement of different objects. Unlike other robot applications there is the fact that transported cargo may have different mass-dimensional characteristics. The payload should be comparable to the mass of the mobile robot. This article addresses the issue of passability on rough terrain for a mobile robot performing the transport task and proposed a technical solution in the field of mechanics of propulsion to improve propelling of the traction wheel of the mobile robot with the ground.
Cocoa Husk/Cassava Leaf Inclusions in Layers Mash Produced Quality Cheap Feeds
Directory of Open Access Journals (Sweden)
Olubamiwa
2001-01-01
Full Text Available A 10-week trial was conducted to investigate the effects of cocoa husk meal (CHM/cassava leaf meal (CLM mixtures in layers mash on laying hen production performance and egg quality. Results were compared with those obtained using two locally popular standard commercial feeds (CFDs. CHM/CLM mixtures were included in the two test diets in the following order : Diet 1 (7.3 CHM/2.7 % CLM and Diet 2 (14.6 CHM/5.4 CLM. Forty 6-month-in-lay individually caged Black Nera hens were randomly allocated to the four diets. Feeding was ad libitum Feed intake, egg weight and percentage egg production were reduced (P <0.05 on Diet 2 relative to the CFDs. The reduction in egg weight was however marginal while the values were in line with the 56-58 g in the literature. Similarly, the value of 65 % percent egg production was considered not poor. Feed efficiency, yolk colour index, shell thickness and yolk percentage were not influenced by diet. On average, feed cost of the CHM/CLM diets were 60 % of those of the CFDs while the feed cost/kg egg was roughly doubled on the latter. It was concluded that the inclusion of CHM/CLM in layers mash promises to be a very economically rewarding venture where the two farm by-products are available.
Energy Technology Data Exchange (ETDEWEB)
Rostami, Amin; Akradi, Jamal; Ahmad-Jangi, Firoz, E-mail: a_rostami372@yahoo.co [University of Kurdistan, Sanandaj (Iran, Islamic Republic of). Faculty of Science. Dept. of Chemistry
2010-07-01
Boric acid has been used as a green, selective and recyclable catalyst for trimethysilylation of alcohols and phenols using hexamethyldisilazane in acetonitrile. Deprotection of trimethylsilyl ethers to their parent alcohols and phenols was also achieved using this catalyst in water at room temperature. The salient features of this methodology are cheap processing, mild acidity conditions, excellent yields of products and easy availability of the catalyst. (author)
Photoacoustic Multicomponent Analyzer for Atmospheric Compounds, Phase I
National Aeronautics and Space Administration — We propose to build a compact, rugged field-deployable laser photoacoustic spectrometric (LPAS) sensor for continuous, real-time measurements of multiple chemical...
Energy Technology Data Exchange (ETDEWEB)
Kaneko, T.; Tazawa, K. [Mitsubishi Chemical Corp., Tokyo (Japan); Shimasaki, K. [Kobe Steel Ltd. (Japan)
1998-08-20
When considering merchandising scale of the coal liquefaction process, it is a preliminary condition that metal used for its catalyst is rich in resource volume, cheap in production cost, without pollution, and so forth, and application of cheap iron ore and ferrous compounds to disposable catalyst is desired. As liquefaction activity of the iron ore was hitherto improved by its micro crushing, its mechanical crush had a limit of about 2 {mu}m in mean particle diameter. However, together with recent crushing technique, crushers with high performance were developed, and then micro crushing by sub-micron became possible industri8ally even for iron ore. In this study, three kinds of Australian iron ores such as limonite of ferric hydroxide type iron ore, pyrite of ferrous sulfide type, and hematite of ferric oxide type were micro crushed to examine coal liquefaction activity and hydrogenation reaction activity of 1-methyl naphthalene (1-MN) and also relationship between properties and activity of catalyst for the latter before and after reaction. 11 refs., 8 figs., 5 tabs.
The Plasma Discharge System For Effective Sterilization Of Water And Solid Surfaces
International Nuclear Information System (INIS)
Senturk, K.
2010-01-01
The different areas such as medicine, surgery, food production need efficient sterilization system since they are directly related to human health. In this work a new plasma system is described in order to present its effectiveness in sterilization. This is a different method from conventional methods such as: chemicals and heat addition, UV irradiation etc. The developed plasma system produces cold plasma working under atmospheric pressure. To generate the plasma both AC and DC high voltage power supplies were used. The developed system is cheap and very effective for sterilization. The light emission for both AC and DC coronas for the plasmas were investigated to understand the nature of generated plasma ionization. Different parameters like temperature, voltage, application time were changed during the plasma application and the optimization for killing the micro-organisms were investigated. To understand the biological effect of plasma on the organisms comparisons were done by using the scanning electron microscope and absorption spectrometer. The plasma was applied on the bacteria like Escherichia coli, Bacillus subtilis, Streptococcus mutans , the yeasts such as Candida albicans, and green algae. The efficiency, the non toxic nature, the affordable price make this plasma discharge method a very efficient one for sterilization.
Maintaining public confidence in UK nuclear safety regulation
International Nuclear Information System (INIS)
Williams, L.
2001-01-01
The key to maintaining stake holder confidence is competence and having the resources necessary to not only carry out regulatory functions effectively, but also to keep the public informed and respond to their questions. This does not come cheap but it is a price well worth paying. (N.C.)
Synthetic Aperture Beamforming in Ultrasound using Moving Arrays
DEFF Research Database (Denmark)
Andresen, Henrik
Medical ultrasound (US) is widely used because it allows cheap real-time imaging of soft tissue with no known side-effects or hazards to either patients or operating personnel. US has existed since the 1960s and was originally adapted from the concept of radar and sonar. The development...
Evaluation of copper and lead immobilization in contaminated soil ...
African Journals Online (AJOL)
The effectiveness of natural clay, calcium phosphate, poultry manure and rice husks as cheap and ecologically non-invasive amendments for immobilizing Cu and Pb in contaminated soil was assessed. A moderately contaminated soil was sampled from a cultivated field in the vicinity of an active waste dump, characterized ...
Structural stability and hydraulic conductivity of Nkpologu sandy ...
African Journals Online (AJOL)
vincent
The 4 x 3 factorial experiment was laid in a randomized complete block design with four replicates. Fruit fibre .... cheap land preparation method especially when unmulched .... Table 3. The effect of seed bed preparation and mulching methods on the cost and .... improved soil physic-chemical properties including nutrients ...
Liturgy as space for anticipation
African Journals Online (AJOL)
2011-05-04
May 4, 2011 ... for my life with AIDS ... dancing has been an effective image of hope for my life with. AIDS ... never be a featured dancer in a big musical as much as I'd love to. ... rather poster, he (deliberately) makes use of a cheap black and.
DEFF Research Database (Denmark)
Ottaviani, Marco; Sørensen, Peter Norman
2006-01-01
on the basis of the advice given and the realized state of the world. In equilibrium of this reputational cheap-talk game, no more than two messages are effectively reported. The model is extended to consider sequential communication by experts with conditionally independent signals. In the long run, learning...
Chlorproguanil - Dapsone a new drug in the fight against malaria
African Journals Online (AJOL)
This drug was developed at the time chloroquine was failing and a search for a cheap effective alternative was on. ... antifolates. This class of drugs works by ..... WHO/CDS/CSR/DRS/2001 , Geneva. 2001 . Winstanley PA. Chemotherapy for falciparum malaria: the armoury, the problems and the prospects. Parasitology.
Near Real-Time, Microchip Assay of Aerosol Chemical Composition, Phase I
National Aeronautics and Space Administration — A compact, autonomous and rugged instrument to measure the concentration of inorganic ions, and possibly organic acids, in atmospheric aerosols is proposed. This...
Photonic Crystal Fiber-Based High Sensitivity Gas Sensor, Phase II
National Aeronautics and Space Administration — Los Gatos Research, Inc. proposes to develop a lightweight, compact, rugged, near and mid-infrared gas-sensing spectroscopy instrument to accurately measure the...
Photonic Crystal Fiber-Based High Sensitivity Gas Sensor, Phase I
National Aeronautics and Space Administration — Los Gatos Research, Inc. proposes to develop a lightweight, compact, rugged, near-infrared gas-sensing spectroscopy instrument to accurately measure the abundance of...
Nanostructured Lanthanum Halides and CeBr3 for Nuclear Radiation and Detection
International Nuclear Information System (INIS)
Guss, Paul; Mukhopadhyay, Sanjoy; Guise, Ron; Yuan, Ding
2010-01-01
Scintillator materials are used to detect, and in some cases identify, gamma rays. Higher performance scintillators are expensive, hard to manufacture, fragile, and sometimes require liquid nitrogen or cooling engines. But whereas lower-quality scintillators are cheap, easy to manufacture, and more rugged, their performance is lower. At issue: can the desirable qualities of high-and low-performance scintillators be combined to achieve better performance at lower cost? Preliminary experiments show that a LaF 3 :Ce oleic acid-based nanocomposite exhibits a photopeak when exposed to 137 Cs source gamma-radiation. The chemical synthesis of the cerium-doped lanthanum halide nanoparticles are scalable and large quantities of material can be produced at a time, unlike typical crystal growth processes such as the Bridgeman process. Using a polymer composite (Figure 1), produced by LANL, initial measurements of the unloaded and 8% LaF 3 :Ce-loaded sample have been made using 137 Cs sources. Figure 2 shows an energy spectrum acquired for CeF 3 . The lighter plot is the measured polymer-only spectrum and the black plot is the spectrum from the nanocomposite scintillator. As the development of this material continues, the energy resolution is expected to improve and the photopeak-to-Compton ratio will become greater at higher loadings. These measurements show the expected Compton edge in the polymer-only sample, and the Compton edge and photo-peak expected in the nanophosphor composites that LANL has produced. Using a porous VYCORR with CdSe/ZnS core shell quantum dots, Letant has demonstrated that he has obtained signatures of the 241Am photopeak with energy resolution as good at NaI (Figure 3). We begin with the fact that CeBr 3 crystals do not have a self-activity component as strong as the lanthanum halides. The radioactive 0.090% 138 La component of lanthanum leads to significant self-activity, which will be a problem for very large detector volumes. Yet a significant
Supplemental Equipment Request for Advanced Marine Mammal Acoustic Localization
National Research Council Canada - National Science Library
Thode, Aaron
2004-01-01
...). The overall project goal is to modify flash-memory recorders, originally developed for marine mammal acoustic tags, into modular, portable, and rugged array systems that can be deployed in multiple...
Low Phase Noise Universal Microwave Oscillator for Analog and Digital Devices, Phase I
National Aeronautics and Space Administration — An inherently rugged Universal Oscillator (UO) is needed to enable a superior class of configurable communications for NASA applications. The requirements are a low...
In-Flight Imaging Systems for Hypervelocity and Re-Entry Vehicles, Phase I
National Aeronautics and Space Administration — It is proposed to create a rugged, reliable, compact, standardized imaging system for hypervelocity and re-entry vehicles using sapphire windows, small imagers, and...
Medical Surveillance for a Soldier Centered Battlespace Awareness
National Research Council Canada - National Science Library
Schmorrow, Dylan D; Solhan, George; Kruse, Amy A
2004-01-01
.... Medical technologies have progressed to the degree that portable, rugged, and wireless designs can be conceived of that could give coalition commanders and medical personnel a view of the health...
International Nuclear Information System (INIS)
Umar, Datin Fatia; Muta'alim; Usui, Hiromoto; Komoda, Yoshiyuki
2009-01-01
Upgraded brown coal water mixture (UBCWM) preparation by using an Indonesian upgraded coal produced by upgraded brown coal (UBC) process, was carried out to study the effect of dispersing and stabilizing additives on rheological behavior of the UBCWM. Three kinds of anionic dispersing additives, naphthalene sulfonic formaldehyde condensate (NSF), poly (meth) acrylate (PMA) and poly styrene sulfonic acid (PSS) and three kinds of stabilizing additives, carboxyl methyl cellulose (CMC), rhansam gum (S-194) and gellan gum (S-60) were used in this study. Results indicate that the addition of NSF 0.3 wt.% together with S-194 0.01 wt.% is effective in preparing UBCWM with good slurryability and stability, based on its rheological characteristics with the apparent viscosity at shear rate of 100 s - 1 and yield stress at zero point of shear rate. The rheological behavior of all of the UBCWM that prepared, exhibits non-Newtonian Bingham plastic. From the economical point of view, the price of S-194 is expensive. On the other hand, CMC is cheap and abundant. Therefore, the addition of CMC 0.01 wt.% together with NSF 0.3 wt.% is also effective in preparing UBCWM with good fluidity and stability. (author)
Seismic migration in generalized coordinates
Arias, C.; Duque, L. F.
2017-06-01
Reverse time migration (RTM) is a technique widely used nowadays to obtain images of the earth’s sub-surface, using artificially produced seismic waves. This technique has been developed for zones with flat surface and when applied to zones with rugged topography some corrections must be introduced in order to adapt it. This can produce defects in the final image called artifacts. We introduce a simple mathematical map that transforms a scenario with rugged topography into a flat one. The three steps of the RTM can be applied in a way similar to the conventional ones just by changing the Laplacian in the acoustic wave equation for a generalized one. We present a test of this technique using the Canadian foothills SEG velocity model.
Seismic migration in generalized coordinates
International Nuclear Information System (INIS)
Arias, C.; Duque, L. F.
2017-01-01
Reverse time migration (RTM) is a technique widely used nowadays to obtain images of the earth’s sub-surface, using artificially produced seismic waves. This technique has been developed for zones with flat surface and when applied to zones with rugged topography some corrections must be introduced in order to adapt it. This can produce defects in the final image called artifacts. We introduce a simple mathematical map that transforms a scenario with rugged topography into a flat one. The three steps of the RTM can be applied in a way similar to the conventional ones just by changing the Laplacian in the acoustic wave equation for a generalized one. We present a test of this technique using the Canadian foothills SEG velocity model. (paper)
Directory of Open Access Journals (Sweden)
Umut Tuncel
2013-03-01
Conclusion: As a result, we can say that spongostan wrapped diced cartilages graft seems to be a cheap, safe and effective method for obtaining a nice nasal dorsal contouring as well as for correcting and preventing of dorsal irregularities in rhinoplasty. [J Contemp Med 2013; 3(1.000: 12-16
Crop protection strategies for major diseases of cocoa, coffee and ...
African Journals Online (AJOL)
In Nigeria, crop protection measures that are cheap, simple, cost-effective and sustainable are desirable to combat Phytophthora pod rot (black pod) and cocoa swollen shoot virus diseases of cocoa, coffee leaf rust and coffee berry diseases, inflorescence blight disease of cashew in order to make farming profitable and ...
Effectiveness of construction materials and some minerals used as radiation shielding
International Nuclear Information System (INIS)
Khunarak, P.; Bunnak, S.
1988-01-01
There are many kinds of ores in Thailand, some large amount of them are cheap and easy to obtain possess shielding properties for gamma radiation. These ores are baryte, illmenite, galena, scheelite, wolframite pyrite, cerrusite. Besides, building structure materials are also introduced for shielding properties study by using Co-60, Cs-137 and Ra-226 as gamma radiation sources in the experiments. The results turn out that those high density ores will possess a better shielding property than the low density ores. Radiation measurement equipment is G.M. tube connected to rate meter
Mechanisms of Photo Degradation for Layered Silicate-Polycarbonate Nanocomposites
National Research Council Canada - National Science Library
Sloan, James M; Patterson, Philip
2005-01-01
...., lightweight structure, rugged abrasion resistance, and high ballistic impact strength). However, as with any polymer system, these materials are susceptible to degradation over time when exposed to various environmental (i.e...
High Performance Fiber-Optic Sensor for Environmental Monitoring, Phase I
National Aeronautics and Space Administration — Los Gatos Research (LGR) proposes to develop a low-cost, compact, lightweight, rugged and easy-to-use environmental monitoring optical fiber sensor device based on...
Effect of malachite green toxicity on non target soil organisms.
Gopinathan, R; Kanhere, J; Banerjee, J
2015-02-01
Although malachite green (MG), is banned in Europe and US for its carcinogenic and teratogenic effect, the dye being cheap, is persistently used in various countries for fish farming, silk, dye, leather and textile industries. Current research, however, fails to elucidate adequate knowledge concerning the effects of MG in our ecosystem. In the present investigation, for the first time, an attempt has been made to study the effects of MG on soil biota by testing Bacillus subtilis, Azotobacter chroococcum, Saccharomyces cerevisiae, Penicillium roqueforti, Eisenia fetida and seeds of three crop plants of different families. Various tests were conducted for determining cytotoxicity, genotoxicity, acute toxicity, morphological and germination effect. Our data confirmed MG toxicity on fungi and bacteria (gram positive and gram negative organisms) showing elevated level of ROS. Genotoxicity caused in the microorganisms was detected by DNA polymorphism and fragmentation. Also, scanning electron microscopy data suggests that the inhibitory effect of MG to these beneficial microbes in the ecosystem might be due to pore formation in the cell and its eventual disruption. Filter paper and artificial soil test conducted on earthworms demonstrated a LC 50 of 2.6 mg cm(-2) and 1.45 mg kg(-1) respectively with severe morphological damage. However, seed germination of Mung bean, Wheat and Mustard was found to be unaffected in presence of MG up to 100 mL(-1) concentration. Thus, understanding MG toxicity in non target soil organisms and emphasis on its toxicological effects would potentially explicate its role as an environmental contaminant. Copyright © 2014 Elsevier Ltd. All rights reserved.
RFID security : cryptography and physics perspectives
Guajardo, J.; Tuyls, P.T.; Bird, N.; Conrado, C.; Maubach, S.; Schrijen, G.J.; Skoric, B.; Tombeur, A.M.H.; Thueringer, P.; Kitsos, P.; Zhang, Y.
2008-01-01
In this chapter, we provide an overview of mechanisms that are cheap to implement or integrate into RFID tags and that at the same time enhance their security and privacy properties. We emphasize solutions that make use of existing (or expected) functionality on the tag or that are inherently cheap
confronting aids - a plea for a national dried milk formula
African Journals Online (AJOL)
The programme also offers opportunity for research and the development ... A cheap national dried milk formula was introduced into the. UK very ... promote the advantages of cup feeding, the correct method of preparing ... nutritious cereals could be mixed with the cheap milk powder ... concise book discusses the place of ...
76 FR 59883 - National Hunting and Fishing Day, 2011
2011-09-28
... local economies and the livelihood of many across America. Last year, after an unprecedented public... families, and especially our youth, to the rugged beauty of the natural wonders our Nation's hunters and...
Jin, Seung-A Annie
2010-06-01
This study gauged the effects of force feedback in the Novint Falcon haptics system on the sensory and cognitive dimensions of a virtual test-driving experience. First, in order to explore the effects of tactile stimuli with force feedback on users' sensory experience, feelings of physical presence (the extent to which virtual physical objects are experienced as actual physical objects) were measured after participants used the haptics interface. Second, to evaluate the effects of force feedback on the cognitive dimension of consumers' virtual experience, this study investigated brand personality perception. The experiment utilized the Novint Falcon haptics controller to induce immersive virtual test-driving through tactile stimuli. The author designed a two-group (haptics stimuli with force feedback versus no force feedback) comparison experiment (N = 238) by manipulating the level of force feedback. Users in the force feedback condition were exposed to tactile stimuli involving various force feedback effects (e.g., terrain effects, acceleration, and lateral forces) while test-driving a rally car. In contrast, users in the control condition test-drove the rally car using the Novint Falcon but were not given any force feedback. Results of ANOVAs indicated that (a) users exposed to force feedback felt stronger physical presence than those in the no force feedback condition, and (b) users exposed to haptics stimuli with force feedback perceived the brand personality of the car to be more rugged than those in the control condition. Managerial implications of the study for product trial in the business world are discussed.
High Power, Thermally Optimized Blue Laser for Lidar, Phase I
National Aeronautics and Space Administration — To enable widespread and rapid airborne bathymetric lidar to adequate depths in many ocean regions a low-cost, rugged, and high energy pulsed laser source must be...
High Power, Thermally Optimized Blue Laser for Lidar, Phase II
National Aeronautics and Space Administration — To enable widespread and rapid airborne bathymetric lidar to adequate depths in many ocean regions a low-cost, rugged, and high energy pulsed laser source must be...
Novel Instrumentation for Lunar Regolith Oxygen Production Facilities, Phase II
National Aeronautics and Space Administration — In this SBIR effort, Los Gatos Research (LGR) proposes to develop, test and deploy three novel compact, rugged and easy-to-use multi-gas analysis instruments, based...
Aquifers Characterization and Productivity in Ellala Catchment ...
African Journals Online (AJOL)
user
... to weak degree of potentiality are found occupying flat to rugged topography of the catchment. ... government and non-governmental organizations. Among various .... Ellala River, forming something like graben structure. This is particularly ...
Nanostructured Material for Accurate and Fast Tracking of Cryogenic Temperatures, Phase I
National Aeronautics and Space Administration — The use of cryogenic propellants in next-generation launch vehicles and rockets relies to a great extent on the availability of rugged, high accuracy (0.2%), fast...
Muhammad, Nadeem; Subhani, Qamar; Wang, Fenglian; Guo, Dandan; Zhao, Qiming; Wu, Shuchao; Zhu, Yan
2017-09-15
This work illustrates the introduction of a simple, rugged and flexible column-switching ion chromatography (IC) technique for an automated on-line QuEChERS extracted samples extracts washing followed by sensitive fluorescence (FLD) determination of five acidic pharmaceutical drugs namely; clofibric acid (CLO), ibuprofen (IBU), aspirin (ASP), naproxen (NAP) and flurobrofen (FLU) in three complex samples (spinach, apple and hospital sewage sludge). An old anion exchange column IonPac ® AS11-HC was utilized as a pre-treatment column for on-line washing of inorganic and organic interferences followed by isocratic separation of five acidic drugs with another anion exchange IonPac ® AS12A analytical column by exploiting the column-switching technique. This novel method exhibited good linearity with correlation coefficients (r 2 ) for all drugs were in the range 0.976-0.996. The limit of detection and quantification of all five acidic drugs were in the range 0.024μg/kg to 8.70μg/kg and 0.082μg/kg to 0.029mg/kg, respectively, and better recoveries in the range 81.17-112.5% with percentage relative standard deviations (RSDs) less than 17.8% were obtained. This on-line sample pre-treatment method showed minimum matrix effect in the range of 0.87-1.25 except for aspirin. This simple rugged and flexible column-switching system required only 28min for maximum elimination of matrices and interferences in three complex samples extracts, isocratic separation of five acidic drugs and for the continuous regeneration of pre-treatment column prior to every subsequent analysis. Finally, this simple automated IC system was appeared so rugged and flexible, which can eliminate and wash out most of interference, impurities and matrices in complex samples, simply by adjusting the NaOH and acetonitrile concentration in washing mobile phase with maximum recoveries of acidic analytes of interest. Copyright © 2017. Published by Elsevier B.V.
Aleksandra Łoś; Aneta Strachecka
2018-01-01
Using insect hemolymph (“blood”) and insect body surface elutions, researchers can perform rapid and cheap biochemical analyses to determine the insect’s immunology status. The authors of this publication describe a detailed methodology for a quick marking of the concentration of total proteins and evaluation of the proteolytic system activity (acid, neutral, and alkaline proteases and protease inhibitors), as well as a methodology for quick “liver” tests in insects: alanine aminotransferase ...
Challenges and Negative Effects of Divorce among Muslim Women in Northern Nigeria
Rafatu Abdul Hamid; Imam Abdul Rahim Muhammad Sanusi
2016-01-01
The alarming explosion of divorce in our present times is a cause of great concern. In fact the divorce rate in Northern Nigeria is high and this is scandalous. The mention of the word (Talaq) divorce has now become so cheap that in some marriages, every argument futures this word, either the husband threatens with it or the wife demands it. Hence women are married and divorce at will for minor reasons. This paper is therefore an attempt to highlight some of the causes of rampant divorce and ...
Chandel, Siddhartha; Khan, Mohsin Ali; Singh, Nishi; Agrawal, Amiya; Khare, Vinita
2017-01-01
Present study is designed to explore the effect of sodium bicarbonate oral rinse on salivary pH and oral micro flora. Twenty five healthy subjects were recruited for the study in department of dentistry in Era Medical College. Subjects were abstained from tooth brushing overnight pre rinse (control) samples were collected after one hour of dinner and were asked to rinse with pre calibrated freshly prepared sodium bicarbonate solution. The salivary samples were then collected the following morning using sterile gauze in marked bottles. Aerobic bacterial culture was done by plating the sample directly from the swab on the surface of Blood agar and Mac Conkeys media respectively. The colony forming units and ph were calculated for the pre rinse and post rinse saliva sample. Results shows that salivary pH increased significantly after sodium Bicarbonate oral rinse. There was a marginal decrease in number of CFU/ml for bacteria especially Viridans Streptococci, Moraxella species. Sodium Bicarbonate oral rinse may be considered as a cheap and effective alternative for chlorhexidine and alcohol based mouth wash, especially where long duration usage is required.
... waste collection" near your zip code in the Earth 911 database Exit for more information. Contact your ... lemon juice in one pint of mineral or vegetable oil and wipe furniture. Rug Deodorizer Liberally sprinkle ...
Small portable speed calculator
Burch, J. L.; Billions, J. C.
1973-01-01
Calculator is adapted stopwatch calibrated for fast accurate measurement of speeds. Single assembled unit is rugged, self-contained, and relatively inexpensive to manufacture. Potential market includes automobile-speed enforcement, railroads, and field-test facilities.
Improved Laser Vibration Radar
National Research Council Canada - National Science Library
Hilaire, Pierre
1998-01-01
.... This thesis reconfigured an existing CO2 laboratory laser radar system that is capable of measuring the frequencies of vibration of a simulated target into a more compact and rugged form for field testing...
2010-05-18
... Pass, AK 99631. Participants should be in good health and prepared/able to hike without assistance in... should also pack their own lunch, snacks and water, wear waterproof, rugged footwear, and be prepared for...
Development of Vanadometric System for Spectrophotometric ...
African Journals Online (AJOL)
rugged, and compares well with some complex methods for assay of timolol maleate in ... 3-[[4-(4-morpholinyl)-1, 2, 5-thiadiazol-3-yl] oxy]- ... preparation methods, costly reagents, expertise ..... chemical characterization, UV spectrophotometric.
Journal of Earth System Science | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Journal of Earth System Science; Volume 121; Issue 5 ... owing to rugged terrain at high altitude, high frequency of intense rainfall and rapidly ... School of Civil Engineering, SASTRA University, Thanjavur, Tamilnadu, India.
Huertas Pérez, J F; Sejerøe-Olsen, B; Fernández Alba, A R; Schimmel, H; Dabrio, M
2015-05-01
A sensitive, accurate and simple liquid chromatography coupled with mass spectrometry method for the determination of 10 selected pesticides in soya beans has been developed and validated. The method is intended for use during the characterization of selected pesticides in a reference material. In this process, high accuracy and appropriate uncertainty levels associated to the analytical measurements are of utmost importance. The analytical procedure is based on sample extraction by the use of a modified QuEChERS (quick, easy, cheap, effective, rugged, safe) extraction and subsequent clean-up of the extract with C18, PSA and Florisil. Analytes were separated on a C18 column using gradient elution with water-methanol/2.5 mM ammonium acetate mobile phase, and finally identified and quantified by triple quadrupole mass spectrometry in the multiple reaction monitoring mode (MRM). Reliable and accurate quantification of the analytes was achieved by means of stable isotope-labelled analogues employed as internal standards (IS) and calibration with pure substance solutions containing both, the isotopically labelled and native compounds. Exceptions were made for thiodicarb and malaoxon where the isotopically labelled congeners were not commercially available at the time of analysis. For the quantification of those compounds methomyl-(13)C2(15)N and malathion-D10 were used respectively. The method was validated according to the general principles covered by DG SANCO guidelines. However, validation criteria were set more stringently. Mean recoveries were in the range of 86-103% with RSDs lower than 8.1%. Repeatability and intermediate precision were in the range of 3.9-7.6% and 1.9-8.7% respectively. LODs were theoretically estimated and experimentally confirmed to be in the range 0.001-0.005 mg kg(-1) in the matrix, while LOQs established as the lowest spiking mass fractionation level were in the range 0.01-0.05 mg kg(-1). The method reliably identifies and quantifies the
Gun, Aburrahman; Ozer, Mehmet Kaya; Bilgic, Sedat; Kocaman, Nevin; Ozan, Gonca
2016-01-01
Fructose corn syrup is cheap sweetener and prolongs the shelf life of products, but fructose intake causes hyperinsulinemia, hypertriglyceridemia, and hypertension. All of them are referred to as metabolic syndrome and they are risk factors for cardiovascular diseases. Hence, the harmful effects of increased fructose intake on health and their prevention should take greater consideration. Caffeic Acid Phenethyl Ester (CAPE) has beneficial effects on metabolic syndrome and vascular function which is important in the prevention of cardiovascular disease. However, there are no known studies about the effect of CAPE on fructose-induced vascular dysfunction. In this study, we examined the effect of CAPE on vascular dysfunction due to high fructose corn syrup (HFCS). HFCS (6 weeks, 30% fed with drinking water) caused vascular dysfunction, but treatment with CAPE (50 micromol/kg i.p. for the last two weeks) effectively restored this problem. Additionally, hypertension in HFCS-fed rats was also decreased in CAPE supplemented rats. CAPE supplements lowered HFCS consumption-induced raise in blood glucose, homocysteine, and cholesterol levels. The aorta tissue endothelial nitric oxide synthase (eNOS) production was decreased in rats given HFCS and in contrast CAPE supplementation efficiently increased its production. The presented results showed that HFCS-induced cardiovascular abnormalities could be prevented by CAPE treatment.
Directory of Open Access Journals (Sweden)
Aburrahman Gun
2016-01-01
Full Text Available Fructose corn syrup is cheap sweetener and prolongs the shelf life of products, but fructose intake causes hyperinsulinemia, hypertriglyceridemia, and hypertension. All of them are referred to as metabolic syndrome and they are risk factors for cardiovascular diseases. Hence, the harmful effects of increased fructose intake on health and their prevention should take greater consideration. Caffeic Acid Phenethyl Ester (CAPE has beneficial effects on metabolic syndrome and vascular function which is important in the prevention of cardiovascular disease. However, there are no known studies about the effect of CAPE on fructose-induced vascular dysfunction. In this study, we examined the effect of CAPE on vascular dysfunction due to high fructose corn syrup (HFCS. HFCS (6 weeks, 30% fed with drinking water caused vascular dysfunction, but treatment with CAPE (50 micromol/kg i.p. for the last two weeks effectively restored this problem. Additionally, hypertension in HFCS-fed rats was also decreased in CAPE supplemented rats. CAPE supplements lowered HFCS consumption-induced raise in blood glucose, homocysteine, and cholesterol levels. The aorta tissue endothelial nitric oxide synthase (eNOS production was decreased in rats given HFCS and in contrast CAPE supplementation efficiently increased its production. The presented results showed that HFCS-induced cardiovascular abnormalities could be prevented by CAPE treatment.
Energy Technology Data Exchange (ETDEWEB)
Toenseth, Svein
2009-07-01
The Snow-white (Snoehvit) plant was first, Now comes the dwarfs. The technology was discovered when a demo plant was to be installed. By use of cheap heat exchangers and other standard components put together in new ways, the solution of cooling even small amount of gas in a cost effective way, was discovered. (AG)
Antimalarial Anthrone and Chromone from the Leaf Latex of Aloe ...
African Journals Online (AJOL)
In Ethiopian traditional medicine, the leaf latex of Aloe debranan Chrstian is used for the treatment of several diseases including malaria. In an ongoing search for effective, safe and cheap antimalarial agents from plants, the leaf latex of A. debrana was tested for its in vivo antimalarial activity, in a 4-day suppressive assay ...
Larvicidal properties of Lepidagathis alopecuroides and Azadirachta ...
African Journals Online (AJOL)
No mortality was recorded in A. gambiae exposed to neem at all the concentrations until the emergence of the adult. The results suggest that L. alopecuroides is more potent than neem and could be developed as a cheap, effective and renewable resource that could be incorporated into the Roll Back Malaria program in ...
Sobrero, Patricio; Valverde, Claudio
2013-01-01
A simple and cheap laboratory class is proposed to illustrate the lethal effect of UV radiation on bacteria and the operation of different DNA repair mechanisms. The class is divided into two sessions, an initial 3-hour experimental session and a second 2-hour analytical session. The experimental session involves two separate experiments: one…
RODOS User's Group: Final project report. Contract number: F14P- CT98-0075
Energy Technology Data Exchange (ETDEWEB)
Sinkko, K.; Ammann, M. (eds.)
2001-03-01
Prior to 1998, the development of RODOS, a decision support system designed for the management of nuclear emergencies, had been carried out almost entirely by research scientists and engineers. The end-users/operators had little or no input into this development. To redress this situation, the RODOS Users Group (RUG) was established in 1998 under a Concerted Action Contract between the European Commission and STUK. The main objectives of this group were to encourage the emergency management community to use such a system, to provide a forum for end-users to share their experience in the use of such systems and to provide feedback from the end-users to the model and system developers in regard to operational problems and required improvements. The contract, which commenced on 1st September 1998, was for a period of two years. During this period, RUG established a www homepage, planned and performed two nuclear accident exercises and held four meetings. Technically the Web page operated very well. State-of-the-art Internet technology provided an efficient communication channel at low cost. The membership of the RUG was, however, too low to maintain a lively and ongoing discussion in parallel with the RODOS project Web page. This experience would suggest that it might have been better to have operated a Web page for RUG on the RODOS project Web-site rather than an independent RUG Web-site. Exercises based on fixed accident scenarios proved to be an appropriate means of highlighting issues that needed to be discussed between users and developers and to stimulate and motivate the end-users to maintain and further develop the system. Such exercises also promoted further activity in the field of emergency management. The organisation and administration of realistic exercises are time consuming, laborious and expensive. It is therefore very important that the maximum benefit is achieved from such exercises. The use of analytical evaluation methods could be better employed
RODOS User's Group: Final project report. Contract number: F14P- CT98-0075
International Nuclear Information System (INIS)
Sinkko, K.; Ammann, M.
2001-03-01
Prior to 1998, the development of RODOS, a decision support system designed for the management of nuclear emergencies, had been carried out almost entirely by research scientists and engineers. The end-users/operators had little or no input into this development. To redress this situation, the RODOS Users Group (RUG) was established in 1998 under a Concerted Action Contract between the European Commission and STUK. The main objectives of this group were to encourage the emergency management community to use such a system, to provide a forum for end-users to share their experience in the use of such systems and to provide feedback from the end-users to the model and system developers in regard to operational problems and required improvements. The contract, which commenced on 1st September 1998, was for a period of two years. During this period, RUG established a www homepage, planned and performed two nuclear accident exercises and held four meetings. Technically the Web page operated very well. State-of-the-art Internet technology provided an efficient communication channel at low cost. The membership of the RUG was, however, too low to maintain a lively and ongoing discussion in parallel with the RODOS project Web page. This experience would suggest that it might have been better to have operated a Web page for RUG on the RODOS project Web-site rather than an independent RUG Web-site. Exercises based on fixed accident scenarios proved to be an appropriate means of highlighting issues that needed to be discussed between users and developers and to stimulate and motivate the end-users to maintain and further develop the system. Such exercises also promoted further activity in the field of emergency management. The organisation and administration of realistic exercises are time consuming, laborious and expensive. It is therefore very important that the maximum benefit is achieved from such exercises. The use of analytical evaluation methods could be better employed
Military Engagement with Social Media
2011-05-06
or position of the Department of the Army, Department of Defense, or the U.S. Government. MILITARY ENGAGEMENT WITH SOCIAL MEDIA BY...been the Army’s best and most effective messengers. Every time a member of the Army family joins Army social media , it increases the timely and...transparent dissemination of information. Social media is a cheap, effective , and measurable form of communication.”6 The Deputy Secretary of Defense
Development of simple DSA equipment and experience of its using
International Nuclear Information System (INIS)
Yoshino, Fumiki; Matsuo, Michimasa.
1984-01-01
We manufactured a cheap and portable simple DSA equipment, consisting of an ordinary X-ray system and a microcomputer which is the hardware exclusively used for real-time processing. As the result of the basic clinical examination by simple DSA equipment, we found it effective on the follow-up study of diseases such as the arteriosclerosis obliterans. We performed the intra-arterial DSA with a catheter which was small in the inside diameter, to reduce its aggression, and at the same time we are trying its application to the functional image. In the future, it will show us the possibility of the routine screening examination at an out-patients' department. Compared with DSA equipment sold in the market, our simple DSA equipment is good enough to make diagnostic images in spite of the limited capacity of TV system. Moreover, our DSA equipment is cheap and portable, and is very effective for the follow-up study of diseases such as the arteriosclerosis obliterans. So we can say that simple DSA equipment is of excellent clinical value. (author)
Bioplastic op bestelling : grondstoffen kunnen steeds opnieuw worden geoogst
Didde, R.; Bolck, C.H.
2014-01-01
Bioplastics hebben de wind in de rug. Steeds meer bedrijven overwegen hun producten te maken van kunststoffen met een plantaardige oorsprong. Christiaan Bolck van Wageningen UR Food & Biobased Research helpt ze aan de juiste receptuur.
Dzyadevych, Sergei V; Soldatkin, Alexey P; Korpan, Yaroslav I; Arkhypova, Valentyna N; El'skaya, Anna V; Chovelon, Jean-Marc; Martelet, Claude; Jaffrezic-Renault, Nicole
2003-10-01
This paper is a review of the authors' publications concerning the development of biosensors based on enzyme field-effect transistors (ENFETs) for direct substrates or inhibitors analysis. Such biosensors were designed by using immobilised enzymes and ion-selective field-effect transistors (ISFETs). Highly specific, sensitive, simple, fast and cheap determination of different substances renders them as promising tools in medicine, biotechnology, environmental control, agriculture and the food industry. The biosensors based on ENFETs and direct enzyme analysis for determination of concentrations of different substrates (glucose, urea, penicillin, formaldehyde, creatinine, etc.) have been developed and their laboratory prototypes were fabricated. Improvement of the analytical characteristics of such biosensors may be achieved by using a differential mode of measurement, working solutions with different buffer concentrations and specific agents, negatively or positively charged additional membranes, or genetically modified enzymes. These approaches allow one to decrease the effect of the buffer capacity influence on the sensor response in an aim to increase the sensitivity of the biosensors and to extend their dynamic ranges. Biosensors for the determination of concentrations of different toxic substances (organophosphorous pesticides, heavy metal ions, hypochlorite, glycoalkaloids, etc.) were designed on the basis of reversible and/or irreversible enzyme inhibition effect(s). The conception of an enzymatic multibiosensor for the determination of different toxic substances based on the enzyme inhibition effect is also described. We will discuss the respective advantages and disadvantages of biosensors based on the ENFETs developed and also demonstrate their practical application.
Directory of Open Access Journals (Sweden)
S A Lone
2017-01-01
Full Text Available This article presents a review pertains the laser irradiation effects and its possible mechanisms of action on spermatozoa functions in domestic animals. To improve artificial insemination, laser is sensitive and cost effective technique, when compared to other conventional methods. Laser may have both positive and negative effects on spermatozoa functions. Since the effects of light are mediated by reactive oxygen species, and the levels of these reactive oxygen species following irradiating spermatozoa with laser may be responsible for determining the effects of laser on sperm. Dose of laser may be regarded as of great significance and this dosage of laser may be responsible for determining its effects on spermatozoa. Optimum dosage of laser for improving seminal attributes may vary among various species and this need to be standardized in each of them. The beneficial effects include improving sperm livability, acrosomal integrity, hypo-osmotic swelling response, mitochondrial function and computer-aided sperm analysis parameters. The increase in cytochrome c oxidase activity, ATP levels and mitochondrial membrane potential, in laser irradiated cells may be responsible for enhanced sperm quality parameters. Improving fertility with laser irradiated spermatozoa has been reported in few species like boar and need to be elaborated in other species. In conclusion laser may be regarded as an easy, cheap and time saving technology for improving artificial insemination; in addition, laser may have various potential applications in the field of reproductive biotechnology as well as in livestock farms and veterinary polyclinics.
The availability of relatively cheap hand-held Global Positioning ...
African Journals Online (AJOL)
spamer
conditions, so the approach failed to produce results ... Hand-held Global Positioning System (GPS) receivers provide opportunities for detailed and rapid mapping of features ..... TICKELL, W. L. N. 1968 — The biology of the great albatrosses,.
Cheap arbitrary high order methods for single integrand SDEs
DEFF Research Database (Denmark)
Debrabant, Kristian; Kværnø, Anne
2017-01-01
For a particular class of Stratonovich SDE problems, here denoted as single integrand SDEs, we prove that by applying a deterministic Runge-Kutta method of order $p_d$ we obtain methods converging in the mean-square and weak sense with order $\\lfloor p_d/2\\rfloor$. The reason is that the B-series...
Is solar PV generated electricity cheap in South Africa?
CSIR Research Space (South Africa)
Roro, Kittessa T
2015-07-01
Full Text Available This presentation reflects on photovoltaic (PV) generated electricity in South Africa, and whether it is a cheaper alternative to current generated electricity in the country. It is projected that by 2019 the installed capacity of PV could...
Army Energy Strategy for the End of Cheap Oil
National Research Council Canada - National Science Library
Nygren, Kip P; Massie, Darrell D; Kern, Paul J
2006-01-01
... from other critical mission elements and programs. The National Commission on Energy Policy conducted a simulation of oil supply disruptions in June 2005 and concluded that oil cost is highly sensitive to supply, U.S., foreign...
Genuine Onion: Simple, Fast, Flexible, and Cheap Website Authentication
2015-05-21
pages, hometown sports teams, sites for local one-time events, small businesses , municipal election campaigns, etc. Though not such large targets as...audio, and interactive storytelling are still available for designers willing to use HTML5 and CSS3. What we have described so far implies a relatively