WorldWideScience

Sample records for che paradigma del

  1. Avatares del paradigma conexionista

    Directory of Open Access Journals (Sweden)

    Asier Arias

    2012-02-01

    Full Text Available Hace ahora un año que falleciera David Everett Rumelhart, conexionista pionero y editor junto con James Lloyd McClelland de la llamada “biblia del Procesamiento Distribuido en Paralelo” (PDP. Al mismo tiempo, los dos volúmenes de la referida biblia celebraban su vigésimo quinto cumpleaños. También uno de los padres de la inteligencia artificial, John McCarthy, que bautizara de hecho la disciplina, nos abandonó el pasado mes de octubre a los 84 años. Estas tres efemérides nos sirven de pretexto para un breve recorrido por las derivas y obstáculos a los que se ha enfrentado el llamado paradigma conexionista desde su puesta en escena como alternativa al cognitivismo clásico.

  2. La chiesa che si fa presepe: visita al Presepe della Chiesa del Rosario di Mottola

    OpenAIRE

    Susy Bigontina; Riccardo Tabilio

    2012-01-01

    Abstract – IT In occasione del Natale, la vie della città di Mottola (Ta, Italia) fioriscono di presepi, che i visitatori possono liberamente ammirare. Quella del presepe è una tradizione molto sentita dagli abitanti della cittadina pugliese, nella quale viene allestito un grande presepe che occupa e cela l’intera navata della Chiesa del Ss. Sacramento e Rosario. Gli allestitori, appartenenti ad una storica Confraternita locale dedicano settimane a costruire un presepe plastico della Be...

  3. El postpositivismo jurídico como culminación del paradigma positivista

    OpenAIRE

    López Paúl, Miguel

    2015-01-01

    Para dar cuenta del paso del estado legal al estado constitucional de derecho, fenómeno conocido como "neoconstitucionalismo", parece necesaria una nueva teorización del derecho: el paso del paradigma positivista, encarnado en su versión m

  4. PRINCIPIOS DEL PARADIGMA CUANTITATIVO EN LA INVESTIGACIÓN EDUCATIVA

    Directory of Open Access Journals (Sweden)

    Wálter Salazar Rojas

    2002-06-01

    Full Text Available Este artículo discute las bases históricas y filosóficas del paradigma cuantitativo en la investigación educativa. Se analiza el concepto numérico de la realidad en el marco de la filosofía griega tomando como referencia a Pitágoras y Platón. Posteriormente, se discute elconcepto de ciencia e investigación científica. Se define la variable, la taxonomía y los niveles de medición.Siguiendo los lineamientos de Campbell y Stanley se analizan los conceptos del diseño experimental, de validez interna y externa, las amenazas que diversos factores le plantean a las mismas, y cuáles son los elementos de control que el método científico y los diseños de investigación tienen para contrarrestar estas amenazas: aleatorización, pretest y grupo control. Finalmente se presenta uno de los avances más relevantes de la metodología cuantitativa como es el meta-análisis, técnica para resumir y analizar resultados de grupos de investigaciones. Se enumeran sus características y los pasos que hay que realizar para completar un meta-análisis.

  5. TRANSNACIONALIZACIÓN, SOSTENIBILIDAD Y EL NUEVO PARADIGMA DEL DERECHO EN EL SIGLO XXI

    Directory of Open Access Journals (Sweden)

    Paulo Márcio Cruz

    2011-11-01

    Full Text Available En función de la emergencia de nuevos escenarios globalizados y transnacionales y del agotamiento de las libertades, en cuanto paradigma del derecho de la Modernidad, el objetivo de este artículo es establecer algunos elementos científicos y teóricos sobre la necesidad de considerar el surgimiento de un nuevo paradigma para el derecho. El texto procura demostrar que en la era posmoderna, la sustentabilidad deberá consolidarse como el nuevo paradigma inductor del derecho, cohabitando con la libertad, más allá de su vocación para ser aplicado a escala planetaria. El derecho procesal es abordado de tal manera que sugiere la dialéctica de las diferentes fuerzas sociales, articulando una vía adjetiva armonizadora a los más diversos valores e intereses legítimos.

  6. El agotamiento del paradigma burocrático ante el riesgo ambiental contemporáneo

    OpenAIRE

    Miguel Moreno Plata

    2011-01-01

    El presente artículo explora los límites del modelo burocrático ante los peligros derivados de los problemas ambientales contemporáneos, cuya naturaleza vinculada con diversos rangos de incertidumbre es opuesta a la lógica y posibilidades del cálculo del paradigma weberiano. Ante este agotamiento paradigmático surge la necesidad de un nuevo modelo de gestión del riesgo, a partir de una nueva racionalidad sustentada en el principio precautorio y en la percepción social del riesgo.

  7. El paradigma positivista y la concepción dialéctica del conocimiento

    OpenAIRE

    Meza, Luis

    2003-01-01

    En este trabajo abordamos el estudio del paradigma positivista y sus principales planteamientos, y lo propio en relación con la concepción dialéctica del conocimiento. Además, presentamos un análisis comparativo y expresamos nuestra posición personal en relación con la propia acción académica que desarrollamos.

  8. Paradigmas del mercado financiero rural en países en desarrollo

    Directory of Open Access Journals (Sweden)

    Luis Alberto Fuentes Méndez

    2006-12-01

    Full Text Available Este artículo tiene como objetivos i analizar los paradigmas que explican el funcionamiento del mercado financiero rural en los países en desarrollo y ii evaluar los resultados de las políticas públicas asociadas a cada paradigma en el acceso a los servicios financieros de las familias rurales pobres. El paradigma de las Instituciones Especializadas de Crédito Agrícola señala que, ante las fallas del mercado de crédito en las que los prestamistas informales monopolizan el mercado con tasas de interés de usura y las organizaciones financieras formales no ofrecen suficientes recursos financieros para el desarrollo, el Estado debe intervenir para garantizar el acceso al crédito. Las políticas derivadas son creación de organizaciones públicas especializadas, subsidiar la tasa de interés activa y regular la banca pública y privada para que destine parte de su cartera de créditos al financiamiento agrícola. El paradigma de los Mercados Financieros propone que un mercado sin regulaciones se acerca al modelo de competencia perfecta y por lo tanto sugiere la no intervención del Estado en su funcionamiento para lograr la máxima eficiencia económica. Este paradigma incluye entre sus políticas liberar las tasas de interés, eliminar las carteras de crédito obligatorias y liquidar las organizaciones públicas de financiamiento. El paradigma de la Información Imperfecta señala que el funcionamiento eficiente y equitativo del mercado financiero se basa en el diseño de instituciones y organizaciones que evadan los problemas generados por la existencia de fallas de información (problemas de evaluación, de incentivos y de reembolso. En el marco de este paradigma las organizaciones de financiamiento rural deben diseñar y aplicar tecnologías que aprovechen las experiencias positivas del sector financiero informal y formal, para mejorar la forma en que se capta, procesa y transmite información entre prestatarios y prestamistas y as

  9. Il museo che non c’è. Note sulla dispersione del patrimonio in Gran Bretagna

    Directory of Open Access Journals (Sweden)

    Caroline Patey

    2011-04-01

    Full Text Available Indifferente alla loro recente moltiplicazione come al sodalizio che vi si celebra con l’architettura di grido, un fantasma si aggira per i musei. Sordo al nome di Jean Nouvel (Reina Sofia, Louvre quanto a quelli di Herzog & De Meuron (Tate Modern, impermeabile ai fasti del British Museum (Norman Foster come ai restauri della Tate Britain (James Stirling, disinteressato alle fortune del ‘nuovo’ Victoria and Albert Museum e malinconico come si addice alla sua natura, il fantasma invita a interrogare tanta luccicante spettacolarità e forse a non dimenticare che, per quanto custode di memoria e guardiano di culture, il museo è anche il luogo dove vengono consumate, direttamente o meno, amnesie e damnatio memoriae e in nome del quale continuano a perpetrarsi non poche violazioni e disseminazioni.

  10. Le variazioni d'inclinazione e la sismicità che hanno preceduto il forte terremoto del Friuli del 6 Maggio 1976

    Directory of Open Access Journals (Sweden)

    M. C. Spadea

    1976-06-01

    Full Text Available In questa prima parte del lavoro, che ci proponiamo
    di dedicare alla disastrosa crisi sismica che ha colpito il Friuli nel 1970,
    ci limitiamo a delineare le caratteristiche presismiche, che hanno preceduto
    la forte scossa del 0 Maggio 1970.
    Nelle premesse, vengono richiamati gli studi su fenomeni presismici,
    iniziati in Italia già negli anni Cinquanta.

  11. El mundo del trabajo: viejos y nuevos paradigmas

    Directory of Open Access Journals (Sweden)

    Miguel Suárez Bosa

    2013-11-01

    Full Text Available Con esta comunicación se pretenden dar una visión de las corrientes actuales del estudio histórico sobre los trabajadores. Metodológicamente, se parte de precisar cuál es el objeto de estudio. y de hacer una crítica de las tendencias que se han seguido. Luego, nos centramos en las aportaciones de dos de las ramas que más contribuyen al conocimiento del mundo del trabajo: el movimiento obrero y de las relaciones laborales. Una propuesta de agenda de investigación, fundamentada en la visión global de la historia, con un riguroso tratamiento de las fuentes, técnicas renovadas y una adecuada selección objetivos, completa el trabajo.The intention of this paper is to give a perspective of present movements in historic study about workmen. Methodologically, we start trying to precise which is the subject o f study of the area, and to criticise its tendencies up to now. Next we will study the contributions of the two branches which have most contributed to the study «f working world: the workers movement and labour relations. A proposal of investigation agenda based upon a global vision of history with a strict treatment of sources, renewed techniques and an accurate selection of the objectives that complete the papers.

  12. Gestión estratégica "Navegando hacia el cuarto paradigma". Revisión del libro

    Directory of Open Access Journals (Sweden)

    Rubén Mario Lurbé

    2013-03-01

    Full Text Available El trabajo consiste en una revisión del libro NAVEGANDO HACIA EL CUARTO PARADIGMA, CLIMA Y COMPROMISO ORGANIZACIONAL, 3° Edición, del autor, JOSÉ R. BETANCOURT T. y analizar las estrategias propuestas por el autor para logar organizaciones de “clase mundial” en America Latina.

  13. Gestión estratégica "Navegando hacia el cuarto paradigma". Revisión del libro

    OpenAIRE

    Rubén Mario Lurbé

    2013-01-01

    El trabajo consiste en una revisión del libro NAVEGANDO HACIA EL CUARTO PARADIGMA, CLIMA Y COMPROMISO ORGANIZACIONAL, 3° Edición, del autor, JOSÉ R. BETANCOURT T. y analizar las estrategias propuestas por el autor para logar organizaciones de “clase mundial” en America Latina.

  14. Orlan como paradigma de la estética del sacrificio

    OpenAIRE

    Benito Climent, José Ignacio

    2011-01-01

    Esta tesis doctoral tiene como punto de partida el estudio del contexto histórico-político de la performance y el surgimiento de movimientos sociales como el feminismo. El marco teórico de esta tesis se nutre de una perspectiva feminista de la diferencia, como la propuesta por Beatriz Preciado desde el postmodernismo francés en su Testo yonqui, así como las de Julia Kristeva o Judith Butler. La hipótesis que nos proponemos demostrar en esta investigación es que Orlan es un paradigma de la per...

  15. La curiosa quietud del paradigma: aprendizajes nómades en contextos de complejidad

    OpenAIRE

    Pozzoli, María Teresa

    2012-01-01

    El viaje ha tenido un papel fundamental en la azarosa supervivencia humana, sin embargo nuestro paradigma es rico en quietudes y pautas fijas. De pronto, los escenarios se trastocan, sobreviene la crisis y nada será como era entonces. Todos estamos en tránsito, de conocimientos, de aprendizajes, de identidades, todos estamos forzados a ser migrantes, aunque la cabeza y el corazón intenten apegarse a una concepción del mundo y de la vida que pertenece a otra época ya pasada. El tercer milenio ...

  16. El pensamiento social del Che en la educación patriótica del escolar primario

    OpenAIRE

    Glicedys Blanco-Matos; Wanda Domínguez-Rodríguez; Emma Medina-Carballosa

    2013-01-01

    Se presenta un conjunto de indicadores para evaluar la educación patriótica del escolar primario tomando como base el pensamiento social del Che como cubano. La efectividad de los in dicadores se comprobó con el uso de los diferentes métodos científicos, los cuales ofrecen evidencia a favor de la propuesta para contribuir a la educación patriótica en escolares de primero a tercero de la Educación Primaria.

  17. LA NECESIDAD DE UNIFICAR LA PSICOLOGIA: EL PARADIGMA DE LA SINTESIS EXPERIMENTAL DEL COMPORTAMIENTO

    Directory of Open Access Journals (Sweden)

    Rubén Ardila

    2003-07-01

    Full Text Available Se analizan los orígenes de la psicología en las preocupaciones iniciales del hombre acerca de su comportamiento y del de las demás personas. Tales problemas interesaron a pensadores tan disímiles como Aristóteles, Kant, Wundt, Freud, Watson, Piaget y Skinner. El paso de los problemas psicológicos de la metafísica a la ciencia representó una importante revolución conceptual. En psicología se ha enfatizado en los últimos cien años la objetividad científica y la experimentación. Una de las alternativas más importantes desde el punto de vista metodológico ha sido el operacionalismo, cuyos elementos positivos y negativos se analizan. Las ‘escuelas’ psicológicas —análogas a los paradigmas de Kuhn— han representado diferentes marcos conceptuales sobre la naturaleza de la psicología. Hoy no hay escuelas sino sistemas, más reducidos y menos dogmáticos. Se considera que la síntesis experimental del comportamiento, cuyas características se presentan, puede llegar a ser un paradigma unificador para toda la psicología.

  18. La chiesa che si fa presepe: visita al Presepe della Chiesa del Rosario di Mottola

    Directory of Open Access Journals (Sweden)

    Susy Bigontina

    2012-01-01

    Full Text Available Abstract – IT In occasione del Natale, la vie della città di Mottola (Ta, Italia fioriscono di presepi, che i visitatori possono liberamente ammirare. Quella del presepe è una tradizione molto sentita dagli abitanti della cittadina pugliese, nella quale viene allestito un grande presepe che occupa e cela l’intera navata della Chiesa del Ss. Sacramento e Rosario. Gli allestitori, appartenenti ad una storica Confraternita locale dedicano settimane a costruire un presepe plastico della Betlemme nella notte di Natale, che mescola icone della tradizione italiana della Natività – alcuni pezzi, ad esempio, sono preziosi manufatti di scuola napoletana – ed elementi naturali tipici della terra delle gravine. Il presepe del Rosario, inoltre, mostra un’interessante ricerca dell’effetto prospettico e forse un ancor più interessante cornice di ciclicità, ottenuta tramite l’alternanza del giorno e della notte, musica ed effetti sonori, che proietta la scena verso un orizzonte atemporale. Questo articolo nasce dalla visita degli autori a Mottola, in occasione della presentazione del libro La Settimana Santa a Mottola, di cui essi sono stati co-autori, e quindi rappresenta il frutto di un nuovo capitolo di lavoro con la viva comunità mottolese ed i suoi riti. Abstract – FR Pour l'occasion de Noël, les rues de la villes de Mottola (Ta, Italie sont embellies de crèches que les visiteurs peuvent admirer en toute liberté. La tradition de la crèche est une tradition très ressentie par les habitants de la petite ville pugliaise, dans laquelle on prépare une grande crèche qui occupe et cache tout le nef de l'église du très Ss. Sacramento e Rosario. Les préparateurs qui appartiennent à une Confrérie historique locale dédient plusieurs semaines pour la construction d'une crèche comme celle de Betleemme de la nuit de Noël - certaines pièces, par exemple, sont de précieux produits manufacturés provenant de l'école napolitaine - et

  19. El museo ante un cambio de paradigma. Del tipo al logotipo

    OpenAIRE

    Baldellou Plaza, Angela

    2014-01-01

    En esta Tesis expongo una reflexión sobre cómo la pérdida de valores ante un cambio de paradigma social ha derivado en la disolución de la tipología de Museo generando un “Museo Contemporáneo” , mediante el estudio sistemático de la obra de los autores más significativos del siglo XX, que, frente al Museo Moderno, es un museo global, que no pertenece a ningún lugar concreto, un museo del desarraigo, desligado incluso de su función. Su origen conceptual basado en una idea “social” participativ...

  20. Fiebre postoperatoria en pacientes del Cardiocentro Ernesto Che Guevara / Postoperative fever in patients of the Cardiocentro Ernesto Che Guevara

    OpenAIRE

    Alina Ceballos Álvarez

    2015-01-01

    Introducción: La fiebre es una de las dificultades que se presentan en el período pos-quirúrgico. Objetivo: Caracterizar la incidencia de fiebre en el postoperatorio de cirugía cardio-vascular. Método: Estudio observacional descriptivo, longitudinal, prospectivo, en 31 pacientes con fiebre en el postoperatorio. Resultados: Un 15,6 % del total de pacientes operados de cirugía cardiovascular (31 casos) presentó fiebre en el postoperatorio y en 20 de ellos la causa fue séptica. Apareció más frec...

  1. El paradigma del neuromarketing a la luz de su producción científica

    OpenAIRE

    Juan Victoria; José Arjona; Rafael Repiso

    2015-01-01

    La comunidad científica internacional ha encontrado en la neurociencia aplicada a las ciencias del comportamiento una relativa y reciente inquietud teóricamente multidisciplinar. De entre todas las propuestas, destaca la del neuromarketing como la más paradigmática, al tiempo que es referenciada especialmente en el ámbito profesional divulgativo. Es por ello, que el objetivo del presente artículo consiste en estudiar la producción científica de impacto relacionada con el paradigma del Neuroma...

  2. Fiebre postoperatoria en pacientes del Cardiocentro Ernesto Che Guevara / Postoperative fever in patients of the Cardiocentro Ernesto Che Guevara

    Directory of Open Access Journals (Sweden)

    Alina Ceballos Álvarez

    2015-08-01

    Full Text Available Introducción: La fiebre es una de las dificultades que se presentan en el período pos-quirúrgico. Objetivo: Caracterizar la incidencia de fiebre en el postoperatorio de cirugía cardio-vascular. Método: Estudio observacional descriptivo, longitudinal, prospectivo, en 31 pacientes con fiebre en el postoperatorio. Resultados: Un 15,6 % del total de pacientes operados de cirugía cardiovascular (31 casos presentó fiebre en el postoperatorio y en 20 de ellos la causa fue séptica. Apareció más frecuentemente en el sexo masculino (74,2 %, tras cirugía de dos vál-vulas o de revascularización miocárdica (67,7 %, y en el grupo etario de 30-49 años (48,9 %. Fueron más encontrados los derrames pleurales (29,0 % y pericárdicos (19,4 %, y las lesiones inflamatorias pulmonares (25,8 %; la mayoría de los enfermos tenían colocados 2 catéteres venosos centrales (77,4 % y llevaban más de tres días con sonda vesical (51,6 % o línea arterial (48,4 %; al 87,1 % de los pacientes se le administró metamizol, al 58,1 % antimicrobianos y al 25,8 % se le tomó muestra para hemocultivo. Los gérmenes más encontrados fueron la pseudomona y el acinetobác-ter y predominó la evolución satisfactoria (solo 1 paciente fallecido. Conclusiones: La frecuencia de aparición de la fiebre en el postoperatorio de cirugía cardiovascular no fue elevada y predominó en hombres, entre 30 y 49 años de edad, con cirugía compleja. Fueron más encontrados los derrames pericárdico y pleural, así como la utilización de varios procedimientos invasivos. El hemocultivo fue útil para determinar la causa de la fiebre y el germen. La mayoría de los pacientes evolucionó satisfactoriamente.

  3. Modificaciones del paradigma de gramáticas artificiales para niños

    Directory of Open Access Journals (Sweden)

    María Fernanda López-Ramón

    2008-01-01

    Full Text Available El objetivo del presente artículo es describir y analizar las modificaciones al paradigma de Gramáticas artificiales de Reber, que permiten su aplicación en niños a partir de la inclusión de juegos interactivos en soporte informático en dos formatos de presentación: alfabético y figurativo. Se trabajó con una muestra de 50 niños, divididos en dos grupos (tercero y quinto año de enseñanza general básica de una escuela estatal de Mar del Plata, Argentina. Las puntuaciones obtenidas en ambas pruebas de aprendizaje implícito mostraron ser significativas con respecto a lo esperado por azar. Las diferencias de las medias (para muestras relacionadas de los resultados de ambas pruebas no fueron significativas. Las modificaciones sugeridas implican un aporte para evaluar el Aprendizaje Implícito en niños con elementos estimulares y procedimentales basados en la retroalimentación que facilitan la adecuación de los niños a la lógica interna de las pruebas

  4. En busca de un paradigma económico para la redefinición del concepto de desarrollo sostenible

    OpenAIRE

    Pérez Adán, José

    1997-01-01

    Not available.Este trabajo pretende dar una visión sintética y descriptiva del síndrome de pérdida que sufre la ciencia económica en su intento de incorporar los interrogantes medioambientales a los mecanismos de predicción socioeconómicos. El repaso de las propuestas del neoliberalismo, del así llamado capitalismo verde, y de la economía ecológica, tiene como objetivo presentar la viabilidad científica de los paradigmas alternativos como modelos de racionalidad económica y como sucedáneos de...

  5. I terremoti del maggio 2012 e la pericolosità sismica dell’area: che cosa è stato sottostimato?

    OpenAIRE

    Stucchi, M.; Istituto Nazionale di Geofisica e Vulcanologia, Sezione Milano-Pavia, Milano, Italia; Meletti, C.; Istituto Nazionale di Geofisica e Vulcanologia, Sezione Milano-Pavia, Milano, Italia; Bazzurro, P.; IUSS Pavia; Camassi, R.; Istituto Nazionale di Geofisica e Vulcanologia, Sezione Bologna, Bologna, Italia; Crowley, H.; Fondazione GEM; Pagani, M.; Fondazione GEM; Pinho, R.; Fondazione GEM; Calvi, G. M.; IUSS Pavia

    2012-01-01

    Analogamente al caso del terremoto di L’Aquila 2009, immediatamente dopo il terremoto dello scorso maggio 2012 in Emilia, stampa, funzionari pubblici e ricercatori dichiararono che la pericolosità sismica della zona danneggiata, e probabilmente anche il rischio sismico, sono stati sottostimati dalla valutazione probabilistica della pericolosità sismica (PSHA) di riferimento per il territorio Italiano e, di conseguenza, dalle norme tecniche basate su quella valutazione. Una delle principali pr...

  6. NUEVO PARADIGMA EN LA GESTIÓN ORGANIZACIONAL: GESTIÓN DEL CONOCIMIENTO

    Directory of Open Access Journals (Sweden)

    William Boet Cisneros

    2003-09-01

    Full Text Available

    En este trabajo se presentan los resultados de una investigación exhaustiva, que tuvo la finalidad de proponer indicadores que permitieran medir el capital intangible de la organización. La motivación principal a la hora de emprender este trabajo estuvo condicionada por la ausencia de una metodología, con valores científicos apropiados para la selección de los indicadores del capital intangible (conocimientos en el Centro Universitario de Guantánamo. Para que el conocimiento se convierta en fuente de ventajas competitivas no basta con que exista, es necesario que se pueda capturar, crear, distribuir, almacenar, compartir y utilizar por los miembros de la organización, y es precisamente a través de la gestión del conocimiento, que se logran estos propósitos, de ahí la actualidad de este trabajo. El objeto de la investigación es dar respuesta a la hipótesis siguiente: Si se aprovechan las capacidades intelectuales de la organización, de forma que desarrolle su capacidad de aprendizaje, que potencie la innovación constante y la creación de nuevos conocimientos y que desarrolle los sistemas y la tecnología necesaria para ello, el Centro Universitario de Guantánamo estará en condiciones de afrontar los retos futuros, y asumir el nuevo paradigma, convertir el capital intelectual en capital financiero

    .

  7. Las casualidades controladas : la primera visibilidad del cambio del paradigma moderno

    OpenAIRE

    Jiménez Ferrera, Daniel N.

    2015-01-01

    Como no pocos proyectos, el origen de esta tesis es fruto de una casualidad. Hace unos años me topé en Londres, en la librería Walden Books del 38 de Harmood St., con una primera edición de la conocida monografía de Mies a cargo de Philip Johnson. El librito, en realidad catálogo de la exposición que en 1947 el MoMA de Nueva York dedicara a la obra de Mies Van der Rohe a los diez años del desembarco del arquitecto en Estados Unidos, tiene un tamaño de 10 x 7,5 pulgadas, es decir, la mitad del...

  8. Comprensión de la deprivación afectiva a partir del paradigma fenomenológico - existencial

    OpenAIRE

    Ricardo Arturo Jaramillo Moreno; Mercedes Claudia García Escallon

    2007-01-01

    El maltrato infantil y específicamente la deprivación afectiva es una práctica validada y trasmitida al interior de distintos núcleos sociales, la familia, la escuela y el estado, lo anterior aumenta la necesidad de tomar medidas que permitan actualizar y ampliar los actuales paradigmas que le explican y comprenden. En el presente artículo se propone la comprensión de la deprivación afectiva como una forma de maltrato infantil que va en deterioro del desarrollo, potencializacio...

  9. El imaginario social como paradigma del conocimiento sociológico

    OpenAIRE

    Arribas González, Luis

    2006-01-01

    Esta comunicación analiza como el conocimiento sociológico organiza los elementos que le conforman, jeraraquizándolos para interpretar la realidad social. Considera como la teoría de Kuhn de la revolución científica puede ser aplicada a la transformación de los paradigmas dominantes en el conocimiento social, y finalmente propone al imaginario social, analizando sus características, como paradigma emergente de esta área de conocimiento.

  10. Determinantes del salario en Chile. Un análisis desde el paradigma de la reproducción social

    Directory of Open Access Journals (Sweden)

    Rodrigo, Luis Miguel

    2015-12-01

    Full Text Available We use the sociological paradigm of Social Reproduction, proposed by the work of Pierre Bourdieu, to explain the wage gap in Chile, in opposition to the Neoclassical economic paradigm, currently hegemonic in the analysis of wage differentials. We expose and compare both theoretical paradigms and describe the case study highlighting the peculiarities of the Chilean neoliberal model. We estimate the salary of the Chilean population in order to explain the explanatory capacity of both theoretical approaches. We estimate two statistical models using the National Socioeconomic Characterization survey (CASEN 2009, firstly, the Neoclassical model based on Mincer equations and, secondly, a model that tries to empirically capture the explanatory factors specific to the paradigm of Social Reproduction. The results indicate that, in the case of Chile, the Reproductive model has greater explanatory power than the Neoclassical model, both for the whole group of workers, and for each of the generations of this group.Frente al paradigma económico neoclásico, hegemónico en la explicación del salario, se presenta el paradigma sociológico de la Reproducción Social, a partir de la obra de Pierre Bourdieu, para dar cuenta de la diferencia salarial en Chile. Después de exponer y comparar ambos paradigmas teóricos, se describe el caso de estudio, destacando las peculiaridades del modelo neoliberal chileno. Para comparar la capacidad explicativa de ambos enfoques, se estima el salario de los chilenos mediante la encuesta de Caracterización Socioeconómica Nacional 2009 (CASEN a partir de dos modelos estadísticos, el modelo neoclásico basado en las ecuaciones de Mincer y un modelo que trata de capturar empíricamente los factores explicativos propios del paradigma de la Reproducción Social. Los resultados indican que, en el caso de Chile, el modelo Reproductivo tiene mayor capacidad explicativa que el Neoclásico, tanto para el conjunto de los asalariados

  11. Supuestos y filiaciones filosóficas de los paradigmas astronómicos en el virreinato del Perú

    Directory of Open Access Journals (Sweden)

    Roberto Katayama Omura

    2014-03-01

    Full Text Available En el presente artículo se estudian los supuestos y filiaciones filosófico-naturales de los paradigmas astronómicos vigentes en el virreinato delPerú. Se busca demostrar que hasta el siglo XVIII fue dominante el paradigma clásico o geocéntrico en la versión moderna de Tycho Brahe y quetambién estuvo presente el paradigma clásico en su versión tradicionalo ptolemaica aunque con menos fuerza. Finalmente, se propone quedesde mediados del siglo XVIII se introduce en el virreinato peruano elparadigma moderno kepleriano-newtoniano el cual se impondrá a finesdel mismo siglo.

  12. El devenir de la modernidad: crisis del paradigma y acercamiento a una nueva epistemología social

    Directory of Open Access Journals (Sweden)

    Fernando Garrido Ferradanes

    2003-10-01

    Full Text Available En la primera parte del artículo desarrollaremos la tesis de la muerte de la modernidad por obra y gracia de su éxito absoluto. Por otra parte, creemos necesario, así mismo, realizar un análisis de la sociedad en la que nos vemos inmersos, la sociedad de la información, que realizaremos en la segunda parte del artículo. Nuestro argumento es que la globalización es una consecuencia de la modernidad, es más: supone el culmen, el éxito, el triunfo del proyecto modernizador. La modernidad se irradia desde Occidente y debido a su lógica interna es eminentemente expansionista. Ahora bien, cuando esa expansión es total la modernidad estalla, muere victima de su propio éxito. Todo esto se ve agudizado por un cambio de Paradigma, del Paradigma Industrial al Informacional, lo que nos legitima para hablar de la entrada en la Sociedad de la Información, donde la información es el motor de la engranaje, donde el conocimiento se refracta continuamente y se emplea en la re-generación de si mismo. En esta sociedad surge un nuevo actor social: La empresa-red, cuyo crecimiento, expansión y generalización implica el socavamiento de los Estado-nación, principales actores de la modernidad. En el presente artículo explicaremos y analizaremos el argumento anteriormente citado, y encontraremos que las consecuencias de la modernidad se han convertido en las características de la globalización: riesgo, información y reflexividad. A la luz de los teóricos actuales más relevantes intentaremos analizar este proceso de cambio social radical.

  13. La logica del m@gm@ tra creatività e marginalità: il paradigma dell'accesso libero e le pubblicazioni elettroniche

    Directory of Open Access Journals (Sweden)

    Orazio Maria Valastro

    2004-06-01

    Full Text Available Le comunità virtuali sono in grado di promuovere nuovi processi d'appropriazione sociale e professionale di strumenti editoriali ancora esclusivi, contribuendo inoltre a valorizzare molteplici identità e sensibilità, personali e professionali, attraverso realtà editoriali che si presentano come strumenti di collaborazione, di comunicazione e approfondimento. Si tratta di strumenti editoriali in grado di affermare uno spirito critico che si esprime attraverso una manifestazione articolata di realtà e sensibilità differenti che convivono e lavorano in rete, sviluppando e preservando uno spazio di comunicazione e di riconoscimento del molteplice e variegato orientamento di prospettive, mettendo alla prova nuove capacita che ci permettono di considerare una trasversalità tra approcci come risorsa, distante da logiche d'opposizione e irriducibilità e consecutiva ad una manifestazione articolata di realtà e sensibilità differenti.

  14. Automatización del control del cálculo de extracciones en la mina de la empresa niquelera Ernesto Che Guevara

    Directory of Open Access Journals (Sweden)

    Arístides A. Legrá-Lobaina

    2010-03-01

    Full Text Available En el artículo se muestran los elementos fundamentales de un algoritmo cuyo objetivo es establecer el contenido y el orden de los procedimientos necesarios para realizar el control del cálculo de extracciones en la mina de la empresa Ernesto Che Guevara que explota, a cielo abierto, yacimientos lateríticos ferroniquelíferos en la región de Moa, Cuba. Asimismo se presenta el diseño de los diálogos informáticos que han automatizado el algoritmo en la aplicación informática Tierra.

  15. MIOOP. Modificación del estándar IEC-61131 para dar soporte al paradigma de programación orientado a objetos. Aplicación al desarrollo del control de procesos industriales

    OpenAIRE

    Sierra Díaz, Ángel Luis

    2012-01-01

    La orientacion a objetos facilita el desarrollo del software a gan escala y de calidad. A pesar del extendido uso de este paradigma en la Ingenieria del Software, su uso en la Ingenieria de Automatizacion de Procesos se encuentra con numerosas dificultades debido, entre otros motivos, al caracter fuertemente conservador del ambito industrial y a la falta de estandirazacion,tanto a nivel de hardware como de software, de los automatas programables. Solo la presion de poderosos clientes de p...

  16. Análisis del Comportamiento de Robots Móviles con RNA. Un Acercamiento desde el Paradigma Reactivo

    Directory of Open Access Journals (Sweden)

    Alejandro Hossian

    2013-02-01

    Full Text Available Por medio de la navegación es posible guiar el curso de un robot móvil a través de un entorno con presencia de obstáculos. Se conocen diferentes esquemas para llevar a cabo esta tarea, pero todos ellos tienen el objetivo común de dirigir el vehículo hacia su destino de la manera más segura y eficiente posible. La capacidad de reacción que pueda poseer el robot cuando se encuentra ante situaciones inesperadas, debe constituir su cualidad más distintiva para desenvolverse eficazmente en el entorno donde este deba operar, lo cual indica el grado de autonomía que este posee. La navegación robótica es aplicable a múltiples disciplinas y entornos industriales; y en este sentido, la aplicación de la Inteligencia Artificial a través de las diferentes tecnologías inteligentes que la componen (redes neuronales, algoritmos genéticos y aprendizaje automático entre otras cobra un gran protagonismo dentro del campo de la Robótica Cognitiva para su desarrollo. El objetivo principal del presente trabajo se focaliza en el análisis y presentación de resultados de investigación en técnicas de navegación robótica, que se han obtenidos en base a experimentos llevados a cabo mediante la aplicación de la tecnología de las redes neuronales artificiales, las cuales concentran las mejores características del paradigma reactivo en lo que se refiere a la navegación autónoma de robots. En el presente artículo se evalúa la efectividad y el desempeño de este paradigma mediante la aplicación de una red neuronal de arquitectura sencilla, obteniendo conclusiones en lo que respecta a la conducta deseada del robot y comparándola con la que manifiesta en su desempeño. Los parámetros que se analizan para esta evaluación están relacionados con la evitación de obstáculos, velocidad de respuesta, optimización de las trayectorias que adopta y el logro de los objetivos.

  17. El paradigma del neuromarketing a la luz de su producción científica

    Directory of Open Access Journals (Sweden)

    Juan Victoria

    2015-08-01

    Full Text Available La comunidad científica internacional ha encontrado en la neurociencia aplicada a las ciencias del comportamiento una relativa y reciente inquietud teóricamente multidisciplinar. De entre todas las propuestas, destaca la del neuromarketing como la más paradigmática, al tiempo que es referenciada especialmente en el ámbito profesional divulgativo. Es por ello, que el objetivo del presente artículo consiste en estudiar la producción científica de impacto relacionada con el paradigma del Neuromarketing. Se analiza su desarrollo, desde el prisma de la bibliometría de la producción científica registrada en la base de datos Scopus, específicamente relacionada con el neuromarketing. La hipótesis general, plantea que este surge a partir de dos disciplinas inconexas, lo que conlleva a una alta dispersión en su producción científica y es un hándicap de auténtica multidisciplinariedad. Asimismo, se realiza un análisis reticular de co-palabras con Vosviewer. En particular, se afirma que la relación con la comunicación -considerada esta como disciplina científica- es inexistente, denunciando una inflación terminológica precisamente allí donde hay déficit de investigación. Otras conclusiones del estudio hacen referencia con el creciente -ya importante en 2013- número de artículos publicados acerca de neuromarketing en los últimos años, concentrándose la mayor parte de la producción en áreas aplicadas, como son la Economía, la Empresa y las Ciencias Sociales.

  18. Che Guevara

    DEFF Research Database (Denmark)

    Cristoffanini, Pablo Rolando

    2014-01-01

    made Che Guevara a political, religious and cultural icon and an object of consumption, despite his total political and military failure in Bolivia and his violent death. Finally the article contrasts the meanings of his image in the original context with new research that calls into question the......Ernesto "Che" Guevara is without doubt the Latin American icon which is most spread globally and has the highest density of meanings. This article interprets and explains the context of the different meanings of his image. Originally his iconic image was inextricably associated with the...... achievements and connotations of the Cuban Revolution in the context of the Cold War. The current meanings of the image must be read in the context of the global consumer culture. The article analyzes and explains how a conjunction of factors such as communication strategies and the connotations of his image...

  19. FUNCIÓN DE PRODUCCIÓN, PRODUCCIÓN CONJUNTA Y SALARIOS (REVISIÓN CRÍTICA DEL PARADIGMA DE LA PRODUCTIVIDAD MARGINAL)

    OpenAIRE

    Antonio Mora Plaza

    2009-01-01

    En este trabajo se traslada a la producción conjunta el paradigma del pago de los salarios de acuerdo con la productividad marginal surgido como consecuencia del criterio de la maximización de beneficios. Se ve las consecuencias en la optimización de recursos que surgen al no admitir que cada empresa produzca un único bien o servicio, sino bajo el supuesto de que cada empresa trabaja con tantas funciones de producción como bienes y/o servicios finales, pero dependientes de la totalidad del tr...

  20. De la actualización del paradigma autobiográfico en la literatura cubana

    Directory of Open Access Journals (Sweden)

    Reinier Pérez-Hernández

    2016-03-01

    Full Text Available Además de abordar la construcción de la figura del héroe narrativo en autobiografías y memorias cubanas de reciente publicación, este ensayo refiere cómo el testimonio marcó desde fuera la autobiografía cubana en los años setenta y ochenta y cómo las memorias y las autobiografías han vuelto a ocupar un espacio destacado, libre del “testimonio”, en las letras cubanas. Entre las obras tratadas, figuran la del pintor Raúl Martínez, la de la ensayista Graziella Pogolotti y la del músico Paquito D’Rivera, entre otras publicadas a finales del siglo XX y principios del XXI.

  1. YouTube como paradigma del vídeo y la televisión en la web 2.0

    OpenAIRE

    Antolín Prieto, Rebeca

    2012-01-01

    La investigación tiene como objetivo general dar una visión del fenómeno YouTube desde sus comienzos hasta la actualidad –cuando recibe 2.000 millones de visitas diarias–buscando las claves de su éxito (en el entorno social, tecnológico, cultural, mediático, político, legal) para entender por qué debe considerarse YouTube como el paradigma del vídeo y de la televisión en la web 2.0.

  2. El paradigma sociocognitivo como base del cambio en la cultura pedagógica: análisis de una experiencia de intervención regional

    OpenAIRE

    Vargas Aguilar, José Antonio

    2009-01-01

    En la presente investigación, el objeto de estudio corresponde al área de la educación. De manera específica, trata acerca de la transformación del paradigma educativo empleado en la práctica docente por uno nuevo, que responde a los requerimientos actuales; conservando, desde luego, la visión educativa del lasallismo. La parte central de este trabajo, consistió en analizar la pertinencia de las acciones pedagógicas que están vinculadas al desarrollo de competencias: capacidades-habilidade...

  3. TRIBUNALES PENALES INTERNACIONALES AD HOC DEL POST-GUERRA FRÍA: CAMBIANDO PARADIGMAS EN EL TRATAMIENTO DE CUESTIONES DE GÉNERO

    OpenAIRE

    Camila Soares Lippi

    2011-01-01

    Analizaremos como la jurisprudencia de los Tribunales Penales Internacionales ad hoc del post-Guerra Fría representa un cambio de paradigmas en cuestiones de género en el Derecho Penal Internacional y en el Derecho Internacional Humanitario. Para eso, partimos del concepto de género, o sea, las construcciones sociales cuanto a los roles masculino y femenino, como categoría central de análisis. Analizamos, primeramente, el post-Segunda Guerra Mundial. Ese momento histórico, ejemplificado por l...

  4. Drogas y Acción Colectiva: nuevas identidades e institucionalización del discurso hacia el cambio de paradigma frente al consumo de drogas en Colombia

    OpenAIRE

    Oscar Alexander, Salgar Lozano

    2015-01-01

    Tras los fracasos de la política antidroga nacen nuevas miradas que proponen alternativas al paradigma de la prohibición del consumo. En Colombia la sociedad civil organizada ha generado repertorios de lucha en torno a los derechos de los usuarios de drogas, principalmente de cannabis, por medio de la movilización social y procesos sociales de construcción de identidad desde la base de la sociedad. Así mismo otros sectores inspirados en la reducción del daño como enfoque en sal...

  5. Fonologia e acquisizione. In che modo l'esperienza della lingua materna plasma la percezione dei suoni del linguaggio?

    OpenAIRE

    Avesani, Cinzia; Vayra, Mario; Best, Catherine; Bohn, O-S

    2008-01-01

    Scopo di questo lavoro ? valutare l'influenza che la fonologia della lingua materna esercita sulla percezione di opposizioni fonologiche non-native da parte di ascoltatori adulti monolingui. La nostra prospettiva teorica si centra sul Perceptual Assimilation Model (PAM), un modello della percezione linguistica non-nativa sviluppato da C. Best (cfr., ad esempio, Best, 1993; 1994a; 1994b; 1995; 1996; 2007). Il modello si basa sull'osservazione empirica che i contrasti fonetici non-nativi non po...

  6. Nuevo “rol” y paradigmas del Aprendizaje, en una Sociedad Global en RED y Compleja: la Era del Conocimiento y el Aprendizaje

    Directory of Open Access Journals (Sweden)

    Rubio Royo, Enrique

    2009-09-01

    la Gestión de la Complejidad, que nos proporciona una adecuada aproximación sistémica, a muchos y diferentes problemas. En nuestro caso, desde el ámbito académico y en el proceso de adaptación al Espacio Europeo de Enseñanza Superior (EEES, se requerirá desarrollar una nueva visión, y estrategia explícita de Gestión del Conocimiento (KM, como adecuación al nuevo entorno y a la incipiente economía del conocimiento asociada. Partiendo de la convergencia emergente de los ámbitos profesional y académico, se observa no sólo la semejanza de los paradigmas tradicionales de la KM y de la LM, sino también la incapacidad de los mismos para asumir los nuevos requerimientos asociados al nuevo entorno en RED. Una nueva reconceptualización del Conocimiento y el Aprendizaje como procesos basados en conexiones (“networking”, nos proporcionará el nuevo “rol” y paradigmas del Aprendizaje: Modelo Adaptativo de Aprendizaje en Entornos Complejos. Como estrategia de adecuación personal al nuevo entorno, y en particular al EEES, se propone un “Proceso de desarrollo de la Identidad Digital” y del “Aprendizaje en RED”, junto con el diseño del correspondiente “Espacio Personal, y Corporativo, de Trabajo y Aprendizaje” (PLWE/CLWE. Presentación del “PLWE-Suricata”*, basado en iniciativas abiertas.

  7. La pulsión de muerte: apuntes para una inversión semántica del paradigma inmunitario desde el psicoanálisis

    Directory of Open Access Journals (Sweden)

    José Cabrera Sánchez

    2013-12-01

    Full Text Available Dada su privilegiada participación en el dispositivo de sexualidad, el psicoanálisis sería parte de una profusa red de tecnologías disciplinarias y normalizadoras comprometidas con el despliegue despolitizante de la biopolítica. Propondremos una interpretación del polémico concepto freudiano de pulsión de muerte desde la perspectiva del paradigma inmunitario desarrollado por Roberto Esposito. La pulsión de muerte participaría del carácter aporístico de lo inmunitario, ya que permite una apertura a la productividad de lo negativo y a la inclusión de la alteridad en el tejido del sí mismo.

  8. Hacia una nueva clasificación de los modelos pedagógicos: el pensamiento configuracional como paradigma científico y educativo del siglo xxi

    Directory of Open Access Journals (Sweden)

    Alexander Ortiz Ocaña

    2013-10-01

    Full Text Available En este trabajo, resultado del proyecto MODEPED: Identificación, caracterización y elaboración del modelo pedagógico de las instituciones educativas públicas del Caribe Colombiano, se hace una nueva clasificación de los modelos pedagógicos en cuatro grande grupos: la pedagogía tradicional (Ignacio Loyola; la escuela nueva (Jhon Dewey, Decroly, Cousinet; la tecnología educativa (B. F. Skinner y la escuela del desarrollo integral (E. Pichón Riviere, P. Freyre, L. S. Vigotsky, A. N. Leontiev, S. L. Rubinstein, A. R. Luria, V. Davidov, I. A. Galperin, L. Zankov, N. Talízina, C. Rogers, Hamachek, A. Maslow, J. Bruner, D. Ausubel, R. Sternberg, J. Piaget, R. Feuerstein, J. de Zubiría, M. de Zubiría. Finalmente, se propone una alternativa emergente, tanto para la investigación científica como para la educación. Se propone el paradigma científico neuroconfiguracional para hacer ciencia humana y social, y un nuevo paradigma educativo para el siglo XXI: el Pensamiento Configuracional (Alexander Ortiz. En este sentido, se define la noción de pensamiento configuracional y se proponen sus bases, sus dimensiones, particularidades, indicadores, estadios, proceso y requerimientos.    

  9. Los humedales y el ordenamiento territorial en el marco del nuevo paradigma de desarrollo sostenible

    Directory of Open Access Journals (Sweden)

    Marco Vinicio Peñaranda Sánchez

    2013-05-01

    Full Text Available Tres partes sobresalen en el presente artículo, a saber: la primera parte es una discusión sobre el concepto de espacioterritorio y su génesis a través del tiempo y de los cambios epistemológicos de la ciencia, que ha hecho de tal concepto su objeto de estudio; una segunda parte trata sobre la relación del proceso de ordenamiento territorial con respecto al desarrollo sostenible de los humedales, con un componente sobre la necesidad de mantener sanos estos ecosistemas y de las posibles leyes que se discuten para regular el ordenamiento territorial a escala nacional y de cómo repercute dicha legislación en estos hábitats; la última parte trata de una propuesta metodológica para el proceso de ordenamiento territorial que hace el autor, a partir de diversas experiencias tanto de científicos, en particular, como de países, en general.

  10. Acerca de los "paradigmas contables"

    Directory of Open Access Journals (Sweden)

    Gerardo Santos

    1997-06-01

    Full Text Available La contabilidad a través de su historia ha construido conocimiento a partir de reflexiones sobre conceptos teóricos y prácticos que se consolidaron como paradigmas, según la clasificación de Ahmed Belkaoui, debido a sus características, intereses, métodos y otra serie de elementos propios de esta forma de aproximación a la ciencia. En este escrito se hace un breve estudio y clasificación de dos paradigmas existentes en contabilidad, el de la ganancia líquida, dividido en los enfoques: a antropológico inductivo y b deductivo de la ganancia líquida y realizada, y el paradigma de la utilidad de la información para la toma de decisiones dividido en: a enfoque de los modelos de decisión y la capacidad predictiva, b enfoque del comportamiento agregado del mercado, c enfoque del inversor individual y, d enfoque del valor económico de la información; al igual que una reseña, en términos de Vicente Pina Martínez, de los "paradigmas emergentes". Finalmente se formulan algunas inquietudes acerca del carácter paradigmático de las nuevas investigaciones y los nuevos campos de aplicación de la contabilidad.

  11. Septentrionalidad y medievalidad en el paradigma arteaguiano de lo maravilloso. Una lectura de las riflessioni de Esteban de Arteaga en Le Rivoluzioni del Teatro Musicale Italiano

    OpenAIRE

    García Montalbán, Antonio

    2014-01-01

    “Septentrionalidad y medievalidad en el paradigma arteaguiano de lo maravilloso. Una lectura de las “riflessioni” de Esteban de Arteaga en Le Rivoluzioni del Teatro Musicale Italiano”, es un estudio de carácter multidisciplinar sobre un texto en muchos aspectos singular y hasta ahora prácticamente no abordado. Las riflessioni son una indagación sobre los fundamentos antropológicos de un determinado constructo de lo maravilloso. Uno de los primeros intentos por analizar y comprender esa fe...

  12. Cambio de paradigmas en la educacón media en México. Experiencias del Colegio de Ciencias y Humanidades de la UNAM.

    OpenAIRE

    Jiménez Moreno, Carlos Agustín

    2015-01-01

    La presente investigación se centra en la evolución histórica de la educación media en México, en especial en el origen y significado que ha tenido el Colegio de Ciencias y Humanidades de la Universidad Nacional Autónoma de México (UNAM) como alternativa de cambio. El objetivo general establecido en la investigación es identificar los desafíos que han enfrentado las instituciones educativas mexicanas de nivel medio en el contexto del cambio de paradigmas de los sistemas educ...

  13. TRIBUNALES PENALES INTERNACIONALES AD HOC DEL POST-GUERRA FRÍA: CAMBIANDO PARADIGMAS EN EL TRATAMIENTO DE CUESTIONES DE GÉNERO

    Directory of Open Access Journals (Sweden)

    Camila Soares Lippi

    2011-12-01

    Full Text Available Analizaremos como la jurisprudencia de los Tribunales Penales Internacionales ad hoc del post-Guerra Fría representa un cambio de paradigmas en cuestiones de género en el Derecho Penal Internacional y en el Derecho Internacional Humanitario. Para eso, partimos del concepto de género, o sea, las construcciones sociales cuanto a los roles masculino y femenino, como categoría central de análisis. Analizamos, primeramente, el post-Segunda Guerra Mundial. Ese momento histórico, ejemplificado por los Tribunales de Núremberg y de Tokio y por los Convenios de Ginebra de 1949. Después analizase los Tribunales Penales Internacionales ad hoc del post-Guerra Fría. Finalmente, analizamos la definición de género en el Estatuto de Roma, que instituye el Tribunal Penal Internacional.

  14. Che genere di diritto?

    Directory of Open Access Journals (Sweden)

    Delia La Rocca

    2014-04-01

    Full Text Available Il recente decreto legge sul femminicidio nasce in un clima, soprattutto mediatico, nel quale la violenza sulle donne viene letta come “emergenza”. Questa chiave di lettura del fenomeno presenta alcuni rischi: in primo luogo, quello di riproporre un modello di intervento pubblico centrato soprattutto sull’approccio repressivo. Il decreto assegna, infatti, una valenza residuale ad una strategia di sostegno delle azioni di prevenzione e di assistenza delle vittime di violenza, al momento rinviate ad un “Piano d'azione straordinario” per il quale non viene previsto alcun finanziamento. E’ tempo di uscire dalla logica emergenziale: la questione della violenza di genere non è solo problema di ordine pubblico. E’ un fenomeno che colpisce al cuore la riscrittura delle regole sulla convivenza tra i generi avviata nel secolo scorso. Ciò che serve è un nuovo momento di elaborazione delle teorie e delle prassi delle donne sul ruolo del sistema giuridico e sulle forme più adeguate per garantire la libertà femminile.

  15. La política del fuego: El desplazamiento contemporáneo del paradigma geopolítico

    Directory of Open Access Journals (Sweden)

    Marder, Michael

    2013-12-01

    Full Text Available This paper theoretizes the transition from a global regime of geopolitics (that is to say, the politics of the earth to a pyropolitical regime, or the politics of fire. Based in the political philosophy of Carl Schmitt, the thesis is that the certainty, stability, and order rooted in the earth are now being displaced by the anomie of fire, as the symbol and the concrete sphere of the political today.Este artículo teoriza la transición del régimen global geopolítico (es decir, la política de la tierra a régimen piropolítico, o la política del fuego. En base a filosofía política de Carl Schmitt, la tesis es que la certidumbre, estabilidad y orden arraigados en la tierra están desplazados por la anomia del fuego, como un símbolo y dominio concreto de lo político hoy.

  16. La política del fuego: El desplazamiento contemporáneo del paradigma geopolítico

    OpenAIRE

    Marder, Michael

    2013-01-01

    This paper theoretizes the transition from a global regime of geopolitics (that is to say, the politics of the earth) to a pyropolitical regime, or the politics of fire. Based in the political philosophy of Carl Schmitt, the thesis is that the certainty, stability, and order rooted in the earth are now being displaced by the anomie of fire, as the symbol and the concrete sphere of the political today.Este artículo teoriza la transición del régimen global geopolítico (es decir, la política de ...

  17. Indagine preliminare della natura fisica del fenomeno che ha originato il periodo sismico irpino dell'Agosto 1962

    Directory of Open Access Journals (Sweden)

    F. PERONACI

    1963-06-01

    Full Text Available Si r i p o r t a n o i r i s u l t a t i di uno studio microsismico eseguito
    sulle scosse più intense, clie hanno c a r a t t e r i z z a t o il periodo sismico
    d e l l ' I r p i n i a dell'Agosto 1962. Eseguita la determinazione dei dati ipocentrali
    si fa osservare che l'ipocentro lia una p r o f o n d i t à superiore (40 km circa
    di quella r i s c o n t r a t a a oggi negli studi di t e r r e m o t i appenninici. La determinazione
    della n a t u r a fìsica della scossa all'ipocentro ha p o r t a t o ad uno
    schema di f r a t t u r a il cui piano si accorda con la direzione delle faglie profonde
    che interessano l ' I t a l i a Meridionale con un andamento trasversale
    r i s p e t t o alla dorsale Appenninica.

  18. La noción de paradigma

    Directory of Open Access Journals (Sweden)

    Luis Fernando Marín Ardila

    2007-01-01

    Full Text Available El artículo reclama la importancia de la noción de paradigma y el conocimiento o reflexión sobre los paradigmas que reproducimos al orientar nuestra acción vital y nuestra comprensión de las distintas facetas de la existencia. Denominamos paradigmatología al estudio de los paradigmas como lógica, semántica e ideológica del conocimiento y la praxis. Dos autores concurren a nutrir este dominio teórico: Thomas S. Kuhn y Edgar Morin; cada uno, desde perspectivas distintas, ha abierto un horizonte de pensamiento que promueve el debate sobre el conocimiento, su estructuración, su historia y su incorporación en la vida académica y en la producción investigativa. Los paradigmas son especies de anteojos o linternas que nos hacen visibles y audibles unos fenómenos y ocultan o dejan otros sobre un trasfondo inconsciente. El artículo concluye con la ilustración de un paradigma imperante en la praxis educativa y pedagógica que posee una potencia tal que se se ha “naturalizado”; se trata del paradigma transmisionista de la educación, en el que se concibe y se vive el lenguaje como un instrumento, el conocimiento como una representación y la pedagogía como transmisión.

  19. Neuroni specchio, a che punto siamo?

    OpenAIRE

    Paolo B. Pascolo

    2012-01-01

    Su “Il Discorso” del 16 gennaio 2012, Vito Digiorgio, parlando di un libro di recente pubblicazione che vede la prefazione di Giacomo Rizzolatti, “Io sono il tuo specchio” (Amrita Edizioni, 2011), così scrive: “La tesi sostenuta nel libro è che questo meccanismo non sia limitato alle azioni fisiche, ma valga anche per la sfera delle sensazioni. I neuroni specchio risuonano anche nelle nostre emozioni”...

  20. Neuroni specchio, a che punto siamo?

    Directory of Open Access Journals (Sweden)

    Paolo B. Pascolo

    2012-07-01

    Full Text Available Su “Il Discorso” del 16 gennaio 2012, Vito Digiorgio, parlando di un libro di recente pubblicazione che vede la prefazione di Giacomo Rizzolatti, “Io sono il tuo specchio” (Amrita Edizioni, 2011, così scrive: “La tesi sostenuta nel libro è che questo meccanismo non sia limitato alle azioni fisiche, ma valga anche per la sfera delle sensazioni. I neuroni specchio risuonano anche nelle nostre emozioni”...

  1. Un singolare caso di rifrazione letteraria. A proposito di una generazione di autori di origine russa che scrive nella lingua del paese di adozione

    Directory of Open Access Journals (Sweden)

    Giulia Gigante

    2016-01-01

    Full Text Available Dall’esame di alcuni esempi di contesti narrativi e procedimenti stilistici caratteristici di diversi autori russi contemporanei che hanno scelto di scrivere nella lingua del paese in cui sono emigrati emerge una tendenza comune nella rappresentazione della Russia natia. Pur nella diversità delle loro opere, questi scrittori rappresentano la cultura delle loro radici avvalendosi di una visione ‘caleidoscopica’ in cui i riferimenti storici, letterari, artistici vengono rivisitati attraverso ricordi, sogni e riflessioni e filtrati attraverso la lingua e la cultura della loro terra adottiva.From the investigation of some examples of narrative contexts and stylistic processes typical of various contemporary Russian authors who have chosen to write in the language of the country where they emigrated, a common tendency emerges concerning the representation of Russia. Despite the differences of the works considered, these authors represents the culture of their roots in a ‘kaleidoscopic’ way, reconsidering the historical, literary and artistic references through memories, dreams and reflections, filtering them through the language and culture of their chosen country.

  2. Canicas, lombrices, arcillas y cuentos en la construcción de un nuevo paradigma en la enseñanza de la Ciencia del Suelo

    Directory of Open Access Journals (Sweden)

    Laura Bertha Reyes-S\\u00E1nchez

    2006-01-01

    Full Text Available Se propone la conformación de un modelo educativo diferente para la enseñanza de las ciencias, en general, y de la Ciencia del Suelo, en particular. Se discute sobre la necesidad de incluir, desde el currículum educativo básico, áreas del conocimiento prioritarias para México que permitan, a través de la comprensión de los fenómenos que involucran al suelo como medio de producción, en equilibrio con la naturaleza, generar alimentos, construir riqueza y sustentar desarrollo. Se plantea la posibilidad de elección, que tenemos como profesionistas, entre el continuar impartiendo una enseñanza oral y repetitiva, frente a la propuesta de innovar la docencia al amalgamar la teoría con la práctica y hacer accesibles los conocimientos a niños y jóvenes en aquellos niveles en que son prácticamente páginas en blanco, capturar su interés y entusiasmo, y generar en ellos amor por el quehacer científico. Finalmente, se convoca a trabajar, para y en ello, a investigadores y catedráticos universitarios, con docentes de todos los niveles preuniversitarios, hasta conformar ese proyecto escolar que lleve a la construcción de un nuevo paradigma en su enseñanza: una enseñanza en la cual confluyan la interpretación de los hechos humanos y la explicación de los hechos científicos, a la vez que éstos se confrontan dialécticamente, en la construcción del aprendizaje infantil.

  3. El devenir de la modernidad: crisis del paradigma y acercamiento a una nueva epistemología social

    OpenAIRE

    Fernando Garrido Ferradanes

    2003-01-01

    En la primera parte del artículo desarrollaremos la tesis de la muerte de la modernidad por obra y gracia de su éxito absoluto. Por otra parte, creemos necesario, así mismo, realizar un análisis de la sociedad en la que nos vemos inmersos, la sociedad de la información, que realizaremos en la segunda parte del artículo. Nuestro argumento es que la globalización es una consecuencia de la modernidad, es más: supone el culmen, el éxito, el triunfo del proyecto modernizador. La modernidad se i...

  4. ¿Estamos ante un cambio de paradigma en la Filosofía del Derecho? El neoconstitucionalismo y la crisis del Estado social

    OpenAIRE

    Lloredo Alix, Luis

    2014-01-01

    Uno de los temas clave de la filosofía jurídica contemporánea tiene que ver con el positivismo jurídico y su pretendida superación. Es común afirmar que, en el marco de los actuales Estados constitucionales, no tiene sentido seguir defendiendo el positivismo. Sin embargo, como se analizará aquí, el iuspositivismo ha sido una corriente contestada desde muy antiguo y conviene ser precavidos a la hora de afirmar que estamos ante un cambio de paradigma. Asimismo, se propondrá que determinadas ori...

  5. El complejo futuro de la evaluación universitaria. (El desafio de pasar el paradigma de evaluar la fábrica educativa de pregrado a la educación individualizada del postgrado

    Directory of Open Access Journals (Sweden)

    Claudio Rama

    2006-01-01

    Full Text Available Resulta necesario revisar la evolución de la evaluación de la calidad de la enseñanza universitaria a lo largo del siglo XX, para exponer algunas de las directrices que fundamentan la enseñanza universitaria y su evaluación en el siglo XXI. Las directrices planteadas se dirigen hacia una educación permanente, diferenciada, especializada, individualizada y orientada a los postgrados, que deben evaluarse mediante la creación de nuevos paradigmas evaluativos de saberes globales y de los conocimientos en la nueva sociedad del saber.

  6. New Scientist: le 50 idee che cambieranno la scienza...

    Directory of Open Access Journals (Sweden)

    Redazione

    2012-07-01

    Full Text Available Quali sono le "idee" destinate a cambiare radicalmente la conoscenza che abbiamo del mondo e le relazioni che intratteniamo con esso? Con l'aiuto di esperti di diverse discipline il New Scientist ha raccolto le 50 che sembrano meglio candidarsi a questa sfida. Dalle scienze della vita all'intelligenza artificiale, dalla genetica alle nanotecnologie, dalla cosmologia alla ricerca sul cervello, dall'ingegneria alla vita artificiale...

  7. New Scientist: le 50 idee che cambieranno la scienza...

    OpenAIRE

    Redazione

    2012-01-01

    Quali sono le "idee" destinate a cambiare radicalmente la conoscenza che abbiamo del mondo e le relazioni che intratteniamo con esso? Con l'aiuto di esperti di diverse discipline il New Scientist ha raccolto le 50 che sembrano meglio candidarsi a questa sfida. Dalle scienze della vita all'intelligenza artificiale, dalla genetica alle nanotecnologie, dalla cosmologia alla ricerca sul cervello, dall'ingegneria alla vita artificiale...

  8. Luces y sombras de dos paradigmas del americanismo español en la renovación del diálogo hispanoamericano (1909-1912

    Directory of Open Access Journals (Sweden)

    Dalla Corte, Gabriela

    2006-12-01

    Full Text Available Between 1909 and 1911, the Spanish Americanist movement was renewed by the initiative of the University of Oviedo and the Casa de América de Barcelona. Both institutions, respectively headed by Rafael Altamira and Rafael Vehils, were able to define two alternative paradigms to the Americanist action: the fisrt one defining a pattern of intellectual intervention led by the universities and the second one a way of economic intervention commanded by some associations. Both paradigms showed their innovative character by launching concrete proposals about all the aspects of Americanist action and proposing ways of balance between regional and state interests.

    Entre 1909 y 1911, el hispanoamericanismo español experimentó una renovación impulsada por iniciativas de la Universidad de Oviedo y la Casa de América de Barcelona. Ambas entidades, lideradas por Rafael Altamira y Rafael Vehils, lograron conformar dos paradigmas alternativos para la acción americanista. El primero definió una pauta de intervención fundamentalmente intelectual liderada por las universidades; el segundo, un modelo de intervención prioritariamente económico, ejecutado por asociaciones. Ambos paradigmas mostraron su carácter innovador al brindar propuestas concretas sobre casi todos los aspectos de la acción americanista y al proponer fórmulas que equilibren los intereses regionales y estatales.

  9. Comunicato stampa N°235 della IARC "LA IARC AFFERMA CHE ANCHE L'ESPOSIZIONE A BASSE DOSI DI RADIAZIONI AUMENTA IL RISCHIO DI MORIRE DI LEUCEMIA TRA I LAVORATORI DEL SETTORE NUCLEARE" pubblicato il 22 Giugno 2015

    OpenAIRE

    Fellone, Lucio

    2015-01-01

    Versione autorizzata in italiano del Comunicato Stampa della IARC N°235 pubblicato il 22 giugno 2015: "LA IARC AFFERMA CHE ANCHE L'ESPOSIZIONE A BASSE DOSI DI RADIAZIONI AUMENTA IL RISCHIO DI MORIRE DI LEUCEMIA TRA I LAVORATORI DEL SETTORE NUCLEARE". Documento originale all'indirizzo: http://www.iarc.fr/en/media-centre/pr/2015/pdfs/pr235_E.pdf Authorized Italian version of the IARC Press Release N°235 published on 22 June 2015: EVEN LOW DOSES OF RADIATION INCREASE RI...

  10. Paralelización del Algoritmo Criptográfico GOST Empleando el Paradigma de Memoria Compartida

    Directory of Open Access Journals (Sweden)

    Marlis Fulgueira-Camilo

    2015-06-01

    Full Text Available El artículo refiere el proceso de paralelización del algoritmo criptográfico GOST. La investigación realizada persigue como objetivo, reducir el tiempo de ejecución del algoritmo. El estudio no se encuentra enfocado al análisis de fortaleza del algoritmo criptográfico, donde se hace énfasis es en el método empleado para disminuir el tiempo de ejecución de los procesos cifre y descifre. Para ello se realiza un diseño paralelo basado en la metodología de Ian Foster, el cual es aplicado a dos implementaciones usando técnicas como: OpenMP y CUDA. Las comparaciones realizadas teniendo en cuenta, tanto al algoritmo secuencial como las implementaciones paralelas, demuestran una significativa reducción de tiempo, sin importar la técnica empleada. El mejor resultado se logra empleando CUDA.

  11. Hacia un paradigma humanista en enfermería en la visión del enfermo terminal.

    OpenAIRE

    Guevara, B.; Mejías, M.; Evies, A.; Zambrano, A.

    2005-01-01

    La visión que debe tener el equipo de salud, en el que se encuentra la enfermera, hacia el enfermo terminal debe ir dirigida hacia el respeto a su dignidad como persona humana, por sus características de individualidad y complejidad que lo hacen responder de forma impredecible a las circunstancias de la vida. En el caso del enfermo terminal se hace necesario que la enfermera asuma una actitud madura, empática, manifestada a través de la compasión por el sufrimiento de este...

  12. Notalgia paréstesica; el paradigma del prurito neuropático: descripción de seis casos

    OpenAIRE

    J.M. Gómez-Argüelles; Michel, F.; L. Gómez Romero; S. Somovilla

    2015-01-01

    La notalgia parestésica es una neuropatía sensitiva crónica caracterizada por cursar con intenso dolor y/o prurito en la zona superior o media de la espalda, típicamente debajo del hombro izquierdo. Suele asociar una zona de hiperpigmentación en el área afectada o cercana a ella. Aunque la etiología no se ha establecido con certeza, se ha intentado explicar por dos motivos, bien por un proceso degenerativo central, o bien por un cuadro de atrapamiento periférico de un nervio en ese ámbito. Au...

  13. Propuesta de diseño de guión multimedia interactivo basado en el paradigma del aprendizaje experiencial

    OpenAIRE

    Calleja-Sánchez, Juan Guillermo

    2013-01-01

    El propósito del presente trabajo es contribuir a la trasferencia de conocimiento en el ámbito de las tecnologías educativas a los usuarios no técnicos (expertos en contenido, docentes y formadores en entornos corporativos), en el diseño de escenarios de aprendizaje mediados por tecnologías. Propone un modelo experto de diseño de guión multimedia interactivo articulado en torno a la teoría de los campos conceptuales de Gerard Vergnaud. Este modelo permite a los usuarios no técnicos, diseña...

  14. La inhumanidad en las Organizaciones vista a través del cine. Una alternativa a los limitantes explicativos del paradigma humanista en la administración

    OpenAIRE

    Cubillos Alzate, Jorge Tulio

    2015-01-01

    El objetivo de esta investigación es proponer una alternativa a los limitantes explicativos del humanismo administrativo a través del cine, específicamente para abordar el fenómeno de la inhumanidad en las organizaciones. Desde la perspectiva crítica del humanismo administrativo, específicamente mediante una síntesis del pensamiento de Omar Aktouf, se allana el camino para abordar a partir de las ciencias humanas y sociales el fenómeno de la inhumanidad. Posteriormente, a travé...

  15. CIMAC y la cobertura del feminicidio de Ciudad Juárez. Un cuestionamiento del paradigma tradicional de la noticiabilidad y los valores noticia

    Directory of Open Access Journals (Sweden)

    Santiago Gallur Santorum

    2013-05-01

    Full Text Available Este artículo pretende reflexionar, a partir de los resultados de una amplia investigación1 , sobre la importancia de la difusión de las problemáticas locales a través de los medios, en un contexto de información globalizada y homogénea. Así, la investigación que aquí se presenta muy resumida, ha podido comprobar como la selección de los hechos que son difundidos como noticias a través de los valores noticia tradicionales es sustituida en la agencia de noticias CIMAC por una forma alternativa, en la cobertura de una situación concreta de violencia local extrema: el feminicidio de Ciudad Juárez. De esta forma, un problema aparentemente local, consigue ser difundido a nivel internacional de tal manera, que acaba percibiéndose como una problemática global que afecta a las mujeres en otras partes de México, América Latina y el mundo. Así, este ejemplo particular pone en evidencia, la posibilidad real de sustituir el paradigma informativo tradicional, por una alternativa real que saca a la luz hechos importantes que ocurren en entornos locales y que normalmente son invisibilizados los medios de comunicación.

  16. Gobierno Abierto: ¿Las nuevas ropas del Emperador? Las paradojas de un paradigma en construcción y su reflejo en Latinoamérica

    Directory of Open Access Journals (Sweden)

    Ramírez-Alujas, Álvaro Vicente

    2012-09-01

    Full Text Available En los últimos años, el concepto de gobierno abierto se ha extendido con fuerza y se ha instalado en la agenda política mundial de manera sorprendente. Sin embargo, se trata de una idea y un modelo en fase de construcción cuya ambigüedad y falta de definición consensuada puede perjudicar significativamente las potencialidades que se le atribuyen, como nuevo paradigma que permita construir capacidades para asumir adecuadamente los desafíos del siglo XXI, sobre la base de llevar a la práctica los principios de la transparencia y apertura, la participación y la rendición de cuentas en los asuntos públicos. El artículo discute los orígenes y alcances del concepto y propone una definición operacional. Además, y tomando el caso de la recientemente creada “Alianza para el Gobierno Abierto” (Open Government Partnership - OGP, se propone un marco de referencia para evaluar los planes de acción que los países latinoamericanos han comprometido al incorporarse a dicha iniciativa. En esta perspectiva, el análisis comparado de los planes de acción permite extraer lecciones y aprendizajes que pueden contribuir a potenciar y consolidar los esfuerzos por “abrir” los gobiernos en la región, desde una visión ligada al concepto de gobernanza abierta y colaborativa. Finalmente, se reflexiona sobre la posibilidad que bajo la etiqueta del gobierno abierto se promueva una nueva agenda de reforma del Estado y modernización de la gestión pública para los próximos años en Latinoamérica. /In recent years, the concept of open government has expanded strongly and is installed in the global political agenda in surprising ways. However, this is an idea and a model under construction whose ambiguity and lack of consensus definition can significantly impair the potential attributed to him, as a new paradigm that can build capacity to properly face the challenges of XXI century, on the basis for implementing the principles of transparency and

  17. Tempo e reciprocità: leve di un nuovo paradigma socioeconomico

    Directory of Open Access Journals (Sweden)

    Paolo Coluccia

    2004-06-01

    Full Text Available Questo saggio tenta di mettere a fuoco la mia riflessione filosofica e la mia attuale ricerca sociale ed economica. Nella sostanza ripropongo gli argomenti da me già trattati in occasione del Colloque International sur l'Aprés-Développement "Défaire le développement, refaire le monde" (Parigi, UNESCO, marzo 2002. Il tempo, la reciprocità e la condivisione delle risorse, se opportunamente ripensati, possono rappresentare una chance per poter ancora vivere insieme, liberi, uguali e diversi, in un mondo responsabile, plurale e solidale. Inoltre possono inaugurare un nuovo paradigma socioeconomico. "Rammentiamo che, per gran parte dell'era moderna, abbiamo associato al concetto di libertà quello di autonomia, e fatto coincidere l'autonomia con la capacità di offrire il nostro lavoro sul mercato. I frutti del lavoro - la proprietà - sono stati considerati simboli della nostra libertà. Il diritto di escludere gli altri da ciò che ci appartiene è stato considerato il miglior modo di proteggere la nostra autonomia e la nostra libertà personale. La vera libertà, però, è figlia della condivisione, non del possesso: non si può essere davvero liberi, se non si può condividere, provare un sentimento di empatia nei confronti dell'altro, abbracciarsi" (Rifkin, 2000. Una versione più ampia ed approfondita di questo saggio si trova con il titolo "Monete locali per il bene comune: lo spirito del SEL" nel libro collettivo curato da Edward Goldsmith Processo alla globalizzazione, Arianna Editrice, Casalecchio (BO, 2002.

  18. El paradigma de la complejidad en Edgar Morin

    OpenAIRE

    López Ramírez, Oscar

    1998-01-01

    El presente es un trabajo introductorio sobre el Paradigma de la Complejidad, apoyado en especial en los estudios de Edgar Morin, señalando su aporte básico. En él se hace una relación de los descubrimientos que en el presente siglo han permitido el desarrollo de este nuevo paradigma. Con ello se busca mostrar cómo el gran problema de la ciencia de nuestro tiempo, radica en su dependencia del paradigma simplificante que ha impedido integrar todos los aportes de la ciencia y la técnica actu...

  19. Cinco paradigmas para abordar lo real

    Directory of Open Access Journals (Sweden)

    Eva Pasek de Pinto

    2006-01-01

    Full Text Available Considerando la crisis de la investigación social, el propósito del estudio fue configurar un fundamento paradigmático para la investigación en ciencias sociales. Partiendo de dos cuerpos teóricos: Mardones, (1991; y Padrón, (1994, 1998, por medio de la deducción y del análisis se obtuvieron cuatro paradigmas de investigación que, integrados, permitieron obtener un quinto paradigma. Así, como resultado del estudio se presentan cinco paradigmas posibles para abordar la realidad: el empírico- inductivo; el racionalista deductivo; el fenomenológico vivencial, el reflexivo crítico y el holístico o de la complejidad. A lo largo del estudio, cada uno de ellos se analiza en cuatro aspectos paradigmáticos: el Ontológico, el Epistemológico, el Axiológico y el Metodológico.

  20. ¿Trabajo social sin fundamento? : aportaciones del paradigma de la complejidad a la epistemología del trabajo social

    OpenAIRE

    Cordero Ramos, Nuria; Blanco López, Juan

    2004-01-01

    El debate sobre la necesaria fundamentación teórica del Trabajo Social está hoy en plena vigencia. La necesidad de "demostrar" su cientificidad es un interés compartido con otras ciencias sociales, que en su caminar epistemológico, han "copiado" el modelo, teórico y práctico, de las ciencias naturales, deudoras del más clásico positivismo racionalista. Sin embargo este modelo "clásico" al que se aspira está puesto en cuestión por estas mismas Ciencias Naturales con la aparición de planteamien...

  1. Análisis crítico del paradigma positivista y su influencia en el desarrollo de la enfermería Critical analysis of positivist paradigm and its influence in knowledge development of nursing

    OpenAIRE

    R. Lizet Veliz; V. Paula Ceballos; S. Sandra Valenzuela; A. Olivia Sanhueza

    2012-01-01

    Este artículo tiene como propósito analizar la influencia del paradigma positivista en Enfermería. Se describen las características de esta corriente de pensamiento y la mirada de Enfermería a través de la visión reactiva o particular-determinística. Se profundiza sobre algunos elementos del positivismo presentes en los ámbitos de desempeño, como: asistencia sanitaria, formación, investigación y gestión. Se concluye que visibilizando dichos ámbitos desde una mirada holística, a la que se acce...

  2. Latinoamérica en la ruptura del paradigma de la comunicación para el desarrollo. El recorrido de los pioneros en la búsqueda de alternativas democráticas.

    OpenAIRE

    Barranquero, Alejandro

    2005-01-01

    La rica producción intelectual y práctica en Latinoamérica parece encontrar en los últimos tiempos un merecido reconocimiento en el ámbito de la comunicación para el cambio social. Las siguientes líneas intentan evaluar elpapel jugado por el continente en la ruptura del paradigma dominante modernizador, así como en la concepción de un modelo más integrado y dialógico de la comunicación (y el desarrollo). Mediante el análisis de la proyección del pensamiento dentro y fuera de sus fronteras, se...

  3. Análisis crítico del paradigma positivista y su influencia en el desarrollo de la enfermería Critical analysis of positivist paradigm and its influence in knowledge development of nursing

    Directory of Open Access Journals (Sweden)

    R. Lizet Veliz

    2012-12-01

    Full Text Available Este artículo tiene como propósito analizar la influencia del paradigma positivista en Enfermería. Se describen las características de esta corriente de pensamiento y la mirada de Enfermería a través de la visión reactiva o particular-determinística. Se profundiza sobre algunos elementos del positivismo presentes en los ámbitos de desempeño, como: asistencia sanitaria, formación, investigación y gestión. Se concluye que visibilizando dichos ámbitos desde una mirada holística, a la que se accede desde otros paradigmas, y la reflexión de los beneficios del cuidado integral y transpersonal por parte de los usuarios, del equipo de salud y de la sociedad, se puede contribuir para cambiar la valoración que tiene la sociedad de la disciplina de enfermería.This paper aims to analyze the influence of positivist paradigm in nursing. This thought tendency is described in terms of history and characteristics and nursing view under the reactive or particular - deterministic vision. Afterwards, it deepens over some positivism elements which are present in nursing area, such as: sanitary assistance, training nurses, and research care management. It is concluded that being able to visualize named areas under a holistic view, which is given by other paradigms as well as the observation of benefits comprehensively and transpersonal care by users, health team and society, a change in the value placed on nursing discipline can be reached.

  4. El poder y los valores en Weber, Freud y Kelsen, a la luz del "nuevo paradigma científico" y en relación con América Latina

    Directory of Open Access Journals (Sweden)

    Eda Cleary

    2011-01-01

    Full Text Available El presente trabajo intentará aproximarse críticamente a la revisión del concepto del "poder" en relación a los valores del hombre, a partir de las teorías desarrolladas por tres maestros universales clásicos de las ciencias sociales y psicoanalíticas como fueron Max Weber, Sigmund Freud y Hans Kelsen. Nuestra hipótesis consiste en afirmar que los aportes teóricos de estos tres autores conservan su validez hasta la actualidad y enriquecen las tesis derivadas del "nuevo paradigma científico" con respecto a las actuales formas de organización del "poder" en redes. Sobre todo en lo que respecta a su doble abordaje acerca del "poder": el análisis de sus estructuras y el origen de los valores que lo sustentan desde sus bases antropológicas. Al concluir se reflexiona acerca de la validez de este pensamiento para la historia moderna de América Latina.

  5. La cuestión del trabajo penitenciario frente al cambio de paradigma. Conflictos y desafíos de su aplicación, tras el debilitamiento del ideal «resocializador» y en el contexto del «postfordismo». El caso de Cataluña.

    OpenAIRE

    Prado, Carolina

    2014-01-01

    La tesis versa sobre la implementación del trabajo productivo en el ámbito de la reclusión penal, en un contexto de cambio de paradigma, tanto en lo penológico (de la “rehabilita-ción” a la “incapacitación”, en cuanto finalidad asignada a la pena), como en lo estruc-tural (del “fordismo” al “postfordismo”, en cuanto a estructura económico-política). La investigación se enfoca en la gestión del trabajo penitenciario en Cataluña, España, por la singular modalidad mixta (público-privada) qu...

  6. El cuidado a la salud bucal del anciano: buenas prácticas fundamentadas en el paradigma de la promoción de la salud Oral health care of the aged: good practices based on health promotion paradigm

    OpenAIRE

    Ana Lúcia Schaefer Ferreira de Mello; Calvino Reibnitz Junior; Alacoque Lorenzini Erdmann

    2009-01-01

    Presenta la elaboración de un referente de buenas prácticas del cuidado a la salud bucal a la población anciana, basado en la Promoción de la Salud (PS). El método adoptado fue el de la Teoría Fundamentada en los Datos. El referencial teórico-práctico se describe para guiar el desarrollo de acciones en consonancia con el paradigma de la PS según la Carta de Ottawa y sus cinco áreas. Es necesario considerar estas prácticas de cuidado como un objetivo a alcanzar y contribuir al progreso sosteni...

  7. La víctima en el mundo hispánico. Su definición a través del paradigma Barroco

    OpenAIRE

    Martínez, Josebe

    2014-01-01

    Resumen: Este artículo examina el feminicidio de Ciudad Juárez y la lucha de las familias de los desaparecidos durante la dictadura argentina (1973-1983). El análisis muestra como el paradigma de El Barroco/lo barroco sirve de archivo y repertorio para la conceptualización de la víctima en el mundo hispánico.Palabras Clave: Barroco, feminicidio, víctima, desaparecido, Argentina.Abstract: This article studies the femicide in Ciudad Juarez and the struggle of families of desaparecidos during th...

  8. La estadística y los diferentes paradigmas de investigación educativa

    OpenAIRE

    Tejedor, E Javier

    1986-01-01

    En este trabajo el autor asocia el término paradigma a la perspectiva científica que predomina en un campo determinado y aboga por mantener la denominación “paradigmas racionalista y naturalista” y evitar el planteamiento del problema en términos de “cuantitativo y cualitativo”. Analiza las diferencias entre ambos paradigmas y asocia la dicotomía entre los métodos cuantitativos y cualitativos al pensamiento de que existe una vinculación única e inequívoca entre método y paradigma justificando...

  9. Evita Perón y el Che Guevara: De la historia a la construcción literaria del mito biográfico

    Directory of Open Access Journals (Sweden)

    Cecilia López Badano

    2014-06-01

    Full Text Available Eva Perón y el Che Guevara son dos de las figuras paradigmáticas argentinas, conocidas internacionalmente a través no sólo de sus vidas, que pueden reconstruirse a partir de documentos históricos, sino por el mito nacional - e internacional - que la muerte temprana ha configurado con ambos mediante la ayuda de la literatura y el cine, expandiendo ficcionalmente el matiz revolucionario de su accionar. El presente texto se propone, en consecuencia, dar cuenta de esas "capas" ficcionales que conforman la construcción estética de los dos mitos biográficos e inciden en la evaluación de sus protagonistas reales, modelando la percepción de ambos, particularmente, la considerada por el gran público más que por los especialistas.

  10. Los estudios de herencia cultural como una alternativa a la arqueología científica o a la patrimonialización de los dioses: del paradigma de la ruptura al de la continuidad

    Directory of Open Access Journals (Sweden)

    Wilhelm Londoño

    2013-10-01

    Full Text Available En las últimas dos décadas varios arqueólogos han reflexionado sobre la problemática relación de la arqueología con la construcción de comunidades imaginadas nacionales. En estas reflexiones el balance ha señalado que la arqueología ha sido funcional a un proyecto nacionalista que ubicó la alteridad en una dimensión temporal distanciada del presente. En este sentido la se legitimó como una disciplina encargada de dar cuenta del pasado (ruptura. A pesar del peso que tiene esta imagen dentro del imaginario, cada vez más comunidades locales están reclamando, no sólo un papel más activo en esta maquinaria de representación  del pasado, sino controles más efectivos sobre los espacios donde se practica la arqueología. Estas peticiones han sido, en muchos casos, legitimadas por el reconocimiento sobre las maneras como el colonialismo impelió a las comunidades locales a desprenderse de prácticas rituales celebradas sobre espacios y objetos específicos (continuidad. Dentro de este escenario ha emergido un nuevo paradigma que busca no saber lo que  ocurrió en el pasado, sino los medios a través de los cuales se desplegaron dispositivos del olvido (efecto de  colonialismo. En este artículo se desea hablar de este campo que puede ser definido  como “estudios de herencia cultural”.

  11. Compreensão do modelo de king sobre o paradigma do Interacionismo Simbólico Entendiendo el modelo de king en el paradigma del Interaccionismo Simbolico Understanding of king's model on the paradigm of Simbolic Interactionism

    Directory of Open Access Journals (Sweden)

    Iliana Maria de Almeida Araújo

    2005-12-01

    Full Text Available Objetivou-se refletir sobre o modelo conceitual de King, segundo a abordagem do Interacionismo Simbólico, dentro do modelo de análises de teoria de Meleis. Para alcançar o objetivo, realizamos uma leitura dos três modelos citados nos trabalho, buscando as congruências e discrepâncias entre os conceitos e correlacionando-os. O estudo permitiu concluir que as teorias concordam ao elucidar o homem como um ser que reage e busca compreender o significado das coisas ao seu redor, planejando e julgando suas ações e a dos outros. É importante a questão dos significados poderem ser modificados e gerarem a elaboração de metas em comum.Se apuntó a reflectir acerca del modelo conceptual de King, según el acercamiento de Interacionismo Simbólico, dentro del modelo de análisis de la teoría de Meleis. Para alcanzar el objetivo, nosotros logramos una lectura de los tres modelos mencionada en el trabajo, mientras buscando las consistencias y diferencias entre los conceptos y poniéndolos en correlación. El estudio permitió concluir que las teorías están de acuerdo al elucidar al hombre como un ser que reacciona e investiga para entender el significado de las cosas en suyo circuito, mientras flotando y juzgando sus acciones y el uno de los otros. Es importante el asunto de los significados podría modificarse y ellos generan la elaboración de metas en común.It was aimed to reflect on King's Theory, according to the approach of Symbolic Interaccionism, and theory analyses model of Meleis. To reach the objective, we proceeded the reading of the three models as mentioned before, looking for the consistencies and discrepancies among the concepts and correlating them. The study allowed to conclude that the theories agree when elucidating the man as a being that reacts and search to understand the meaning of things to his/her circuit, drifting and judging their actions and the one of the other ones. It is important the subject of the meanings

  12. The University Policlinic pedagogic pattern: expression of the new formative paradigm. El modelo pedagógico Policlínico Universitario: expresión del nuevo paradigma formativo.

    Directory of Open Access Journals (Sweden)

    Zenia Sánchez García

    2007-02-01

    Full Text Available

    Since the creation of the National Health System a steady, progressive, and gradual process of paradigm change has taken place in our country in medical sciences, under materialistic philosophy conceptions until arriving in our days to the new pedagogic model for basic integral general doctor's formation, sustained by the working education strength as fundamental principle. It implies to locate the student under professionals conditions to solve real or potential problems, using the teacher’s behaviour, and accompanying these solutions with studies in the own performance process. In this sense, it acquires great importance the current teaching aids revolution, since it facilitates the most up-to-date knowledge, being this new model the expression of the formative socio -doctor paradigm.

    Desde la creación del Sistema Nacional de Salud, en nuestro país se ha efectuado un proceso de cambio gradual, progresivo, y paulatino del paradigma en las ciencias médicas, bajo las concepciones de la filosofía materialista, hasta llegar en nuestros días al nuevo modelo pedagógico de formación del médico general integral básico, sustentado sobre la fortaleza de la educación en el trabajo como principio fundamental. Ello implica situar al estudiante en condiciones profesionales para solucionar problemas reales o potenciales, utilizando los modos de comportamiento de los docentes, y acompañando estas soluciones con actividades de estudios en el propio proceso de actuación. En este sentido, adquiere gran importancia la actual revolución de los medios de enseñanza, ya que facilita a los educandos los conocimientos más actualizados, siendo este nuevo modelo la expresión del paradigma socio

  13. Historicismo: notas sobre um paradigma

    OpenAIRE

    José D’Assunção Barros

    2012-01-01

    Este artigo tem por objetivo desenvolver algumas considerações sobre o Historicismo e sua possibilidade de ser examinado como um dos paradigmas que concorrem para o estabelecimento de uma história científica no século XIX. O primeiro ponto tratado é relativo às origens do paradigma Historicista na transição do século XVIII para o século XIX. Na sequência, aproximamo-nos da apropriação conservadora do paradigma historicista no novo contexto no qual a burguesia européia está assentada no Poder,...

  14. Aplicación del paradigma alternativo a un estudio de usuarios en el área de la información en Ciencias Sociales en el Uruguay: un aporte metodológico

    Directory of Open Access Journals (Sweden)

    María Cristina Pérez, Martha Sabelli

    2013-11-01

    Full Text Available se presenta una síntesis teórico-metodológica de la investigación sobre necesidades y comportamientos de uso de información de los especialistas del área Ciencias Sociales, aplicada como primera etapa del estudio internacional de los usuarios reales y potenciales de la Red IDIN. Se enmarca en el paradigma alternativo de los Estudios de Usuarios, ubicando al usuario en tiempo y espacio, analizando su comportamiento en relación a canales, tipos de información, fuentes, tecnologías en diversos contextos. Mediante la Encuesta con entrevista y aplicando la técnica de “incidente crítico”, el usuario puede describir individualmente y desde su percepción sus propias experiencias reales en relación con la información. Los resultados obtenidos, a través de un análisis cuantitativo y cualitativo, son insumo básico para el diseño de productos y servicios de “valor agregado”.

  15. Historicismo: notas sobre um paradigma

    Directory of Open Access Journals (Sweden)

    José D’Assunção Barros

    2012-08-01

    Full Text Available Este artigo tem por objetivo desenvolver algumas considerações sobre o Historicismo e sua possibilidade de ser examinado como um dos paradigmas que concorrem para o estabelecimento de uma história científica no século XIX. O primeiro ponto tratado é relativo às origens do paradigma Historicista na transição do século XVIII para o século XIX. Na sequência, aproximamo-nos da apropriação conservadora do paradigma historicista no novo contexto no qual a burguesia européia está assentada no Poder, combinando-se com a consolidação dos modernos estados-nações. A especificação das características deste paradigma constituem o principal ponto de análise

  16. Hacia una nueva clasificación de los modelos pedagógicos: el pensamiento configuracional como paradigma científico y educativo del siglo xxi

    OpenAIRE

    Alexander Ortiz Ocaña

    2013-01-01

    En este trabajo, resultado del proyecto MODEPED: Identificación, caracterización y elaboración del modelo pedagógico de las instituciones educativas públicas del Caribe Colombiano, se hace una nueva clasificación de los modelos pedagógicos en cuatro grande grupos: la pedagogía tradicional (Ignacio Loyola); la escuela nueva (Jhon Dewey, Decroly, Cousinet); la tecnología educativa (B. F. Skinner) y la escuela del desarrollo integral (E. Pichón Riviere, P. Freyre, L. S. Vigotsky, A. N. Leontiev,...

  17. Sei così bella quando piangi. Lana Del Rey, voce e fenomeno della fragilità che è in noi

    Directory of Open Access Journals (Sweden)

    Federico Zannoni

    2015-07-01

    Full Text Available Frailty is an ontological part of human experience and characterizes our times. Instability, insecurity, addictions, loneliness, difficulty in finding meaning and perspectives, desire to escape and nostalgia for an unknown and unreal past are predominant in the life of many young people and teenagers. In this context it is possible to consider the global success of the singer Lana Del Rey and of her melancholy and languid lyrics, but also of her videos and photographs, that are expression and celebration of an alleged existential frailty that allows her supporters, especially if adolescents or young women, to identify with her. The study of the phenomenon Lana Del Rey allow to move closer to those feelings of weakness and discomfort that are often hidden, unspoken, confined in the shadows for lack of courage or for shame, but that are, at the same time,  full of grace and of vital energy.  This is one of the tasks of pedagogy.

  18. Los laberintos del Trabajo Social. Nuevos paradigmas en la formación, la práctica y la investigación

    Directory of Open Access Journals (Sweden)

    Paola Segura Segura

    2012-04-01

    presentados en las IX y X Jornadas Bianuales que realiza la Asociación de Profesionales de Servicio Social del Gobierno de la Ciudad de Buenos Aires (APSS, nominadas Crisis Social y Transformación de la Vida Cotidiana. Ser o Rehacer el Sistema (2002 y Los Laberintos del Trabajo Social, los nuevos Desafíos en la Práctica y la Investigación (2004, respectivamente.

  19. El cuidado a la salud bucal del anciano: buenas prácticas fundamentadas en el paradigma de la promoción de la salud Oral health care of the aged: good practices based on health promotion paradigm

    Directory of Open Access Journals (Sweden)

    Ana Lúcia Schaefer Ferreira de Mello

    2009-06-01

    Full Text Available Presenta la elaboración de un referente de buenas prácticas del cuidado a la salud bucal a la población anciana, basado en la Promoción de la Salud (PS. El método adoptado fue el de la Teoría Fundamentada en los Datos. El referencial teórico-práctico se describe para guiar el desarrollo de acciones en consonancia con el paradigma de la PS según la Carta de Ottawa y sus cinco áreas. Es necesario considerar estas prácticas de cuidado como un objetivo a alcanzar y contribuir al progreso sostenido en la calidad del cuidado y la transformación en las condiciones de salud bucal durante el curso de la vida.It presents the elaboration of a theoretical-practical referential of good oral health care practices to the aged population, based on the principles of Health Promotion (HP. The methodological referential adopted was Grounded Theory. The theoretical-practical referential is described to guide the development of oral health care actions to the aged, in consonance with the HP paradigm defended in the Ottawa Charter according to five areas. It is necessary to consider these care practices, that conform the theoretical-practical referential here detailed, as an objective to reach, to contribute to the sustained progress in the quality of the care and, consequently, promote a transformation in oral health conditions during life course.

  20. Cambios en el paradigma del empleo público y sus repercusiones en procesos psicosociológicos. Estudio en la UNMdP

    OpenAIRE

    Musticchio, Carlos A.; Arraigada, Mariana Cecilia

    2013-01-01

    La estructura organizacional determina la capacidad de una organizacional de cumplir con su misión. De ella depende en gran medida el logro de resultados. P. Senge dice "La estructura es la configuración de interrelaciones entre los componentes claves del sistema. Puede incluir la jerarquía y flujo de procesos, pero también incluye actitudes y percepciones, la calidad del producto, los modos en que se toman decisiones y cientos de factores más.". Se puede ver el rol crucial de las personas y ...

  1. Análisis de los paradigmas de liderazgo geopolítico de la República Federativa del Brasil

    OpenAIRE

    Perego, José Gustavo

    2006-01-01

    En este trabajo lo que busco es mostrar las verdaderas posibilidades de liderazgo del Brasil, en base a diferentes factores que constituyen su poder nacional. Me planteo la posibilidad de un liderazgo, desde un encuadre teórico acerca del significado de liderazgo y sus implicancias para el líder y sus seguidores, principalmente en sus costos. Puntualizo en una síntesis los diferentes ejes que marcan la política externa brasileña y como estos no logran despegar gracias a sus falencias estru...

  2. Canicas, lombrices, arcillas y cuentos en la construcción de un nuevo paradigma en la enseñanza de la Ciencia del Suelo

    OpenAIRE

    Laura Bertha Reyes-S\\u00E1nchez

    2006-01-01

    Se propone la conformación de un modelo educativo diferente para la enseñanza de las ciencias, en general, y de la Ciencia del Suelo, en particular. Se discute sobre la necesidad de incluir, desde el currículum educativo básico, áreas del conocimiento prioritarias para México que permitan, a través de la comprensión de los fenómenos que involucran al suelo como medio de producción, en equilibrio con la naturaleza, generar alimentos, construir riqueza y sustentar desarrollo. Se plantea la pos...

  3. Che Argentino (1) y Che Guerrilla (2). Reflexiones en torno a un interesante intento fallido

    OpenAIRE

    Manuel Gárate

    2009-01-01

    Escribir sobre un ícono de la cultura popular y específicamente sobre la cultura de izquierda resulta de por sí un desafío, especialmente si no se desea caer en la posición panfletaria o simplemente en la caricatura. Lo mismo sucede con los realizadores que se lanzan en la tarea de recrear la vida de los denominados “grandes personajes de la historia”. A Esta altura, no cabe ninguna duda que el “Che Guevara”, más que Ernesto Guevara de la Serna, constituye uno de los íconos fundamentales del ...

  4. Paradigmas escolares vigentes : influjos en el sistema educativo español

    OpenAIRE

    José Penalva Buitrago

    2009-01-01

    Este artículo presenta un estudio de los paradigmas escolares vigentes. Dentro de la extensión bibliográfica relativa a este tema, el autor sintetiza las tendencias dominantes sobre el modelo de escuela en torno a cuatro paradigmas: i) el paradigma de la eficacia, ii) de la organización compleja, iii) de la cultura contra-hegemónica, y iv) de la creación de significados compartidos. Al final, se presta atención al modelo de escuela del sistema educativo español, reseñando las influencias que ...

  5. Dos Paradigmas Hermenéuticos del Pensamiento Político de Tomás de Aquino: sus Virtudes, Limitaciones y Virtualidades

    Directory of Open Access Journals (Sweden)

    Santiago Argüello

    2016-06-01

    Full Text Available RESUMEN: El presente trabajo examina dos de los principales modelos de exposición del pensamiento político de Tomás de Aquino vigentes en el siglo XX. Uno, en cuya representación se ha escogido la obra de Eschmann, mira a la relación de la obra del Aquinate con sus predecesores; el otro, adecuadamente representado por Ullmann, mira a la relación de dicha obra con el pensamiento que se proyecta a partir de él hacia la Modernidad. Al determinar tanto las virtudes cuanto limitaciones propias de estos modelos hermenéuticos, se hace posible advertir las virtualidades presentes en los mismos, abriendo nuevos caminos de investigación que superen la tensión concebida entre el poder eclesiástico y el civil, así como el temor por reanimar un concepto que, si bien embrionario en la obra del autor medieval, es imprescindible para comprender cabalmente su reactivación del republicanismo aristotélico. Tal es el concepto de nación.

  6. Scuola, infanzie e culture in Quebec. Le politiche educative interculturali dal paradigma culturalista al paradigma civico

    Directory of Open Access Journals (Sweden)

    Letizia Caronia

    2009-07-01

    Full Text Available Questo articolo propone un’analisi storica e una riflessione critica sui modi con cui il Quebec ha affrontato e costantemente riaffronta il problema della scuola pubblica in una società storicamente multiculturale, multietnica e plurilingue. In particolare, la riflessione riguarda il piano normativo e legislativo e le politiche scolastiche via via elaborate, per rispondere alla sfida di pensare e costruire una scuola pubblica capace di costruire una “infanzia quebecchese”. Una lettura del’curricolo ideale’ - si dirà - ci dice poco sulla ‘realtà’ educativa di un paese. Eppure, in Quebec come altrove, le politiche scolastiche costituiscono i segnali pubblici del modo con cui un paese – rappresentando pubblicamente e ufficialmente la sua scuola - rappresenta se stesso, i propri valori, le proprie concezioni di ‘infanzia’. Dopo un breve quadro storico inteso a tracciare l’origine multiculturale del Quebec (come di tutti gli stati nordamericani, par.1, saranno presi in esame la legge 101 (1977 che sancisce il francese come lingua ufficiale di insegnamento e il dibattito sempre vivo e lacerante che ha accompagnato questa legge e le sue successive modifiche (parr. 2-4. In secondo luogo, saranno presi in esame il recente processo di laicizzazione della scuola quebecchese sancito dalla legge 118 (giugno 2000 e le profonde implicazioni culturali, politiche e identitarie di tale processo (parr. 5-8. In un paese che storicamente ha fatto un uso a carattere esplicitamente identitario del riferimento alle religioni dei due gruppi maggioritari, che ha costruito su esso la propria organizzazione sociale, le identità dei gruppi e i loro rapporti di forza, la deconfessionalizzazione della scuola pubblica ha implicazioni e significati culturali del tutto peculiari. Infine sarà analizzata l’assunzione ufficiale della vocazione interculturale della scuola pubblica (parr. 9-11. L’incrocio di questi tagli prospettici fa emergere i

  7. Un nuevo paradigma de negocio: la empresa social. Ganadoras del XIX Premio AECA de Artículos sobre Contabilidad y Administración de Empresas

    OpenAIRE

    Guzmán Raja, Manuela; Martínez Franco, Carmen María

    2013-01-01

    Las autoras recibieron en Madrid el citado galardón, en el acto que la Asociación Española de Contabilidad y Administración de Empresas (AECA) organizó a tales efectos en la sede del Club Financiero Génova, donde realizaron una presentación pública de su trabajo, que será publicado en breve en el próximo número de la Revista AECA, así como un resumen del mismo en el diario de difusión nacional Cinco Días. El artículo premiado nace como respuesta a la búsqueda de alternativas viables en la act...

  8. Mercosur post elecciones: posibles escenarios dos paradigmas en disputa

    OpenAIRE

    Lagarde Munin, Oscar Andrés; Mucciaccia, Facundo

    2014-01-01

    Al analizar la historia del Mercosur, se observan claramente dos fases bien diferenciadas. En la primera década (años 90) el proceso estuvo fuertemente influenciado por el llamado regionalismo abierto, siguiendo una lógica estrictamente comercial propia de la hegemonía neoclásica de entonces; mientras que en la segunda década se produjo un cambio de paradigma, traducido en una mayor intervención del Estado como rector del proceso de integración y la consecuente modificación de las agendas, e...

  9. Los paradigmas financieros en tiempos de crisis

    Directory of Open Access Journals (Sweden)

    Guillermo de la Dehesa

    2014-12-01

    Full Text Available La crisis financiera mundial de finales del siglo XX ha puesto en evidencia los problemas de aplicación de los paradigmas financieros sobre los que se basa la actividad inversora de los agentes económicos que intervienen en los mercados de capitales. Esta experiencia ha demostrado, una vez más, que la aplicación de las teorías y de los modelos más consolidados en la ciencia de las finanzas no funciona adecuadamente, bien porque los supuestos sobre los que se basan dejan de darse en situaciones críticas, bien porque no se utilizan de forma correcta. No quiero decir que dichas teorías o modelos no sean coherentes, ya que son los que han permitido el enorme desarrollo de los mercados financieros, pero tienen problemas en los momentos críticos.

  10. Evaluación del bienestar en proyectos de ecoaldeas a partir del paradigma del desarrollo a escala humana. Los casos de Sunseed, Lakabe y Los Baños al–Hamam

    OpenAIRE

    Sola Hurtado, Ana Ángeles

    2012-01-01

    Hablaremos de un movimiento que surge como crítica a un modo de vida que podemos reconocer en la sociedad actual, con la lógica del sistema capitalista moderno, donde se potencia la individualidad frente a la colectividad. En este contexto aparecen diversas comunidades intencionales con fuertes motivaciones sociales y ecológicas que pretenden vivir de otra manera desligándose de las tendencias globales de desarrollo. Veremos que las ecoaldeas son construcciones sociales, centra...

  11. Estado seguro — ciudadano amenazado: El paradigma de la seguridad y sus gestos simbólicos

    OpenAIRE

    Londoño Carvajal, Germán

    2011-01-01

    En este trabajo propongo como tema de reflexión el paradigma securitario en las democracias contemporáneas —con una particular y casi exclusiva referencia a Colombia—. Este paradigma postula la seguridad como valor principal y como principio fundamental del Estado, que soslaya los clásicos pilares del Estado Social y democrático de derecho. ¿En qué consiste ese paradigma? ¿Cuáles son sus bases fundamentales y, sobre todo, cuáles son sus repercusiones en la vida c...

  12. EL PODER CONSTITUYENTE “EXTRAORDINARIO” COMO PARADIGMA DE RESPONSABILIDAD DEL ESTADO. UN MODELO (DES) DIBUJADO DESDE LA TEORÍA DE JUEGOS.

    OpenAIRE

    Alonso Niño, Edwin Hernando

    2013-01-01

    En el escrito se advierte de la íntima conexión entre las inconsistencias técnicas de la Constitución de 1991, que no previó los mecanismos adecuados para la salvaguarda del pacto constituyente. Por esta vía, quedó abierta la puerta para que sea el juez constitucional el que, a través de la teoría de la sustitución de la Constitución, le establezca límites al poder de reforma, y de esta manera se pone en el panorama la posibilidad de que surja una eventual Responsabilidad que sea posible imp...

  13. A che punto siamo con la pianificazione territoriale regionale e paesaggistica? Prima parte

    OpenAIRE

    De Luca, Giuseppe

    2014-01-01

    Raccolta di contributi di sugli esiti della pianificazione territoriale e paesaggistica regionale italiana a 14 anni dalla modifica costituzionale del 2001 che ha ritagliato un ruolo concorrente per le Regioni; a 10 anni dalla emanazione del Codice dei beni culturali e del paesaggio del 2004, e a e 8 dall’inizio del ciclo di programmazione europea 2007-2013). Questa prima parte interessa le regioni: Liguria (scritti di S. Capurro, A. Canziani, S.G. Lanza), Lombardia (scritti di L. Lussignoli,...

  14. RESPUESTA DE LOS ACADÉMICOS DE UNA UNIDAD CIENTÍFICA ANTE EL CAMBIO DE PARADIGMA EDUCACIONAL EN UNA UNIVERSIDAD CHILENA DEL CONSEJO DE RECTORES Academic answerer of a cientifc unit to a change of educacional paradigm in a chilean university of rectors council

    OpenAIRE

    CLaudio Brieba Rodríguez

    2006-01-01

    Entre los años 2001 y 2004, se realizó, a través de metodología inductiva y por medio de encuestas tipo panel, un estudio de tipo descriptivo, interpretativo y comprobatorio que permitiese entender la dinámica de la respuesta de los académicos de una unidad científica ante el cambio de paradigma educacional (del conductismo al constructivismo). Se presentan los resultados que indican que el cambio no fue tan estresante como se esperaba, aunque por ser la mayoría de los Académicos profesionale...

  15. La construcción cultural del cuerpo: El paradigma de los trastornos de la conducta alimentaria The cultural body building: The paradigm of eating disorders

    Directory of Open Access Journals (Sweden)

    Rosa Behar A

    2010-12-01

    Full Text Available Antecedentes: La construcción de la imagen corporal ideal se basa en valores, creencias y patrones estéticos característicos de nuestra sociedad occidental, en cuyo contexto emergen los trastornos alimentarios (TCA. Objetivo: Describir los factores que contribuyen a la construcción cultural del cuerpo en los TCA. Método: Se efectuó una revisión exhaustiva de la evidencia en la literatura especializada nacional e internacional. Resultados: El modelo de belleza occidental contemporáneo promueve una silueta corporal delgada, sinónimo de éxito, atractivo e inteligencia, observada principalmente en la clase social alta, enfatizada por el modelaje, los medios de comunicación, la publicidad y el culto narcisista al cuerpo, predisponiendo al desarrollo de los TCA. También contribuyen a la construcción cultural del cuerpo, factores individuales, tales como las diferencias genéricas (95% de los casos de TCA afectan a mujeres, la identificación predominante con el estereotipo de rol de género femenino, la mayor prevalencia en la raza blanca, la relevante influencia de la familia y las amistades sobre el peso, silueta y alimentos, las críticas y/o burlas de los otros significativos, el reforzamiento social respecto a los cambios biológicos y emocionales de la adolescencia, los rasgos perfeccionistas y la filiación a los sitios web "pro-ana" y "pro-mia". Conclusiones: La internalización de las presiones socioculturales genera consecuencias negativas y distorsionadas en los cuerpos femeninos, especialmente en mujeres adolescentes y adultas jóvenes en riesgo para desarrollar TCA. Son necesarias las estrategias de prevención primaria y psicoeducación para manejar en un estilo más sano los mensajes mediáticos enfocados en la perfección corporal.Background: Ideal body image building is based on values, beliefs and aesthetic patterns characteristic of our western society where eating disorders (ED emerge. Objective: To describe factors

  16. Novos paradigmas literários

    Directory of Open Access Journals (Sweden)

    Denise Azevedo Duarte Guimarães

    2005-12-01

    Full Text Available O artigo estuda a emergência de novos paradigmas literários, procurando refletir acerca das textualidades contemporâneas. Focaliza os hipertextos informatizados e a poesia multimídia, com o intuito de desvendar como estão sendo criados novos procedimentos expressivos e em que medida eles podem ser identificados com reflexões teóricas anteriores acerca do texto literário impresso. Remete a questões ligadas à leitura dos diferentes tipos de signos e aos modos como eles se integram para a constituição dessas novíssimas linguagens híbridas em novos suportes.El artículo estudia la emergencia de nuevos paradigmas literarios, procurando reflejar acerca de las textualidades contemporáneas. Enfoca los hipertextos informatizados y la poesía multimedia, intentando desvendar cómo están siendo creados nuevos procedimientos expresivos y en qué medida ellos pueden ser identificados a reflexiones teóricas anteriores acerca del texto literario impreso. Remite a cuestiones ligadas a la lectura de los diferentes tipos de signos y a los modos cómo ellos se interaccionan para la constitución de los novísimos lenguajes híbridos en nuevos supuestos.This article investigates the emergence of new literary paradigms as it tries to understand new contemporary textualities. It analyses some hypertexts and multimedia poetry trying to trace how new expressive procedures are being created. How can these new languages be identified and what are their relations to previous theories which dealt with the literary printed text? This study approaches questions linked to the reading of different types of signs and the modes they function towards the fabrication of these new hybrid languages.

  17. Comunicato Stampa della IARC N°231 - "LA MAGGIOR PARTE DEI TUMORI NON SONO CAUSATI DALLA "CATTIVA SORTE" - LA IARC REPLICA AD UN ARTICOLO SCIENTIFICO IL QUALE SOSTIENE CHE FATTORI AMBIENTALI E FATTORI LEGATI ALLO STILE DI VITA SIANO RESPONSABILI DI MENO DI UN TERZO DI TUTTE LE NEOPLASIE " - del 13 gennaio 2015

    OpenAIRE

    Fellone, Lucio

    2015-01-01

    Versione autorizzata in italiano del Comunicato Stampa della IARC  N°231 pubblicato il 13 gennaio 2015: "LA MAGGIOR PARTE DEI TUMORI NON SONO CAUSATI DALLA "CATTIVA SORTE" - LA IARC REPLICA AD UN ARTICOLO SCIENTIFICO IL QUALE SOSTIENE CHE FATTORI AMBIENTALI E FATTORI LEGATI ALLO STILE DI VITA SIANO RESPONSABILI DI MENO DI UN TERZO DI TUTTE LE NEOPLASIE. Documento originale all'indirizzo:  http://www.iarc.fr/en/media-centre/pr/2015/pdfs/pr23...

  18. Paradigma de la comlejidad, modelos científicos y conocimiento educativo

    OpenAIRE

    Romero Pérez, Clara

    2003-01-01

    El objetivo de este artículo es mostrar los principios epistemológicos sobre los que se apoya el Paradigma de la Complejidad y la Teoría del Caos, así como también contextualizar su desarrollo en el marco del debate epistemológico actual. Este Paradigma aglutina a científicos de diversos campos de conocimiento que insisten en la conveniencia de adoptar nuevos modelos teóricos, metodológicos y, por ende, una nueva epistemología, que permita a la comunidad científica elabor...

  19. Proust contra el paradigma indiciario

    OpenAIRE

    Melamed, Analía

    2003-01-01

    Según Carlo Ginzburg la Recherche de Proust se rige por el mismo paradigma indiciario que encuentra en las prácticas detectivescas de Sherlock Holmes, en los análisis de pinturas de Morelli, en la interpretación de los sueños de Freud. En todos ellos se da particular relevancia a las huellas, fragmentos, síntomas, índices, pues el descubrimiento de la verdad consiste en su lectura e interpretación. Pero en la novela proustiana los indicios se multiplican y contradicen, las lecturas son variab...

  20. Hrad Prácheň

    Czech Academy of Sciences Publication Activity Database

    Durdík, Tomáš

    Horažďovice : Prácheňsko, 2009, 46-49, 63-65. ISBN 978-80-254-6202-7 Institutional research plan: CEZ:AV0Z80020508 Keywords : castle * castellology * Prácheň * medieval archaeology * architecture * Middle Ages * Bohemia Subject RIV: AC - Archeology, Anthropology, Ethnology

  1. Stile didascalico e verità del mito in un exemplum ovidiano : Ars amatoria 1, 623-6

    Directory of Open Access Journals (Sweden)

    Federica Bessone

    2010-11-01

    Full Text Available Nell'Ars amatoria l'uso ironico degli exempla mitologici rientra nella parodia del genere didascalico. Per dimostrare che le blanditiae piacciono anche alle donne caste e vergini, il maestro d'amore ricorda che Giunone e Atena si vergognano “ancora adesso” di non aver vinto il Giudizio di Paride. L'impiego di una formula didascalica lucreziana dà scherzosamente una pretesa di scientificità a un exemplum tratto dal mito, e da un mito spesso contestato per il suo contenuto incredibile e scandaloso. Ovidio dà una risposta polemica alla critica razionalistica del mito espressa nelle Troiane di Euripide: benché disinteressate al matrimonio, anche la sposa di Giove e la dea vergine per scelta dovevano desiderare ardentemente l'elogio della bellezza, essendo soggette come qualsiasi donna ed essere vivente alla legge della vanità universale. La prova viene dal seguito del mito stesso: lo stilema eziologico nunc quoque rimanda al proemio dell'Eneide, dove il giudizio di Paride è una delle motivazioni antiche dell'ira di Giunone, motore del poema. Il rimando al testo nazionale dei Romani garantisce la verità del mito preso a paradigma dal maestro d'amore: per quanto problematico, quel racconto mitico ha una sua realtà indubitabile; l'esistenza dell'Eneide è la prova – poetica – che l'offesa nella vanità è per Giunone una ferita che perdura. Svincolato ormai dalle sue pretese di veridicità, il mito può riaffermare qui, per gli scopi argomentativi del praeceptor amoris, la sua incontestabile verità letteraria ed ‘umana’.

  2. Psicología y discapacidad: un encuentro desde el paradigma social

    Directory of Open Access Journals (Sweden)

    Lucrecia Alfaro-Rojas

    2013-06-01

    Full Text Available El tema de la discapacidad ha sido abordado desde diversos paradigmas o modelos que han dictado el modo de brindar atención a personas con esta condición. Aunque en la literatura se encuentran diversas denominaciones para estos paradigmas, el presente artículo se refiere a los tres paradigmas que engloban las posturas más habituales hacia el tema de la discapacidad: el paradigma tradicional, el paradigma médico-biológico y el paradigma social. Es dentro de este último que se concibe a la persona con discapacidad desde un enfoque biopsicosocial y se apunta hacia una integración real y efectiva de esta población en todas las esferas de la vida en la sociedad. Este nuevo paradigma social obliga a replantear los abordajes, que, hasta hace poco tiempo, eran bien vistos y promovidos por los profesionales que se relacionaban laboralmente con esta población. La Psicología no escapa a esta influencia y, por tanto, se ve en la necesidad de revisar algunas de sus prácticas tradicionales a la luz del nuevo paradigma, que propone trascender la atención centrada exclusivamente en la persona para incidir en el contexto social. Esto implica, por ejemplo, el surgimiento de nuevas actitudes en el quehacer cotidiano de los y las profesionales en Psicología y, por tanto, una nueva planificación y orientación de los sistemas de atención.

  3. Natura pedagogica e rilevanza politica del concetto di 'composizione musicale'

    Directory of Open Access Journals (Sweden)

    Luca Aversano

    2013-12-01

    Full Text Available Il contributo discute ed evidenzia le relazioni che intercorrono tra il concetto di composizione musicale e gli àmbiti della pedagogia e della politica. A partire da un'analisi storico-lessicologica della parola "composizione" vengono illustrate le variabili semantiche del termine e  il tratto comune che le caratterizza, ossia il riferimento costante a un principio razionale di aggregazione di elementi diversi, a cui l'attività compositiva, nelle sue possibili esplicazioni e in quanto progetto di organizzazione sonora, è sempre riconducibile. La composizione musicale viene dunque interpretata come metafora-chiave di una possibile strada per la soluzione di un problema molto urgente della contemporaneità: come tenere insieme persone provenienti da culture diverse, come combinare identità differenti in una nuova identità comune.D'altro canto, la musica d'arte, nel suo oscillare tra testo notato e interpretazione, è intimamente affine al paradigma giuridico che sta a fondamento di qualsiasi organismo sociale.

  4. Aplicación del paradigma del diseño universal en la educación universitaria: implantación de estudios y percepción sobre inclusión de medidas curriculares

    OpenAIRE

    Sanchez Fuentes, Sergio

    2013-01-01

    [ES] Durante la segunda mitad del Siglo XX diferentes acontecimientos llevaron a varios sectores de la sociedad a trabajar con un mismo objetivo, lograr la máxima accesibilidad para los ciudadanos, independiente de cuáles fueran sus condiciones y características personales. Por un lado, y fundamentalmente en los países de América del Norte, el movimiento de las personas con discapacidad comenzó a desarrollar una importante actividad en favor de su visibilidad en la sociedad y por la lucha de ...

  5. Conocer y ser en el paradigma constructivista

    Directory of Open Access Journals (Sweden)

    Jose Antonio Camargo Rodriguez

    2014-03-01

    Full Text Available Toda teoría acerca del aprendizaje se fundamenta en una interpretación del conocimiento, la cual se encuentra, a su vez, ligada a una cierta concepción de «ser». No será posible asimilar verdaderamente cualquiera de tales teorías si se ignoran, o no se consideran con el debido detenimiento, las ideas de conocer y «ser» que le sirven de base. Sc pone de presente que el constructivismo, en contraste con la teoría transmisionista de la enseñanza y el aprendizaje, predominante en la pedagogía tradicional, tiene su fundamento en la interpretación según la cual el conocer es una actividad humana en la que, a medida quo conoce, el hombre construye el «ser». Antes de todo conocimiento, las cosas no tienen un «ser»; están ahí, pero no se sabe lo que son. El «ser», quo constituye el objeto de todo conocer, aquello que el sujeto persigue a través de su conocimiento, no toes dada de antemano, ni le viene de fuera, sino quo es una elaboración quo el mismo realiza a través de su actividad cognoscitiva, un contenido de su propia conciencia. Hay, pues, una cierta paradoja entre las ideas de conocer y «ser» que sirven de fundamento al constructivismo, cuya reflexión se propone en aras de ganar una mejor comprensión, de encontrarle a este paradigma un sentido más allá de la pedagogía y la didáctica.

  6. Minorías sexuales: sobre el paradigma de la Tolerancia y el paradigma de la Ciudadanía Plena

    Directory of Open Access Journals (Sweden)

    Daniel Kantor

    2011-01-01

    Full Text Available Proponemos dos formas paradigmáticas de concebir los derechos de las minorías sexuales en un marco jurídico-político y social general. El primer paradigma es una mirada a través del prisma de la "Tolerancia", el segundo desde la perspectiva de la "Ciudadanía Plena". Hemos deducido las características de ambos paradigmas a partir de proyectos de leyes, leyes y casos jurisprudenciales referentes al "Derecho de Asociación" y al "Derecho al Matrimonio entre Personas del Mismo Sexo". Revisamos el discurso jurídico y las implicancias políticas de las sentencias, y algunos aspectos histórico-sociales de las luchas por las reivindicaciones de las minorías sexuales en Argentina.

  7. Il lungo freddo storia di Bruno Pontecorvo, lo scienziato che scelse l'URSS

    CERN Document Server

    Mafai, Miriam

    2012-01-01

    Nelle parole della grande giornalista recentemente scomparsa, la documentata narrazione della storia di Bruno Pontecorvo, fisico nucleare di fama mondiale che, nel pieno della Guerra fredda, scelse di abbandonare l'Occidente e di lavorare e vivere nell'Unione Sovietica. Grazie alla capacità della Mafai nel ricostruire gli eventi cruciali della vita di Pontecorvo in un nuovo quadro rivelatore, "Il lungo freddo" non offre solo un'inedita prospettiva sulla drammatica corsa alla bomba atomica - dalle decisive scoperte del Progetto Manhattan alla tragica esplosione di Hiroshima, dalla prima atomica sovietica alla bomba all'idrogeno - ma rappresenta soprattutto la memoria collettiva di una generazione che ha posto la politica al centro delle proprie scelte di vita. E svela i drammi umani di un conflitto che per più di quarant'anni ha diviso il mondo.

  8. Toetsen als Leerinterventie. Samenvatten in het Testing Effect Paradigma [Tests as learning interventions. Summarization in the testing effect paradigma investigated

    NARCIS (Netherlands)

    Dirkx, Kim; Kester, Liesbeth; Kirschner, Paul A.

    2011-01-01

    Dirkx, K. J. H., Kester, L., & Kirschner, P. A. (2011, July). Toetsen als leerinterventie. Samenvatten in het testing effect paradigma onderzocht [Tests as learning interventions. Summarization in the testing effect paradigma investigated]. Presentation for Erasmus University Rotterdam, Rotterdam.

  9. ¡Atrevámonos a romper los viejos paradigmas!

    OpenAIRE

    Velázquez, Esther

    2013-01-01

    En este trabajo comparto una reflexión crítica en torno a los paradigmas que sustentan la educación universitaria y la economía, partiendo de la base de que el paradigma que sustenta a ambas es el mismo, el viejo paradigma newtoniano-cartesiano. Esta toma de consciencia me lleva a unirme a las voces que reclaman la necesidad de romper con estos viejos paradigmas y abrazar uno nuevo, holístico e integrador. Si, como docentes, nos atrevemos a romper los viejos paradigmas; si, como economistas, ...

  10. Book Review, 50 Animali che hanno cambiato il corso della Storia, Eric Chaline

    Directory of Open Access Journals (Sweden)

    Manuel Graziani

    2013-06-01

    Full Text Available Copertina rigida "anticata", brossura cucita, carta di pregio, grafica curata nei minimi dettagli. Rientra senza dubbio nel novero della pubblicistica divulgativa di qualità questo volume uscito in Italia per i tipi di Ricca Editore. Un volume, elegante e classico, che racconta l'evoluzione dell'uomo da cacciatore ad agricoltore/pastore e, più in generale, di come ha preso piede nella storia il nuovo approccio nei confronti del regno animale. "Oltre al ruolo nel commercio e nell'agricoltura" scrive l'autore, "gli animali hanno contribuito in diversi altri modi alla cultura e alla storia dell'uomo. Alcuni come il leone, lo scarabeo sacro, il cobra e l'aquila di mare testa bianca hanno una lunga storia come simboli politici e religiosi. Nel campo della scienza e della medicina, lo studio di animali come il moscerino della frutta, il fringuello e l'iguanodonte è stato determinante per lo sviluppo della nostra conoscenza dell'evoluzione del mondo naturale."Ad ognuno dei 50 animali "che hanno cambiato il corso della Storia" viene dedicato un paragrafo sintetico, ma comunque esaustivo, corredato da foto, illustrazioni, immagini d'epoca e brevi notizie storiche, curiose e al contempo istruttive. Cosa unisce la zanzara al gin tonic? E l'ape alla mandorla? Lo sapevate che Buffalo Bill dove aver cacciato 4.000 bisonti nella sola stagione 1867-1868 divenne uno strenuo difensore della creatura vivente più grande dell'America del Nord? E che il lombrico, oltre alla sua incessante azione di riciclo biologico e minerale, è considerato una vera prelibatezza dai Maori della Nuova Zelanda? E ancora, che durante la seconda guerra mondiale un piccione chiamato G.I. Joe ricevette una medaglia dall'esercito degli Stati Uniti per aver salvato oltre mille persone? Oppure che, in contrasto con le superstizioni occidentali secondo le quali il gatto è di cattivo auspicio, in Giappone i gatti sono considerati dei veri portafortuna e che lo sport del polo ebbe origine

  11. CONECTIVISMO, ¿UN NUEVO PARADIGMA EN LA EDUCACION ACTUAL?

    Directory of Open Access Journals (Sweden)

    Liana Carolina Ovalles Pabon

    2014-06-01

    Full Text Available Este proyecto es producto de una reflexión crítica y estructurada por la inminente presencia en la cotidianidad de mecanismos tecnológicos que directa o indirectamente están presentes en los actos pedagógicos, surge la necesidad de entender la forma como está estructurando el pensamiento de los estudiantes y desde el accionar docente, cómo se puede beneficiar el accionar docente y pedagógico de ésta nueva tendencia que gira entorno a la tecnología que permite la conectividad; la educación no puede ser agena a las tendencias y actualizaciones del mundo, por esta razón se crea el paradigma de la educación actual en base al conectivismo.

  12. Propuestas para el nuevo paradigma educativo de la historia

    OpenAIRE

    de Barros, Carlos

    2008-01-01

    Las propuestas y reflexiones que hoy ponemos a debate sobre el qué, el cómo y el por qué de la enseñanza de la historia en el nuevo siglo, responden a un doble interés: 1) Poner en valor, didácticamente, algunos de los consensos sobre la escritura de la historia ya establecidos en el Manifiesto de Historia a Debate de 2001.1 2) Recoger, en el contexto del nuevo paradigma historiográfico que defendemos, debates y aportaciones recientes de la metodología didáctica y la epistemología pedagógica,...

  13. Evaluación del aprendizaje en la enseñanza del Derecho

    Directory of Open Access Journals (Sweden)

    Emilio Marenales Berrospe

    2015-09-01

    Full Text Available Contenido: Evolución del concepto de "evaluación". Paradigmas de evaluación. Concepto de "paradigma". El paradigma cuantitativo. El paradigma cualitativo. Clasificación de los instrumentos de evaluación. Concepto de instrumento de evaluación. Técnicas más usuales en cada paradigma. Características y ejemplos de los instrumentos más usuales. En el paradigma cuantitativo.Exámenes convencionales. Orales. Escritos.Tests pedagógicos. Tests de rendimiento. Tests informales o pruebas objetivas. Pruebas prácticas o de ejecución.  En el paradigma cualitativo. La observación. Registro anecdótico o crítico. Registro acumulativo o pautas de observación dirigida. Escalas de calificación o valoración. Cuestionarios. Inventarios. La entrevista. Conclusiones

  14. Che legend elab ka 40 aastat hiljem / Evelyn Kaldoja

    Index Scriptorium Estoniae

    Kaldoja, Evelyn, 1980-

    2007-01-01

    Ilmunud ka: Postimees : na russkom jazõke 9. okt. lk. 10. Argentinas sündinud ja 1967. aastal hukatud revolutsionääri Ernesto Che Guevara poliitikukarjäärist, tema panusest Kuuba revolutsiooni ja poliitikasse. Ernesto Che Guevara mälestamisest Ladina-Ameeerika riikides. Lisa: Kuuba revolutsioon; Che Guevara elu

  15. Tema 1. Introducción al paradigma orientado a objetos

    OpenAIRE

    Cachero Castro, Cristina; Ponce de León Amador, Pedro José

    2009-01-01

    En la primera parte del tema se presenta el concepto de abstracción y los diferentes mecanismos de abstracción presentes en los lenguajes de programación. En la segunda parte nos centramos en el paradigma de programación orientada a objetos (POO), estudiando las carácterísticas de los lenguajes orientados a objetos (LOO), su historia y las metas de la POO.

  16. Conservazione programmata: i risvolti economici di un cambio di paradigma

    Directory of Open Access Journals (Sweden)

    Stefano Della Torre

    2010-10-01

    Full Text Available La conservazione programmata è una procedura innovativa, pensata come passaggio dal restauro come evento alla conservazione come processo di lungo periodo. Essa è qualcosa di più della manutenzione e del monitoraggio: è una strategia complessa, che riunisce la mitigazione dei rischi di grande scala e una accurata organizzazione delle attività quotidiane. Attuarla è dunque qualcosa di più che fare manutenzione: significa impiantare uno scenario nuovo, ponendo questioni sulle strategie e sui nessi tra le attività conservative e i processi di sviluppo locale.Questo articolo introduce la conservazione programmata come tentativo di andare oltre l’affermazione che il patrimonio conta per il suo impatto sull’economia turistica. Il programma di ricerca si incentra sulle esternalità positive del processo di conservazione. Se il capitale umano è un parametro interessante per valutare un’economia, la conservazione conta per il suo impatto sulla capacità di dubitare, di imparare, di innovare: in altre parole, il focus si sposta dal patrimonio come asset dato, alle attività conservative come opportunità per accrescere il capitale intellettuale.La tesi di fondo è che la conservazione programmata fornisce più esternalità positive, e rende la loro gestione più facile, di quanto non avvenga nel tradizionale modello si restauro/promozione.  Planned conservation is an innovative procedure, stepping from restoration as event, to preservation as long-term process. It is something more than maintenance and monitoring: it is a rather complex strategy, merging a large scale reduction of risks and a careful organization of daily activities. Implementing planned conservation, therefore, is something more effective than implementing maintenance: it means setting a totally new scenario, posing questions about strategies and links between preservation activities and local development processes. This paper introduces planned conservation as an attempt

  17. The paradigm’s origin in the modern publicitary photography: the Tenedor of André Kertesz or the Cuello Idestyle of Paul Outerbridge Origen del paradigma de la fotografía publicitaria moderna: el Tenedor de André Kertesz o el Cuello Idestyle de Paul Outerbridge

    Directory of Open Access Journals (Sweden)

    José Manuel Susperregui

    2010-08-01

    Full Text Available Due to the ambiguity of the origins of advertising photography and its paradigm this article has been focussed on two anthological images : the Kertesz Fork and Outerbridge’s Idestyle Neck. The analysis of these images and their authors has enabled us to conclude that Outerbridge’s photography the Idestyle Neck is more paradigmatic as it conveys sufficient and necessary information to enable the receiver to perfectly identify the product being advertised, surpassing the Kertesz Fork at this information level. Debido a la ambigüedad sobre los orígenes de la fotografía publicitaria y su paradigma este artículo se ha centrado en dos imágenes antológicas, como son el Tenedor de Kertész y el Cuello Idestyle de Outerbridge. A través del análisis de estas imágenes y sus autores se llega a la conclusión de que la fotografía de Outerbridge, el Cuello Idestyle, es más paradigmática porque contiene la información suficiente y necesaria para que el receptor pueda identificar perfectamente el producto que se anuncia, superando al Tenedor de Kertész en este nivel de información.

  18. L'Ombrone pistoiese, il fiume che non c'è

    OpenAIRE

    G.A.Centauro

    2011-01-01

    Si tratta di saggio storico, inserito in opera monografica, dedicato all’approfondimento delle vicende che hanno interessato nei secoli il fiume, dal periodo arcaico a quello medievale e moderno, con particolare riferimento alla topografia antica dell’ager pistoriensis. Il saggio è articolato in capitoli e paragrafi, con ampio repertorio bibliografico, dedicati al bacino fluviale dell’Ombrone pistoiese. In questo saggio l’autore offre un'inedita lettura del legame tra il fiume e le prime colo...

  19. Dalla Fiat al web. Che cosa una ontologia sociale basata sui documenti permette di spiegare

    OpenAIRE

    Casetta, Elena; Torrengo, Giuliano

    2016-01-01

    Nel 2009, prendendo le mosse da articoli e libri pubblicati negli anni precedenti, Maurizio Ferraris proponeva la “documentalità”, una ontologia sociale che, a differenza della received view basata sull’intenzionalità collettiva, individuava il fondamento degli oggetti sociali negli atti iscritti. Prendendo come spunto due oggetti sociali tipicamente torinesi – il capoluogo piemontese è il luogo di nascita del filosofo – e cioè la casa automobilistica Fiat e l’Università di Torino, in questo ...

  20. La macchina che cerca Dio. Nasce LHC forse scoprira' Higgs elusiva particella della creazione

    CERN Multimedia

    Bianucci, P

    2003-01-01

    "LEON Lederman, premio Nobel per la fisica, l'ha misticamente definita la particella di Dio perche' sarebbe il pilastro sul quale si appoggia tutta la materia dell'universo che conosciamo. Piu' tecnicamente, e' la "particella di Higgs", un bosone previsto dal Modello Standard del microcosmo la cui esistenza sarebbe necessaria per giustificare, anche quantitativamente, la massa di tutte le particelle" (1/2 page).

  1. Cercasi lavoratore inflessibile, che non giochi di squadra. L'autismo al lavoro

    OpenAIRE

    Thomas Stephens

    2013-01-01

    Le persone affette da autismo sono sempre più richieste nel mondo del lavoro. In alcuni settori tecnici, questo handicap può infatti rivelarsi una grande risorsa. Gli imprenditori stanno prendendo coscienza delle similitudini esistenti tra le caratteristiche mentali che distinguono un buon programmatore e quelle tipiche della sindrome di Asperger (forma d'autismo senza ritardi nello sviluppo cognitivo): spiccato interesse per un tema particolare, passione per i numeri e i modelli e predilezio...

  2. DESAFÍOS Y PARADIGMAS DE LA EDUCACIÓN SUPERIOR

    OpenAIRE

    Salvador Valencia Carmona

    2012-01-01

    Se plantean como desafíos y paradigmas de la educación superior en nuestro país los siguientes: construcción de la sociedad del conocimiento; acceso universal a la educación superior; recursos presupuestarios acordes con los estándares internacionales; diversificación del financiamiento; transparencia y rendición de cuentas; internacionalización de la educación superior; implantación de mecanismos de evaluación y acreditación En tales aspectos, el Estado Mexicano debe recuperar su liderazgo y...

  3. El Concepto de Marketing Bajo el Paradigma Relacional. Una Agenda para Latinoamérica

    Directory of Open Access Journals (Sweden)

    Judith Cavazos Arroyo

    2010-03-01

    Full Text Available Este artículo presenta un análisis sobre la situación del marketing en América Latina y sus implicaciones en relación a la globalidad. Se reflexiona en la necesidad de repensar la conceptualización del marketing considerando los avances y los retos para las empresas de la región, así como las características de mercados dinámicos con demandas de un trato más personalizado. Se destaca la necesidad del uso de las nuevas tecnologías y la adopción de nuevos enfoques, tal es el caso del marketing de relaciones, a través del cual se propone un nuevo paradigma en la disciplina. DOI: 10.5585/remark.v8i1.2124

  4. Abitare e conservare il patrimonio architettonico. Il caso del Convento di Cristo, 1979-2009.

    Directory of Open Access Journals (Sweden)

    Alvaro Barbosa

    2010-12-01

    Full Text Available Abitare è rimanere in un luogo. È interagire con lo spazio, il paesaggio, la natura e gli uomini. Il risultato di quest’azione permane come un segno nel territorio ed è trasmessa alle generazioni future col passare del tempo. In questo modo a si afferma il concetto di patrimonio associato all’azione dell’abitare un luogo sia questo una casa, sia un convento, una città, un paesaggio costruito, etc. I luoghi del patrimonio sono il supporto fisico della memoria sociale, la quale è trasmessa nell’atto stesso del vivere umano. Così la memoria degli uomini è radicata nel modo in cui loro abitano i luoghi. Togliere ai luoghi questa caratteristica di vita, questa funzione dell’abitare, riduce drasticamente il senso del patrimonio ed il suo ruolo di monumento, di memoria vivente. Cercare di mantenere vivo il patrimonio, nelle sue diverse valenze, è il compito principale della società odierna rispetto al patrimonio costruito. Si può affermare che oggi conosciamo tutte le soluzioni tecniche per la conservazione dei monumenti. Non disponiamo tuttavia delle soluzioni sociali capaci di mantenerli viventi e attuanti nel nostro mondo contemporaneo. Il caso del Convento di Cristo diventa un paradigma di questa lotta per una nuova strategia di conservazione centrata sul vivere i luoghi, sull’abitare il patrimonio.

  5. L’immaginazione al lavoro. Che cosa e come conosciamo dal romanzo

    Directory of Open Access Journals (Sweden)

    Gianluca Consoli

    2011-12-01

    Full Text Available L’articolo delinea i fondamenti di un’epistemologia del romanzo, rispondendo alle domande di base: che cosa e come possiamo conoscere attraverso il romanzo. A partire dalla definizione del romanzo come racconto di finzione, viene sviluppata  una posizione di cognitivismo radicale, per la quale il romanzo (a produce conoscenza modale; (b giustifica questa conoscenza in base al principio della verosimiglianza; (c favorisce l’apprendimento per esperienza in virtù dell’esemplificazione immaginativa. Le tesi proposte vengono corroborate in riferimento ai recenti dati sperimentali ottenuti dalle scienze cognitive, in particolare dalla psicologia cognitiva, sull’immaginazione, la finzione, la simulazione.

  6. Dicty_cDB: CHE433 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHE433 (Link to dictyBase) - - - Contig-U14976-1 CHE433P (Link to Original ... sticklw*kcnpfyn*ilsrsw*l*fif*ickssy*in**sr*r*t*kyc*ngs *fck*i igs**kfkcy*yn*vingk--- ---LFQVVXXHLDPKYSVSIY ... FENV Homology vs CSM-cDNA Score E Sequences producing s ignificant alignments: (bits) Value CHE433 (CHE433 ... 009. 4. 4 Homology vs DNA Score E Sequences producing s ignificant alignments: (bits) Value N AE017197 |AE ... 9.21 Homology vs Protein Score E Sequences producing s ignificant alignments: (bits) Value CP001193_372( ...

  7. La nascita imperfetta delle cose la grande corsa alla particella di Dio e la nuova fisica che cambierà il mondo

    CERN Document Server

    Tonelli, Guido

    2016-01-01

    In quel preciso momento, un centesimo di miliardesimo di secondo dopo il Big Bang, si è deciso il nostro destino. In un universo in cui materia e antimateria si equivalevano, e che quindi avrebbe potuto, in ogni istante, tornare a essere pura energia, può essere bastata una leggerissima preferenza del bosone di Higgs per la materia anziché per l'antimateria ed ecco che si è prodotto il mondo che abbiamo sotto gli occhi. "Ecco qua il minuscolo difetto, la sottile imperfezione da cui è nato tutto. Un'anomalia che dà origine a un universo che può evolvere per miliardi di anni." Se tutto nasce da lì, dobbiamo capire in ogni dettaglio quel momento cruciale, ricostruirlo fotogramma per fotogramma, al rallentatore e da diverse angolature. Per questo al Cern di Ginevra è stato realizzato Lhc, l'acceleratore di particelle più potente del mondo, il posto più simile al primo istante di vita dell'universo che l'uomo sia stato in grado di costruire. Per questo da anni i migliori fisici del mondo lavorano giorno...

  8. Tres décadas de Evaluación del Impacto Ambiental en España. Revisión, necesidad y propuestas para un cambio de paradigma

    OpenAIRE

    Tomás Sánchez, José Enrique de

    2014-01-01

    Desde la implantación de la Evaluación del Impacto Ambiental en España, hace ya más de tres décadas, ni los procedimientos ni el concepto mismo parecen haber experimentado evolución alguna, al menos a mejor. Varios factores han contribuido a que, en la actualidad, la EIA se haya convertido en poco más que un requisito administrativo, en “una cosa más” que pedir a los promotores que pretendan implementar sus proyectos. La verdadera importancia de una EIA consistente y orientada a la protección...

  9. El anhelo de autonomía y el resultado casi inevitable de la imitación: la evolución del tercer mundo entre el paradigma weberiano y la búsqueda de un camino propio

    OpenAIRE

    Mansilla, H. C. F.

    2011-01-01

    El desarrollo efectivo en el Tercer Mundo y las prácticas cotidianas en el mismo nos obligan a reconsiderar el debate entre las teorías evolutivas “clásicas” y el relativismo contemporáneo, que postula la incomparabilidad de todos los modelos civilizatorios y de las etapas de la evolución histórica. Max Weber estudió el carácter excepcional de la modernidad occidental, cuyo éxito mundial fue reconocido como tal hasta hace poco. Las sociedades del Tercer Mundo adoptan numerosos valores de orie...

  10. Las tecnologías educativas bajo un paradigma construccionista|bun modelo de aprendizaje en el contexto de los nativos digitales, del programa "Niños con Talento Académico PENTA UC"

    OpenAIRE

    Hess S., Roland

    2015-01-01

    Cuando apareció el concepto del constructivismo, las Tecnologías de Información y Comunicación (TIC) como se conocen hoy, eran aun un sueño. Con la aparición de los Nativos Digitales (Prensky, 2009) cambió el concepto de la educación, dado la tendencia natural de estos Estudiantes en ocupar los Dispositivos Tecnológicos (Notebook, Netbook, Ultrabook, Tablet, SmartPhone, IPhone, etc.) como una herramienta de aprendizaje. Ellos optan por poner atención a lo novedoso, sorprendente, colorido e i...

  11. La teoría crítica de Bolívar Echeverría. Una reinterpretación del paradigma de la comunicación desde América Latina

    OpenAIRE

    Stefan Gandler

    2015-01-01

    Bolívar Echeverría procura captar el concepto de praxis en su concreta dimensión histórica. Si este concepto está inseparablemente vinculado al del sujeto (autónomo) que decide libremente, ¿cómo se puede concebir como algo históricamente determinado, concreto? ¿Cómo reconstruir teóricamente este conjunto de particulares decisiones subjetivas a partir de determinaciones conceptuales históricas-concretas que necesariamente buscan lo general? ¿Cómo concebir cierta determinación cultural de la ...

  12. La salud mental (en la argentina: dos paradigmas en pugna

    Directory of Open Access Journals (Sweden)

    Croxatto, Guido L.

    2012-12-01

    Full Text Available En el presente trabajo se analiza una relectura crítica de la institución de la “discapacidad” en el Derecho Civil argentino a la luz de los nuevos paradigmas en materia de salud mental que tienden a restablecer a los sujetos (mal llamados “discapacitados o “incapaces” en su dignidad y su autonomía, entendiendo que la discapacidad más que una enfermedad o limitación de la persona, (como a menudo se la ha visto es una barrera que traza la misma sociedad que luego, a través del derecho, discapacita (declara discapacitada a la persona. Se sostendrá que la discapacidad encarna una contradicción del derecho. En este marco, se analiza una propuesta de cambio a partir de un nuevo modelo social (en reemplazo del modelo tutelar del Código Civil argentino, que ha demostrado que la “tutela” es un modelo vertical que tiende a silenciar y aislar a quienes más necesitan ser escuchados que pone en el centro el pleno respeto de la dignidad y de la autonomía de las personas usuarias de servicios de salud mental. Se analiza el rol del curador provisorio en los juicios de insania, planteando el interrogante de si debe actuar como un abogado de la persona (Kraut o como un auxiliar del juez (Llambías, acentuando en esos casos el carácter vertical (tutelar de estos procesos (que asimilan el proceso jurídico a una parte del tratamiento médico y en consecuencia, el aislamiento y el silenciamiento de la persona que más necesita ser escuchada durante el proceso judicial: el presunto “incapaz”. La conclusión es que el Derecho Civil debe abandonar la figura de la discapacidad porque discapacitando no ha “protegido” ni “recuperado” a los “incapaces”, sino que los ha aislado, silenciado, matado y anulando como personas (muchas veces, al solo efecto de resguardar un patrimonio. Para el derecho ya no puede haber discapacitados ni incapaces. Solo personas. Se demostrará que la discapacidad es una institución incompatible con un

  13. Entre libros y bytes: las librerías universitarias ante el paradigma digital

    Directory of Open Access Journals (Sweden)

    Reyna Yunuhen Ponce Navarrete

    2012-01-01

    Full Text Available El presente artículo se divide en tres apartados: el primero de ellos da cuenta del panorama actual de las librerías en México, que se caracteriza por la escasez de dichos éstas y por su concentración, tanto económica como geográfica; el segundo, reflexiona sobre las transformaciones del proceso editorial ante el uso de las Tecnologías de Información y Comunicación en su desarrollo, con énfasis en su fase de la comercialización; por su parte, el tercero apartado aborda el caso particular de las librerías universitarias, con el fin de proponer estrategias que fortalezcan sus proyectos culturales, a partir del uso a favor de lo que algunos consideran el último gran reto del mundo editorial: su integración al paradigma digital.

  14. Paradigma experto-novato: Análisis diferencial de la pérdida de consistencia del Tokui Waza en Judo bajo situación específica de fatiga. Expert-Novice paradigm: Differential analysis of the loss of consistency in the Tokui-Waza of Judo under a specif situation of fatigue.

    Directory of Open Access Journals (Sweden)

    García García, José Manuel

    2007-10-01

    Full Text Available ResumenEste estudio pretende analizar si existe pérdida en la consistencia de la técnica especial en Judo cuando se ven comprometidas las reservas energéticas del judoka, y si existen, conocer cuáles son los elementos más significativos que pudieran condicionar la óptima ejecución del mismo. Los combates de Judo suelen terminar con una tasa de acumulación lactácida de entre 14 a 20 mmol/l en sangre. El test utilizado (COPTEST© reproduce un combate de Judo con altos niveles de solicitación anaeróbica que asemejan los requerimientos energéticos de un combate en el contexto de la alta competición. En los últimos años, varios estudios científicos (Sterkowicz,1999,2002, (García 1996,1999,2004, (Monteiro, 2003, (Francini, 2003 han intentado enumerar los posibles aspectos tanto condicionales como técnicos y cognitivos que diferencian a un judoka campeón de otro que no lo es. Método: Utilizando el modelo de investigación del paradigma Experto-Novato de Shulman (1986 se evaluaron 110 judokas de alto rendimiento. Todos realizaron el Coptest (García, 1995. Se consideraron “expertos” a los judokas que habían obtenido medalla en unos JJOO, cto mundial o cto continental. Eran “novatos” los judokas de alto rendimiento que no habían conseguido tal resultado. Se evaluaron las siguientes variables: a Desequilibrio b adecuación secuencial c ángulo requerido para la correcta construcción de la técnica y d elementos determinantes para que exista proyección Se tomaron datos de todas la ejecuciones del Tokui waza durante la ejecución del Coptest (total 4950 proyecciones. El análisis de los datos reveló que existen diferencias significativas en la ejecución del tokui waza realizado por un judoka “experto” al realizado por uno “novato.AbstractThe aim of this study tries to analyze if loss in the consistency of the special technique in Judo exists when are seen it jeopardize the power reserves of judoka and know which are

  15. Dicty_cDB: CHE482 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHE482 (Link to dictyBase) - - - Contig-U15645-1 CHE482P (Link to Original ... nnfqnvrnytsscwrxr*kkcysikkrtkeirkrekdsrs*skesr*eis skw **w*tke*ketrts*re***lg*itnesk*rkdykrmdrcitidriisw*i ...

  16. Dicty_cDB: CHE595 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHE595 (Link to dictyBase) - - - Contig-U15754-1 CHE595P (Link to Original ... ersslvc rklshdsitsyls*ilw**ipn*isnklw*prnfgyrsr*yl*tsh *ylpresrwy*kic ww*tnfrkktlersyivq*ifpw**wcwswcfspdw ... ersslvc rklshdsitsyls*ilw**ipn*isnklw*prnfgyrsr*yl*tsh *ylpresrwy*kic ww*tnfrkktlersyivq*ifpw**wcwswcfspdw ...

  17. Dicty_cDB: CHE315 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHE315 (Link to dictyBase) - - - Contig-U16455-1 CHE315P (Link to Original ... 03 0.0 3 CO483664 |CO483664.1 GQ0206.B3_A14 GQ020: Clean ... ROOTS systems -Diurnal cycle Picea glauca cDNA clo ...

  18. Dicty_cDB: CHE648 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHE648 (Link to dictyBase) - - - Contig-U16524-1 CHE648P (Link to Original ... .1 Influenza A virus (swine/Cotes d'Armor/1515/99 (H1N1 )) partial N1NA gene for Neuraminidase, genomic RNA ...

  19. Dicty_cDB: CHE845 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHE845 (Link to dictyBase) - G22884 DDB0220687 Contig-U11704-1 CHE845P (Lin ... _1( BC116182 |pid:none) Homo sapiens TAF1-like RNA polymer ... 33 9.6 (Q8IZX4) RecName: Full=Transcription ini ...

  20. Dicty_cDB: CHE120 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHE120 (Link to dictyBase) - - - Contig-U11687-1 CHE120P (Link to Original ... clqrfkpfkt--- ---ktkytqxipqext*ns*srtrsyxrqiyr*kig*tlc *nh*ifkrihg*fp*xtfts *sqr Frame B: wptgckksikygiitw ...

  1. La teoría crítica de Bolívar Echeverría. Una reinterpretación del paradigma de la comunicación desde América Latina

    Directory of Open Access Journals (Sweden)

    Stefan Gandler

    2015-01-01

    Full Text Available Bolívar Echeverría procura captar el concepto de praxis en su concreta dimensión histórica. Si este concepto está inseparablemente vinculado al del sujeto (autónomo que decide libremente, ¿cómo se puede concebir como algo históricamente determinado, concreto? ¿Cómo reconstruir teóricamente este conjunto de particulares decisiones subjetivas a partir de determinaciones conceptuales históricas-concretas que necesariamente buscan lo general? ¿Cómo concebir cierta determinación cultural de la praxis humana, productiva y consumativa, sin caer en simplificaciones etnologizantes, biologistas? Echeverría vislumbra esta relación entre libertad y tradición, entre individualidad y colectividad en el lenguaje humano y la ciencia que lo investiga: la semiótica (Saussure, Jakobson, Hjelsmlev.

  2. Cómo estudiarla conciencia: tres paradigmas para la psicología

    Directory of Open Access Journals (Sweden)

    Arturo Aguilar

    2001-01-01

    Full Text Available Gran parte de la confusión que existe en la psicología contemporánea podría reducirse si se llevara a cabo una integración de los diferentes paradigmas o puntos de vista. Por otra parte aunque la física clásica ha constituido hasta ahora el modelo a seguir para la ciencia, el concepto de conciencia no es necesario para la solución satisfactoria de los problemas físicos, excepto en el campo de la llamada mecánica cuántica; pero puede ser indispensable para resolver conceptualmente la mayoría de los problemas psicológicos. Lo que estoy proponiendo es una metáfora conceptual que supone que todos los fenómenos psicológicos (es decir, las expresiones de la conciencia deben estudiarse simultáneamente desde tres puntos de vista o paradigmas: el fisiológico, el conductual, y el cognoscitivo. Por ejemplo, en el estudio de la emoción (una forma de conciencia, deberían tomarse tres clases de mediciones: correlatos fisiológicos, cuestionarios verbales y grabaciones de vídeo de las expresiones corporales. Naturalmente que cada clase de datos debe ser tratada metodológicamente de acuerdo al paradigma correspondiente dentro del cual fueron obtenidos. De esta manera la existencia de congruencia entre los tres aspectos mencionados de la conciencia individual podrían ser verificados, además de evitar saltos indiscriminados entre esos paradigmas. Asimismo, el localizar el sistema de interés (v.g. la emoción dentro de su nivel propio en la escala evolutiva (forma o clase de conciencia permitiría la identificación certera de sus subsistemas correspondientes y contexto apropiado. Para tal propósito se propone una metáfora geométrica, en la forma de un tetraedro, el cual permite el "mapeo" de paradigmas y niveles de escala evolutiva de la conciencia en una representación visualmente integrada. En el dibujo del modelo se muestra un tetraedro rodeado por una esfera, la cual representa el contexto pertinente de la conciencia humana: el

  3. Modelos de desarrollo y paradigmas de política exterior en la segunda posguerra: Brasil-Argentina

    OpenAIRE

    Tenewichi, Marta; Gómez, Teresita

    2002-01-01

    El objetivo del presente trabajo es analizar la correspondencia entre los paradigmas dominantes en la política exterior brasileña y los modelos de desarrollo adoptado, ya que existe consenso entre los especialistas en reconocer que uno de los atributos esenciales y rasgos más perdurables de la política exterior brasileña es -a diferencia de otros países de América Latina como Argentina-, su estrecha relación con el modelo de desarrollo del país. Teóricamente el trabajo se inscribe dentro del ...

  4. Impacto de las tecnologías de la información y las comunicaciones en la educación y nuevos paradigmas del enfoque educativo Impact of the information andc ommunication technologies in education and new paradigms in the educational approach

    Directory of Open Access Journals (Sweden)

    Vicente PrietoDíaz

    2011-03-01

    Full Text Available Las tecnologías de la información y las comunicaciones (TIC's se han constituido en elementos sustantivos inherentes al desarrollo de todas las esferas de la vida. La educación no ha escapado a ello, donde se descubre un universo ilimitado de posibilidades como recurso para el aprendizaje con la posibilidad de expandirse a un mayor número de usuarios de diferentes escenarios con la capacidad de socializar el conocimiento. Nuestro país ha sido consecuente con el imperativo del desarrollo e implementación de las TIC´s, las que ya se expanden a todos los niveles de enseñanza y cobran especial fuerza en la universalización de la educación superior, cuyos impactos fundamentales se centran en su uso como fuente de información, canal de comunicación, instrumento cognitivo y de procesamiento de la información. Esto impone nuevos roles para los protagonistas del proceso formativo e implican retos para el profesional del futuro y las instituciones formadoras, las que han de lidiar con aspectos técnicos, formación especializada, seguridad informática y otros elementos que determinan la expansión de las TIC´s. En el sector de la salud, su uso se ha fortalecido y dimensionado a partir del surgimiento y desarrollo de la Red Telemática de Salud en Cuba, INFOMED. Su utilización en la Educación Médica ha introducido nuevos paradigmas como la educación centrada en el estudiante, el autoaprendizaje y la gestión del conocimiento, que han modificado el papel histórico de los profesores. Las TIC´s han propiciado la creación de espacios educativos virtuales que, basados en un modelo pedagógico, pueden garantizar el aprendizaje con el uso de estrategias innovadoras.The information and communication technologies (ICTs have become significant elements inherent to the development in all spheres of life. Education is not beyond these realities because this field embraces an unlimited universe of possibilities as learning resources to be likely

  5. Characterization of che W Genes of Leptospira interrogans and Their Effects in Escherichia coli

    Institute of Scientific and Technical Information of China (English)

    Zhen-Hong LI; Ke DONG; Jing-Chun SUN; Jian-Ping YUAN; Bao-Yu HU; Jing-Xing LIU; Guo-Ping ZHAO; Xiao-Kui GUO

    2006-01-01

    The motility and chemotaxis systems are critical for the virulence of leptospires. In this study,the phylogenetic profiles method was used to predict the interaction of chemotaxis proteins. It was shown that CheW1 links to CheA1, CheY, CheB and CheW2; CheW3 links to CheA2, MCP (LA2426), CheB3 and CheD1; and CheW2 links only to CheW1. The similarity analysis demonstrated that CheW2 of Leptospira interrogans strain Lai had poor homology with CheW of Escherichia coli in the region of residues 30-50. In order to verify the function of these proteins, the putative cheW genes were cloned into pQE31 vector and expressed in wild-type E. coli strain RP437 or cheW defective strain RP4606. The swarming results indicated that CheW1 and CheW3 could restore swarming of RP4606 while CheW2 could not. Overexpression of CheW1 and CheW3 in RP437 inhibited the swarming of RP437, whereas the inhibitory effect of CheW2 was much lower. Therefore, we presumed that CheW1 and CheW3 might have the function of CheW whileCheW2 does not. The existence of multiple copies of chemotaxis homologue genes suggested that L.interrogans strain Lai might have a more complex chemosensory pathway.

  6. LE TRASFORMAZIONI DEL PAESAGGIO RURALE DI MONTALCINO TRA OTTOCENTO E ATTUALITÀ

    OpenAIRE

    Armellini, Riccardo

    2012-01-01

    Obbiettivo del presente studio è la creazione di un approfondito quadro conoscitivo del territorio del comune di Montalcino (SI) che permetta di identificare le caratteristiche del paesaggio, monitorare i processi che ne hanno generato o che ne stanno ancora generando le trasformazioni in modo da individuare i criteri e gli indicatori per la sua gestione e conservazione. In particolare,riguardo all'aspetto della conservazione, è necessario inventariare e documentare i siti e gl...

  7. Non è la fine del mondo. Lalande, le comete e la comunicazione del rischio nel Settecento.

    OpenAIRE

    Ampollini, Ilaria

    2016-01-01

    Nell'aprile del 1773, Parigi fu scossa dal timore che una cometa provocasse un disastroso cataclisma. All'origine del clamore, il "Mémoire sur les comètes" dell'astronomo Lalande (Bourg-en-Bresse 1732-Paris, 1807), che aveva sostenuto la non impossibilità fisica e matematica di uno scontro/incontro tra Terra e comete.

  8. Hacia la construcción de un nuevo paradigma social

    OpenAIRE

    Alguacil Denche, Aitana; Azkarraga Etxagibel, Joseba; Barkin, David; Belloy, Patricio; Bolívar Espinoza, Gardy Augusto; Callahan, Manuel; Caloca Osorio, Oscar Rogelio; Checa Hidalgo, Diego; Dockendorff, Cecilia; Elizalde, Antonio; Estermann, Josef; Esteva, Gustavo; Estrada Turra, Baldomero; Facuse, Marisol; Figueroa Burdiles, Noelia

    2012-01-01

    Existe un creciente consenso en el mundo académico respecto a que el paradigma que ha inspirado el surgimiento del mundo moderno enfrenta una profunda crisis. Muestra de ello son la imposibilidad hasta ahora de dar cuenta de problemas endémicos de la humanidad que la modernidad ofreció resolver: guerra y violencia (fraternidad); pobreza e inequidad social (igualdad); y opresión (libertad). Más aún, los progresivos estragos sociales y ambientales de la sociedad mercado-céntrica señalan la nece...

  9. Paradigmas en la vejez: homogeneización y transiciones cinematográficas

    Directory of Open Access Journals (Sweden)

    Alejandro Klein

    2016-01-01

    Full Text Available El objetivo del presente artículo es tratar de aproximarse y entender paradigmáticamente cuál es el abordaje que hace el cine −en tanto fenómeno que produce y reproduce mensajes políticos y sociales− sobre el tema de la vejez y el envejecimiento, teniendo en cuenta especialmente que el mundo se encuentra en una etapa de “envejecimiento poblacional”. Se plantean dos grandes grupos de paradigmas aunque teniendo en especial consideración que la divergencia se impone cada vez más sobre la uniformización ideológica.

  10. Tecnolog??a, aprendizaje, intercultura. Paradigmas pedag??gicos de la transici??n

    OpenAIRE

    Galliani, Luciano

    2011-01-01

    Se ha producido una ???mutaci??n antropol??gica??? debido a la presencia generalizada de las nuevas tecnolog??as de la informaci??n y de la comunicaci??n (TIC) y de los medios de comunicaci??n digitales en los procesos sociales y culturales. El multiculturalismo en una sociedad globalizada exige una Pedagog??a de los multialfabetismos y de los multimedialidad basada en tres paradigmas integrados del e-learning: informaci??ntransmisi??n, interaccionista-sist??mico, socio-constru...

  11. La calidad de vida de la familia como resultado de los servicios: el nuevo paradigma

    OpenAIRE

    Turnbull, Ann P.

    2003-01-01

    El artículo describe brevemente la transición del antiguo paradigma entre discapacidad y familia, centrado en “arreglar” discapacidades y el nuevo, que subraya los servicios y la investigación centrada en la familia, que es el modelo prevaleciente en la intervención temprana para niños discapacitados. La concepción de la calidad de vida de la familia se centra en cinco campo principales. En primero de ellos es el campo de la seguridad y la salud que comprende los aspectos de la salud física y...

  12. Paradigmas en la vejez: homogeneización y transiciones cinematográficas

    OpenAIRE

    Alejandro Klein

    2016-01-01

    El objetivo del presente artículo es tratar de aproximarse y entender paradigmáticamente cuál es el abordaje que hace el cine −en tanto fenómeno que produce y reproduce mensajes políticos y sociales− sobre el tema de la vejez y el envejecimiento, teniendo en cuenta especialmente que el mundo se encuentra en una etapa de “envejecimiento poblacional”. Se plantean dos grandes grupos de paradigmas aunque teniendo en especial consideración que la divergencia se impone cada vez más sobre la uniform...

  13. "la responsabilidad del sujeto"

    OpenAIRE

    FRANCISCO J. RENGIFO

    2005-01-01

    Interrogar el concepto de responsabilidad en psicoanálisis requiere de un acto de indulgencia con respecto al debate ético que supone. La posición ética del psicoanálisis dista del paradigma filosófico debido a la revolución ética inspirada por Freud y desarrollada por Lacan. El psicoanálisis anuncia un modelo de responsabilidad esencial e inédito que revoluciona todo paradigma ético. La responsabilidad para el psicoanálisis se inscribe en el registro de un "bien decir", que supone el respeto...

  14. Gerencia universitaria postmoderna en el paradigma de la responsabilidad social

    Directory of Open Access Journals (Sweden)

    Giuseppe Siracusa

    2012-01-01

    Full Text Available Las instituciones de educación superior son espacios complejos, polidimensionales y multivariables que tienen la responsabilidad de modularse a los requerimientos que demanda la sociedad actual. Ante este reto ecosocial, las universidades requieren redimensionar sus procesos misionales para dar respuestas al entorno. Desde esta perspectiva, la gerencia universitaria del nuevo milenio está centrada en un conglomerado de apotegmas entre los cuales destacan la identidad y cultura nacional, el reconocimiento de la alteridad humana, la ciudadanía universal, el conocimiento conjugado y transdisciplinario. Siendo éste un proceso aún en construcción, el artículo tiene como propósito establecer algunas líneas macro de acción que le permitan a la universidad insertarse en ese mundo sociodivergente, intercultural y universal que la rodea. La metodología se fundamentó en el estudio de diversas fuentes documentales, iniciando con los distintos enfoques epistemológicos, teóricos conceptuales, que relacionen el accionar de la gerencia universitaria postmoderna en el paradigma de la responsabilidad social. Concluyendo que la nueva praxis universitaria tiene como umbral constituir un ser integral ganado para una sociedad cambiante y compleja, por tal razón la gerencia universitaria del siglo XXI deberá apostar por la formación de un ciudadano con aptitudes para la comunica ción, el análisis creativo y crítico, el trabajo solidario en contextos multiculturales y sobre todo ganado por y para la comunidad

  15. El Che y el progreso científico-tecnológico en la agroindustria azucarera

    Directory of Open Access Journals (Sweden)

    Tirso W. Sáenz

    2010-01-01

    Full Text Available En la vida y obra del Che hay aspectos cuya indagación debe contribuir a una mejor comprensión de su multifacética personalidad. Uno de esos aspectos es, precisamente, el concerniente a su participación directa en la construcción de la base técnico-material del socialismo en Cuba durante su gestión como Ministro de Industrias. En esta función desempeñó un importante papel en el proceso de industrialización cubano y, vinculado al mismo, en la promoción y organización del progreso científico y tecnológico; en el caso particular de este trabajo en la agroindustria azucarera y sus derivados.

  16. Cercasi lavoratore inflessibile, che non giochi di squadra. L'autismo al lavoro

    Directory of Open Access Journals (Sweden)

    Thomas Stephens

    2013-08-01

    Full Text Available Le persone affette da autismo sono sempre più richieste nel mondo del lavoro. In alcuni settori tecnici, questo handicap può infatti rivelarsi una grande risorsa. Gli imprenditori stanno prendendo coscienza delle similitudini esistenti tra le caratteristiche mentali che distinguono un buon programmatore e quelle tipiche della sindrome di Asperger (forma d'autismo senza ritardi nello sviluppo cognitivo: spiccato interesse per un tema particolare, passione per i numeri e i modelli e predilezione per i compiti ripetitivi.

  17. Book Review, 50 Animali che hanno cambiato il corso della Storia, Eric Chaline

    OpenAIRE

    Manuel Graziani

    2013-01-01

    Copertina rigida "anticata", brossura cucita, carta di pregio, grafica curata nei minimi dettagli. Rientra senza dubbio nel novero della pubblicistica divulgativa di qualità questo volume uscito in Italia per i tipi di Ricca Editore. Un volume, elegante e classico, che racconta l'evoluzione dell'uomo da cacciatore ad agricoltore/pastore e, più in generale, di come ha preso piede nella storia il nuovo approccio nei confronti del regno animale. "Oltre al ruolo nel commercio e nell'agricoltura" ...

  18. Il piu grande centro europeo di ricerca oggi festeggia l'anniversario del Nobel di Rubbia e Van der Meer. Cern, vent'anni guardando al futuro Ora la sfida si gioca sull'acceleratore di particelle pronto per il 2007, che provera a svelare i segreti della materia

    CERN Multimedia

    Durante, E

    2003-01-01

    "CERN, vent'anni guardando al futuro Ora la sfida si gioca sull'acceleratore di particelle pronto per il 2007, che provera a svelare i segreti della materia" [CERN, twenty years of looking towards the future. The present challenge is the particle accelerator that will be ready in 2007, which will try to reveal the secrets of matter] (2 pages)

  19. Dicty_cDB: CHE332 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHE332 (Link to dictyBase) - - - Contig-U16517-1 - (Link to Original site) ... SL Frame C: ---lgxxxifsfarsvvkrgxqgvsniytqhkpllhef*ivf *rtn*kkplihtyqqlnq erdhkm*lylwlvvslmkrh*pftllil* Ho ...

  20. Dicty_cDB: CHE465 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHE465 (Link to dictyBase) - - - Contig-U10820-1 - (Link to Original site) ... gtfxgy*fpnxs*t*schlshsfirc*ngwlw*kin sfpsnvslstish*sip *sxrsnneriieklkknnhv**nntilffffnyxh Homology vs CSM ...

  1. Dicty_cDB: CHE501 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHE501 (Link to dictyBase) - - - Contig-U11143-1 - (Link to Original site) ... KKKKFXFFXKK--- Translated Amino Acid sequence (All Frames ) Frame A: kniini*k*tkkkqfyllrkkkkkkkkkkkxkkkkkkknf ...

  2. Dicty_cDB: CHE605 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHE605 (Link to dictyBase) - - - Contig-U11143-1 - (Link to Original site) ... KKKNFXFFXKK--- Translated Amino Acid sequence (All Frames ) Frame A: kniini*k*tkkkqfyllkkkkkkkkkkkxxkkkkkkifx ...

  3. Enfermagem e AIDS: saber e paradigma Enfermería y SIDA: saber y paradigma Nursing and AIDS: knowledge and paradigm

    Directory of Open Access Journals (Sweden)

    Iara de Moraes Xavier

    1997-01-01

    Full Text Available Este trabalho consiste num recorte de uma pesquisa que aborda a reação entre o Saber em Enfermagem e a AIDS. Caracteriza a época atual como um período de transição entre o paradigma da ciência moderna e um novo paradigma, de cuja emergência se vão acumulando os sinais, denominada ciência pós-moderna. Traz a dinâmica da AIDS no Brasil a partir de 79.908 casos notificados de 1980 a 1996. O objetivo principal é descrever o saber de enfermagem que tem fundamentado a assistência de enfermagem prestada aos pacientes soropositivos e com AIDS em um Hospital Universitário situado no Rio de Janeiro.Este trabajo, consiste en un recorte de una investigación que aborda la relación entre el Saber en Enfermería y el SIDA. Caracteriza la época actual, como un período de transición entre el paradigma de la ciencia moderna y un nuevo paradigma, de cuya emergencia se van acumulando las señales de la denominada ciencia post-moderna. Trae la dinámica del SIDA en el Brasil, a partir de 79.908 casos notificados de 1980 a 1996. El objetivo principal, es describir el saber que ha fundamentado la asistencia de enfermería prestada a los pacientes soropositivos y con SIDA, en un Hospital Universitario, situado en Rio de Janeiro, Brasil.This study is a part of a research that comments the relation between Nursing Knowledge and AIDS. The actual period of time is treated like a period of transition between the modern science and one new paradigm. This is called post-modern science. It brings the dynamics of AIDS in Brazil after the registration of 79.908 cases from 1980 to 1996. The main objective is to describe nursing knowledge that has based nursing care to soropositive and aidetic patients in a University-Hospital located in Rio de Janeiro, Brazil.

  4. El paradigma de las membranas en agujeros negros

    OpenAIRE

    Muñoz, José Daniel; Tejeiro, Juan Manuel

    2012-01-01

    El paradigma de las membranas es un método para trabajar campos de materia cerca de agujeras negras, que permite construir imágenes espaciales variables en el tiempo, sin perder la exactitud de la relatividad general. En este artículo se describe el paradigma de las membranas, y se aplica al campo electromagnético alrededor de un agujero negro de Schwarzchild.

  5. Evaluation einer Dispositionsoberfläche im Dresdner Eisenbahnlabor

    OpenAIRE

    Dietsch, Sandra; Huth, Michael; Meier, Hartmut; Naumann, Anja; Schöne, Eric

    2015-01-01

    In einer Zusammenarbeit zwischen dem Eisenbahnbetriebslabor der TU Dresden (EBL) und dem Deutschen Zentrum für Luft- und Raumfahrt e.V. (DLR) wurde ein vom EBL entwickeltes Dispositionssystem vom DLR auf die Benutzungsfreundlichkeit der Bedienoberfläche getestet. Ziel war es, Empfehlungen für eine Weiterentwicklung des Systems, insbesondere hinsichtlich der sehr kompakten Darstellung von Informationen, zu erhalten. Es konnte gezeigt werden, dass die Dispositionsoberfläche eine gute Usability ...

  6. Dicty_cDB: CHE784 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHE784 (Link to dictyBase) - - - Contig-U16298-1 | Contig-U16523-1 CHE784P ... e update 2002.10.25 Translated Amino Acid sequence tnt *yfh*lif*YFQIKMIPKKQKGFNGEPKSHQEIDRSQSPLKQRTNNNNYQQ ... QYFQPRQTQNAWGK QNNSIPLEEQFQEVKPITQPQTPETTTTTTTTTTTTTNTTNT NLLVPRISRRDMVKDSDI ENVAIVTAKSKTVQGKQISLISNFFP--- ... nlfvfqqlvnlhtkwhf*lveqfs lmlrlnyxxklffl*i Frame B: tnt *yfh*lif*YFQIKMIPKKQKGFNGEPKSHQEIDRSQSPLKQRTNNNNYQQ ... QYFQPRQTQNAWGK QNNSIPLEEQFQEVKPITQPQTPETTTTTTTTTTTTTNTTNT NLLVPRISRRDMVKDSDI ENVAIVTAKSKTVQGKQISLISNFFP--- ...

  7. Del fracaso del desarrollo al desarrollo endógeno sustentable: La nueva Organización de Desarrollo Regional

    OpenAIRE

    José J. Contreras; Alejandro Ochoa Arias; Claudia Pilonieta Blanco

    2007-01-01

    El objetivo del presente artículo es colaborar en el debate en torno al fracaso del paradigma tecno-económico del desarrollo en Venezuela y sus implicaciones en la organización de Desarrollo Regional. En este orden de ideas el artículo presenta un breve esbozo del paradigma tecno-económico del desarrollo y del fracaso de su implantación en Venezuela. El fracaso se entenderá en términos de una catástrofe cultural en Venezuela que alcanza su crisis a finales del siglo XX. Como contr...

  8. NUEVO PARADIGMA PEDAGÓGICO PARA ENSEÑANZA DE CIENCIAS Y MATEMÁTICA

    Directory of Open Access Journals (Sweden)

    Horacio E. Bosch

    2011-01-01

    Full Text Available El objetivo del trabajo es presentar un nuevo paradigma pedagógico (Pedagogía STEM para el aprendizaje de ciencias, tecnología, ingeniería y matemática (Sciences, Technology, Engineering and Mathematics, basado so- bre políticas, programas y experiencias desarrolladas en el mundo en los últimos años, adaptado a instituciones, profesores y alumnos de habla hispana. El cuerpo fundamental del trabajo está constituido por el perfecciona- miento de criterios de pertinencia para la implantación de dicho paradigma (enfoque transdisciplinario, constitu- ción de redes, utilización de tecnologías para experimentación, producción de recursos pedagógicos, transferen- cia. Como resultado de investigaciones educativas realizadas durante la última década, se hace referencia a la producción de nuevos recursos didácticos para trabajar con docentes en ambientes de laboratorio. Estos recur- sos son propuestas de ejemplos cómo debe enseñarse física, química, biología y matemática asistidas por tecno- logías electrónica e informática, ofrecidos en forma abierta para profesores y alumnos de habla hispánica.

  9. Smart City: aspetti geomatici di un paradigma “fuzzy”

    Directory of Open Access Journals (Sweden)

    Andrea Fiduccia

    2013-02-01

    Full Text Available Il concetto di Smart City viene proposto con molte varianti non sempre tra loro coerenti. Ne sceglieremol’accezione che propone la possibilità di una migliore qualità della vita negli spazi urbani rimpiazzandone lacaotica complessità con innovazioni tecnologiche per realizzare i nostri progetti di lavoro e di vita. All’interno delparadigma ci concentreremo sugli specifici aspetti del segmento disciplinare della geomatica.Smart City: geomatics aspects of afuzzy paradigmThe label smart city is still quite a fuzzyconcept and is used in ways that arenot always consistent. We endorsethe definition that “a city can be definedas ‘smart’ when investments inhuman and social capital and traditional(transport and modern (ICTcommunication infrastructure fuelsustainable economic developmentand a high quality of life, with a wisemanagement of natural resources,through participatory governance”.Geomatics provides a set of conceptsand tools for the planningand management of Smart Cities(City Sensing,City Model, ProximalSensing, WIKI Sensing, etc. The IntegratedOperations Center (IOCis the foundation using geographictechnologies to join Smart City withSafe City. Smart Grid Systems are away to make operational the urbansosteneability in the energy sector.Some Intergraph’s technologies areused as examples of the contributionof geomatics in the implementationof Smart City paradigm.

  10. Autorretrato y autorrepresentación: territorio de experimentación y cambio de paradigma en el siglo XX

    OpenAIRE

    GALLIS PEREIRA BARAONA, MARÍA ISABEL

    2011-01-01

    La presente disertación, titulada Autorretrato y autorrepresentación: territorio de experimentación y cambio de paradigma en el siglo XX, se apoya en el estudio de las implicaciones conceptuales que subyacen a la temática del autorretrato e intenta formular una definición del concepto de autorrepresentación. Esta es una indagación teórica-práctica e interdisciplinar que se apoya en una investigación histórica, recurriendo para ello sobre todo a los escritos de los propios artistas, a la ...

  11. A responsabilidade do poder político no estado constitucional sob o paradigma da democratic responsiveness

    OpenAIRE

    Lorencini, Bruno César

    2013-01-01

    [ES] El objetivo central de la tesis es formular propuestas normativas de delineamiento del instituto de la responsabilidad del poder político de forma que ese sirva como mecanismo de conformación de un paradigma de democracia calificada (democratic responsiveness), cuyo atributo fundamental es favorecer la correlación entre la actividad política y las expectativas e intereses de la sociedad. Bajo las premisas de que la calificación democrática debe ser un objetivo fundament...

  12. Non è gentile accontentarsi delle parole. Il dono del senso

    OpenAIRE

    Sommaggio, Paolo

    2011-01-01

    Questo scritto tratta alcuni aspetti caratteristici del dono nella società giapponese. Nello scambio del dono, l’oggetto conferito e gli agenti che vi partecipano si trasformano in simboli e la relazione che li lega può essere avvicinata al linguaggio, al logos.

  13. Gloria Corpas Pastor, Investigar con corpus en traducción: los retos de un nuevo paradigma

    OpenAIRE

    Mira Rueda, Concepción

    2013-01-01

    La presente obra ha sido el fruto de una minuciosa investigación inspirada en la evolución que está llevando a cabo la Sociedad de la Información y el Espacio Europeo de Investigación en cuestión de investigación en corpus. De hecho, como la propia autora ya nos indica en el prefacio de su obra Investigar con corpus en traducción: los retos de un nuevo paradigma «el propósito del presente trabajo es reflexionar en torno al corpus como nuevo paradigma de investigación en Traductología». Dicho ...

  14. FUNDAMENTOS DEL PARADIGMA CUALITATIVO EN LA INVESTIGACION EDUCATIVA

    OpenAIRE

    Leda Badilla Chavarría

    2006-01-01

    La investigación cualitativa en el campo de la educación es un tema de interés actual, ya que está inmersa en nuestras prácticas profesionales cotidianas. El propósito de este intercambio investigativo permite reconstruir, articular y reflexionar sobre algunos tópicos que fundamentan el enfoque cualitativo de investigación y que están relacionados con nuestros escenarios habituales de trabajo. De manera que primero se realizará una aproximación, desde sus componentes epistemológicos y metodol...

  15. FUNDAMENTOS DEL PARADIGMA CUALITATIVO EN LA INVESTIGACION EDUCATIVA

    Directory of Open Access Journals (Sweden)

    Leda Badilla Chavarría

    2006-12-01

    Full Text Available La investigación cualitativa en el campo de la educación es un tema de interés actual, ya que está inmersa en nuestras prácticas profesionales cotidianas. El propósito de este intercambio investigativo permite reconstruir, articular y reflexionar sobre algunos tópicos que fundamentan el enfoque cualitativo de investigación y que están relacionados con nuestros escenarios habituales de trabajo. De manera que primero se realizará una aproximación, desde sus componentes epistemológicos y metodológicos, a la investigación cualitativa, para luego continuar caracterizando este enfoque desde la producción de la información, su análisis, las fuentes de credibilidad de los resultados y la ética que lo sustenta.

  16. LA UNIVERSIDAD ANTE LOS NUEVOS PARADIGMAS DE LA INFORMACIÓN Y EL CONOCIMIENTO (PIC)

    OpenAIRE

    Edgar Chirinos; Carlos Figueredo A.; Aurora Goyo; Elita Méndez; Luís Rodolfo Rojas Vera

    2015-01-01

    En este artículo se hace un análisis teórico del comportamiento que deberían asumir las universidades, su gerencia y sus actores principales (docentes y estudiantes) ante el surgimiento de nuevos paradigmas de la información y el conocimiento (PIC) causados por la aprehensión de las tecnologías de información y comunicación (TIC). Se tomó como base la definición de la universidad del siglo XXI bajo la dimensión tecnológica de una sociedad sustentada en el conocimiento, cuyo pilar fundament...

  17. LA UNIVERSIDAD ANTE LOS NUEVOS PARADIGMAS DE LA INFORMACIÓN Y EL CONOCIMIENTO (PIC

    Directory of Open Access Journals (Sweden)

    Edgar Chirinos

    2015-06-01

    las universidades, su gerencia y sus actores principales (docentes y estudiantes ante el surgimiento de nuevos paradigmas de la información y el conocimiento (PIC causados por la aprehensión de las tecnologías de información y comunicación (TIC. Se tomó como base la definición de la universidad del siglo XXI bajo la dimensión tecnológica de una sociedad sustentada en el conocimiento, cuyo pilar fundamental está integrado por las plataformas tecnológicas, las telecomunicaciones y redes del conocimiento. Se concluye que una de las brechas en el propósito de democratización y acceso social al conocimiento.

  18. Psicología y discapacidad: un encuentro desde el paradigma social

    OpenAIRE

    Lucrecia Alfaro-Rojas

    2013-01-01

    El tema de la discapacidad ha sido abordado desde diversos paradigmas o modelos que han dictado el modo de brindar atención a personas con esta condición. Aunque en la literatura se encuentran diversas denominaciones para estos paradigmas, el presente artículo se refiere a los tres paradigmas que engloban las posturas más habituales hacia el tema de la discapacidad: el paradigma tradicional, el paradigma médico-biológico y el paradigma social. Es dentro de este último que se concibe a la p...

  19. Silicio: Presente e Futuro del FV

    OpenAIRE

    VIRTUANI ALESSANDRO

    2006-01-01

    Oltre il 90% dei moduli oggi in commercio sono in Silicio, elemento che rappresenterà ancora a lungo la principale materia prima del fotovoltaico. Sono ora in fase di studio nuovi processi di produzione dei wafer di Silicio, alcuni quasi maturi per venire applicati nella produzione industriale e che potrebbero rendere il fv assai competitivo con le fonti di energia tradizionali.

  20. Le emozioni e il linguaggio del corpo

    OpenAIRE

    Georgievska, Ana

    2011-01-01

    Nella comunicazione umana riconosciamo vari elementi che sono connessi tra di loro formando un insieme che aiuta a trasmettere una informazione. Il solo contenuto delle parole non è sufficiente per qualificare tale informazione. Il corpo spesso parla più delle parole e riesce a dare un senso emozionale del contenuto. Le emozioni sono spesso fondamentali per la validità dell’informazione

  1. Paradigma e Disciplina nas Perspectivas de Kuhn e Morin

    Directory of Open Access Journals (Sweden)

    Sérgio Luís Boeira

    2009-07-01

    Full Text Available Normal 0 21 false false false MicrosoftInternetExplorer4 http://dx.doi.org/10.5007/1807-1384.2009v6n1p90 Este ensaio compara o conceito de paradigma nas perspectivas de Thomas Kuhn e Edgar Morin. Apesar da relevância internacional de suas obras e de suas contribuições para a história da ciência e para a filosofia da ciência, observa-se na literatura uma falta de estudos comparativos sobre suas principais idéias, o que tem gerado confusões e simplificações. O ensaio parte de extensa pesquisa de obras publicadas pelos autores em âmbito internacional. Na primeira seção, trata-se da perspectiva de Kuhn sobre diversas noções, como paradigma, matriz disciplinar, comunidade científica e incomensurabilidade. Na segunda, examina-se a perspectiva de Morin sobre paradigma disjuntor-redutor e paradigma da complexidade. Na terceira seção, comparam-se suas perspectivas sobre progresso científico, a partir da noção de disciplina, para discernir aspectos convergentes e divergentes em suas obras, resumidos nas conclusões. Palavras-chave: Paradigma; Disciplina; Filosofia da ciência.

  2. PERKEMBANGAN PARADIGMA EPISTEMOLOGI DALAM FILSAFAT ISLAM

    Directory of Open Access Journals (Sweden)

    Fathul Mufid

    2015-03-01

    Full Text Available Abstract:    Based on historical reports, Islamic epistemology paradigm has evolved from time to time bringing different schools each other. This paper aims at revealing such differences. Methods employed are philosophical Literary Review where compiled data are analyzed inductively to formulate theoretical constructions. Research findings reveal that peripatetic philosophers highlight their mind as a dominant tool to gain knowledge using demonstrative method (burhānī.Whilst illuminative philosophers, ‘irfāniyyīn, and Sufis believe that knowledge can only be derived from mystical intuition after purification of the heart (qalb trough practices (riyā╨ah. Different schools such as ones held by Mulla Sadra and Abed al-Jabiri are based on those distinctive principles.Abstrak:      Paradigma epistemologi pemikiran Islam menurut laporan sejarah mengalami perkembangan dari zaman ke zaman, yang berbeda prinsip antara aliran yang satu dengan yang lain. Tulisan ini bertujuan untuk menguak letak perbedaan antara aliran-aliran tersebut. Metode kepustakaan filsafat dilakukan dengan analisa data induktif untuk merumuskan konstruksi teoritik.  Temuan penelitian ini adalah, bahwa para filosof Muslim Paripatetik mengedepankan akal atau rasio sebagai alat yang paling dominan untuk memperoleh pengetahuan yang benar dengan menggunakan metode demonstratif (burhānī. Sementara filosof iluminasi, kaum ‘irfānī, dan kaum sufi berprinsip bahwa pengetahuan hakiki hanya dapat diperoleh melalui intuisi-mistik, setelah melalui proses penyucian hati (qalb dengan berbagai bentuk latihan (riyā╨ah. Sementara epistemologi Mulla Sadra menggunakan tipe “hikmah”, yaitu pemaduan antara visi rasional dengan visi mistik, yang kemudian diselaraskan dengan syari’at. Epistemolog kontemporer, Abed al-Jabiri memilih epistemologi burhānī yang meyakini bahwa sumber pengetahuan adalah rasio, bukan teks atau intuisi.

  3. Dicty_cDB: CHE274 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ary, clone:8230402C21, 3' end partial sequence, similar to ddbj:Z37164 M.musculus Cctq mRNA encoding cytosolic chaperone containing...M.musculus Cctq mRNA encoding cytosolic chaperone containing TCP-1, theta subunit (CCTtheta). 52 0.012 1 CD1... chaperonin containing ... 255 9e-67 AY823273_1( AY823273 |pid:none) Notothenia coriiceps...s CSM-cDNA Score E Sequences producing significant alignments: (bits) Value CHE274 (CHE274Q) /CSM/CH/CHE2-D/...eq.d/ 1419 0.0 own update 2002. 9.27 Homology vs DNA Score E Sequences producing signi

  4. Installazione di una sonda tipo “barasol” a Dagala (Etna) per la misura continua del flusso di radon dal suolo (13 Ottobre 2006)

    OpenAIRE

    Giammanco, S.; Istituto Nazionale di Geofisica e Vulcanologia, Sezione Palermo, Palermo, Italia; Neri, M.; Istituto Nazionale di Geofisica e Vulcanologia, Sezione Catania, Catania, Italia; Baubron, J. C.; Istituto Nazionale di Geofisica e Vulcanologia, Sezione Catania, Catania, Italia; Burton, M.; Istituto Nazionale di Geofisica e Vulcanologia, Sezione Pisa, Pisa, Italia; Condarelli, D.; Istituto Nazionale di Geofisica e Vulcanologia, Sezione Catania, Catania, Italia

    2006-01-01

    L’Unità Funzionale Vulcanologia e Geochimica della Sezione di Catania dell’INGV sta sviluppando una nuova tecnologia che permette il monitoraggio in continuo del Radon, un gas che cambia la sua concentrazione in dipendenza del flusso di gas dal suolo. Visto che il tasso di emissione di radon dal suolo è dipendente dalla dinamica sia del magma che delle faglie, si tratta di un parametro che ha una forte potenzialità per la sorveglianza dei vulcani. Per tale motivo l’INGV, nell’ambi...

  5. Componenti e Sistemi Hardware : Un libro bianco per raccontare le principali sfide che il nostro Paese dovrà affrontare nei prossimi cinque anni

    OpenAIRE

    Di Natale, Giorgio; Prinetto, Paolo

    2015-01-01

    Internet sta rivoluzionando la nostra società e la nostra economia, favorendo l’interazione, lo scambio di idee, la condivisione delle informazioni, creando nuove modalità di coinvolgimento politico e sociale e di scambio economico e commerciale. Spazio cibernetico (Cyberspace) è il termine convenzionalmente usato per riferirsi all’ambiente all’interno del quale avvengono le operazioni che fanno uso di Internet. La riduzione dei costi di accesso alla rete e lo sviluppo del- la banda larga com...

  6. Teoria feminista: o desafio de tornar-se um paradigma

    Directory of Open Access Journals (Sweden)

    Mirian Santos Paiva

    1997-12-01

    Full Text Available Partindo da crise do paradigma tradicional e tendo como epicentro a crítica feminista, este trabalho tenta mostrar o desafio que enfrenta a teoria feminista para tornar-se um novo paradigma e para tanto realiza-se uma pesquisa bibliográfica, consubstanciada na literatura pertinente ao tema. Evidencia-se que o desafio de ser um paradigma em ascensão faz com que esta teoria enfrente problemas teóricos, conceituais e metodológicos que precisam de um esforço conjunto para serem aprofundados e resolvidos. Todavia, o desenvolvimento desta teoria não depende apenas do mundo acadêmico, mas está também atrelado a mudanças na estrutura social, pois, de uma sociedade mais igualitária, mais facilmente emergirá um conhecimento sem dominação de gênero.

  7. La Città Inclusiva. Educazione, democrazia e giustizia sociale: la ricerca di una prospettiva e di strategie che promuovano umanizzazione e inclusione

    OpenAIRE

    Errani, Francesco

    2015-01-01

    L'interrogativo da cui nasce la ricerca riguarda la possibilità di individuare, in controtendenza con la logica neoliberista, strategie per l'affermarsi di una cultura dello sviluppo che sia sostenibile per l'ambiente e rispettosa della dignità delle persone, in grado di valorizzarne le differenze e di farsi carico delle difficoltà che ognuno può incontrare nel corso della propria esistenza. Centrale è il tema del lavoro, aspetto decisivo delle condizioni di appartenenza sociale e di valorizz...

  8. Dicty_cDB: CHE236 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHE236 (Link to dictyBase) - - - Contig-U13888-1 CHE236P (Link to Original ... 5523_1( AY615523 |pid:none) Gallus gallus neuronal tryptophan ... ... 258 2e-67 BC013458_1( BC013458 |pid:none) Mus ... lanine hydroxy... 256 9e-67 (Q0EAB8) RecName: Full=Tryptophan ... 5-hydroxylase 2; EC=1... 256 9e-67 (Q8IWU9) RecNam ...

  9. Una teoria del gioco

    Directory of Open Access Journals (Sweden)

    Adolfo Barbatelli

    2006-11-01

    Full Text Available Questo articolo è la prima parte di un lavoro di ricerca sul gioco d’azzardo nella città di Napoli. Per parlare di gioco d’azzardo ho preliminarmente cercato delle coordinate concettuali per definire il concetto di gioco prendendo come punti cardinali le concezioni del gioco di: 1 Huizinga, storico del pensiero di matrice storicistico-idealistica degli anni ’30; 2 Caillois, il versatile sociologo francese degli anni ’50; 3 Lanternari, antropologo dinamista italiano a noi contemporaneo. Il quarto punto cardinale è il radicale disvelamento della natura di costruzione logica di ogni forma di comunicazione fatto da Wittgenstein che mi ha portato alla conclusione che cercare il significato di un concetto (come quello di gioco porta a ragionare su delle idee e che bisogna imporsi un dubbio sistematico quando si ragiona su delle idee. Ma in questo excursus ho provato a tirare le fila sulla letteratura antropologica sull’argomento e, soprattutto, ho trovato delle coordinate concettuali che mi hanno premesso di impostare delle ipotesi che illustrerò nel prossimo articolo che parlerà di gioco d’azzardo.

  10. Investigating the role of CheA-3 in Dusulfovibrio Vulgaris Hildenborough

    Energy Technology Data Exchange (ETDEWEB)

    Ray, Jayashee; Keller, Kimberley; Krierim, Bernhard; Auer, Manfred; Keasling, Jay; Wall, Judy; Mukhopadhyay, Aindrila

    2010-05-22

    Multiple sets of chemotaxis genes including three cheA homologs were identified in the genome sequence of the anaerobic bacterium Desulfovibrio vulgaris Hildenborough. Each CheA is a histidine kinase (HK) and part of a two component signal transduction system. Knock out mutants in the three cheA genes were created using single cross-over homologous recombination insertion. We studied the phenotypes of the cheA mutants in detail and discovered that ?cheA-3 has a non swarming/swimming phenotype both in the soft agar plates and Palleroni chamber assays. CheA-3 shows similarity to the Shewanella oneidensis CheA-3 and the Vibrio cholerae CheA-2 that are responsible for chemotaxis in the respective organisms. We did not find any morphological or structural differences between the three Delta cheA mutants and the wild type cells in electron microscopy. Our results from these studies are presented.

  11. Investigating the role of CheA-3 in Dusulfovibrio Vulgaris Hildenborough

    International Nuclear Information System (INIS)

    Multiple sets of chemotaxis genes including three cheA homologs were identified in the genome sequence of the anaerobic bacterium Desulfovibrio vulgaris Hildenborough. Each CheA is a histidine kinase (HK) and part of a two component signal transduction system. Knock out mutants in the three cheA genes were created using single cross-over homologous recombination insertion. We studied the phenotypes of the cheA mutants in detail and discovered that ?cheA-3 has a non swarming/swimming phenotype both in the soft agar plates and Palleroni chamber assays. CheA-3 shows similarity to the Shewanella oneidensis CheA-3 and the Vibrio cholerae CheA-2 that are responsible for chemotaxis in the respective organisms. We did not find any morphological or structural differences between the three Delta cheA mutants and the wild type cells in electron microscopy. Our results from these studies are presented.

  12. La strana storia della luce e del colore

    CERN Document Server

    Guzzi, Rodolfo

    2011-01-01

    Sino al 1600 la luce era oggetto di studio degli scienziati ed il colore dei filosofi. Questa dicotomia fu superata dall’Esperimentum Crucis di Newton che spiego’ come la luce contenesse il colore. Il libro analizza le teorie che furono sviluppate dai greci, per evolversi successivamente nelle teorie degli scienziati arabi e approdare al medio evo. Con l’Esperimentum Crucis Newton dimostro’ che la luce conteneva i colori primari. Tra gli esperimenti che egli fece ci furono anche quelli sulla percezione che risultarono sbagliati; solo Goethe capi’ quale era la vera portata di quegli esperimenti e li rifece dando una interpretazione che, oggi, sappiamo essere vera, ma che a quel tempo fu alquanto osteggiata. Nel frattempo la comunita’ scientifica progrediva sul concetto di visione e di sensazione, poiche’ gli strumenti di indagine si raffinavano. Bisogna pero’ arrivare ai giorni nostri per avere una spiegazione sul comportamento della luce e del colore e come questa viene percepita da noi. Solo ...

  13. Procurando outros paradigmas para a educação

    OpenAIRE

    Barros Maria Elizabeth Barros de

    2000-01-01

    Este artigo, inspirado nas propostas de Deleuze e Guattari, faz uma análise das práticas educacionais pautadas no paradigma cientificista. Propõe outras direções de sentido e um redimensionamento da educação com baser no paradigma ético/estético/político trazendo a proposta das "Árvores do Conhecimento"de M. Authier e P. Levy como uma possibilidade de se construírem comunidades de conhecimento, recusando os especialismos.

  14. La teoria del ciclo vitale del risparmio di Modigliani cinquant’anni dopo

    Directory of Open Access Journals (Sweden)

    Mauro Baranzini

    2005-06-01

    Full Text Available Nei primi anni ’50 Franco Modigliani, insieme a Richard Brumberg e ad Albert Ando, formulò lateoria del ciclo vitale del consumo e del risparmio, che ha riscosso un enorme e indiscussosuccesso per almeno tre decenni. Tuttavia, a partire dai primi anni ’80 la teoria del ciclo vitale èstata criticata in modo sempre più serrato, per almeno quattro ragioni. La prima consistenell’esistenza di una significativa trasmissione intergenerazionale della ricchezza, da ricondurre acause esogene al modello del ciclo vitale. La seconda ragione è rappresentata dalla crescenteevidenza che i ricchi continuano a risparmiare in misura maggiore rispetto ai meno fortunati,come, in effetti, Keynes sosteneva. Il terzo motivo è che vi sono prove sempre più evidenti,almeno nell’Europa occidentale e in Giappone, che le famiglie giovani, durante i venti e i trentaanni di età, risparmiano una quota positiva e crescente del proprio reddito, e ciò si pone indeciso contrasto con la versione originaria della teoria del ciclo vitale. Infine, numerosi lavoriempirici hanno rilevato che i pensionati accantonano una parte elevata del proprio reddito. Ciòimpone un serio ripensamento dell’approccio della teoria del ciclo vitale, che interessa sia l’analisieconomica sia la politica economica.

  15. La spirale dell’azzardo: una subcultura del gioco che “evapora” le relazioni / La spirale du jeu de hasard : une sous-culture qui empêche toute relation / The gambling: a subculture of game that “burns” the relationships

    Directory of Open Access Journals (Sweden)

    Molin Valentina

    2011-07-01

    Full Text Available In this paper I have analysed the characteristics of what I define the “gambling subculture”, which is detectable in certain gaming environments and in subgroups of particularly “rabid” players. Within these subcultures there have been identified rules and sanctions, values, consolidate behaviours, characterization of relationships and interactions, and the conclusion is that what is built within the gambling environment is a separate universe, an “outer reality”, in which the values of the world “outside” change. It was also possible to conclude that, to join the gambling world for a gambler – learning its rules, sharing its values, developing relations inside it – represents a stimulus for gambling habits, as it allows to consider as “normal” their behaviour thanks to positive feedback from their groups of fellow players, and to the neutralization of possible negative feedback from “non-players”.Nel presente contributo vengono analizzate le caratteristiche di quella che ho definito “subcultura dell'azzardo”, rilevabile in determinati ambienti ludici e in sotto-gruppi di giocatori particolarmente “accaniti”. Di queste forme di subcultura sono state individuate norme e sanzioni, valori, comportamenti consolidati, caratterizzazione delle relazioni e delle interazioni, giungendo alla conclusione che quello che viene costruito negli spazi di gioco rappresenta un universo separato, un “extraluogo”, nel quale vengono scritte nuove regole e nel quale cambiano i valori rispetto al mondo “esterno”. È stato possibile inoltre concludere che l'adesione all'“universo gioco” – l'interiorizzazione delle sue norme, la condivisione dei suoi valori, lo sviluppo di relazioni al suo interno – rappresenta un fattore di mantenimento della condotta ludica, poiché permette di considerare “normale” il proprio comportamento grazie ai rinforzi positivi che giungono dal gruppo dei compagni-giocatori e alla

  16. El Che - más que médico

    Directory of Open Access Journals (Sweden)

    Natalia I. Osorio Curbelo

    2015-12-01

    Full Text Available Revolucionario, dirigente político, comandante guerrillero, intelectual y médico.  Uno de los íconos del siglo XX.  Nació en Rosario, Argentina, el 14 de junio de 1928. En 1938, con apenas 10 años, el padre le enseñó a jugar Ajedrez en el transcurso del año, deporte que no dejaría de practicar nunca más y lo estudiaría por siempre. En 1939 supo de la existencia de Cuba, pues teniendo 11 años, cuando vivía en Alta Gracia, en Buenos Aires se desarrollaba la VII Olimpiada de Ajedrez y el más conocido de los ajedrecistas cubanos José Raúl Capablanca, obtuvo la medalla de Oro en el primer tablero, convirtiéndose en noticia mundial. La gran pasión por el juego ciencia  se puso de manifiesto durante toda su vida, jugó Ajedrez cuando estaba viajando en un avión, cuando  estuvo detenido en alguna estación policial o, simplemente, a las tres de la madrugada recibía una delegación mexicana para jugar una partida después de conversar sobre los temas generales comunes. Ernesto Guevara, eternamente Che, revolucionario integral y multifacético, sintió gran afición por los deportes y aunque por lo general se le cita como amante del ajedrez y el fútbol, también, desde niño, practicó con derroche de coraje y voluntad otros no tan divulgados. A sus prácticas deportivas también se entregó con la voluntad, coraje y pasión que lo caracterizaron a lo largo de su vida. Luego del triunfo de la Revolución cubana, en la que ganó  los grados de Comandante, hubo  un deporte priorizado  en la vida del Che: el Ajedrez.  Dos veces ganó en los campeonatos patrocinados por el Ministerio de Industria, que él presidía,  y participó, además, en los Torneos del INDER donde ascendió, por los resultados alcanzados, a la primera categoría. Se enfrentó en partidas simultáneas a varios de los mejores jugadores de esos días, entre ellos los grandes maestros soviéticos Victor Korchnoi y Mijail Tal y el argentino Miguel Najdorf, d

  17. El nuevo paradigma estratégico

    OpenAIRE

    Argumosa Pila, Jesús Rafael

    2000-01-01

    Not available

    En los últimos años del final del segundo milenio ha comenzado el proceso de diseño de un nuevo orden mundial en el que se está estableciendo una moderna doctrina de seguridad así como un emergente modelo de estrategia global que responda a las transformaciones de todo tipo que se están sucediendo, de forma acelerada, en estos momentos y en el previsible próximo futuro, en todo el planeta.

  18. El nuevo paradigma estratégico

    Directory of Open Access Journals (Sweden)

    Argumosa Pila, Jesús Rafael

    2000-03-01

    Full Text Available Not available

    En los últimos años del final del segundo milenio ha comenzado el proceso de diseño de un nuevo orden mundial en el que se está estableciendo una moderna doctrina de seguridad así como un emergente modelo de estrategia global que responda a las transformaciones de todo tipo que se están sucediendo, de forma acelerada, en estos momentos y en el previsible próximo futuro, en todo el planeta.

  19. Dicty_cDB: CHE473 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHE473 (Link to dictyBase) - - - Contig-U16373-1 - (Link to Original site) ... fnssfkf****y***w*y***rinkk*www**i**qi*kskttt **kr**skw ***q****kfk*kpyck***iyitii*lssfr*irkgkretrl*nhl*y*t ...

  20. A crèche on the Meyrin CERN site

    CERN Multimedia

    Association du personnel

    2013-01-01

    A few months ago (see Echo 175) we announced the opening, at the end of August, of a crèche at the CERN Staff Association’s nursery school. After a very active summer, where a new floor was added to the canteen building, the new school year started in excellent conditions and, as expected, the new crèche opened on Tuesday 27 August. This crèche, with 13 full-time equivalent places, can accept 18 children aged between three months and two years in a space fully refitted to care for the little ones. A specially designed space for breastfeeding helps mothers working on the site to respect their baby's rhythm. In compliance with the standards of supervision in the canton of Geneva six educators take care of the children in shifts. This new space is fully integrated in the nursery school so that now the crèche, Kindergarten and school of the CERN Staff Association can welcome children aged from three months to six years, from Monday to Friday, and...

  1. Dicty_cDB: CHE241 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHE241 (Link to dictyBase) - - - Contig-U16260-1 - (Link to Original site) ... AY305530 |pid:none) Macrobiotus islandicus voucher Mis ... 172 2e-42 AY305532_1( AY305532 |pid:none) Richt ...

  2. Dicty_cDB: CHE141 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHE141 (Link to dictyBase) - - - Contig-U16260-1 - (Link to Original site) ... AY305530 |pid:none) Macrobiotus islandicus voucher Mis ... 283 1e-75 AY305532_1( AY305532 |pid:none) Richt ...

  3. Disputabilidad en los sistemas de redes de distribución eléctrica. un análisis desde los modelos de telecom unicaciones en el marco del paradigma económico neo­clásico

    OpenAIRE

    SCHWEICKARDT, GUSTAVO ALEJANDRO; PISTONESI, HÉCTOR

    2009-01-01

    La introducción de disputabilidad en el mercado de distribución eléctrica, adscrita al paradigma económico dominante (Neo­clásico o Marginalista) y solidaria al segmento de comercialización, no exhibe en la actualidad soluciones satisfactorias. Esta aseveración, de carácter general, es de especial incumbencia para aquellos países de Latinoamérica, en los cuales los cuerpos regulatorios intentan definir un mercado no regulado para ciertos usuarios denominados elegibles. Los mismos ...

  4. Õppiv organisatsioon ja juhtimise uus paradigma / Harry Roots

    Index Scriptorium Estoniae

    Roots, Harry, 1950-2010

    2004-01-01

    Juhtimise uus paradigma tähendab varasemaga võrreldes märgatavalt soodsama õpikeskkonna loomist. Nii nagu igapäevane juhtimispraktika kujundab organisatsioonis domineerivat kultuuritüüpi, samamoodi see ka kas soodustab või tõkestab õppiva organisatsiooni kujunemist, leiab autor. Tabelid. Skeemid

  5. Il disagio degli insegnanti tra psicologia e pedagogia: una indagine multidimensionale sul fenomeno del burnout

    OpenAIRE

    Francesca Botticelli; Franco Burla; Elvira Lozupone; Rachela Pellegrino

    2012-01-01

    A partire da un minuzioso esame della letteratura internazionale sui diversi versanti che costituiscono gli elementi chiave di questa ricerca (stress lavoro-correlato, burnout, formazione insegnanti) il lavoro vuole analizzare il fenomeno del burnout degli insegnanti come fenomeno multi dimensionale. Si raggiunge questo obiettivo a partire dalla concezione del burnout come risultato di stress lavoro-correlato che si muove su dimensioni plurime, aventi carattere sia soggettivo che organizzativ...

  6. LOS PARADIGMAS A-CAUSALES Y LA FUNDAMENTACIÓN DE LA CIENCIA PSICOLÓGICA

    Directory of Open Access Journals (Sweden)

    Plinio Negrete

    1999-01-01

    Full Text Available La descripción de fenómenos que pertenecen al espacio psicológico en el marco del paradigma causal (cuerpos en movimientoconduce a resultados que no corresponden a la naturaleza intrínseca de estos fenómenos. En este trabajo el espacio psicológico es visto como un nivel más profundo de organización mental, una sección de la región de transición entre las dos sustancias cartesiana De allí, la psicología es vista como la ciencia de esta región de transición, cuyos fenómenos no son necesariamente gobernados por el principio de causalidad usual. Se muestra que este principio es más bien un caso particular de una simetría más general.

  7. O que é problematizar? Géneses de um paradigma

    Directory of Open Access Journals (Sweden)

    Michel Fabre

    2011-12-01

    problème. Ce qui nécessite de concevoir une logique de la recherche, centrée sur la construction du problème et pas seulement sur sa résolution. Il est possible d’esquisser les incidences pédagogiques des quatre problématologies étudiées quant à la relation entre savoir et problème. Leurs divergences mêmes s’avèrent pédagogiquement surdéterminées: elles renvoient aux problèmes d’une pédagogie des problèmes.La idea del problema invade, en la actualidad, la escuela y la formación. ¿Cómo evitar que esta idea no se diluya y se caricature? Parece necesario volver a la cuestión de raíz: ¿Qué se cuestiona? Se estudia aquí la génesis del paradigma de las preguntas de las 4 filosofías de problemas de John Dewey, Gaston Bachelard, Gilles Deleuze y Michel Meyer. Mientras que estas filosofías se manifiestan a partir de intuiciones diferentes y desarrollan sus propias teorías, estas coinciden en gran medida en la idea de cuestionar, lo que permite una definición precisa de los conceptos (el cuestionamiento, el problemático, el problema. Estas filosofías permiten también poner de relieve las exigencias intelectuales de una actitud que parece hacer el curso normal del pensamiento común, e incluso - según algunos de nuestros autores - del pensamiento filosófico, marcado por el olvido, precisamente, del problema No hay ningún cuestionamiento, si una auto-reflexión no es establecida, una dialéctica entre los datos y condiciones del problema, lo cuál es necesita diseñar una lógica de la investigación, centrada en la construcción de problema y no sólo en su resolución. Es posible esbozar las implicaciones pedagógicas de las cuatro abordajes y estudiar la relación entre el conocimiento y el problema. Sus diferencias se revelan pedagógicamente de manera sobredeterminada: enviar de vuelta a los problemas una pedagogía de los problemas

  8. Emozioni, sentimenti, percezione del mondo

    OpenAIRE

    Crescimbene, Massimo; Istituto Nazionale di Geofisica e Vulcanologia, Sezione Roma1, Roma, Italia; La Longa, Federica; Istituto Nazionale di Geofisica e Vulcanologia, Sezione AC, Roma, Italia

    2011-01-01

    L’educazione è una sfida. Il presente e il futuro di una società si disegnano assumendosi un rischio educativo. Da questa forte affermazione si comprende che un progetto di educazione al rischio deve confrontarsi con il cambiamento. E che questo cambiamento, individuale e collettivo, per essere osservabile dovrà esplicitarsi in azioni di prevenzione al rischio. Perseguire l’obiettivo del cambiamento vuol dire tenere in debito conto il fattore umano. Per questi motivi - in 10 anni di ...

  9. "La responsabilidad del sujeto"

    Directory of Open Access Journals (Sweden)

    FRANCISCO J. RENGIFO

    2005-01-01

    Full Text Available Interrogar el concepto de responsabilidad en psicoanálisis requiere de un acto de indulgencia con respecto al debate ético que supone. La posición ética del psicoanálisis dista del paradigma filosófico debido a la revolución ética inspirada por Freud y desarrollada por Lacan. El psicoanálisis anuncia un modelo de responsabilidad esencial e inédito que revoluciona todo paradigma ético. La responsabilidad para el psicoanálisis se inscribe en el registro de un "bien decir", que supone el respeto a la singularidad del sujeto y al deseo que lo habita, así como el derecho al enigma que introduce el inconsciente en la cultura.

  10. Hacia nuevos paradigmas en las Relaciones Internacionales

    Directory of Open Access Journals (Sweden)

    Graciela Arroyo Pichardo

    1998-01-01

    Full Text Available Es parte de una serie de reflexiones respecto a las diversas manifestaciones de los recientes cambios mundiales y su impacto en muchos aspectos de la existencia humana, particularmente en el campo del conocimiento social. La múltiple concentración de elementos que vinculan lo social con la naturaleza, lo interno con lo externo, lo local con lo mundial, imponen un replanteamiento de la vieja e inacabada interdisciplinariedad ¿Es entonces necesaria una nueva ciencia social? Evidentemente que un enfoque holístico de lo social-mundial es imprescindible, asi como un cambio de conciencia y de concepciones. Como respuesta a lo anterior, ya empiezan a invocarse algunos de los desarrollos más recientes de las ciencias naturales, como la física y la química, para poder interpretar la nueva realidad social. Nos referimos a principios como el de la relatividad, la indeterminación, la irreversibilidad de los fenómenos, la teoría del caos. Esta transformación cognoscitiva y de la conciencia puede contribuir también a la superación del ser humano como tal.

  11. El nuevo paradigma de las ciencias y la teoría de gestión

    Directory of Open Access Journals (Sweden)

    Iván Alonso Montoya

    2016-05-01

    Full Text Available El presente artículo hace una revisión del cambio de paradigma desde la ciencia positiva a un enfoque más complejo de la misma, mediante un recorrido a través de diferentes autores y sus concepciones para llegar a nuevos enfoques más coherentes con los nuevos aportes desde diferentes áreas del conocimiento, como la física, la química y la biología. A partir del desarrollo histórico de la ciencia se muestra cómo ésta ha tenido que ajustar su método hacia uno más coherente con las nuevas problemáticas por modelar.

  12. El nuevo paradigma de las ciencias y la teoría de gestión

    OpenAIRE

    Iván Alonso Montoya; Alexandra Montoya

    2016-01-01

    El presente artículo hace una revisión del cambio de paradigma desde la ciencia positiva a un enfoque más complejo de la misma, mediante un recorrido a través de diferentes autores y sus concepciones para llegar a nuevos enfoques más coherentes con los nuevos aportes desde diferentes áreas del conocimiento, como la física, la química y la biología. A partir del desarrollo histórico de la ciencia se muestra cómo ésta ha tenido que ajustar su método hacia uno más coherente con las nuevas proble...

  13. Fractional derivatives. An introduction; Derivate frazionarie. Che cosa sono, a cosa servono

    Energy Technology Data Exchange (ETDEWEB)

    Dattoli, G. [ENEA, Div. Fisica Applicata, Centro Ricerche Frascati, Rome (Italy)

    2001-07-01

    In this item is presented a brief survey of fractional calculus and of the relevant applications. In the work are discussed different points of view of the operation of fractional derivative and present a unifying definition. The role played by fractional derivatives and integrals within the framework of integral transform is analyzed. [Italian] In questo articolo si traccia un profilo del cosidetto calcolo frazionario e delle relative applicazioni a problemi di matematica pura ed applicata. Si discutono varie definizioni dell'operazione di derivata frazionaria, non tutte coincidenti fra loro, e si mostra come sia possibile proporre una definizione univoca che inglobi tutte le altre. Si analizza infine il ruolo giocato dalle derivate e dagli integrali frazionari e, piu' in generale, quello degli operatori differenziali ad esponente frazionario, nell'ambito della teoria delle rappresentazioni integrali.

  14. Riscritture del romance nel secondo Novecento italiano

    OpenAIRE

    Stefano Nicosia

    2012-01-01

    Si intende offrire una panoramica ragionata sul ritorno del romance della tradizione italiana, sotto forma di riscrittura, attraverso le opere di alcuni autori del nostro secondo Novecento. Piuttosto che un’analisi di ogni singola riscrittura, che necessiterebbe uno spazio a se stante, si privilegia qui la descrizione del fenomeno  nelle sue implicazioni con le modalità di trasformazione della tradizione e con il contesto intellettuale di una stagione della cultura italiana....

  15. Un diálogo de pensares: Dos paradigmas para la práctica y la investigación en el trabajo social en el mundo hispanoparlante

    OpenAIRE

    Martínez Brawley, Emilia; Zorita, Paz M-B.

    2013-01-01

    En este artículo se explicaran los principios de los paradigmas principales de práctica e investigación en el trabajo social del mundo anglosajón; se presentarán reflexiones sobre estos paradigmas vis-a-vis la realidad cultural y lingüística hispanoparlante y se sugerirán alternativas paradigmáticas para la práctica y la investigación en el trabajo social en las comunidades de habla castellana.

  16. Paradigmas emergentes y ciencias de la complejidad

    OpenAIRE

    Miguel Martínez Miguélez

    2011-01-01

    La investigación científica viene sufriendo a partir de las primeras décadas del siglo XX, cambios radicales en la manera de generar enunciados seguros y firmes a partir de las certezas proporcionadas por el Método Científico. Sin embargo, a partir de las serias dudas generadas por la manera de explicar el mundo y su realidad, se ha venido entendiendo al indagar metodológico-científico centrado en búsquedas que den cuenta de la realdad cambiante y dinámica, cuestión que no es entendida en las...

  17. Hezkuntza holistikoa: XXI. mendeko hezkuntza paradigma

    OpenAIRE

    Iribarren Blasco, Ainhoa

    2014-01-01

    Vivimos inmersos en una sociedad de constante cambio. Esos cambios, tienen cierta influencia en la vida social, personal y económica de cada individuo planteando nuevos desafíos. Por lo tanto, la escuela debe de estar preparada para responder de la manera más eficaz y significativa a esos nuevos desafíos o a las nuevas problemáticas que presentan los alumnos y alumnas. Para ello, proponemos la educación holística, una educación basada en la sociedad del siglo XXI. De todas formas, la educació...

  18. Dicty_cDB: CHE280 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CGT Length of 3' end seq. 583 Connected seq. ID - Connected seq. - Length of connect...um cDNA, mRNA sequence. 36 0.080 2 AE006311 |AE006311.1 Lactococcus lactis subsp. lactis IL1403 section.... 253 3e-66 BC082653_1( BC082653 |pid:none) Xenopus laevis hypothetical LOC494... 251 8e-66 CR857176_1( CR857176 |pid:none) Pon...cytoskeletal 4.0 %: mitochondrial 4.0 %: vacuolar 4.0 %: vesicles of secretory system >> prediction for CHE280 is...CH (Link to library) CHE280 (Link to dictyBase) - - - Contig-U16447-1 - (Link to Or

  19. Care and education in the Danish Créche

    DEFF Research Database (Denmark)

    Broström, Stig; Hansen, Ole Henrik

    2010-01-01

    This article seeks to identify the relation between policy and lived life, for the small child in the Danish crèche. To accomplish this, the article integrates demography, traditions, national curriculum and psychological, educational, and recent developments in research. It is an attempt to reveal...... knowledge and consequences, by conducting the academic legitimacy of diverse paradigms, and recognizing the quality and distinctive character of the theories involved. The methods used involve systematic readings, organization, and interpretation of textual material derived from legislation and relevant...... that, it is vital to emphasize the influence that policy causes on educational practice in the crèche, e.g., the conceptualization of education and care....

  20. Investitionsschwäche der Unternehmen schafft Handlungsbedarf

    OpenAIRE

    Fratzscher, Marcel; Gornig, Martin; Schiersch, Alexander

    2016-01-01

    Obwohl die Bundesregierung erste Maßnahmen auf den Weg gebracht hat, besteht in Deutschland weiterhin eine signifikante Investitionsschwäche. Die vorliegende Studie des DIW Berlin untermauert dies anhand der Entwicklung der Unternehmensinvestitionen. Demnach investieren die hiesigen Firmen heute kaum mehr als im Jahr 2007, also vor der weltweiten Finanz- und Wirtschaftskrise. In den USA beispielsweise liegt das Investitionsniveau hingegen um fast 14 Prozent höher. Die Expertenkommission zur "...

  1. Paradigmas emergentes y ciencias de la complejidad

    Directory of Open Access Journals (Sweden)

    Miguel Martínez Miguélez

    2011-01-01

    Full Text Available La investigación científica viene sufriendo a partir de las primeras décadas del siglo XX, cambios radicales en la manera de generar enunciados seguros y firmes a partir de las certezas proporcionadas por el Método Científico. Sin embargo, a partir de las serias dudas generadas por la manera de explicar el mundo y su realidad, se ha venido entendiendo al indagar metodológico-científico centrado en búsquedas que den cuenta de la realdad cambiante y dinámica, cuestión que no es entendida en las primeras décadas del siglo pasado. Apartir de su propuesta centrada en las ideas de complejidad y de sistema, el autor establece analogías y complementariedades entre ambas concepciones, para concluir que es necesario cambiar de mentalidad en la idea de hacer ciencia, pues se está gestando una nueva manera de abordar la realidad.

  2. La tutela penale del risparmio e del mercato finanziario. L'insider trading

    OpenAIRE

    Rocco, Gian Luigi

    2010-01-01

    1. Il mercato finanziario ed il risparmio costituiscono valori costituzionalmente significativi, data l’importanza che rivestono per il tessuto economico e finanziario di un Paese, tanto più in un’economia globalizzata, come quella contemporanea, sempre più caratterizzata da un processo di finanziarizzazione della ricchezza. L’assetto normativo e regolamentare, che deve presiedere al funzionamento del mercato ed alla gestione del risparmio, è storicamente caratterizzato dal tentativo di ri...

  3. La economía ecológica y el poder constitutivo de la contabilidad: En contra de la cosificación y la economización del mundo, contradicciones e invisibilidades del paradigma neoclásico.

    OpenAIRE

    Gómez Contreras, Jennifer Lorena

    2010-01-01

    En el presente documento se abordará la pregunta ¿Qué parámetros, concepciones y lineamientos deberían tenerse en cuenta en la contabilidad, con el fin de incorporar en la información contable mediciones y valoraciones de lo medio ambiental, bajo una visión alternativa a la de acumulación de capital? Para ello se presentaran algunos de los vacios del marco teórico presente hoy en día en la economía convencional en lo correspondiente al tratamiento de lo medio ambiental, y cómo en respuesta a ...

  4. "BASI MOLECOLARI DEL MEDULLOBLASTOMA: RUOLO DELLE E3-LIGASI REN ED ITCH NEL SIGNALING DI HEDGEHOG"

    OpenAIRE

    Pietrosanti, Laura

    2011-01-01

    Il medulloblastoma è la forma più comune di neoplasia infantile. È causato da alterazioni genetiche e epigenetiche che influenzano lo sviluppo delle cellule progenitrici dei granuli del cervelletto. Tali difetti comprendono delezioni cromosomiali, come la delezione del braccio corto del cromosoma 17, ed alterazioni nelle più importanti vie di trasduzione del segnale. È stato recentemente descritto che il medulloblastoma è strettamente legato all’attivazione costitutiva della pathway Sonic-He...

  5. El paradigma de Comportamiento Informacional como alternativa para comprender los fenómenos informacionales en América Latina

    OpenAIRE

    Cristian Berrío-Zapata; Fabio Mosso Moreira; Ricardo Cesar Gonçalves Sant'Ana; María Liliana Muñoz Ortega

    2016-01-01

    La Ciencia de la Documentación, predecesora de las Ciencias de la Información, históricamente descuidó el estudio del hombre común. Como producto de la era fordista, suponía que el valor de cualquier comportamiento informacional era su carácter técnico y económico. Como contrapunto, este artículo presenta algunos de los aportes el paradigma del Comportamiento Informacional, que abandona esta tendencia y su énfasis en el sistema de información, formal y estandarizado, para estudiar al usuario ...

  6. Un cambio de paradigma en la evaluación: de los tests tradicionales a la evaluación de desempeño

    OpenAIRE

    Jalo, Marcela Lilian; Pérez Albizu, María Candela; Piris, Giovanna

    2015-01-01

    Las últimas tendencias en la enseñanza de una lengua extranjera muestran una evolución hacia nuevos enfoques. Sin embargo, las estrategias de evaluación no reflejan en forma fehaciente este cambio de paradigma. Mayoritariamente se continúa priorizando la evaluación formal y sumativa y no se le otorga a la evaluación de proceso la importancia que esta conlleva. El presente trabajo intenta demostrar que la evaluación no puede ser solo concebida como instrumento de medición del aprendizaje del a...

  7. El paradigma de aprendizaje discriminativo dimensional una revisión metodológica y de confrontaciones teóricas

    OpenAIRE

    López Ruiz, José

    1987-01-01

    Se intenta alcanzar a través de la metodología experimental los objetivos generales de desligar la misma del paradigma e - r así como el estudio de un proceso a través tanto del análisis de secuencias de respuestas abiertas como de patrones eventos internos inferidos. Para ello se planifico un diseño factorial 3x3x3 tomando como variables independientes la ... edad niveles representativos de los tres ciclos de E.G.B. Entrenamiento con compuestos de estimulo de una dos y tres dimensiones - la...

  8. Georreferenciación de fotografías aéreas de 1927 pertenecientes a la confederación hidrográfica del Ebro (che) y análisis de usos de suelo de la zona comprendida entre Remolinos y Zaragoza

    OpenAIRE

    Martínez Cebrián, Alodia

    2014-01-01

    El vuelo pionero de 1927, llevado a cabo en la cuenca hidrográfica del Ebro, permite un reconocimiento preciso del cauce del Ebro desde esa fecha. La georreferenciación de las fotografías del 1927con respecto al vuelo oleícola de 1998 y con la ayuda de un modelo digital de elevaciones (MDE), hizo posible la integración de estas fotografías aéreas en las nuevas tecnologías de gestión de datos, tales como son los Sistemas de Información Geográfica (SIG). La creación del mosaico con ellas permit...

  9. Paradigmas de enfermería (no posibles: La necesidad de una ruptura extraordinaria (No possible pradigms of nursing: The necessity of an extraordinary rupture

    Directory of Open Access Journals (Sweden)

    Xabier Irigibel-Uriz

    2010-12-01

    Full Text Available Aproximación foucaultiana a la discusión en torno a la naturaleza de la ciencia normal de enfermería y la posible extraordinariedad del paradigma de la transformación descrito por Kerouack y col. y asumido como anhelo del desarrollo de la enfermería. Ejercicio teórico donde los aportes conceptuales de Thomas Kuhn permiten ubicar la discusión en torno a los límites de los paradigmas (No Posibles, como espacio e instante desde donde podrían emerger los enfrentamientos que dieran origen a investigaciones y paradigmas extraordinarios.A Foucaultian approximation of the discussion in terms of the nature of the normal science of nursing and the possible extraordinariness of the Transformation paradigm described by Kerouack et al. and assumed as a desire for development of nursing. A theoretical exercise where Thomas Kuhn offers his concepts which allow for the discussion in terms of the limits of the (No Possible Paradigms, like space and instance from where tensions could emerge that give rise to extraordinary investigations and paradigms.

  10. Análisis conceptual y operativo del turismo sostenible. El caso de Mar Chiquita

    OpenAIRE

    Bertoni, Marcela

    2009-01-01

    El desarrollo del paradigma ambiental ha implicado cambios significativos en la actividad turística. La difusión de este paradigma plantea una concepción y una ética nuevas del turismo que reimpone el análisis de todas las dimensiones que inciden en la actividad: naturales, económicas, sociales y políticas.

  11. 幽门螺杆菌cheA和cheY基因表达及其产物与细菌趋化的相关性%Prokaryotic expression of Helicobacter pylori cheA and cheY genes and correlation among the expressed products and bacterial chemotactic behavior

    Institute of Scientific and Technical Information of China (English)

    吴盛海; 徐丽慧; 严杰; 王贤军

    2009-01-01

    目的 克隆幽门螺杆菌趋化相关基因cheA和they并构建其原核表达系统,建立幽门螺杆菌体外趋化模型并确定其趋化诱导物质,了解特异性抗体和氯氰碘柳胺对幽门螺杆菌趋化的抑制作用.方法 PCR扩增幽门螺杆菌NCTC11637株全长cheA和cheY基因片段,T-A克隆后测序.构建上述目的基因原核表达系统,采用SDS-PAGE和Bio-Rad凝胶成像分析系统检查目的重组蛋白rCheA和rCheY的表达情况,Ni-NTA亲和层析法提纯rCheA和rCheY.rCheA和rCheY免疫家兔获得抗血清,用饱和硫酸铵沉淀法和DEAE-32离子交换法提纯IsG,用免疫扩散法检测抗血清及其IsG效价.采用硬琼脂法建立幽门螺杆菌NCTC11637株体外趋化模型并检测11种物质的趋化诱导作用,同时分别观察抗rCheA IgG(rCheA-IgG)和氯氰碘柳胺钠对细菌趋化的抑制作用.结果 PCR扩增获得预期大小的cheA和cheY基因片段,其核苷酸和氨基酸序列与文献报道完全相同.所构建的原核表达系统能有效表达rCheA和rGheY.rCheA和rCheY兔抗血清及其IgG免疫扩散效价均分别为1:4和1:2.盐酸、硫酸和乙酸对该幽门螺杆菌均有趋化诱导作用,一定浓度的rCheA-IgG和氯氰碘柳胺钠均对幽门螺杆菌趋化有抑制作用(P<0.05).结论 本研究成功地构建了幽门螺杆菌NCTC11637株cheA和cheY基因原核表达系统.H~+是诱导幽门螺杆菌趋化的信号物质,rCheA-IgG和氯氰碘柳胺钠均能抑制幽门螺杆菌对H~+的趋化.%Objective To clone the cheA and cheY genes of Helicobacter pylori for construction of their prokaryotic expression systems, and to establish chemotactic model in vitro of H. pylori for determing chemotaxis-inducing substances and to understand the effects of specific antibody and closantel on inhibiting chemotactic behavior of the microbe. Methods The segments of entire cheA and cheY genes were amplified by PGR and then sequenced after T-A cloning. Prokaryotic expression systems of the

  12. Emanuele Liaci, Il gatto che si mordeva la coda

    OpenAIRE

    Lucia Pascale

    2012-01-01

    Il gatto che si mordeva la coda (Le Chat qui se mordait la queue) est le premier livre du poloniste et professeur Emanuele Liaci (1976). Sur un arrière-fond autobiographique, ce roman à la première personne fait interagir Ferdy Durke, Gingio pour les intimes, une figure inspirée du roman de Witold Gombrowicz, avec Mattia Pascal, un célèbre personnage de la littérature italienne né sous la plume de Luigi Pirandello. L’histoire commence à Rome, le héros-narrateur doit entamer son premier jour d...

  13. Emanuele Liaci, Il gatto che si mordeva la coda

    Directory of Open Access Journals (Sweden)

    Lucia Pascale

    2012-07-01

    Full Text Available Il gatto che si mordeva la coda (Le Chat qui se mordait la queue est le premier livre du poloniste et professeur Emanuele Liaci (1976. Sur un arrière-fond autobiographique, ce roman à la première personne fait interagir Ferdy Durke, Gingio pour les intimes, une figure inspirée du roman de Witold Gombrowicz, avec Mattia Pascal, un célèbre personnage de la littérature italienne né sous la plume de Luigi Pirandello. L’histoire commence à Rome, le héros-narrateur doit entamer son premier jour d...

  14. Weber no Século XXI: Desafios e Dilemas de um Paradigma Weberiano

    Directory of Open Access Journals (Sweden)

    Carlos Eduardo Sell

    2014-03-01

    Full Text Available Después de décadas de intensivo trabajo de exegesis de la obra de Weber, una amplia investigación realizada en Alemania sobre este autor condujo a la caracterización de su obra en torno al tema de la racionalización. A partir de este presupuesto, una nueva generación de investigadores viene intentando formular una propuesta de actualización de la teoría weberiana, por medio de su confrontación con los principales problemas de análisis de la sociología contemporánea. ¿Cuáles son las características del "paradigma weberiano" y cómo evaluarlo en términos de agenda teórica contemporánea? Con base en estas cuestiones, se examina, en primer lugar, cómo el programa de investigación weberiano se inserta en la disputa alrededor de la articulación entre agencia (plano micro y estructura (macro en la teoría social. El segundo eje de análisis trata la teoría de la modernidad y evalúa el intento de sus intérpretes de desplegar las investigaciones weberianas del plano de la génesis al plano de la diversificación de la modernidad (modernidades múltiples.

  15. L'armoniosa complessità del mondo

    Directory of Open Access Journals (Sweden)

    Marco Mozzoni

    2013-05-01

    Full Text Available “Le emozioni sono parte integrante dei processi mentali che portano verso le scoperte scientifiche e verso i nuovi modelli che spiegano il mondo”. Di questo è convinta Anna Curir dell'Istituto Nazionale di Astrofisica - Osservatorio Astronomico di Torino, autrice del bel libro “I processi psicologici della scoperta scientifica. L'armoniosa complessità del mondo”, edito da Kim Williams Books (Torino, 2012, con la prefazione di Felice Perussia. E' un libro prezioso quello della Curir, matematica di formazione, scritto con eleganza e passione sincera per un argomento che travalica i confini delle discipline, consentendo di portare a galla un filo conduttore che sembra legare intrinsecamente il cosmo e la psiche. Il tutto “in nome di quella trasversalità delle culture che è la cifra distintiva di questo secolo, della postmodernità”.

  16. Michela/Miki: storia vera di un uomo che non si è mai sentito donna

    Directory of Open Access Journals (Sweden)

    Anna Paola Lacatena

    2015-07-01

    Full Text Available Quella raccontata da un paziente del Dipartimento Dipendenze Patologiche della ASL di Taranto, Michela prima e Miki poi, è la storia di un'infanzia difficile, consumata in una casa in cui la violenza e la scarsa attenzione nei confronti dei bisogni sono la cifra principale. La protagonista non accetta le sue sembianze femminili, non si sente donna, vive come se non lo fosse. Da subito, si percepisce uomo in un corpo femminile. Miki non è un personaggio frutto di fantasia, dove quest'ultima rischierebbe di essere superata per drammaticità dalla realtà. È una persona che non ha saputo né voluto coltivare una menzogna esistenziale. Inizialmente provandoci con tutta la rabbia verso la vita di cui Michela era capace e successivamente con la consapevolezza di non essere solo distruttività e rabbia. Il desiderio profondo di vedere realizzata la propria autenticità lo conduce al rifiuto di darsi in pasto all'annientamento completo decidendo, dopo un accumulo di sofferenze e rifiuti, di decidere chi e come essere nel mondo. Rifiutando il rifiuto, cercandosi profondamente, la sfida non è stata più contro il resto del mondo ma a favore di sé e, conseguentemente degli Altri.

  17. Neurogenesi del controfattuale

    Directory of Open Access Journals (Sweden)

    Stefano Calabrese

    2013-06-01

    Full Text Available Lo studio delle morfologie cui è ricorsa la letteratura per l’infanzia occidentale si spiega anche alla luce delle recenti scoperte in merito al pensiero controfattuale dei bambini, ossia il riferimento da un lato a ciò che non esiste, che potrebbe avvenire in futuro o che sarebbe potuto avvenire in passato se si fossero date condizioni differenti, dall’altro a mondi inesistenti e del tutto implausibili, come testimoniato dal genere fantasy. Contrariamente a quanto sostenuto da Piaget, le neuroscienze identificano oggi nella corteccia pre-frontale la regione cui si riconoscono prerogative tradizionalmente antitetiche quali la pianificazione delle azioni, la progettualità e l’immaginazione.

  18. Las TIC, el proceso del conocimiento y las competencias docentes

    Directory of Open Access Journals (Sweden)

    Augusto Perez Lindo

    2014-11-01

    Full Text Available En el marco del Seminario Internacional "Formación y conocimiento" organizado por la Universidad de Sorocaba presentamos un análisis de los efectos de las TICs en los procesos del conocimiento. Tratamos de demostrar que esos efectos se producen en varias direcciones: cambios en la visión de la realidad, de la subjetividad, del lenguaje, de los paradigmas, de las relaciones sociales. Propone fortalecer competencias adecuadas al cambio de paradigma, como la capacidad para seleccionar e interpretar informaciones, la capacidad para pensar científicamente, la capacidad para comunicar, la capacidad para convivir, la capacidad para dominar varios lenguajes.

  19. Finally, a crèche at CERN!

    CERN Document Server

    Anaïs Schaeffer

    2013-01-01

    After many years of discussion, the CERN Staff Association’s first crèche will open its doors in September to welcome up to 20 babies and toddlers.   A delicate operation: the installation of 11 modules above the Nursery's School canteen. Image: Sigrid Knoops. The CERN Staff Association’s Nursery School, which will soon turn 50, is pleased to announce the establishment of CERN’s first crèche. This project, which has come to fruition over the past academic year with the support of the CERN Management, meets an established and growing need among the Laboratory’s personnel and users. As a modular construction, the Nursery School’s new second floor was assembled above the existing canteen in a matter of days. Its 11 modules are ultra-modern – they’re even equipped with underfloor heating. “Thanks to this extension, we will be able to accept around twenty babies at the start of the academ...

  20. EL ESTADO EN LA GESTIÓN DEL CONFLICTO: LA REFORMA DEL PROCESO PENAL EN LATINOAMÉRICA

    Directory of Open Access Journals (Sweden)

    Asael Mercado Maldonado

    2010-05-01

    Full Text Available La actual reforma del proceso penal en Latinoamérica vive el tránsito del paradigma del Estado racional que, al ejercer la justicia punitiva, dota de sentido al proceso penal, otorgándole más facultades al juez, pasa al paradigma del sistema de justicia penal como marco de discusión y gestión de un conflicto de intereses surgido a consecuencia de la comisión de un delito, donde las partes, como interesados en que se resuelva, comparten protagonismo con el juzgador. En este artículo desarrollaremos ambos paradigmas y las consecuencias que originan para el proceso penal, a fin que se considere cuál de las dos presenta mayor garantía y eficiencia para la sociedad.

  1. Perché io credo in colui che ha fatto il mondo

    CERN Document Server

    Zichichi, Antonino

    1999-01-01

    Fin troppo spesso si sente dire che il mondo della scienza e quello della religione sono in completa opposizione e che non condividono alcuna esperienza o caratteristica in comune. Nulla potrebbe essere più falso di queste affermazioni secondo Antonino Zichichi, che in quest'opera afferma come la ricerca scientifica e l'esperienza religiosa abbiano in comune molto più di quanto si possa pensare.

  2. La disciplina delle emozioni tra introspezione e performance: pratiche e discorsi del controllo a Toraja (Indonesia)

    OpenAIRE

    Aurora Donzelli; Douglas Hollan

    2013-01-01

    La letteratura antropologica sulle emozioni relativa alle società dell’Indonesia e dell’area più vasta che comprende il Sudest asiatico e il Pacifico sembra convergere sull’enfasi attribuita alla questione del controllo emozionale3. Gli antropologi che hanno lavorato in quest’area sono stati inevitabilmente affascinati dalla compostezza e dall’assenza di espressione diretta dei sentimenti dimostrata nel comportamento quotidiano delle persone che cercavano di comprendere (Anderson 1966, p. 129...

  3. Esigenze stilistiche in un testo non inventivo: la traduzione del libretto di istruzioni

    OpenAIRE

    Koenraads, Elisabeth

    1995-01-01

    Chi si accinge a lavorare come traduttore freelance si troverà prima o poi davanti a un libretto di istruzioni da tradurre. Lavoro che dal principante viene ben volentieri accettato, a meno che non si tratti di macchinari molto complessi o di manuali destinati agli specialisti del settore. In fin dei conti noi tutti abbiamo una certa familiarità con un gran numero di macchine ed elettrodomestici che usiamo quotidianamente. Inoltre noi tutti siamo stati qualche volta...

  4. La traduzione del linguaggio medico: analisi contrastiva di testi in lingua italiana, inglese e tedesca

    OpenAIRE

    Magris, Marella

    1992-01-01

    L'oggetto della presente trattazione è capire che cosa si intenda per linguaggio medico. Applicando la definizione più comune di linguaggio settoriale al caso specifico, possiamo dire che il linguaggio è un sottosistema del linguaggio naturale che viene utilizzato per la comunicazione tra specialisti della scienza medica. Tale sottosistema si distingue dal linguaggio generale e dagli altri linguaggi tecnici e scientifici per alcune caratteristiche, ossia per la scelta e l'uso di determinati ...

  5. La “guerra del éter”

    OpenAIRE

    Pena Rodríguez, Alberto

    2015-01-01

    Quest’articolo analizza alcuni aspetti relativi all’intervento della radio portoghese nella guerra civile spagnola partendo da un corpus documentale che fornisce alcuni interessanti elementi per studiare questo aspetto del conflitto spagnolo. Basato su fonti provenienti da emeroteche ed archivi tanto spagnoli quanto portoghesi, l’analisi si sofferma particolarmente sul ruolo svolto da una stazione che si rivelò molto importante per la vittoria del bando franchista: il “Rádio Club Português” (...

  6. CRISIS ECONÓMICAS Y CAMBIOS DE PARADIGMA

    OpenAIRE

    Gonzalo Castañeda

    2010-01-01

    En este ensayo se plantea que la teoría económica ortodoxa se encuentra en una encrucijada debido a su pobre desempeño para explicar la crisis financiera internacional que inició en 2008. Asimismo, se sostiene la hipótesis de que la teoría de la complejidad social es un mejor paradigma para explicar fenómenos socioeconómicos, especialmente los caracterizados por situaciones de desequilibrio y comportamientos colectivos no-lineales. En particular, se hace referencia a modelos con agentes heter...

  7. O Paradigma Anarquista Em Educação

    Directory of Open Access Journals (Sweden)

    Sílvio Gallo

    2009-12-01

    Full Text Available Este artigo procura explorar as possibilidades de se pensar o arcabouço teórico do Anarquismo como paradigma para análise da educação contemporânea. Para tanto, apresenta os princípios gerais de sua filosofia política, tratando-o como um princípio gerador, mais do que uma doutrina propriamente dita. Em um segundo memento, procura aplicar esses princípios a questões educacionais, defendendo a emergência e a fecundidade de uma Filosofia da Educação de cunho libertário.

  8. O Paradigma Anarquista Em Educação

    OpenAIRE

    Sílvio Gallo

    2009-01-01

    Este artigo procura explorar as possibilidades de se pensar o arcabouço teórico do Anarquismo como paradigma para análise da educação contemporânea. Para tanto, apresenta os princípios gerais de sua filosofia política, tratando-o como um princípio gerador, mais do que uma doutrina propriamente dita. Em um segundo memento, procura aplicar esses princípios a questões educacionais, defendendo a emergência e a fecundidade de uma Filosofia da Educação de cunho libertário.

  9. Ripensando la logica dei processi economici localizzati. In margine alla concezione del capitale di Adam Smith e Fernand Braudel

    OpenAIRE

    Dini, F.

    2011-01-01

    mentre la concezione del capitale di Smith è strumentale e attualistica (è lo strumento che genera la divisione tecnica e sociale del lavoro, e pertanto, attraverso l'espansione del mercato, lo sviluppo economico), secondo Braudel il capitale ha come forma tipica quella liquida, mentre la forma reificata (quella che genera le divisioni del lavoro smithiane) è saltuaria e contingente. La differenza deriva evidentemente dai diversi punti di vista e dai diversi obiettivi euristici degli autori, ...

  10. Terapia del dolore: un messaggio in bottiglia

    Directory of Open Access Journals (Sweden)

    Tiziano Cornegliani

    2011-09-01

    Full Text Available Poche cose quanto il trattamento del dolore dovrebbero richiedere una gestione “integrata”. E questo perché il dolore è un’esperienza soggettiva: troppi sono gli elementi che concorrono alla sua elaborazione da parte di un singolo individuo per cercare di oggettivare la sofferenza che egli prova. La medicina ci ha provato in ogni modo, nel suo continuo - e per molti aspetti sacrosanto e legittimo - anelito a rincorrere l’oggettività, ma...

  11. 2. I corpi del cinema: dall’enunciatore allo spettatore

    OpenAIRE

    Malavasi, Luca

    2014-01-01

    O corpo che oscilli alla musicaO sguardo che brilliCome possiamo scindere dalla danzaColui che la esegue?W. B. Yeats 2.1. Dopo tutto, c’è sempre un corpo Negli ultimi vent’anni, all’interno di discipline molto diverse, si è assistito a un rilancio della ricerca attorno ai temi del corpo, del somatismo e dell’incarnazione – e, da ultimo, in termini quasi riassuntivi, dell’esperienza. Nel caso degli studi cinematografici, l’iniezione di questi nuovi oggetti di ricerca ha permesso in primo luogo...

  12. Che cosa (non è rimasto della francesità?: addomesticamento e straniamento nelle traduzioni italiana e slovena di Les fleurs bleues di Raymond Queneau

    Directory of Open Access Journals (Sweden)

    Martina Ožbot

    2013-05-01

    Full Text Available Nel presente contributo vengono offerte alcune riflessioni sulla traduzione di aspetti culturalmente specifici nel testo letterario, e in particolare sulle versioni italiana e slovena del romanzo Les Fleurs bleues di Raymond Queneau, che sono opera rispettivamente di Italo Calvino e di Ana Barič Moder. Al centro dellʼattenzione è soprattutto la dicotomia traduttiva tra lʼapproccio straniante e quello domesticante. Un esame del testo originale e delle due traduzioni ha dimostrato che ambedue i traduttori si sono sforzati di preservare i caratteri della cultura di partenza iscritti nel romanzo queneauiano. Allo stesso tempo, però, hanno cercato di integrare le proprie versioni negli ambienti dʼarrivo quando ciò pareva necessario per rendere possibile il pieno funzionamento delle due traduzioni come opere letterarie che, nei specifici contesti italiano e sloveno, sono destinate ad avere la funzione di entità letterarie a sé stanti, cioè indipendenti dal loro primario legame con il testo di partenza francese. Fatte queste premesse, lʼapproccio generale dei due traduttori può essere caratterizzato come relativamente addomesticante, anche se in entrambe le versioni, e in particolare in quella italiana, viene concesso ampio spazio anche allo straniamento, purché esso non incrini la funzionalità della traduzione.

  13. Memorias del V Congreso Latinoamericano de Agroecología - SOCLA : Trabajos científicos y relatos de experiencias: la agroecología, un nuevo paradigma para redefinir la investigación, la educación y la extensión para una agricultura sustentable

    OpenAIRE

    Sarandón, Santiago J.; Abbona, Esteban

    2015-01-01

    Este libro reúne los resúmenes de trabajos científicos y relatos de experiencias presentados en el V Congreso Latinoamericano de Agroecología, organizado por la Sociedad Científica Latinoamericana de Agroecología, que tuvo lugar en la ciudad de La Plata, Argentina, del 7 al 9 de Octubre del 2015. Los trabajos y experiencias abordan diferentes líneas temáticas del amplio campo de la Agroecología y tienen como objetivos: a) contribuir a la difusión de los avances en investigación agroecológica ...

  14. L’impatto del cinema sul turismo: il fenomeno del cineturismo

    OpenAIRE

    Astrid Pellicano

    2016-01-01

    “Un film è sempre l’inizio di un viaggio”, così il fenomeno del cineturismo ci porta per mano a scoprire le location dei film e le emozioni che si celano dietro la più grande macchina dei sogni: il cinema. Spesso decidere la giusta destinazione per le proprie ferie è difficile, dal momento che esistono vari fattori, dal tempo, all’età, alle esigenze economiche e ai gusti, e luoghi che sono più speciali e più interessanti per trascorrervi le vacanze. Spesso ad influenzare ci pensan...

  15. Etiche del paesaggio

    Directory of Open Access Journals (Sweden)

    Massimo Venturi Ferriolo

    2015-11-01

    Full Text Available L’etica riflette sui rapporti fra uomo e ambiente. Indaga l’azione dell’uomo. Svela la sua visione della vita e il mondo possibile e accoglie in sé un complesso di norme morali e di costume che identificano un preciso comportamento nella vita di relazione. Si riferisce all’agire dell’individuo in una struttura sociale che lo comprende. Siamo alla ricerca di un’essenza del paesaggio indipendente dalla mera pittura, dalla rappresentazione, dall’immagine sentimentale: dalla natura sia ideale che reale. Prendere coscienza della cosa in sé, anche nei suoi aspetti ideali, significa comprenderne la complessità. Possiamo leggere quindi ogni paesaggio come realtà etica, risultato dell'operosità dell'uomo nella natura, ambito complessivo della vita: nel significato peculiare di progetto del mondo umano, che parte da lontano, da quando l'uomo ha incominciato a trasformare il proprio ambiente naturale per creare i luoghi dell'abitare, modellati con la mano e con lo spirito. La conoscenza dei paesaggi in tutta la loro complessità, a partire dal mondo antico, diventa quindi un nostro obiettivo. Questo significa superare, se non addirittura rovesciare, alcuni luoghi comuni consolidati e storicizzati: la teoria secondo la quale il paesaggio, nella sua dimensione estetica, sarebbe un'invenzione della modernità; il collegamento tra la moderna pittura di paesaggio e la nascita dei concetti estetici; la confusione tra natura e paesaggio, frequente nelle concezioni ecologico- ambientaliste; la tesi lessicale della nascita della coscienza del paesaggio, legata all'esistenza di una parola specifica che lo indichi. 

  16. Principios rectores para enfrentar la crisis del agua en la República Argentina

    OpenAIRE

    Chiesa, Virginia María

    2014-01-01

    En la década del ´70 comenzó a gestarse un nuevo modelo de producción orientado a buscar un equilibrio entre los beneficios ambientales, sociales y económicos. En la actualidad el enfoque de la sustentabilidad se ha convertido en el paradigma dominante del pensamiento ambiental. Dicho paradigma trajo como consecuencia un cambio radical en torno a la administración del recurso hídrico, puesto que tradicionalmente la gestión del agua se centraba en la dimensión productiva de la misma y a partir...

  17. Cuore e testa (1927 e La percezione del prossimo (1929

    Directory of Open Access Journals (Sweden)

    José Ortega y Gasset

    2012-01-01

    Full Text Available Cuore e testa e La percezione del prossimo, proposti qui in traduzione italiana, sono due articoli che il filosofo spagnolo José Ortega y Gasset (1883-1955 pubblicò su “La Nación” di Buenos Aires rispettivamente nel 1927 e 1929. Dalla scrittura dialogante dell’intellettuale che più profondamente rappresentò l’esigenza di rinascita e modernizzazione nella Spagna della prima metà del Novecento, veniamo introdotti a questioni a noi vicinissime quali: la rieducazione ai valori di un nuovo umanesimo che controbilanci la fiducia dell’uomo europeo nel progresso tecnico e nel perfezionamento intellettuale; i processi psicologici, visivi, come modello ermeneutico; il problema della percezione del prossimo che instaura la dialettica tra differenze radicali (le distanze tra i diversi, gli opposti, l’uomo e la donna e possibilità di comprensione dell’altro.

  18. Maurizio Ferraris, Documentare la documentalità prima del collasso ontologico

    Directory of Open Access Journals (Sweden)

    Guglielmo Feis

    2010-06-01

    Full Text Available Recensiamo l’ultimo lavoro di Maurizio Ferraris, dedicato all’ontologia sociale: Documentalità. Perché è necessario lasciar tracce.  Nel primo paragrafo sono esposte quelle che Ferraris caratterizza come le tesi portanti del suo lavoro, che quindi sono presentate nel secondo paragrafo. Il terzo e il quarto paragrafo sono dedicati alle critiche: prima quelle che Ferraris fa a Barry Smith e a John Searle servendosi della sua teoria e poi, tenendo conto del dibattito e delle recensioni seguite all’uscita del libro, quelle a Ferraris e alla sua teoria.

  19. Discovering Che-1/AATF: a new attractive target for cancer therapy

    Directory of Open Access Journals (Sweden)

    Simona eIezzi

    2015-04-01

    Full Text Available The transcriptional cofactor Che-1/AATF is currently emerging as an important component of the DNA damage response machinery, the complex signaling network that maintains genome integrity and prevents tumorigenesis. Moreover this protein is involved in a wide range of cellular pathways, regulating proliferation and survival in both physiological and pathological conditions. Notably, some evidence indicates that dysregulation of Che-1/AATF levels are associated with the transformation process and elevated levels of Che-1/AATF are required for tumor cell survival. It is for these reasons that Che-1/AATF has been regarded as an attractive, still theoretical, therapeutic target for cancer treatments. In this review, we will provide an updated overview of Che-1/AATF activities, from transcriptional regulation to DNA damage response.

  20. El humanismo como paradigma de la enfermería como ciencia

    Directory of Open Access Journals (Sweden)

    Núñez Gómez Nicolás Arturo

    1999-12-01

    Full Text Available

    Humanism's philosophical conception is presented to development a paradigm of nursing science. The nursing from creation has been guided toward professional practice and category; of Care has been fundamental contribution. In this article our intends is to grow some fine general of reflection so that nurses contribute to development of a science called nursing and whose accent is man in their multiple dimensions.

    A partir del humanismo como concepción filosófica se presenta una propuesta para crear un paradigma de la enfermería como ciencia. Desde su creación, la enfermería se ha orientado hacia su práctica profesional y la categoría de cuidado ha sido su aporte fundamental. Este artículo se propone crear unas líneas generales de reflexión, para que las enfermeras aporten al desarrollo de una ciencia llamada enfermería y cuyo acento es el hombre en sus múltiples dimensiones.

  1. Equazioni: le icone del sapere

    NARCIS (Netherlands)

    S. Bais

    2009-01-01

    Il mistero del cosmo è scritto nel linguaggio della matematica, e le equazioni sono le frasi che ne esprimono la bellezza e la profondità. Cercare di spiegare la scienza senza equazioni è come cercare di spiegare l’arte senza illustrazioni: partendo da questo presupposto, Sander Bais presenta una ga

  2. Educando para qué y para quién. El cambio de paradigma que el desarrollo sostenible demanda a la educación superior

    OpenAIRE

    Segalàs Coral, Jorge

    2016-01-01

    La sociedad tal como está organizada actualmente no tiene futuro, es insostenible; tanto ambiental, social, como económicamente. Estamos en una situación con un gran incremento de demandas al ecosistema y una disminución de recursos disponibles que conlleva a la aparición de conflictos sociales. Esto es debido a un paradigma económico neoliberal que prioriza el crecimiento a cualquier precio sin tener en cuenta los límites finitos del planeta y que incrementa las diferencias entre los ganador...

  3. Sistema informativo del Fondo Sociale Europeo di Regione Toscana - Adeguamenti normativi e correttivi, integrazione della parte finanziaria e gestione liquidazioni

    OpenAIRE

    Buzzi, Maria Claudia; Prati, Enrico

    2002-01-01

    Il presente documento ha come obiettivo descrivere l'adeguamento del Sistema Informativo FSE, che gestisce progetti ed attivit? relativi al servizio della Formazione Professionale regionale, per estendere la gestione ai progetti di tutti i servizi regionali e per metterlo in linea con le modifiche intervenute a livello normativo. Sono descritte inoltre la standardizzazione di una procedura omogenea di liquidazione che comprende tutta la casistica che si realizza per i diversi servizi regional...

  4. El paradigma competitivo: aspectos fundamentales de la ideología y las prácticas predominantes en economía y gestión.

    Directory of Open Access Journals (Sweden)

    Andrés Guillermo Hernández Martínez

    2010-05-01

    Full Text Available El presente trabajo de investigación hace una búsqueda y análisis de los elementos centrales del surgimiento y evolución del paradigma competitivo. El punto de partida de la presentación está en el pensamiento de Darwin, dada la importancia y trascendencia de sus ideas no sólo en el terreno de la biología, sino además en las ciencias sociales. Particularmente, la sociobiología, la economía y la gestión, son discutidas en el transcurso de este texto, mostrando las diferentes formas en que el discurso de la evolución se convirtió en elemento fundamental de cada una de ellas. Los temas centrales abordados son la lucha por la existencia, el concepto de competencia en la economía y la gestión y las implicaciones del modelo competitivo. El trabajo busca entonces ilustrar el paradigma, además de presentar las principales implicaciones que ha tenido para la sociedad a través de las teorías y las prácticas de la economía y la gestión.

  5. Sporto psichologijos ir edukologijos paradigma pasaulyje ir Lietuvoje

    OpenAIRE

    Motiejūnaitė, Kristina; Skurvydas, Albertas

    2006-01-01

    Naujoji mokslo paradigma — naujas mokslinis raštingumas, nauja mokslo kultūra, kurios pagrindiniai bruožai — mąstymo kritiškumas, abejonė, nuolatinė tiesos paieška ir nesibaigiantis dialogas su gamta, žmogumi, visuomene. Iki šiol vyraujant klasikinei mokslo paradigmai, sudėtingos susireguliuojančios sistemos tiriamos atitrūkusiais nuo tikrovės ir neinformatyviais tyrimo būdais (Skurvydas, 2001). Klasikinio mokslo atstovai ieško absoliučiai „tvirtų“ mokslinės tiesos apibrėžimo kriterijų (Ku...

  6. Borrelia burgdorferi CheD Promotes Various Functions in Chemotaxis and the Pathogenic Life Cycle of the Spirochete.

    Science.gov (United States)

    Moon, Ki Hwan; Hobbs, Gerry; Motaleb, M A

    2016-06-01

    Borrelia burgdorferi possesses a sophisticated chemotaxis signaling system; however, the roles of the majority of the chemotaxis proteins in the infectious life cycle have not yet been demonstrated. Specifically, the role of CheD during host colonization has not been demonstrated in any bacterium. Here, we systematically characterized the B. burgdorferi CheD homolog using genetics and biochemical and mouse-tick-mouse infection cycle studies. Bacillus subtilis CheD plays an important role in chemotaxis by deamidation of methyl-accepting chemotaxis protein receptors (MCPs) and by increasing the receptor kinase activity or enhancing CheC phosphatase activity, thereby regulating the levels of the CheY response regulator. Our biochemical analysis indicates that B. burgdorferi CheD significantly enhances CheX phosphatase activity by specifically interacting with the phosphatase. Moreover, CheD specifically binds two of the six MCPs, indicating that CheD may also modulate the receptor proteins. Although the motility of the cheD mutant cells was indistinguishable from that of the wild-type cells, the mutant did exhibit reduced chemotaxis. Importantly, the mutant showed significantly reduced infectivity in C3H/HeN mice via needle inoculation. Mouse-tick-mouse infection assays indicated that CheD is dispensable for acquisition or transmission of spirochetes; however, the viability of cheD mutants in ticks is marginally reduced compared to that of the wild-type or complemented cheD spirochetes. These data suggest that CheD plays an important role in the chemotaxis and pathogenesis of B. burgdorferi We propose potential connections between CheD, CheX, and MCPs and discuss how these interactions play critical roles during the infectious life cycle of the spirochete. PMID:27021244

  7. His Excellency Professor Dr Che-Ho Wei, Chairman, National Science Council Executive Yuan, Republic of China

    CERN Multimedia

    Patrice Loïez

    2002-01-01

    Photo 01: Professor Dr. Che-Ho Wei signing the Guest Book with CERN Director-General, L. Maiani. Photo 02: Professor Dr. Che-Ho Wei. Photo 03::Professor Dr. Che-Ho Wei shaking hands with CERN Director-General, L. Maiani.

  8. La coordinación del profesorado como necesidad en la construcción del EEES: una experiencia en investigación-acción

    OpenAIRE

    Terrón López, María José; Blanco Archilla, María Yolanda; Berenguer Císcar, Fernando Juan; Learreta Ramos, María Begoña

    2007-01-01

    La construcción del EEES comporta grandes transformaciones que hay que asumir tanto desde el punto de vista de la gestión académica como de la intervención docente en las aulas. Los cambios necesarios en la docencia no son posibles sin la acción coordinada del equipo docente implicado. Partimos del concepto de paradigma como cada uno de los esquemas formales en que se organizan los procesos de enseñanza superior. Estos paradigmas deben cambiar radicalmente debido a las implicaciones de Boloni...

  9. Le lingue settoriali del tedesco

    OpenAIRE

    Taino, Piergiulio

    1995-01-01

    Le particolarità delle lingue settoriali esaminate sia dai filologi che dagli esperti delle diverse discipline sono state per molto tempo quelle lessicali e anche oggi la terminologia assorbe la mole principale del lavoro. La ricerca sulle lingue settoriali del tedesco come parte della linguistica applicata tende ad un ampliamento della sua sfera d'interesse dal termine alla frase e da questa al testo. Tale processo corrisponde a un orientamento generale della linguistica da ...

  10. Caregiving e malattia di Alzheimer: una ricerca sugli effetti del luogo di cura sul benessere psicofisico dei caregiver

    OpenAIRE

    Ripamonti, C.; Gatti, M; Alessi, C; Fumagalli, B; Sala, F.

    2014-01-01

    Introduzione: Le caratteristiche della malattia di Alzheimer fanno si che la cura del paziente affetto da questo tipo di demenza risulti difficoltosa e possa incidere sull’equilibrio psico-fisico e sulla motivazione di chi opera a stretto contatto con questi malati (Aguglia et al., 2004). L’esposizione prolungata del caregiver a fattori di stress cronici è stata definita “caregiver burden” (Pillemer, Suitor, 1996), termine che esprime il carico fisico, psicologico, sociale e finanziario del c...

  11. Quel che resta di Marx. La riflessione di Bobbio durante e dopo la Resistenza

    OpenAIRE

    Sbarberi, Franco

    2013-01-01

    La ricerca utilizza, in primo luogo, i testi inediti di Norberto Bobbio su Marx e sul marxismo depositati presso il Centro Studi Piero Gobetti di Torino. A partire dagli anni Quaranta, Bobbio partecipa ad un dibattito internazionale su ciò che è vivo e ciò che è morto nel pensiero di Marx. Egli è affascinato dall’interpretazione marxiana della storia «dal punto di vista degli oppressi», ma è anche respinto dal messaggio rivoluzionario che la sottende. Secondo Bobbio, Marx ha proposto una conc...

  12. Acerca de la inversión en educación como herramienta de la estrategia de prevención social del delito/About the investment in education as a tool of social crime prevention strategy

    Directory of Open Access Journals (Sweden)

    Daniel Schulman

    2012-08-01

    Full Text Available Se ubicará en el presente a la Institución educativa formal como una herramienta de prevención del delito dentro de la Estrategia de Prevención social del delito en el marco del paradigma de la Gestión del Riesgo.

  13. Addio Nando Orfei, uno dei padri del circo

    OpenAIRE

    Francesco De Filippo

    2015-01-01

    «Il circo è e sarà il più grande spettacolo del mondo». Nando Orfei sarà ricordato per questa frase, la "sua" frase, e per quella giacca bordeaux, improbabile e forte come tutti i colori e i gusti legati al mondo circense, secondo la legge che vuole lo spettatore affascinato e sopraffatto da lustrini, suoni e luci. Gusti forti, come il desiderio e l'adrenalina che a Nandino doveva pompargli in corpo ogni volta che alle spalle gli si chiudeva la porta in ferro lasciandolo isolato dal mondo, ac...

  14. Homology modeling, substrate docking, and molecular simulation studies of mycobacteriophage Che12 lysin A.

    Science.gov (United States)

    Saadhali, Shainaba A; Hassan, Sameer; Hanna, Luke Elizabeth; Ranganathan, Uma Devi; Kumar, Vanaja

    2016-08-01

    Mycobacteriophages produce lysins that break down the host cell wall at the end of lytic cycle to release their progenies. The ability to lyse mycobacterial cells makes the lysins significant. Mycobacteriophage Che12 is the first reported temperate phage capable of infecting and lysogenising Mycobacterium tuberculosis. Gp11 of Che12 was found to have Chitinase domain that serves as endolysin (lysin A) for Che12. Structure of gp11 was modeled and evaluated using Ramachandran plot in which 98 % of the residues are in the favored and allowed regions. Che12 lysin A was predicted to act on NAG-NAM-NAG molecules in the peptidoglycan of cell wall. The tautomers of NAG-NAM-NAG molecule were generated and docked with lysin A. The stability and binding affinity of lysin A - NAG-NAM-NAG tautomers were studied using molecular dynamics simulations. PMID:27411553

  15. MSL Chemistry and Mineralogy X-Ray Diffraction X-Ray Fluorescence (CheMin) Instrument

    Science.gov (United States)

    Zimmerman, Wayne; Blake, Dave; Harris, William; Morookian, John Michael; Randall, Dave; Reder, Leonard J.; Sarrazin, Phillipe

    2013-01-01

    This paper provides an overview of the Mars Science Laboratory (MSL) Chemistry and Mineralogy Xray Diffraction (XRD), X-ray Fluorescence (XRF) (CheMin) Instrument, an element of the landed Curiosity rover payload, which landed on Mars in August of 2012. The scientific goal of the MSL mission is to explore and quantitatively assess regions in Gale Crater as a potential habitat for life - past or present. The CheMin instrument will receive Martian rock and soil samples from the MSL Sample Acquisition/Sample Processing and Handling (SA/SPaH) system, and process it utilizing X-Ray spectroscopy methods to determine mineral composition. The Chemin instrument will analyze Martian soil and rocks to enable scientists to investigate geophysical processes occurring on Mars. The CheMin science objectives and proposed surface operations are described along with the CheMin hardware with an emphasis on the system engineering challenges associated with developing such a complex instrument.

  16. Nichtlineare optische Spektroskopie an der Galliumphosphid-Silizium(001)-Grenzfläche

    OpenAIRE

    Brixius, Kristina

    2014-01-01

    In dieser Arbeit wurde die Grenzfläche zwischen Galliumphosphid (GaP) und Silizium(001) (Si), einem polaren, respektive nicht polaren indirekten Halbleiter, mittels nichtlinearer optischer Spektroskopie untersucht. Dabei stand die optische Frequenzverdopplung an der Grenzfläche im Vordergrund. Es konnte gezeigt werden, dass das Signal der Heterostruktur von einem Grenzflächenbeitrag dominiert wird, der bei den beiden Fest...

  17. El paradigma de la complejidad como instrumento teórico y metodológico en la investigación didáctica sobre la contaminación y sobre la energía

    OpenAIRE

    García Díaz, J.; Cano Martínez, M.

    2009-01-01

    En dos investigaciones recientes (Cano, 2008; García, Rodríguez y Solís, 2008; Rodríguez, 2008), hemos utilizado el Paradigma de la Complejidad como instrumento teórico que ha orientado el diseño y desarrollo de dichas investigaciones. En la primera investigación (Cano, 2008), se realizó un estudio pormenorizado del proceso de construcción de conocimiento relevante y significativo sobre la contaminación del agua con alumnos de cuarto de ESO. En la segunda (García, Rodríguez y Solís, 2008; Rod...

  18. Il diavolo in corpo: una lettura del Decameron di Giovanni Boccaccio The devil in the flesh: a reading of Boccaccio's Decameron

    Directory of Open Access Journals (Sweden)

    Andrea Lombardi

    2012-12-01

    Full Text Available Considerare il Decameron esclusivamente un "classico" non rende giustiza alla sua struttura narrativa geometrica e complessa. Poiché ognuno dei suoi aspetti rivela il potenziale sovversivo della sua macchina narrativa. Le cento novelle con la loro cornice, che descrive l'epidemia della peste nera del 1348, ne fanno il primo libro organico della narrativa occidentale: un testo con una architettura peculiare. Una lettura attenta, però, può individuare una nuova novella, quella di numero 101 (nell'Introduzione alla quarta giornata: ciò che rivela la crisi finale della struttura chiusa, dell'architettura pianificata. Ciappelletto, protagonista della prima novella, diviene Santo da "peggiore uomo del mondo" che era; mentre Griselda, eroina dell'ultima delle cento novelle, mostra che la sua iperbolica virtù si trasforma in cinismo crudele. Così il Decameron crea il proprio futuro, rappresentando una mimesi ampia della sua epoca e, allo stesso tempo, avviando una rottura radicale ironica, o meglio elusiva: modello della commedia rinascimentale e dell'ermeneutica, nell'uso radicale dell'ironia. Possiamo forse considerare il Decameron una risposta istigante alla domanda attuale sulla natura di ciò che è contemporaneo.Considerar o Decamerão apenas como um "clássico" não faz justiça à sua estrutura narrativa geométrica e complexa. Pois cada um de seus aspectos revela o potencial subversivo de sua narrativa. As cem novelas junto com sua moldura, que descreve a epidemia da Peste Negra em 1348, fazem dele o primeiro livro orgânico da narrativa ocidental, um texto com sua arquitetura peculiar. Porém, uma leitura cuidadosa pode revelar a existência de uma nova novela, a de número 101 (na Introdução à Quarta Jornada: o que representa a crise final da estrutura fechada, de uma arquitetura planejada. Ciappelletto, protagonista da primeira novela, torna-se Santo, de "pior homem do mundo" que era; enquanto Griselda, heroína da última das cem

  19. Studio di alcuni tratti del temperamento nel cane

    OpenAIRE

    Beghelli, Valentina

    2014-01-01

    Il temperamento può essere definito come l’attitudine che un cane esprime verso le persone e verso altri animali, la combinazione di tratti fisici e mentali, acquisiti e non, che determinano il comportamento del cane. Tale parametro delinea perciò il carattere di un individuo, inclinazioni e tendenze, eccitabilità, tristezza, rabbia e il modo caratteristico di comportarsi di un individuo, con particolare riferimento alle interazioni sociali. La presente tesi di Dottorato rappresenta uno s...

  20. Maurizio Ferraris, Documentare la documentalità prima del collasso ontologico

    OpenAIRE

    Guglielmo Feis

    2010-01-01

    Recensiamo l’ultimo lavoro di Maurizio Ferraris, dedicato all’ontologia sociale: Documentalità. Perché è necessario lasciar tracce.  Nel primo paragrafo sono esposte quelle che Ferraris caratterizza come le tesi portanti del suo lavoro, che quindi sono presentate nel secondo paragrafo. Il terzo e il quarto paragrafo sono dedicati alle critiche: prima quelle che Ferraris fa a Barry Smith e a John Searle servendosi della sua teoria e poi, tenendo conto del dibattito e delle recensioni seguite a...

  1. Il ruolo delle infrastrutture nella costruzione e nella percezione del territorio

    Directory of Open Access Journals (Sweden)

    Roberto Busi

    2012-08-01

    Full Text Available L’opera di pianificazione del paesaggio non può che passare attraverso la pianificazione delle componenti fisiche del territorio che, oltre agli indubitabili significati ed obiettivi funzionali, sono anche gli elementi costitutivi del paesaggio perché rappresentano le componenti percepibili del territorio medesimo; cosicché la pianificazione paesistica viene ad essere ad un tempo la diretta conseguenza e l’alta motivazione di quella urbanistico-territoriale conferendole motivi, fini e valori elevati.E le infrastrutture sono, come detto, le componenti fisiche primarie dell’antropizzazione del territorio sia in quanto tali, sia in quanto fattore per eccellenza di eventi generanti componenti fisiche.

  2. Nuevo paradigma normativo sobre la ciudad: Retornando a la ciudad tradicional

    Directory of Open Access Journals (Sweden)

    Tejedor, J.

    2015-03-01

    Full Text Available Spanish urbanism has been characterized historically for giving priority to the urban sprawl and new buildings. The attention to the existing urban space and buildings has been marginal in the legislation and slightly systematic in the practice. After the explosion of the real-estate bubble, but not only for this reason, the economic and financial reality of Spain, has turned into a priority the treatment of cities and buildings with new approaches, promoting integrated and energetically efficient urban regeneration, stimulating a new normative paradigm with the Act 8/2013, of June 26, regarding urban renewal, regeneration and renovation.El urbanismo español ha primado siempre el ensanche y la nueva edificación. La atención al tejido urbano y la edificación existentes ha sido marginal en la legislación y poco sistemática en la práctica. Tras la explosión de la burbuja inmobiliaria, pero no solo por esa razón, la realidad económica y financiera del país ha convertido en prioridad lo que era una necesidad, abordar con nuevos planteamientos el tratamiento de la ciudad y la edificación, promoviendo su regeneración integrada y energéticamente eficiente, impulsando un nuevo paradigma normativo mediante la Ley 8/2013, de 26 de junio, de rehabilitación, regeneración y renovación urbana.

  3. La crisi del diritto del lavoro

    Directory of Open Access Journals (Sweden)

    Alessandro Garilli

    2012-01-01

    Full Text Available Riassunto - L’Autore ripercorre in chiave critica l’evoluzione delle politiche legislative in materia di lavoro, alla luce dell’attuale fase di crisi economico finanziaria. Nell’esaminare i principali interventi normativi attuati da inizio secolo, l’Autore mette in evidenza le scelte di metodo e gli elementi di continuità che accomunano i vari provvedimenti, individuandoli nell’affannosa ricerca del punto di equilibrio tra flessibilità e garantismo. La riflessione si chiude con alcuni interrogativi sulle ultime linee di riforma del mercato del lavoro e con l’auspicio che, anche al cospetto delle imprescindibili ragioni dell’economia, il diritto del lavoro possa continuare a svolgere il proprio tradizionale ruolo di disciplina di tutela della persona.   Abstract - The author analyzes, with a critically oriented approach, the development of the employment law, in the light of the current economic and financial crisis. In examining the main regulatory measures implemented since the beginning of the century, the author highlights the methodological choices and the elements of continuity that unite the various measures, focusing them in a hard research of a point of balance between flexibility and security. The discussion concludes with some questions about the last lines of the reform of the labor market and with the hope that, even in the face of compelling reasons of economy, labor law can continue to play its traditional role of governing the protection of person.

  4. UN CASO DI LIPOMA DEL FILUM TERMINALE RECIDIVATO

    Directory of Open Access Journals (Sweden)

    Giuseppa Patti

    2009-01-01

    Full Text Available Il lipoma del filum terminale è una rara patologia che determina disturbi conseguenti a compressione midollare. Si tratta di una forma di spina bifida occulta, responsabile spesso dell’insorgenza della sindrome del midollo ancorato. Riportiamo il caso di un bambino, operato per correzione del lipoma, il quale a un anno dall’intervento chirurgico ripresenta i medesimi sintomi che lamentava prima dell’operazione. Si sottolinea l’importanza di un intervento chirurgico precoce e di un follow-up continuo allo scopo di individuare eventuali recidive.

  5. Assistência à mulher climatérica: novos paradigmas Atención a la mujer climatérica: nuevos paradigmas Assistance to the climacteric woman: new paradigms

    Directory of Open Access Journals (Sweden)

    Dino Roberto Soares De Lorenzi

    2009-04-01

    Full Text Available O envelhecimento populacional é uma realidade demográfica brasileira. Como conseqüência, espera-se, nos próximos anos, um aumento progressivo na procura dos serviços de saúde por mulheres com queixas relacionadas ao climatério. Paralelamente, a assistência ao climatério tem passado por uma modificação de paradigmas, impondo aos profissionais de saúde uma mudança de atitude. Reconhece-se que o climatério é influenciado tanto por fatores biológicos, como por fatores psicossociais e culturais, cujo conhecimento é fundamental para uma assistência mais qualificada e humanizada. Este artigo propõe refletir sobre as mudanças de paradigmas na assistência ao climatério, destacando a multidisciplinaridade e interdisciplinaridade, no sentido acolher melhor essa parcela da população e proporcionar-lhe um cuidado integral e individualizado, aproximando o saber da sensibilidade, voltado a uma melhor qualidade vida.Envejecimiento poblacional es una realidad demográfica brazilian. Consecuentementese espera un aumento progresivo de la búsqueda en los servicios de salud del país por mujeres con quejas relacionadas al climaterio. La asistencia al climaterio ha pasado por un cambio de paradigmas que han impuesto a los profesionales de la salud. El climaterio es influenciado por factores biológicos, factores psicosociales y culturales, cuyo conocimiento es fundamental para la planificación de una asistencia. Artículo se propone reflexionar sobre los cambios de paradigmas, el abordaje multidisciplinario e interdisciplinario, en el sentido de recibir mejor esta parcela de la población y proporcionarle un cuidado integral e individualizado, aproximando el saber de la sensibilidad, y el tener como objetivo a una mejor calidad de vida.Population aging is a demographic reality for Brazil. Consequently, in the next years it is expected a progressive increase in seeking health care services in the country by women with complaints related to

  6. Overexpression, purification, crystallization and preliminary X-ray analysis of CheY4 from Vibrio cholerae O395

    International Nuclear Information System (INIS)

    The chemotaxis response regulator CheY4 from V. cholerae has been cloned, overexpressed, purified and crystallized in monoclinic and hexagonal space groups; the crystals diffracted to 1.67 and 1.9 Å resolution, respectively. Chemotaxis and motility greatly influence the infectivity of Vibrio cholerae, although the role of chemotaxis genes in V. cholerae pathogenesis is poorly understood. In contrast to the single copy of CheY found in Escherichia coli and Salmonella typhimurium, four CheYs (CheY1–CheY4) are present in V. cholerae. While insertional disruption of the cheY4 gene results in decreased motility, insertional duplication of this gene increases motility and causes enhanced expression of the two major virulence genes. Additionally, cheY3/cheY4 influences the activation of the transcription factor NF-κB, which triggers the generation of acute inflammatory responses. V. cholerae CheY4 was cloned, overexpressed and purified by Ni–NTA affinity chromatography followed by gel filtration. Crystals of CheY4 grown in space group C2 diffracted to 1.67 Å resolution, with unit-cell parameters a = 94.4, b = 31.9, c = 32.6 Å, β = 96.5°, whereas crystals grown in space group P3221 diffracted to 1.9 Å resolution, with unit-cell parameters a = b = 56.104, c = 72.283 Å, γ = 120°

  7. Breve fenomenologia del lettore ai confini del nonsense (o Il lettore provocato

    Directory of Open Access Journals (Sweden)

    Laura Lucia Rossi

    2012-12-01

    Full Text Available In questo articolo esaminiamo alcuni generi letterari che sono stati spesso accostati al nonsense letterario. In particolare prendiamo in considerazione il ruolo del lettore all’interno di questi testi e ne proponiamo una sorta di fenomenologia. Invitiamo, infine, a riflettere su come considerare la dimensione del lettore all’interno di un genere letterario possa condurre a risultati rilevanti circa la definizione del genere stesso.

  8. LA CARTA DEL PAESAGGIO GEOLOGICO, DEI BENI NATURALI E CULTURALI DELLA MEDIA VALLE DEL TEMO

    OpenAIRE

    Di Gregorio, Felice; Masala, Alberto

    2016-01-01

    Vengono presentati i risultati di una ricerca finalizzata allo studio e alla valorizzazione dei beni naturali e culturali della Media Valle del Temo (Sardegna NO). Il lavoro, che ha la sua massima espressione grafica nella Carta del paesaggio geologico e dei beni naturali e culturali, è stato condotto a partire dalla Carta tecnica regionale tramite la realizzazione di una serie di carte tematiche di base (Carta geologica, Carta geomorfologia, Carta dell’uso del suolo e della copertura vegetal...

  9. Le sostruzioni del tempio di Apollo Sosiano e del portico adiacente

    OpenAIRE

    Bianchini, Marco

    2014-01-01

    Si analizzano le opere murarie di fondazione e di sostruzione del Tempio di Apollo Sosiano e del portico retrostante e i loro rapporti con le fondazioni del Tempio di Bellona e del Portico di Ottavia. Le strutture esaminate presentano una complessa stratigrafia riconducibile alle varie fasi di un grande cantiere che, negli ultimi decenni del i secolo a.C., portò alla completa ricostruzione di tutta l’area a nord del nuovo Teatro di Marcello. Si individuano inoltre molti elementi utili per la ...

  10. El innatismo moral, un nuevo paradigma de desarrollo moral, aportaciones desde la cognición y la neurociencia

    Directory of Open Access Journals (Sweden)

    M.ª del Pilar Quiroga Méndez

    2013-12-01

    Full Text Available Este trabajo presenta los nuevos abordajes en desarrollo moral, intuicionismo moral, procesamiento dual, cerebro moral, y universales morales, procedentes de la investigación generada en los últimos años. Durante más de cien años los científicos en general y la psicología en particular, han sido hostiles a la noción de que pueda existir una facultad moral o un sentido de la justicia innato En la actualidad un cuerpo importante de investigación científica procedente de la moderna ciencia cognitiva, está confluyendo en la afirmación del innatismo moral. Hoy existen evidencias suficientes para suponer que las capacidades morales básicas son no aprendidas y universales. Es razonable pensar que una especie tan intensamente social como la nuestra ha creado un modo de favorecer los procesos indispensables para la supervivencia. Por otra parte el procesamiento moral sigue una secuencia que destaca por su automaticidad, lo cuál se refrenda desde la mayor parte de las investigaciones de la psicología cognitiva y desde la neurociencia, creando todo ello un nuevo paradigma de aproximación a la comprensión del desarrollo moral.

  11. Posdisciplina una aventura metodológica en tiempos de nuevos paradigmas. Una mirada sobre el espacio público.

    Directory of Open Access Journals (Sweden)

    Elsa Laurelli

    2014-12-01

    Full Text Available El nuevo siglo se caracteriza por la innovación de nuevos paradigmas lo cual está significando aventurarse en la búsqueda de nuevos caminos para interpretar al espacio público, no solo como un espacio abierto, verde y de uso común aun para los que están en “situación de calle”, sino como un espacio de reproducción física, económica y social, de esparcimiento, de memoria, de símbolos colectivos y de lucha de la sociedad. Esta aventura implica desarrollar y relacionar conceptos, metodologías y saberes de distinto origen poniendo énfasis en los problemas a resolver y no en los límites disciplinares que podrían cercenarlos. La naturaleza social del espacio público y el desafío de una mirada crítica tanto de las políticas públicas como de las prácticas de diferentes agentes en el proceso de construcción del espacio urbano, son fuentes de nuevos temas, problemas y espacios de reflexión en la “sociedad pos”.

  12. Calidad de las aguas superficiales en la Cuenca del Ebro. Tendencias de salinidad, nitrato y fosfato

    OpenAIRE

    Quílez Sáez de Viteri, Dolores

    2011-01-01

    Objetivo General: Caracterización de la calidad de las aguas superficiales de la Cuenca del Ebro y de sus tendencias. Redes de Control de Calidad de Aguas de CHE: - 497 estaciones de control - Datos instantáneos con frecuencias variables - Se han seleccionado 31 estaciones - Relevancia dentro de la Cuenca del Ebro - Predominio del regadío - Disponibilidad de datos

  13. Nuevos paradigmas y desafíos en la prevención y control del cáncer de cuello uterino en América Latina New paradigms and challenges in cervical cancer prevention and control in Latin America

    Directory of Open Access Journals (Sweden)

    Maribel Almonte

    2010-12-01

    Full Text Available El cáncer de cuello uterino sigue siendo un problema de salud pública en Latinoamérica. El uso de la citología para la detección de lesiones pre-cancerosas no ha tenido mayor impacto en las tasas de incidencia y mortalidad, que aún se mantienen altas en la región. La disponibilidad de nuevas técnicas de tamizaje para la detección de lesiones pre-cancerosas y de vacunas altamente eficaces que previenen casi todas las lesiones relacionadas con VPH-16 y VPH-18 en mujeres no expuestas previamente al virus representan una gran oportunidad para la prevención del cáncer de cuello uterino en la región. En este manuscrito resumimos la evidencia científica y la experiencia de la región en i el uso de pruebas de VPH y de la inspección visual después del ácido acético (IVAA en tamizaje primario, y ii la implementación de programas de vacunación en adolescentes. Finalmente enumeramos una serie de recomendaciones adecuadas para distintos escenarios. La factibilidad de implementar un programa nacional de prevención de cáncer de cuello uterino exitoso y sostenible en países latinoamericanos dependerá de las prioridades de salud, la infraestructura y personal de salud disponible, determinadas luego de un riguroso análisis situacional local.Cervical cancer continues to be a significant health problem in Latin America. The use of conventional cytology to detect precancerous cervical lesions has had almost no major impact on reducing cervical cancer incidence and mortality rates, which are still high in the region. The availability of new screening tools to detect precancerous lesions provide great opportunities for cervical cancer prevention in the region, as do highly efficacious HPV vaccines able to prevent nearly all lesions associated with HPV-16 and -18 when applied before viral exposure. This paper summarizes the scientific evidence and regional experiences related to: i the use of HPV testing and visual inspection after the

  14. Marco metodológico y tecnológico para la gestión del conocimiento organizativo que dé soporte al despliegue de buenas prácticas de Ingeniería del software

    OpenAIRE

    Mora Soto, José Arturo

    2011-01-01

    Hoy en día nos encontramos inmersos en una sociedad que está en constante cambio, donde los paradigmas creados por los padres de la automatización y formalización de procesos de la era moderna, Henry Ford y Frederick Taylor, han dejado de ser totalmente válidos; cuando a principios del siglo XX la capacidad productiva se basaba mayormente en la fuerza física, hoy en los albores del siglo XII el paradigma es muy distinto, ya que la productividad de la sociedad actual, llamada “del conocimiento...

  15. Riscritture del romance nel secondo Novecento italiano

    Directory of Open Access Journals (Sweden)

    Stefano Nicosia

    2012-12-01

    Full Text Available Si intende offrire una panoramica ragionata sul ritorno del romance della tradizione italiana, sotto forma di riscrittura, attraverso le opere di alcuni autori del nostro secondo Novecento. Piuttosto che un’analisi di ogni singola riscrittura, che necessiterebbe uno spazio a se stante, si privilegia qui la descrizione del fenomeno  nelle sue implicazioni con le modalità di trasformazione della tradizione e con il contesto intellettuale di una stagione della cultura italiana. Dal nucleo fondamentale degli anni Sessanta-Settanta, la ricchezza dei palinsesti proposti si allunga fino agli anni Novanta. Le riscritture interessano infatti tanto Calvino, Manganelli e Sanguineti, quanto Celati, Bufalino e le declinazioni del fumetto Disney, con due appendici ancora più vicine ai nostri giorni: Santagata e Marini. Attraverso questi testi e le tecniche che dispiegano, è possibile verificare la consistenza e la qualità di alcune pratiche di letteratura e cultura che si possono ascrivere ad una poetica compiutamente postmoderna nel nostro paese, poetica di riutilizzo dei materiali della tradizione in senso vitale e nuovamente generativo per le storie e i generi letterari.

  16. Identification and Characterization of a Putative Chemotaxis Protein, CheY, from the Oral Pathogen Campylobacter rectus

    OpenAIRE

    LaGier, Michael J.; Bilokopytov, Ihor; Cockerill, Bradley; Threadgill, Deborah S.

    2014-01-01

    Campylobacter rectus is an understudied oral bacterium that contributes to periodontitis. Processes that contribute to the disease-causing capabilities of pathogens, such as chemotaxis, are largely unknown in C. rectus. The aim of this study was to better understand C. rectus chemotaxis, by examining the C. rectus genome for the presence of a cheY gene. CheY proteins play a part in chemotaxis by acting as two-component response regulators. Significantly, CheY proteins from several pathogens, ...

  17. Il fascismo, i culti a-cattolici e le religioni dell'Oriente nelle riviste del regime (1922-1943)

    OpenAIRE

    GORLA, FILIPPO

    2012-01-01

    La tesi esplora i rapporti del fascismo con i culti a-cattolici e mediorientali, oltre che con alcuni fenomeni politico-spirituali dell’Estremo Oriente. Essa muove da questi interrogativi: quali erano nel fascismo i legami tra il pensiero e l’azione? Quale ruolo era riconosciuto allo “spirito”? Il regime intendeva creare una religione politica? E’ esistito un sincretismo fascista? La fonte principale della tesi è costituita dalle riviste politiche del regime, che consentono di cogliere le fin...

  18. Propaganda del odio y del miedo

    OpenAIRE

    Moreno Cantano, Antonio César

    2016-01-01

    Durante la Seconda guerra mondiale in tutta l’Europa dell’Asse incrementarono una serie di eventi pubblici che ambivano a scatenare l’odio nei confronti di alcuni gruppi sociali. Sulla scorta del Terzo Reich, la Francia di Vichy realizzò in tutto il paese una serie di esibizioni il cui intento era quello di offendere e disumanizzare gruppi sociali specifici, come gli ebrei, i comunisti e i massoni. Questo avvenne per esposizioni come La Franc maçonnerie dévoilée (1940), Le Juif et la France (...

  19. The new Meyrin crèche takes its first steps

    CERN Multimedia

    2008-01-01

    The new Meyrin crèche was inaugurated on 10 October and already caters for 16 children of CERN personnel. Copyright: Laurent Barlier. Copyright: Robert Tillmann. At the end of August, the new Meyrin crèche in Champs-Fréchets, the Espace de Vie Enfantine (EVE), welcomed its first intake of infants. They included 16 children of members of the CERN personnel who are benefiting from the agreement signed in 2007 with the commune of Meyrin (see Bulletin n°43&44/2007). The crèche was officially inaugurated on 10 October with several CERN representatives in attendance, including HR Department Head, Enrico Chiaveri, and Head of the Relations with the Host States Service, Friedmann Eder. The following day, EVE held an open day for the inhabitants of Meyrin and interested members of the CERN personnel. The new 1516 m2 building ‘s spaces have very clean and ...

  20. O paradigma económico de eficácia organizacional

    OpenAIRE

    Fernandes, António

    2007-01-01

    Este artigo faz uma breve revisão da literatura acerca do estudo do paradigma de eficácia organizacional cujo espírito gravita em torno do processo interno. No paradigma económico de eficácia podem incluir-se três grandes contributos, designadamente, da teoria da gestão científica do trabalho de Taylor, da teoria clássica desenvolvida por Fayol e da teoria da burocracia de Weber.

  1. CONVERGENCIA DE PARADIGMAS BIOTECNOLÓGICOS Y ESTRATEGIAS DE LOS GRUPOS LÍDERES MUNDIALES

    OpenAIRE

    Pablo Lavarello

    2014-01-01

    El propósito de este artículo es analizar la diversificación tecnológica de las grandes firmas frente a la emergencia de nuevos paradigmas tecnológicos. A partir de la siste - matización de una base de datos de patentes, en este trabajo se hace la pregunta, por un lado, ¿estos procesos dan lugar a la convergencia entre las bases de conocimiento y la emergencia de un nuevo paradigma de biotecnología industrial? Por el otro, se discute a partir de datos de los principales grupos en escala inter...

  2. Nuevos Paradigmas en la Investigación en la Historia de la Contabilidad

    OpenAIRE

    Miriam Núñez Torrado

    2000-01-01

    En la última década se ha despertado un interés creciente por la historia de la contabilidad en diversos foros académicos. Ese interés ha impulsado un nuevo debate sobre las posibilidades metodológicas a la hora de acometer una investigación en este área. En este trabajo se presentan los dos paradigmas fundamentales de la historiografía contable, el positivista y el crítico, para a continuación proponer un nuevo paradigma integrador de ambas posiciones metodológicas. Ello se hará a partir de ...

  3. PARADIGMAS DE INVESTIGACIÓN EN CONTABILIDAD DE GESTIÓN

    OpenAIRE

    Carlos Eduardo Facin Lavarda; Mercedes Barrachina; Vicente M. Ripoll Feliu

    2008-01-01

    Los estudios realizados sobre la evolución de la investigación contable evidencian que las publicaciones en las principales revistas contables, se ubican en el paradigma funcionalista, siendo la corriente dominante en nuestros días, privilegiando todavía, por tanto, las conclusiones obtenidas a través de métodos estadístico – cuantitativos. Con el objetivo de entender el estado actual de la investigación en Contabilidad de Gestión, el artículo lleva a examinar los paradigmas de investigación ...

  4. Quel che resta della piantata. Trasformazioni del paesaggio agrario lungo il tracciato della via Postumia

    Directory of Open Access Journals (Sweden)

    Marco Cillis

    2015-10-01

    Full Text Available The paper is about some influences have led to the transformation of a liner landscape along the ancient via Postumia from Genua to the Adriatic sea, taking into account the great contribution Emilio Sereni gave the history of rural Italian landscape. Comparing archeological and literary sources, maps and plans, the aim is understanding how and how much the features of the road are still alive along the landscape it crosses.

  5. Museo Palazzo Ricci - Più reale del reale

    Directory of Open Access Journals (Sweden)

    Stefano Ciocchetti

    2014-06-01

    Full Text Available Può una realtà virtuale diventare un’esperienza più concreta di quella reale?Sembra di si osservando il lavoro di Tesi di Stefano Ciocchetti.In questo articolo si illustrano le fasi di lavorazione che hanno portato alla riproduzione digitale degli ambienti e delle opere esposte nel Museo Palazzo Ricci di Macerata, tra i più importanti per quel che riguarda l’arte italiana del ‘900. La riproduzione digitale è avvenuta attuando diverse tecniche di ripresa, che hanno reso possibile la navigazione virtuale all’interno del Museo e l’interazione con le opere d’arte presenti, simulando un’esperienza assimilabile a quella reale ed offre, inoltre, possibilità di fruizione che vanno oltre un’esperienza concreta.Questo grazie alle tecniche di ripresa utilizzate, come l’alta definizione che permette di osservare particolari di opere non visibili ad occhio nudo o la modellazione 3d che permette di osservare le sculture attraverso punti di vista differenti.

  6. Los sistemas just-in-time/Kanban, un paradigma productivo

    Directory of Open Access Journals (Sweden)

    Huberto Juárez Núñez

    2002-01-01

    Full Text Available Los sistemas just-in-time/Kanban surgen en el contexto de la reconstrucción de la economíajaponesa hacia mediados del siglo XX. Fueron las empresas automotrices (especialmente Toyotalas que lograron hacer un análisis crítico de las debilidades y fortalezas del sistema fordista, y enese camino encontraron rutas alternativas que mostraron su importancia cuando en el proceso desu internacionalización dieron respuesta a problemas sistémicos del capitalismo. Su impacto en lasestructuras productivas ha sido enorme. Por una parte, han impulsado nuevas formas de integra-ción industrial (lean production, modular production y, por la otra, han cambiado radicalmen-te la cultura empresarial y laboral frente a conceptos como productividad y calidad. En este trabajose hace un reconocimiento del desarrollo de los sistemas, sus procesos de internacionalización y losimpactos recientes en las transformaciones de la industria del automóvil.

  7. Propiedades espaciales del mecanismo atencional inhibitorio

    Directory of Open Access Journals (Sweden)

    Alejandro Castillo

    2003-01-01

    Full Text Available En una serie de tres experimentos se estudia una posible especificidad espacial del mecanismo atencional inhibitorio. A través del paradigma de priming negativo se examina en concreto si existen diferencias entre estímulos distractores situados dentro del foco atencional del sujeto y otros situados en la periferia. Mediante la utilización de una letter-matching task similar a la que emplearon Nelly, Lissner y Beck (1990, se obtiene efecto de priming negativo sólo en aquellas letras distractores que se sitúan fuera del foco de atención del sujeto. Los resultados sugieren que el sistema inhibitorio que actúa a nivel de características físicas y espaciales no puede inhibir los estímulos situados dentro del foco, por lo cual todos ellos son forzosa-mente procesados a nivel semántico.

  8. A crèche for CERN staff The Staff Association project

    CERN Multimedia

    Association du personnel

    2006-01-01

    For many years, the Staff Association has supported the demand for the creation of a crèche for the children of CERN staff. Several studies have been carried out without leading to a concrete plan. The fact that the CERN population is getting younger and the shortage of local facilities have led to a more urgent demand for this type of social service over the past few years. Furthermore, the Equal Opportunities Panel had already recommended that crèche places be made available.

  9. Il fantasma dell'universo che cos'è il neutrino

    CERN Document Server

    Carocci, Lucia

    2015-01-01

    Ben prima della luce, a un decimillesimo di secondo dal Big Bang, i neutrini sono apparsi nell'universo. Dopo un secondo il brodo primordiale si era raffreddato abbastanza da consentire loro di muoversi liberi e ancora oggi, dopo quasi quattordici miliardi di anni, sono numerosissimi. Ma che cosa sono i neutrini? Elusivi come fantasmi, camaleontici, viaggiano indenni attraverso la materia arrivando dritti sino a noi dagli angoli più remoti e nascosti dell'universo. Per saperne di più seguiremo i fisici che li studiano in laboratori sotterranei o in luoghi estremi come i ghiacciai polari o le profondità marine.

  10. La incorporación de la práctica estudiantil en las universidades latinoamericanas como nuevo paradigma educativo

    Directory of Open Access Journals (Sweden)

    Claudio Rama Vitale

    2011-01-01

    Full Text Available Históricamente, la dinámica educativa en América Latina en la mayoría de los campos disciplinarios, sólo en un nivel marginal incluía la actividad práctica en el proceso de enseñanza. Sin embargo, en los últimos años se verifica en el marco de la lenta inclusión de un paradigma emergente, la expansión en la región de la pasantía estudiantil y la práctica pre-profesional. Éstas se comienzan a conformar como componentes estructurales del proceso de enseñanza-aprendizaje y como distinciones de las nuevas configuraciones institucionales y educativas de la educación superior en la región. Es parte de una revalorización del conocimiento empírico, que se asume en un creciente plano de igualdad con el llamado conocimiento científico. En este artículo analizaremos algunas de estas nuevas prácticas en su marco conceptual, como ellas se asocian a la incorporación del enfoque por competencias, a un cambio en la tradicional extensión universitaria, y cómo su expansión normativa en la región es parte de la transformación de los sistemas y las prácticas universitarias en la región.

  11. L'interpretazione del contratto internazionale

    OpenAIRE

    Vinci, Pierpaolo

    2012-01-01

    La ricerca ha ad oggetto l’analisi di clausole, contenute nei contratti del commercio internazionale, che sembrano finalizzate a fornire in anticipo una metodologia dell’interpretazione del contratto. L’elaborato pertanto analizza i profili di validità ed efficacia di singole e specifiche clausole, come le “clausole d’intero accordo”, le “clausole di non modificazione orale”, le clausole contenenti definizioni, e simili, alla luce delle regole giudiriche di derivazione eteronoma applicabil...

  12. El proyecto arquitectónico: Paradigma de la complejidad.

    OpenAIRE

    Azulay Tapiero, Marilda

    2012-01-01

    Ponencia escrita presentada en la sesión dedicada a Ámbitos, Innovación y Calidad, en las IV Jornadas Internacionales sobre Investigación en Arquitectura y Urbanismo. Esta propuesta quiere indagar en los enfoques del pensamiento complejo enunciados por Edgar Morin como ámbito de investigación para organizar el conocimiento acerca del proceso de elaboración y re-elaboración de la arquitectura y el modo en que se percibe, interpreta, significa,... En él se sitúa el proyecto arquitectónico, e...

  13. Il posto dialettometrico che spetta ai punti-ais 338 (Adorgnano, Friuli, 398 (Dignano/Vodnjan, Istria E 367 (Grado, Friuli Presentazione di tre carte di similiarità

    Directory of Open Access Journals (Sweden)

    Hans Goebl

    2015-10-01

    Full Text Available Il titolo del nostro contributo non è stato scelto a caso. Il problema del posto da assegnare a una varietà linguistica tanto locale quanto regionale costituisce, dal lontano 1876 (ASCOLI 1876a: Del posto che spetta al ligure nel sistema dei dialetti italiani fino ai giorni piu vicini a noi (BLASCO FERRER 1986: La posizione linguistica del catalano nella Romània un capitolo tra i più importanti della dialettologia e/ o geografia linguistica romanza. Si badi però al fatto che la ricerca del posto da assegnarsi a una qualsiasi varietà geolinguistica rappresenta, in ultima analisi, una delle tante metafore scientifiche tra le quali si annoverano, fra l'altro, I'albero genealogico (tedesco: Stammbaum e I'onda (tedesco: Welle. Orbene, si sa che, in sede di scienza, le metafore di qualsiasi indole non costituiscono risultati scientifici a se stanti, bensí strumenti euristici. La metafora della collocazione di una varietà geolinguistica data non puo prescindere dall'utilizzazione mentale dello spazio tridimensionale e cioè euclidèo. Nella prospettiva tridimensionale, il posto della varietà geolinguistica esaminata equivale a un punto ben definito (median te le coordinate x, y ez all'interno di uno spazio tridimensionale ugualmente ben definito. Se si considera dunque, in chiave tridimensionale, il posto di una varietà geolinguistica data, la considerazione concomitante dello spazio euclidèo appartenentevi è indispensabile. In questo articolo, due delle tre dimensioni euclidèe sono rappresentate dai 251 punti della nostra rete-AIS, mentre la terza dimensione viene definita dalla misurazione delle s_imilarita linguistiche tra il punto di riferimento-AIS - e cioe quello di cui si esamina il posto dialettometrico - ed i restanti 250 punti della rete di osservazione.

  14. Ecological paradigm of legionella: a revision. New strategy and its implication in public health Revisión del paradigma ecológico de la 'legionella'. Estrategia ecológica y su implicación en salud pública

    Directory of Open Access Journals (Sweden)

    José Bernardo Ferrer Simó

    2008-12-01

    fundamental, in order to find block substances .Regarding the relation with the biofilm (authentic critical point of the system its elimination or decrease to minimal levels by the utilization of specific materials, the design of devices or systems of easy cleanliness (curved corners, accessible spaces, suitable maintenance of the facilities (inlays, corroded surfaces, etc. with frequent (physics cleanliness and the continuously utilization of substances against the film are necessary.Algunos aspectos difícilmente explicados por el modelo ecológico descrito por Rowbothan en 1980, como son: la dosis infecciosa anormalmente baja, las largas distancias en las cuales la bacteria permanece viable en el seno del aerosol difundido, la dificultad de crecimiento en los medios de cultivo estándar, la poca eficacia de los desinfectantes antilegionela en el control de los brotes, la reinfección o sencillamente la ausencia de transmisión persona-persona, son analizados bajo el prisma de la microbiología ecológica. Centrados en la relación bacteria-protozoo, diversos estudios sugieren que la amplificación o crecimiento bacteriano podría tener lugar en dos fases o etapas, funcionalmente distintas, según la proporción o ratio bacteria-ameba (MOI- multiplicity of infection. En una primera fase de crecimiento rápido, en la que esta relación es sustancialmente baja, la entrada de una bacteria de legionela en la ameba originaría una única vacuola, que tras la lisis amebiana, liberaría al medio formas libres infectantes para otras amebas. La segunda etapa, de diseminación o colonización de otros nichos ecológicos, con relaciones MOI altas, se producen varias vesículas de crecimiento en el interior de la ameba que serían expulsadas por la misma sin necesidad de lisar. El enquistamiento de la ameba en esta fase, se produce tras la liberación masiva al medio de las vesículas que hubiera en el interior. Algunos autores sugieren que estas vesículas por sus características de

  15. Premessa del progetto esecutivo del piano pilota per la conservazione dei beni culturali in Umbria

    Directory of Open Access Journals (Sweden)

    Giovanni Urbani

    2011-11-01

    Il primo testo prescelto, che appare ancora oggi sostanzialmente attuale e predittivo rispetto ai problemi contemporanei della gestione dei beni culturali, è la premessa al progetto esecutivo del piano pilota per la conservazione dei beni culturali della regione Umbria, elaborato da Giovanni Urbani nel 1975.

  16. Oscillazioni del mesone D^0

    CERN Document Server

    Schiraldi, Vito; Morello, Michael Joseph

    In fisica delle particelle, con il termine di "oscillazione" si indica la trasformazione di una particella neutra nella sua antiparticella e viceversa, fenomeno dovuto al fatto che gli autostati di flavor non sono autostati della matrice di massa. Il Modello Standard delle interazioni fondamentali predice che l'oscillazione del mesone D^0 avvenga su tempi molto maggiori di una vita media, e appaia perciò come un effetto piccolo, inferiore al percento, in contrasto con il caso dei mesoni B^0 e B^0_s che oscillano con molta maggiore rapidità. Sperimentalmente, l'oscillazione dei mesoni D^0 è rimasta inosservata fino a tempi recenti: la prima evidenza sperimentale dell'esistenza di un effetto di oscillazione è stata ottenuta soltanto nella primavera del 2007 dagli esperimenti BaBar (SLAC, USA) e Belle (KEKB, Japan). Nell'agosto 2007 anche l’esperimento CDF (Fermilab, USA) ha presentato una evidenza simile, basata sull'analisi di una parte del campione di dati disponibile. La tesi descrive gli aspetti speri...

  17. La antropología social española en los 80 como paradigma tardomoderno

    Directory of Open Access Journals (Sweden)

    Anta Félez, José-Luis

    2005-12-01

    Full Text Available In the end of the seventies and the decade of 80 in the XX Century are marked by a deep change in the structures and systems of the politics, the society and the Spanish economy, where it highlights the creation and consolidation of the Spain of the Autonomies. In this same period the social anthropology is devoted with profusion to sit down the bases of its own work, so much in the academi than institutionally. At the same cheats that it is centred in the systematic study of the differential reality of the Spain's century end, taking the topic of the identity central like. In this article it is meant to this process as tardomodem, to be able to arrive to a conformation of the history of the Spanish anthropology in syntony with the big contemporary paradigms and in consonance with the countries of our environment.

    El final de los años 70 y la década de los 80 del siglo XX están marcados por un cambio profundo en las estructuras y sistemas de la política, la sociedad y la economía españolas, donde destaca la creación y consolidación de la España de las Autonomías. En este mismo periodo la antropología social se dedica con profusión a sentar las bases de su propio trabajo, tanto académica como institucionalmente, a la par que se centra en el estudio sistemático de la realidad diferencial de la España finisecular, tomando como central el tema de la identidad. En este artículo se significa este proceso como tardomoderno, para poder llegar a una conformación de la historia de la antropología española en sintonía con los grandes paradigmas contemporáneos y en consonancia con los países de nuestro entorno.

  18. A epidemiologia, os valores e o significado de paradigma Epidemiology, values, and the meaning of paradigm

    Directory of Open Access Journals (Sweden)

    Djalma Agripino de Melo Filho

    1997-10-01

    Full Text Available Recentemente, o emprego do termo paradigma chegou ao âmbito epidemiológico. Este texto analisou criticamente uma classificação de 'paradigmas epidemiológicos', proposta por Almeida-Filho. Inicialmente constatou-se que os valores não foram considerados como elementos fundamentais para a construção dos paradigmas, distanciando-se, assim, da matriz kuhniana. Uma vez que a sistematização procurou unir tendências antitéticas, ela pareceu estar mais próxima da epistéme foucaultiana. Finalmente, considerou-se mais apropriada a utilização do termo hegemonia, em vez de paradigma, para sistematizar períodos epidemiológicos, pois os valores das vertentes estão comprometidos com a particularidade (principalmente classe social.Use of the term paradigm has recently reached the epidemiological milieu. This article provides a critical analysis of a classification of "epidemiological paradigms" as proposed by Almeida-Filho. It was initially ascertained that values were not considered fundamental elements for the construction of paradigms, and that they therefore distanced themselves from the Kuhnian matrix. Systematization sought to unite antithetical tendencies and thus seemed closer to the Foucaltian epistéme. Finally, hegemony was considered a more appropriate term than paradigm for systematizing epidemiological periods, since the values of the different watersheds are committed to particularity (principally social class.

  19. A LÓGICA DOMINANTE DO SERVIÇO EM MARKETING – UM NOVO PARADIGMA?

    Directory of Open Access Journals (Sweden)

    Clara Isabel Koetz

    2013-01-01

    Full Text Available As diversas mudanças que vêm ocorrendo na disciplina de marketing têm sido consideradas, por diversos estudiosos da área, como um novo paradigma. Vargo e Lusch (2004 apontam a emergência de uma nova lógica, cuja ênfase está nos aspectos intangíveis, como habilidades, informação e conhecimento e na interatividade e conectividade dos relacionamentos, o qual poderia vir a substituir o modelo tradicional. O objetivo deste ensaio teórico é propor uma reflexão acerca da Service Dominant Logic (SDL, proposta por Vargo e Lusch (2004, a fim de identificar se, de fato, ela pode ser considerada um novo paradigma em marketing. Para tal, é realizado um exame do desenvolvimento teórico da disciplina, bem como da estrutura teórica proposta pelos autores, com base na perspectiva filosófico-científica e no conceito de paradigma de Kuhn (2006. A análise demonstra que o marketing evoluiu, por um lado, orientado pelas alterações impostas pelo ambiente; por outro lado, por meio de discussões teóricas que permitiram o avanço da disciplina. Não houve, ao logo deste processo, nem mesmo com a lógica dominante dos serviços, uma ruptura drástica que possa ser considerada uma troca de paradigmas.

  20. El paradigma intencional en la evaluación ciudadana de la administración local. La utilidad frente al bienestar

    Directory of Open Access Journals (Sweden)

    Carreras Romero, Enrique

    2013-04-01

    Full Text Available In the last years, one can find a renewed interest in the citizen´s assessment of local services. This article examines the possibility of applying the so called intentional paradigm to this field. The paradigm is based on the theory of reasoned action and it links service evaluation to the citizen´s political intention within the same explanatory mechanism. nevertheless, this mechanism has been formulated in two rival versions, “satisfaction” and “service value”. The purpose of this paper is to determine which of these models works better in the assessment of local services. Using empirical data collected in nine cities from the east of spain, a secondary analysis was applied using structural equation models in order to find out the most plausible mechanism (utility versus wellbeing that explains the formation of favorable attitudes towards local entities.

    Encontramos, en los últimos años, un renovado interés por la evaluación ciudadana de los servicios locales. el artículo examina las posibilidades de la aplicación del paradigma intencional en este campo. el paradigma, basado en la teoría de la acción razonada, vincula en un mismo mecanismo explicativo, la evaluación de los servicios con la intención política del ciudadano. sin embargo, este mecanismo ha sido formulado en dos versiones rivales, la satisfacción y el valor del servicio. el propósito del artículo es determinar cuál de los dos modelos funciona en la evaluación de los servicios locales. sobre los datos empíricos obtenidos de una investigación en nueve ciudades del levante español, se ha operado un análisis secundario utilizando modelos de ecuaciones estructurales para determinar el mecanismo más verosímil (utilidad del servicio o bienestar que explica la formación de actitudes favorables hacia las entidades locales públicas.

  1. On the Application of Simple Experiments to the Teaching of ChE Thermodynamics

    Science.gov (United States)

    McNeil, Kenneth M.

    1978-01-01

    This article describes the undergraduate ChE thermodynamics course at Drexel University and the reasons for incorporating a series of laboratory experiments into the course. Included is a list of lecture topics and a description of each of the experiments. (BB)

  2. La producción de libros de texto en la última década en la Argentina: el paradigma didáctico

    OpenAIRE

    Agratti, Laura Viviana

    1996-01-01

    En un artículo anterior, realizado en colaboración con el profesor Guillermo Obiols, analizamos la producción de libros de texto para la enseñanza de la filosofía en la escuela secundaria en la Argentina entre el último tercio del siglo pasado y principios de los 80 de nuestro siglo. En dicho artículo analizamos de un modo muy amplio y general la noción de "paradigma" para agrupar la producción de libros de textos que se podía señalar eran la expresión de la influencia de distintas corrientes...

  3. El estatus científico de la enfermería : paradigma, método y naturaleza de su objeto de estudio

    OpenAIRE

    Salas Iglesias, Manuel Jesús

    2003-01-01

    El presente documento trata de definir cuál es la situación actual del estatus científico de la enfermería, así como definir los principales problemas que impiden su situación de consolidación en el contexto general de la ciencia. Hacemos un recorrido por la significación y estado de los términos de paradigma, matriz disciplinaria, teoría, modelo, método científico y proceso de enfermería, así como su adecuación a las características de la ciencia y a la naturaleza ...

  4. El gasto público y las nuevas formas de intervención del Estado

    OpenAIRE

    Iñiguez, Alfredo; Selva, Rafael A.

    2009-01-01

    Uno de los pilares del actual esquema macroeconómico lo constituye el aumento en la intervención del Estado en la economía y en particular de la acción directa que se traduce en mayor gasto público. La negación a una política de ajuste del gasto es el cambio más relevante de paradigma respecto de la modalidad para enfrentar la crisis.

  5. Análisis del sistema organizacional desde una perspectiva compleja como herramienta de recursos humanos

    Directory of Open Access Journals (Sweden)

    Alonso Tejada Zabaleta

    2010-01-01

    Full Text Available Se presenta la propuesta de un Modelo del Sistema Organizacional, como una herramienta analítica que pueda ser utilizada por los encargados de RRHH o Talento Humano en las organizaciones, para definir, caracterizar, analizar y decidir sobre los elementos constitutivos del sistema y las consecuentes interacciones de dichos elementos. Labase filosófica del modelo se sustenta en un intento de aproximacióndesde el llamado "paradigma de la complejidad".

  6. Nullità del contratto. Artt. 1418-1423

    OpenAIRE

    Franceschelli, V

    2015-01-01

    Vincenzo Franceschelli Nullità del contratto. Artt. 1418-1423 c.c. Milano, Giuffrè Ed., 2015, Pag. XXVIII-406 Collana: Il codice civile. Commentario La monografia tratta della disciplina della nullità, assecondando la regolazione di cui agli articoli 1418, 1419, 1420, 1421, 1422, 1423 e 1424 del codice civile, di cui costituisce un commento. La nullità è una costruzione dei giuristi che non trova riscontro nelle altre scienze. È una originale costruzione del diritto. ...

  7. La conservazione del moderno nella cultura architettonica contemporanea

    OpenAIRE

    Accetta, Cinzia

    2006-01-01

    La tesi di dottorato analizza con rigore metodologico e acutezza critica la tematica del restauro del moderno al fine di chiarire il rapporto esistente tra la cultura architettonica contemporanea e l’architettura moderna, in quanto portatrice dei valori della modernità. Le problematiche legate alla conservazione di questa complessa eredità culturale, intendendo non solo le opere del Movimento Moderno ma tutta la produzione architettonica che dagli albori della rivoluzione industriale risale i...

  8. Il recupero dell'area del mercato ortofrutticolo

    OpenAIRE

    P.B. Giorgieri; F. Alberti

    2009-01-01

    Contributo pubblicato nella monografia n. 2/2009 della collana Architetture città e territorio dedicata alle trasformazioni urbane in Toscana riguardante le strategie del Piano urbano integrato per lo sviluppo sostenibile (PIUSS) di Massa, elaborato da S. Viviani, P. Giorgieri e F. Alberti per conto del Comune di Massa, che nel 2010 è stato presentato alla Regione Toscana e ammesso ai finanziamenti dei fondi strutturali europei (FESR). Nel testo viene descritto il progetto per il recupero del...

  9. Hacia la definición de un nuevo paradigma para la equidad en salud. Una propuesta para el análisis de las bases filosóficas de la salud colectiva

    OpenAIRE

    Pagannini, José María

    2006-01-01

    La salud colectiva está en crisis en la mayoría de los países. La meta de equidad en salud no se ha cumplido a pesar de los reiterados enunciados de los organismos internacionales y los gobiernos nacionales. Una de las causas de este evidente fracaso se atribuye, en parte, a las limitaciones del paradigma sanitario utilizado en las últimas décadas, definido sin considerar las corrientes de avanzada en desarrollo social y que ha provocado confusión y antinomias. Por lo tanto, se considera nece...

  10. Del caos a los sistemas: los fundamentos de ingeniería en la teoría de la organización, 1879-1932

    OpenAIRE

    Yehouda Shenhav

    1997-01-01

    El presente documento rastrea la génesis del paradigma de sistemas en el estudio de las organizaciones en los Estados Unidos remontándose a las prácticas de ingeniería del siglo XIX. Los análisis empíricos para el periodo 1879-1932 se basan en los datos primarios recogidos de las tres publicaciones periódicas en que por primera vez se codificó y cristalizó el estudio de las organizaciones: Engineering Magazine, American Machinist, y ASME Transactions. Se halló que la evolución del paradigma d...

  11. Noi siamo quello che ricordiamo - Le frazze di Crucoli: il teatro, il rito, il riscatto sociale

    Directory of Open Access Journals (Sweden)

    Tonia Mingrone

    2012-01-01

    Full Text Available Abstract - IT Questo lavoro nasce da una ricerca di campo sulle frazze, termine dialettale che indica le farse di Carnevale che si rappresentavano fino a cinquant’anni fa in molti paesi calabresi, tra cui il mio, Crucoli, in provincia di Crotone. Lo scopo di questo lavoro non è fare un resoconto esaustivo di tutto ciò che accadeva a Crucoli durante la celebrazione del Carnevale, impresa assai difficile dal momento che non ci sono documenti scritti e quindi bisogna affidarsi ai racconti orali delle persone intervistate, spesso non fedeli alla realtà, perché modificati dal tempo e dalla memoria. L’approccio con cui ho intrapreso questa ricerca è sicuramente legato all’aspetto teatrale e performativo dell’evento, senza trascurarne la rilevanza antropologica. Il materiale raccolto è frutto di interviste e colloqui con la gente del posto unito ad un grande lavoro di ricerca bibliografica di autori che avevano trattato di questo argomento in relazione ai loro paesi di origine.Lo scopo è quello di delineare l’organizzazione e lo svolgimento delle frazze, cercando di ricostruire la sua durata e le ripercussioni sulla comunità, nonché dimostrare ancora una volta come il teatro, messo a disposizione di alcuni eventi, diventi un mezzo forte di liberazione e di contestazione. Abstract - FR Cet article prend sa naissance par une recherche sur champ concernant les frazze, terme dialectal qui dénote les farces du Carnaval mises en scène jusqu'à il y a cinquante ans dans plusieurs villages en Calabria, entre eux le mien, Crucoli, dans la province de Crotone. La raison de ce travail n'est pas d'accomplir un compte rendu exhaustif de tout ce qui avait lieu à Crucoli pendant la célébration du Carnaval, l'exploit étant très difficile, du moment qu'aucun document écrit a été parvenu et par conséquence il est nécessaire de se remettre aux contes des témoins interviewés, souvent pas fidèles au réel, parce-que détournés par les

  12. Sviluppo e crisi. Per una prospettiva della compresenza

    Directory of Open Access Journals (Sweden)

    Andrea Pirni

    2011-02-01

    Full Text Available Il paradigma della modernità, adottando il concetto di sviluppo come tema chiave, ha elaborato moltissime teorie del mutamento: qui sviluppo e crisi risultano necessariamente contrapposti sia sotto il profilo teorico che empirico. La complessità crescente delle società europee contemporanee mette in discussione la capacità interpretativa del mutamento che le coinvolge attualmente e suggerisce l’elaborazione di nuove prospettive che focalizzino il processo di trasformazione in corso piuttosto che soffermarsi sul risultato. Dopo aver sinteticamente inquadrato il concetto di sviluppo nell’ambito del paradigma della modernità l’articolo intende sostenere l’utilità di una prospettiva che considera congiuntamente crisi e sviluppo per analizzare il mutamento delle democrazie contemporanee.

  13. A proposito del suffisso – eo.

    Directory of Open Access Journals (Sweden)

    Giuseppe Francescato

    2015-10-01

    Full Text Available Recentemente la mia attenzione è stata richiamata sulla presenza di alcuni esempi di parole derivate, formate col suffisso -eo, nel linguaggio di un informatore in una località margina- 1e del Friuli (Villanova, frazione di s. Giorgio di Nogaro. Si tratta di esempi come sgurlèo, remenèo, ciulèo, ecc., cioè - già a prima vista - di esempi paralleli a quelli derivati col suffisso -io nell'italianQ standard: mormorì, calpestìo, fruscìo, ecc. E' interessante notare.subito che G. De Leidi, nel suo accuratissimo. studio (pubblicato postumo sui suffissi nel friulano (1984, pur esaminando un numero elevato di suffissi (160 non fa alcuna menzione di -eo, e questo benchè nel vocabolario friulano conosciuto con il neme di il nuovo Pirona figuri, fra le "giunte e correzioni« (p. 1389 un esempio pure derivato , con -eo (ranganèo, che rientra appunto nella categoria degli esempi che ci interessano. Questo serve comunque a dimostrare la scarsità di documentazione relativa a tale suffisso, visto cheuno studioso diligente come appunto De Leidi si è potuto lasciar sfuggire quest'unico esempio che fino ad ora era, per così dire, ufficialmente conosciuto, in quanto registrato da quello che è il vocabolario friulano per antonomasia.

  14. Cambiamenti del corpo legati alla sindrome lipodistrofica e processi di ristrutturazione dell'identità in persone affette da HIV/AIDS

    OpenAIRE

    De Paola, Maria

    2010-01-01

    Premessa Nella persona, l’identità implica un senso di continuità e di unità fondamentale: aspetti che ognuno sperimenta nella propria vita. La malattia cronica, l’infezione da HIV/malattia AIDS, ed i diversi aspetti ad essa legati, tra cui i cambiamenti del corpo legati alla lipodistrofia, cambiamenti talvolta evidenti e per questo stigmatizzanti, possono rappresentare una cesura forte e gravemente destabilizzante nel senso di identità del paziente, sia sul piano psicofisico che social...

  15. EL PARADIGMA CIENTÍFICO DE LAS CIENCIAS AGRARIAS: UNA REFLEXION THE SCIENTIFIC PARADIGM OF AGRARIAN SCIENCES: A REFLECTION

    Directory of Open Access Journals (Sweden)

    León Darío Vélez Vargas

    2004-06-01

    Full Text Available A partir de los retos que hoy propone la sociedad, la ciencia, la tecnología y los contextos regionales, nacionales e internacionales, en los que se desenvuelve la agricultura y la ruralidad, se plantea que los paradigmas que han sustentado las ciencias y profesiones agropecuarias, sus reglas y procedimientos, son insuficientes para enfrentarlos y resolverlos, integralmente. La evidencia empírica desborda los marcos teóricos y supuestos desde los cuales estos desafíos son analizados y se formulan las soluciones. Se propone que para enfrentar exitosamente los nuevos retos y contextos, se requiere de nuevos paradigmas que definan un conjunto nuclear de fundamentos científicos e ingenieriles y una unidad mínima de estudio y trabajo. Esta unidad mínima debe permitir, desde una percepción sistémica y armónica, la identificación y análisis de los factores que intervienen en los procesos productivos y su contextos, el trabajo de las disciplinas y la formulación de preguntas y necesidades. En las ciencias agrarias, este cambio de paradigma puede estar representado en el enfoque agroecosistémico, el cual permite: a ordenar jerárquicamente la unidad de trabajo e investigación y sus niveles de interacción; b presentar el proceso productivo como una resultante del efecto integrado de factores socioeconómicos, ecológicos, culturales, científicos y tecnológicos; c la identificación integral de los problemas y soluciones; d el quiebre de los limites disciplinarios; e y responder a las demandas de una agricultura sostenible, competitiva, multifuncional y con equidad.Based on the challenges that are offered today by society, science, technology, and the regional, national and international contexts in which agriculture and rurality are unfolding, it is argued that the paradigms that have sustained the agricultural sciences and professions and their rules and protocols are insufficient for confronting and solving them in an integral fashion

  16. Reputazione dei fondi di Private Equity e sua influenza sul costo del debito nel mercato italiano

    OpenAIRE

    Desquens Palacios, David

    2012-01-01

    Un approccio molto comune dei fondi di Private Equity (buyout groups) è che si focalizzano in investimenti a breve termine a discapito della creazione di valore a medio/lungo termine. Usando obbligazioni emesse fra gli anni 1985 e 2013 da aziende che si sono quotate nel mercato borsistico italiano attraverso IPO, si vogliono studiare le influenze di questi fondi sul costo del debito, ovvero se la reputazione dei fondi di Private Equity ha qualche effetto sui costi di agenzia.

  17. Attività di gestione patrimoniale di una società di gestione del risparmio

    OpenAIRE

    Asic, Viktor

    2011-01-01

    Riassunto della tesi di dottorato Titolo: “Attività di gestione patrimoniale di una società di gestione del risparmio” Le società di gestione di risparmio costituiscono il “new vehicle” orientato alla gestione per conto di terzi di portafogli mobiliari. Note con l’acronimo di SGR, le società in questione rappresentano un intermediario finanziario che negli ultimi anni ha assunto notevole importanza grazie ai progressi e alle prospettive offerti dalla nuova normativa che disciplina ...

  18. Due giustificazionismi del totalitarismo comunista e nazista:Eric Hobsbawm ed Ernst Nolte

    OpenAIRE

    Berti, Giampietro

    2004-01-01

    Accettando le rispettive analisi deresponsabilizzanti dello studioso inglese e dello studioso tedesco, non si capisce che cosa siano stati di per se stessi il comunismo e il nazismo. Non a caso Hobsbawm e Nolte non mettono al centro della loro disamina la domanda decisiva circa la natura politico-sociale del totalitarismo e, non rispondendo a questo fondamentale quesito (che implica la necessità di un'analisi strutturale, le cui fonti ideologiche devono essere fatte risalire molto più indietr...

  19. Alienazione e informatica nella distopia del Novecento e dei primi anni Duemila

    OpenAIRE

    Meozzi, Tommaso

    2016-01-01

    La tesi analizza, attraverso il concetto di “alienazione”, un corpus di opere letterarie e cinematografiche che hanno al centro la descrizione fantastica di regimi totalitari, e che possono essere ricondotte al genere della distopia, o utopia negativa. Si tratta in primo luogo di alcuni classici del genere: Die andere Seite (Alfred Kubin, 1909), My (Evgenij Zamjatin, 1924), Brave New World (Aldous Huxley, 1932), 1984 (George Orwell, 1949), per quanto riguarda la narrazione letteraria; Metrop...

  20. UTILIZACIÓN DE NUEVOS PARADIGMAS QUE PERMITAN PROFUNDIZAR LOS CONOCIMIENTOS SOBRE LAS RELACIONES SUELO-PLANTA EN CONDICIONES TROPICALES

    Directory of Open Access Journals (Sweden)

    R. Martínez-Viera

    2009-01-01

    Full Text Available El presente trabajo ofrece argumentaciones para demostrar la necesidad de crear nuevas bases paradigmáticas, que permitan garantizar el desarrollo de una agricultura más productiva, optimizando las relaciones suelo-planta sin afectar la salud ambiental. Para ello, se hace necesario integrar los nuevos enfoques biológicos y técnicos de las ciencias agrícolas con los procedentes de las ciencias sociales y se concluye que para desarrollar una agricultura sustentable hay que tener en cuenta las exigencias sociales, económicas y políticas que conducen a crear una sociedad sustentable. Los paradigmas actuales que orientan las relaciones suelo-planta asumen que las limitaciones de los agroecosistemas pueden ser eliminadas solamente con la aplicación de distintas clases de insumos externos, se concentran en los procesos exógenos del suelo y olvidan los endógenos, y no consideran a las plantas como organismos con sus propias capacidades y estrategias para crecer y sobrevivir en estrecha relación con los procesos biológicos efectivos del suelo. Hoy no se consideran las interrelaciones que existen con los contextos ecológicos, socioeconómicos y culturales, donde se establecen los procesos productivos y se concluye falsamente que los conocimientos y las tecnologías pueden ser aplicados de la misma manera en cualquier lugar. Es por ello que para resolver los graves problemas alimentarios que hoy existen, debe darse un salto cualitativo representado por cambios paradigmáticos, que permitan asumir los nuevos compromisos, estableciéndose la interdisciplinariedad y el enfoque sistémico en la investigación, docencia, transferencia tecnológica y práctica agrícola.

  1. Los paradigmas de redacción normativa como medio para alcanzar la seguridad: ¿una apuesta segura?

    Directory of Open Access Journals (Sweden)

    Fernando Centenera Sánchez-Seco

    2013-01-01

    Full Text Available En diferentes referencias que se ocupan de la redacción de normas, se considera que éstas deben tener un lenguaje sencillo, claro y preciso, para así poder ofrecer seguridad. Una primera aproximación a esta afirmación, partiendo de diferentes dimensiones de la seguridad, ofrece numerosos argumentos para corroborarla. Así acontece si analizamos la seguridad como cualidad del derecho (en lo que respecta a la certeza de orientación, la firmeza del derecho o su eficacia, como justicia formal (con las implicaciones que ello conlleva en los ámbitos de la libertad y la igualdad y como justicia material (en lo que respecta a la protección de los derechos fundamentales, por ejemplo. Sin embargo, un examen más detenido demuestra que también existen razones para pensar que los paradigmas de redacción señalados no siempre aportan seguridad, y que en determinadas circunstancias el lenguaje complejo, vago o impreciso puede resultar conveniente. Si esto es así, parece que convendría reformular la directriz señalada al comienzo. Para llevar a cabo esta labor, la teoría de la legislación ofrece numerosas herramientas sugerentes, que pueden dar cabida a las circunstancias señaladas. En este estudio se propone la puesta en práctica de un sistema de racionalidad capaz de dar cobertura a las circunstancias diagnosticadas, estructurado en diferentes niveles de racionalidad, donde tienen cabida tanto los aspectos lingüísticos, como aquellos relacionados con la seguridad. 

  2. DALL’«ARTICOLO EPR» AGLI ESPERIMENTI DI ALAIN ASPECT: IL LUNGO CAMMINO DEL PROBLEMA DELLA NONLOCALITÀ IN MECCANICA QUANTISTICA

    Directory of Open Access Journals (Sweden)

    Vera Matarese

    2014-03-01

    Full Text Available Quando, nel 1935, venne pubblicato il famoso articolo chiamato poi “EPR Paper” per le iniziali dei suoi autori - Einstein, Podolsky, Rosen -, la comunità scientifica dovette confrontarsi non solo con le manifeste provocazioni che il suo argomento voleva mostrare, ma anche con latenti problemi che sarebbero sbocciati più avanti in tutti i loro stridenti contrasti. L’incompletezza della meccanica quantistica, che l’“articolo EPR” si proponeva di dimostrare, poggiava infatti su un principio molto problematico, quello della località, che sarebbe esploso nell’esperimento prima concettuale di Bohm e poi sperimentale di Aspect. Ciò che questo articolo vuole delineare è lo sviluppo del problema della nonlocalità, dai suoi albori fino alla prova della sua effettiva esistenza nel mondo quantistico, dove, come ben ha dimostrato Bell, nulla possono fare le variabili nascoste per dissolvere la realtà nonlocale di alcuni fenomeni.

  3. Ciencia-tecnología-sociedad, globalización y los límites del planeta

    OpenAIRE

    Viñuela Rodríguez, Juan Pedro

    2005-01-01

    En las sociedades globalizadas en las que vivimos nos encontramos frente a una crisis ecológica producida por nuestro modelo de desarrollo, que aquí lo consideramos bajo el concepto del paradigma de la dominación, y que hunde sus raíces en la tradición griega y judeocristiana. Si queremos salir hacia un nuevo modelo de sociedad sostenible nos vemos obligados a salir de este paradigma lo que implica una revolución a otro nuevo que proponemos que sea el del cuidado de la comunidad biótica de la...

  4. Manifestazioni ideologiche e simboliche del potere papale da Niccolò V a Paolo II

    Directory of Open Access Journals (Sweden)

    Anna Modigliani

    2009-12-01

    Full Text Available Il saggio affronta il problema delle espressioni ideologiche e simboliche del potere e del governo pontificio dal pontificato di Niccolò V a quello di Paolo II, con particolare attenzione per i modi in cui l’esercizio del potere temporale e spirituale dei papi veniva giustificato in testi diversi dalla trattatistica che specificamente riguarda questi temi, ad esempio nel De coniuratione Porcaria di Pietro Godi o nella Vita Nicolai quinti di Giannozzo Manetti. Lo studio rivela una netta distinzione tra quei papi che sottolinearono l’origine del potere papale dall’antico impero, attraverso la falsa Donazione di Costantino (in particolare Paolo II nei primi anni di pontificato e coloro che presero una posizione più critica nei confronti di questa tradizione (Niccolò V e Pio II.

  5. L’APPARATO DEL GOLGI: NUOVI RUOLI PER UN VECCHIO ATTORE

    Directory of Open Access Journals (Sweden)

    Tiziana Apuzzo

    2006-01-01

    Full Text Available L’Apparato del Golgi viene generalmente considerato come deputato alla secrezione, all’impacchettamento e alla condensazione dei prodotti di secrezione. Tuttavia negli ultimi 15 anni, numerose osservazioni sperimentali oltre a confermare questo ruolo, hanno suggerito altre funzioni più complesse. Sembra interessante il comportamento del Golgi e di altre proteine ad esso associate durante i processi di divisione cellulare. GRASP65, una proteina dinamicamente associata al Golgi, sembra essere coinvolta nel processo di disassemblamento dell’organulo durante la mitosi. Le diverse funzioni che GRASP65 è in grado di svolgere durante la varie fasi del ciclo cellulare sostengono l'ipotesi che vedono GRASP65 determinante nella regolazione del destino differenziativo della cellula. Tutto questo porta ad un concetto nuovo che vede il Golgi come un’importante centro di smistamento delle informazioni tra nucleo e la superficie cellulare nonché ipoteticamente coinvolto in ruoli diversi da quelli ormai noti.

  6. La construcción del proyecto axiológico colectivo desde el paradigma postreligional

    Directory of Open Access Journals (Sweden)

    Marià Corbí

    2015-03-01

    Full Text Available The techno-sciences accelerated growth, in continuous interaction, and the constant emergence of new products and services, in a global society, are leading in all countries to the biggest axiological crisis our species has ever suffered. All societies are in transition, from a preindustrial life to the industrial ones, and from industrial to societies of knowledge, innovation and continuous change. Knowledge Societies, inevitable legacy of our elders, are already been implanted in humanity, to stay and expand. The axiological collective projects (ACP, characteristic of preindustrial societies, with their religious paradigm, have been expelled from large social groups and have been called into question by the rest. Also ideologies of industrial societies are being shown in all parts unable to provide a ACP that address the problems that arise in the current transit. We know that the ACP can not come to us nor from heaven, nor from the nature of things. We have to build by ourselves, but our ancestors taught us no procedures to do that. Our urgent task is to create a knowledge about how to build an axiological epistemology. We have to create collective ACP from post-religional paradigm. At etake is our survival.

  7. Educación y pedagogía desde la perspectiva del paradigma emergente

    Directory of Open Access Journals (Sweden)

    Omar Huertas Díaz

    2013-01-01

    Full Text Available Los contenidos que aquí se pretenden desarrollar abordan la relación existente entre la complejidad y sus sistemas de pensamiento, con las categorías de educación, pedagogía y cultura ciudadana, interre lación en la cual el derecho, la educación y la pedagogía se unen como un trinomio de fuerzas generadoras de una cultura ciudadana que desarrolle unos horizontes y calidad de vida diferente, pudiendo ser contrastada por cualquier ciudadano y ciudadana desde su compleja vivencia, lo cual permite el rescate de lo emergente para traducirlo en acciones renovadas que permanentemente transformen la realidad. Esta temática se aborda desarrollando de forma concreta el concepto de complejidad y su relación con la transdisciplina, para luego determinar cuál debería ser la aplicación de estos en la educación y la pedagogía y en específico la educación ciudadana, de manera que se replique de forma positiva en la comunidad y humanidad entera.

  8. A educação em enfermagem à luz do paradigma da complexidade La educación en enfermería bajo el paradigma de la complejidad Nursing education in the light of the complexity paradigm

    Directory of Open Access Journals (Sweden)

    Ana Lúcia da Silva

    2007-09-01

    Full Text Available Os objetivos desta pesquisa foram reconhecer, interpretar e discutir temas oriundos dos discursos de docentes de um Curso de Graduação em Enfermagem, como fontes orientadoras para um ensino-aprendizagem humanizado, à luz da Teoria da Complexidade defendida por Edgar Morin. Tratase de pesquisa qualitativa, tipo exploratória e analítica. Buscou-se verificar princípios do paradigma da complexidade por meio da análise de conteúdo, modalidade temática , em discursos de onze docentes, obtidos no ano de 2004. Os temas encontrados foram: ensinar: responsabilidade do docente; unir saberes: ligações e interrelações para o enfrentamento da realidade; ensinar a complexidade humana; estimular a criatividade e a curiosidade; enfrentar as incertezas: construindo o conhecimento contínuo e dinâmico da vida; viver o processo ensino-aprendizagem por meio da transdisciplinaridade e ensinar a cidadania. Este estudo nos mostrou que é possível fazer acontecer um ensino superior pautado na condição humana, na solidariedade e na interligação dos saberes.Los objetivos de esta investigación han sido los de reconocer, interpretar y discutir temas oriundos de los discursos de docentes de un Curso de Graduación en Enfermería, como fuentes de orientación para una enseñanzaaprendizaje humanizados bajo la Teoría de la Complejidad defendida por Edgar Morin. Se trata de una investigación cualitativa, tipo exploratoria y analítica. Se buscó verificar principios del paradigma de la complejidad a través del análisis de contenido , modalidad temática en discursos de once docentes, obtenidos en el año de 2004. Los temas encontrados han sido: enseñar: responsabilidad del docente; unir sabidurías: relaciones e interrelaciones para hacer frente a la realidad; enseñar la complejidad humana; estimular la creatividad y la curiosidad; hacer frente a la incertidumbre: construyendo el conocimiento continuado y dinámico de la vida; vivir el proceso de ense

  9. Simboli e politica: un percorso al di là del visibile

    OpenAIRE

    Bonanni, Erica

    2002-01-01

    La politica -dal greco 'polis' città- è oggi uno dei termini più generici e sfuggenti del nostro dizionario. L'immagine a cui si fa generalmente riferimento, pensando al potere politico è quella del sovrano. Innumerevoli sono le figure scolpite o dipinte che l'arte ci ha tramandato rendendole imperiture. Esse, come si cercherà di evidenziare, testimoniano la necessità del potere di rappresentarsi, di rendersi visibile, in quanto il re è portatore di significati simbolici che v...

  10. IL PRETESTING DEL QUESTIONARIO STRUTTURATO. L'ANALISI DELL'INTERAZIONE TRA INTERVISTATORE E INTERVISTATO

    OpenAIRE

    PALMIERI, MARCO

    2013-01-01

    Nella lunga tradizione di riflessioni e ricerche sul tema della “qualità del dato”, mi sembra che due posizioni, tra loro antitetiche, prevalgano sulle altre: una di origine comportamentista secondo la quale la qualità del dato è definita come “assenza di distorsioni nel processo di misurazione” (Groves 1991); l’altra, che Mauceri (2003) ha chiamato “pragmatica”, vede nella qualità del dato “la soddisfazione delle condizioni logiche e metodologiche necessarie al conseguimento degli obiettivi ...

  11. La Nueva Gerencia Pública: Flamante mito de un viejo paradigma

    OpenAIRE

    Leobardo Ruíz Alanís

    2006-01-01

    La administración pública es tan antigua como el Estado moderno. La administración también contribuye a su permanencia. La amplitud de los cuerpos burocráticos del Estado es una clara manifestación de su desarrollo. A pesar de las acometidas de las nuevas y viejas teorías anti estatales, la burocracia, ha logrado sobrevivir. Recientemente la gerencia pública se ha erigido como una pretendida innovación anti burocrática; sin embargo en el texto se demuestra su similitud con el cameralismo, que...

  12. Petroleum market instability and enterprise rule; Instabilita' del mercato petrolifero e ruolo delle imprese

    Energy Technology Data Exchange (ETDEWEB)

    Vacca' , S. [Milan Univ. Bocconi, Milan (Italy); Citterio, G. [Saras, S.p.A. (Italy); Pesce, P. [Istituto di Economia delle Fonti di Energia, Milan (Italy)

    2000-09-01

    Special importance is given to some producer country (Saudi Arabia, Iraq, Kuwait, Iran, United Arab Emirate, Venezuela) that determine the trend of petroleum price. These countries have about the 70% of world petroleum reserves against the 3% of world population. [Italian] Nello studio dell'instabilita' del mercato internazionale del petrolio, si e' finora attribuita particolare importanza al ruolo che svolgono alcuni Paesi produttori, in particolare i sei grandi produttori (Arabia Saudita, Irak, Emirati Arabi Uniti, Kuwait, Iran e Venezuela) che sono in grado, anche associandosi ad altri (OPEC), di determinare, attraverso l'autoimposizione delle quote di produzione, gli andamenti del prezzo del petrolio, che si ripercuotono assai negativamente sulla complessiva economia petrolifera mondiale. A tal riguardo occorre, infatti, avere sempre presente che questi Paesi possiedono circa il 70% delle riserve mondiali di petrolio, pur rappresentando meno del 3% della popolazione mondiale. Da qui anche l'interpretazione del fenomeno dell'instabilita' come conseguenza di una contrapposizione sostanzialmente politica fra Paesi capitalistici industrializzati e Paesi produttori di petrolio. La consapevolezza della forte rigidita' della domanda di petrolio, unitamente alla sua concetrazione in determinate aree geografiche, prevalentemente in Medio Oriente, ha reso quello del petrolio un argomento con forti connotazioni politiche, contrapponendo due sistemi socio-culturali, quello occidentale e quello arabo, che fino agli anni '60 non avevano particolari motivi per essere in disaccordo, ma che hanno attraversato molti momenti caldi, dopo la crisi israeliana e la crescente necessita' di energia per l'economia globale. Con il passare del tempo tale contrapposizione, legata anche alla volonta' da parte dei Paesi produttori di sfruttare al massimo le rendite petrolifere, ha portato alla costituzione di societa' nazionali

  13. Book review. Anestesia e analgesia locoregionale del cane e del gatto. Francesco Staffieri

    Directory of Open Access Journals (Sweden)

    Manuel Graziani

    2014-03-01

    Full Text Available Il volume di anestesia e analgesia locoregionale del cane e del gatto è pensato per essere un testo "da sala operatoria" – come afferma l'autore – perché consente un rapido, ma allo stesso tempo dettagliato, consulto per il libero professionista che si trova a gestire un'anestesia. Si tratta di un piccolo libro, tascabile, che può essere considerato un punto di partenza per gli studenti e per tutti quei medici veterinari che intendono avvicinarsi in maniera specialistica all'arte dell'anestesiologia veterinaria. L'anestesia locoregionale costituisce, infatti, uno strumento insostituibile per la gestione del dolore perioperatorio in medicina veterinaria. Nel volume si forniscono le nozioni di base per praticare i principali blocchi nervosi centrali e periferici. Per ogni blocco sono riportate le tecniche alla cieca (mediante l'ausilio dei punti di repere anatomici e quelle con l'impiego dello stimolatore nervoso periferico. Il volume, corredato da immagini foto e grafici, per un totale di 65 figure, si apre con i capitoli relativi ai farmaci, agli strumenti e alle complicanze dell'anestesia locoregionale. Prosegue con i blocchi nervosi centrali (anestesia epidurale e spinale e si conclude con i blocchi periferici (testa, arto anteriore, torace, arto posteriore. L'autore, Francesco Staffieri, è un medico veterinario che svolge il dottorato di ricerca nel Dipartimento delle Emergenze e dei Trapianti di Organi, Sezioni di Cliniche Veterinarie e Produzioni Animali dell'Università degli Studi Aldo Moro di Bari.

  14. La crisis latente del Darwinismo

    Directory of Open Access Journals (Sweden)

    Abdalla, Maurício

    2006-06-01

    Full Text Available In this article I will be analyzing the Darwinist paradigm in the biological science, discussing its capacity to give satisfactory understanding of the new data from biochemistry, microbiology and genetics. The general aim of this analysis is to contribute for the debate about the statute of the scientific theories. Its specific aim is to reflect upon a possible crisis of the Darwinist paradigm, which could corroborate the conception of scientific theories as something historically transitory, and not as definitive discoveries.

    El presente artículo analiza el paradigma darwinista en las ciencias biológicas a partir de la pregunta sobre su capacidad de explicar satisfactoriamente los nuevos datos obtenidos de la bioquímica, la microbiología y la genética. El objetivo general del análisis es contribuir con una discusión acerca del estado de las teorías científicas y el objetivo específico es reflexionar sobre una posible crisis del paradigma darwinista, lo que corroboraría la concepción de las teorías científicas como algo históricamente transitorio y no como descubrimientos definitivos.

  15. Metáforas obsesivas e ideogramas [marcas del surrealismo en la construcción del discurso de Le Corbusier

    OpenAIRE

    Luis Rojo de Castro

    2015-01-01

    Para los surrealistas, la manifestación de los aspectos sublimes de la realidad requiere la presencia simultánea del paradigma y de su deformación, de su forma estable y su fractura. Sea este paradigma el lenguaje –garante de la coherencia semántica por medio de la estructura sintáctica–, el marco –el mecanismo para diferenciar la realidad de su representación– o la estructura anatómica –sobre cuya apariencia se sustenta la naturalidad orgánica o, al menos, se representación. En una impr...

  16. PRISMA Statement per il reporting di revisioni sistematiche e meta-analisi degli studi che valutano gli interventi sanitari: spiegazione ed elaborazione

    Directory of Open Access Journals (Sweden)

    Alessandro Liberati

    2015-06-01

    Full Text Available Revisioni sistematiche e meta-analisi sono strumenti indispensabili per sintetizzare in modo accurato ed affidabile le evidenze sull’efficacia e sulla sicurezza degli interventi sanitari. Tuttavia, la loro chiarezza e trasparenza non è ancora ottimale. Un reporting inadeguato delle revisioni sistematiche ne diminuisce il valore per professionisti sanitari, policy-makers e altri utilizzatori. Dallo sviluppo del QUOROM (QUality Of Reporting Of Meta-analysis statement — linea guida per il reporting pubblicata nel 1999 — sono emerse diverse novità concettuali, metodologiche e pratiche rispetto alla conduzione e al reporting di revisioni sistematiche e meta-analisi. Inoltre, review di revisioni sistematiche pubblicate hanno rilevato che spesso le informazioni più importanti di questi studi vengono riportate in maniera inadeguata. Considerate queste problematiche, un gruppo internazionale di autori e metodologi esperti ha sviluppato il PRISMA (Preferred Reporting Items for Systematic reviews and Meta-Analyses, che costituisce una evoluzione del QUOROM, la linea guida originale per il reporting di revisioni sistematiche e meta-analisi sulla valutazione degli interventi sanitari. Il PRISMA statement include una checklist di 27 item e un diagramma di flusso in 4 step. La checklist include gli item essenziali per un reporting trasparente delle revisioni sistematiche. Questo articolo di spiegazione ed elaborazione descrive il significato e il razionale di ciascun item della checklist. Ogni item include un esempio di reporting ottimale e, dove possibile, riferimenti a studi rilevanti e letteratura metodologica. Il PRISMA statement, questo documento e il sito web (www.prisma-statement.org hanno l’obiettivo di migliorare il reporting di revisioni sistematiche e meta-analisi.

  17. El estudio del desarrollo cognitivo hoy

    OpenAIRE

    Torrado Pachón, María Cristina

    2010-01-01

    Si este texto se hubiera escrito a comienzos de la década de los 70, seguramente estaría centrado en mostrar las bondades del modelo propuesto por Piaget y su carácter de paradigma orientador de la investigación del desarrollo cognitivo, tal como en ese momento lo mostraban el volumen y la diversidad de las investigaciones realizadas en el marco de dicho modelo. Casi 30 años después el panorama ha cambiado como consecuencia de nuevos desarrollos de la psicología desde los cuales la teoría de ...

  18. Site-specific and synergistic stimulation of methylation on the bacterial chemotaxis receptor Tsr by serine and CheW

    Directory of Open Access Journals (Sweden)

    Weis Robert M

    2005-03-01

    Full Text Available Abstract Background Specific glutamates in the methyl-accepting chemotaxis proteins (MCPs of Escherichia coli are modified during sensory adaptation. Attractants that bind to MCPs are known to increase the rate of receptor modification, as with serine and the serine receptor (Tsr, which contributes to an increase in the steady-state (adapted methylation level. However, MCPs form ternary complexes with two cytoplasmic signaling proteins, the kinase (CheA and an adaptor protein (CheW, but their influences on receptor methylation are unknown. Here, the influence of CheW on the rate of Tsr methylation has been studied to identify contributions to the process of adaptation. Results Methyl group incorporation was measured in a series of membrane samples in which the Tsr molecules were engineered to have one available methyl-accepting glutamate residue (297, 304, 311 or 493. The relative rates at these sites (0.14, 0.05, 0.05 and 1, respectively differed from those found previously for the aspartate receptor (Tar, which was in part due to sequence differences between Tar and Tsr near site four. The addition of CheW generated unexpectedly large and site-specific rate increases, equal to or larger than the increases produced by serine. The increases produced by serine and CheW (added separately were the largest at site one, ~3 and 6-fold, respectively, and the least at site four, no change and ~2-fold, respectively. The rate increases were even larger when serine and CheW were added together, larger than the sums of the increases produced by serine and CheW added separately (except site four. This resulted in substantially larger serine-stimulated increases when CheW was present. Also, CheW enhanced methylation rates when either two or all four sites were available. Conclusion The increase in the rate of receptor methylation upon CheW binding contributes significantly to the ligand specificity and kinetics of sensory adaptation. The synergistic effect of

  19. La Nueva Gerencia Pública: Flamante mito de un viejo paradigma

    Directory of Open Access Journals (Sweden)

    Leobardo Ruíz Alanís

    2006-01-01

    Full Text Available La administración pública es tan antigua como el Estado moderno. La administración también contribuye a su permanencia. La amplitud de los cuerpos burocráticos del Estado es una clara manifestación de su desarrollo. A pesar de las acometidas de las nuevas y viejas teorías anti estatales, la burocracia, ha logrado sobrevivir. Recientemente la gerencia pública se ha erigido como una pretendida innovación anti burocrática; sin embargo en el texto se demuestra su similitud con el cameralismo, que al igual que éste podrá desaparecer o pasar de moda, quedando en el olvido. Se considera lo riesgoso de importar modelos administrativos sin considerar las condiciones que les dieron origen y los efectos que pudieran causar al implantarse en un medio ambiente como el nuestro, tan diferente al original.

  20. LAS NUEVAS TECNOLOGÍAS Y REENCUADRAMIENTO DE PARADIGMAS EDUCATIVOS

    OpenAIRE

    Adilaurinda Ribeiro de Oliveira; Alessandro Marco Rosini

    2012-01-01

    La creciente evolución de la información y de la tecnología, estimulan profundos cambios en el mundo del trabajo y nuevas exigencias en el ámbito de la educación. Desafío que necesita atender la demanda de la sociedad y buscar nuevos caminos y espacios de aprendizaje. Este estudio trata sobre una idea de la utilización de las tecnologías utilizadas hoy en la educación, rescatar algunos conceptos básicos de cierta área hoy en día tan importante para las personas en sus relaciones sociales. Est...

  1. el paradigma de la Unión Europea

    Directory of Open Access Journals (Sweden)

    Magdalini Psarou

    2005-01-01

    Full Text Available En este artículo, la autora aborda la formación, características e impacto histórico del Estado-nación como preámbulo a la temática de la Unión Europea, el ejemplo más avanzado de integración regional multinacional, y su realidad actual. El análisis se centra en las problemáticas derivadas de su gestación, funcionamiento y aplicación como un macro proyecto político, económico, social, cultural y de identidad destinado a ser ejemplo de unidad, tolerancia y aceptación de la alteridad en una realidad antagonizada entre la globalización y la regionalización.

  2. El paradigma de Comportamiento Informacional como alternativa para comprender los fenómenos informacionales en América Latina

    Directory of Open Access Journals (Sweden)

    Cristian Berrío-Zapata

    2016-05-01

    Full Text Available La Ciencia de la Documentación, predecesora de las Ciencias de la Información, históricamente descuidó el estudio del hombre común. Como producto de la era fordista, suponía que el valor de cualquier comportamiento informacional era su carácter técnico y económico. Como contrapunto, este artículo presenta algunos de los aportes el paradigma del Comportamiento Informacional, que abandona esta tendencia y su énfasis en el sistema de información, formal y estandarizado, para estudiar al usuario común y su día a día. El Comportamiento Informacional desarrolla una epistemología ecológica y evolutiva. Los Trabajadores del Conocimiento ya no son la única comunidad digna de estudio. Se investigan las comunidades, los nichos cerrados, los grupos excluidos, poblaciones representativas de las grandes mayorías de la humanidad. Para la Ciencia de la Información en países en desarrollo esta es una oportunidad para comprender la situación de sus usuarios informacionales desde otras perspectivas y evaluar críticamente conceptos importados tales como la Brecha Digital, cuya base está en la visión utilitaria y tecnocentrista del paradigma clásico. Documentation science, a predecessor of information science, historically neglected to study a common person. As a product of the Fordist Era, documentation science supposed the value of any information on behavior was its technical and economic nature. In contrast, this article presents some of the contributions of the paradigm of informational behavior, which moves away from this trend, and it emphasizes on a formal standardized information system to study a common use and that user's day-to-day life. Informational Behavior develops an ecological and evolutionary epistemology. Knowledge workers are no longer the only Community worthy of being studied. Today studies research communities, closed niches, excluded groups, and representative populations of vast human majorities. For information

  3. Reconnaissance Mapu-Che of Chile: Treaty versus Constitution, History versus Law

    OpenAIRE

    Clavero Salvador, Bartolomé

    2011-01-01

    The compromise acquired since 1991 by successive Chilean governments to recognise indigenous presence in the organization of the State at a constitutional level has revealed the mutual academic and legal ignorance in relation to the evidence for Mapu-Che recognition. This work revisits the historical and legal relationship between the Chilean and the Mapu State, which until the Chilean conquest of the Mapu in the 1880s was carried out through Treaties and Parliaments that implied a mutual rec...

  4. Untersuchung der Elektronendynamik an der PTCDA/Ag(111)-Grenzfläche

    OpenAIRE

    Schwalb, Christian

    2009-01-01

    Im Rahmen dieser Arbeit wird die Elektronendynamik an der PTCDA/Ag(111)-Grenzfläche mit Hilfe von zeit- und winkelaufgelöster Zweiphotonen-Photoemission (2PPE) sowie zeitaufgelöster Photolumineszenz-Spektroskopie (PL) untersucht. Der erste Teil der Arbeit widmet sich der Charakterisierung eines unbesetzten elektronischen Zustands, der sich durch die Adsorption der PTCDA-Moleküle 0.6 eV oberhalb der Fermienergie ausbildet, während ...

  5. Reconocimiento Mapu-Che de Chile: Tratado ante Constitución, Historia frente a Derecho

    OpenAIRE

    Clavero Salvador, Bartolomé

    2009-01-01

    The compromise acquired since 1991 by successive Chilean governments to recognise indigenous presence in the organization of the State at a constitutional level has revealed the mutual academic and legal ignorance in relation to the evidence for Mapu-Che recognition. This work revisits the historical and legal relationship between the Chilean and the Mapu State, which until the Chilean conquest of the Mapu in the 1880s was carried out through Treaties and Parliaments that implied a mutual rec...

  6. Cambiar paradigmas: una experiencia en educación superior

    Directory of Open Access Journals (Sweden)

    Gisella Vargas Chinchilla

    2004-09-01

    Full Text Available

    Resumen. Una experiencia en educación superior, al estilo de investigación-acción, donde una “comunidad de aprendizaje” constituida por docentes y estudiantes, busca convertirse en entes multiplicadores del desarrollo sostenible, dentro del plan de formación de docentes de Educación Preescolar.

    Esta investigación constituye el Trabajo final de Graduación, requisito de un grupo de estudiantes para obtener el grado de Licenciadas en Educación Preescolar, en la Universidad de Costa Rica. El proceso metodológico dio inicio con un diagnóstico, para seguir con un plan de acción, organizado y desarrollado en conjunto, estudiantes y docentes, para culminar con la aceptación de “compromisos ambientales” asumidos por las personas participantes.

     

    Abstract. This is a research-action type of experience in higher education lived by a “learning community” conformed by teachers and students whose aim is to become fostering agents for sustainable development. The experience was carried out as part of the plan for teacher training in Preschool Education.

    This paper is the authors' Final Graduation Paper, a requirement to obtain a Licentiate degree in Preschool Education at the University of Costa Rica. The research began with a diagnosis that would lead to the implementation of an action plan that was organized and carried out jointly by the students and their teachers. The project finished with the participants' acceptance of some “environmental commitments”.

  7. Teoria, conhecimento e pragmática da comunicação: o paradigma pulsional

    OpenAIRE

    Silveira Jr., Potiguara Mendes da

    2015-01-01

    Parte-se do estado da arte feito por Muniz Sodré (2012a) sobre a abordagem acadêmica do campo comunicacional e a dificuldade para defini-lo em seu aspecto "científico". No intuito de prospectar além dos paradigmas identificados por Sodré (o sociológico, dos efeitos; e o semiótico, dos códigos), propõe-se o paradigma pulsional que orienta a Transformática, teoria psicanalítica da comunicação.PALAVRAS-CHAVE: Teorias da comunicação; Conhecimento; Psicanálise. ABSTRACTAccording to the state of th...

  8. CONVERGENCIA DE PARADIGMAS BIOTECNOLÓGICOS Y ESTRATEGIAS DE LOS GRUPOS LÍDERES MUNDIALES

    Directory of Open Access Journals (Sweden)

    Pablo Lavarello

    2014-01-01

    Full Text Available El propósito de este artículo es analizar la diversificación tecnológica de las grandes firmas frente a la emergencia de nuevos paradigmas tecnológicos. A partir de la siste - matización de una base de datos de patentes, en este trabajo se hace la pregunta, por un lado, ¿estos procesos dan lugar a la convergencia entre las bases de conocimiento y la emergencia de un nuevo paradigma de biotecnología industrial? Por el otro, se discute a partir de datos de los principales grupos en escala internacional si la mencionada di - versificación da lugar a una base de conocimientos coherentes o es, simplemente, una expansión conglomeral, existiendo aun posibilidades de entrada para firmas de países en desarrollo.

  9. La insuficiencia de los paradigmas metafóricos en psicología.

    Directory of Open Access Journals (Sweden)

    Jesús Mosterín

    2003-01-01

    Full Text Available Desde Platón y Aristóteles hasta nuestro tiempo, pasando por Descartes, Freud, Watson y las tendencias cognitivistas actuales, nuestra ignorancia de los mecanismos neurales subyacentes a los fenómenos psíquicos ha sido compensada por una gran riqueza de paradigmas metafóricos. La insuficiencia de este enfoque se muestra, por ejemplo, en la concepción freudiana de los sueños. Aunque más vale una metáfora que nada, los paradigmas metafóricos deberían ser considerados como meras teorías provisionales de caja negra que en el futuro deberán ser sustituidas por teorías explicativas de caja traslúcida basadas en la compensación de los mecanismos subyacentes.

  10. Sistema de impostos no novo paradigma de comércio

    OpenAIRE

    Teixeira, Carla Sofia Gonçalves

    2010-01-01

    O tema desta dissertação tem a ver com o sistema de impostos no novo paradigma de comércio. Como veículo que veio revolucionar o mundo dos negócios, o Comércio Electrónico provocou um impacte profundo não somente nas empresas, como também na sociedade em geral. As preocupações relativamente à tributação deste novo paradigma têm vindo a aumentar uma vez que o Comércio Electrónico facilita a evasão e a fraude fiscais. Paralelamente tenta-se evitar que a rede electrónica ...

  11. O Roma quanta fuit! Tra scenate e svarioni dell’odierno S. Uffizio. Riflessioni sul can. 1378, § 2, a proposito del caso di Martha Heizer

    Directory of Open Access Journals (Sweden)

    Francesco Zanchini di Castiglionchio

    2014-07-01

    Full Text Available "A CHIARE LETTERE" - CONFRONTI (di Francesco Zanchini di CastiglionchioSi sa che la nomina del card. Levada a Prefetto della Congregazione dottrinale va fatta risalire a una scelta personale di Benedetto XVI, che già l’aveva apprezzato come collaboratore durante la sua lunga presidenza del Dicastero, per poi nomiarlo suo successore, superando i dubbi insorti in Curia a proposito della mancanza, in lui, di una solida formazione accademico-teologica e canonistica. Ma perseverare diabolicum, se è vero che la sua figura ha poi inevitabilmente percorso l’intero cursus honorum della preminenza dottrinale, attraverso il meccanismo automatico, che porta l’investito anche alla presidenza della pontificia Commissione biblica, e poi della Commissione Teologica internazionale; ipoteca delicata, questa, su enti di ricerca per sé liberi, e comunque rispondenti a finalità non riconducibili a quella del controllo dottrinale.

  12. L'Emozione che insegna: parola persuasiva e paradigmi mitici in tragedia

    OpenAIRE

    Nicolai Mastrofrancesco, Roberto

    2007-01-01

    Questa ricerca ruota intorno a tre termini: emozione, paradigma, persuasione. Nella prima parte cercherò di mostrare il ruolo fondamentale delle emozioni, e in particolare delle emozioni violente e dolorose, nel processo di composizione e in quello di ricezione delle tragedie. Il veicolo delle emozioni sono i racconti mitici portati sulla scena e agiti dagli attori e dal coro. Proprio le emozioni (πάθη) e i miti (μυθοι) sono i due elementi chiave della tragedia nella definiz...

  13. The Pseudomonas aeruginosa chemotaxis methyltransferase CheR1 impacts on bacterial surface sampling.

    Directory of Open Access Journals (Sweden)

    Juliane Schmidt

    Full Text Available The characterization of factors contributing to the formation and development of surface-associated bacterial communities known as biofilms has become an area of intense interest since biofilms have a major impact on human health, the environment and industry. Various studies have demonstrated that motility, including swimming, swarming and twitching, seems to play an important role in the surface colonization and establishment of structured biofilms. Thereby, the impact of chemotaxis on biofilm formation has been less intensively studied. Pseudomonas aeruginosa has a very complex chemosensory system with two Che systems implicated in flagella-mediated motility. In this study, we demonstrate that the chemotaxis protein CheR1 is a methyltransferase that binds S-adenosylmethionine and transfers a methyl group from this methyl donor to the chemoreceptor PctA, an activity which can be stimulated by the attractant serine but not by glutamine. We furthermore demonstrate that CheR1 does not only play a role in flagella-mediated chemotaxis but that its activity is essential for the formation and maintenance of bacterial biofilm structures. We propose a model in which motility and chemotaxis impact on initial attachment processes, dispersion and reattachment and increase the efficiency and frequency of surface sampling in P. aeruginosa.

  14. Modelo explicativo del conocimiento organizacional en la Corporación Autónoma Regional del Valle del Cauca - CVC

    OpenAIRE

    Carlos Hernán González Campo; Henry Antonio Saltaren Quiñónez; Nubia Mercedes Arenas Quiñones

    2010-01-01

    El conocimiento es el activo más importante que posee una organización, en particular para las Autoridades Ambientales, el presente artículo de investigación tiene como objetivo presentar un modelo explicativo del conocimiento organizacional en la Corporación Autónoma Regional del Valle del Cauca - CVC y el diseño de una propuesta para la gestión de conocimiento organizacional, ambos resultantes de la investigación interpretativa basada en el paradigma constructivista utilizados en la meto...

  15. Aprendizaje cooperativo en el espacio europeo de educación superior: su aplicación en las prácticas de psicología del desarrollo afectivo y social

    OpenAIRE

    Lanza Escobedo, David

    2014-01-01

    La creación del Espacio Europeo de Educación Superior, y de forma subsidiaria su irrupción en la Universidad, ha venido acompañada de un nuevo paradigma que ha conducido a una redefinición de la función docente. Este paradigma emergente, que pone énfasis en el aprendizaje del alumno –como sujeto activo de su propio aprendizaje– supone la pérdida casi total del rol de profesor como instructor, para pasar a ser un orientador. De ahí que el docente tenga la responsabilidad moral ...

  16. Dose evaluation for workers employed in an industry involving enamel paints containing zirconium silicate; Valutazione di dose per i lavoratori occupati in una industria che utilizza vernici a smalto contenenti silicato di zirconio

    Energy Technology Data Exchange (ETDEWEB)

    Castellani, C.M.; Berico, M.; De Zaiacomo, T.; Formignani, M.; Ianni, A.; Nobili, C.; Sandri, S.; Vasselli, R. [ENEA, Centro Ricerche Ezio Clementel, Bologna (Italy). Dipt. Ambiente

    1999-07-01

    In the frame of the European Recommendations for radiological protection, an evaluation of the annual dose has been made for workers employed in an industry for the production of sanitary equipment involving the use of enamel paints containing zirconium silicate. [Italian] Nella prospettiva dell'applicazione della direttiva europea relativa alla protezione radiologica dei lavoratori, vengono presentati i risultati relativi alla valutazione di dose annuale complessiva per i lavoratori occupati in una industria per la produzione di articoli igienico-sanitari che utilizza vernici a smalto contenenti silicato di zirconio. Il fine e' la valutazione del problema radioprotezionistico per gli addetti a causa delle impurezza radioattive presenti nei materiali utlizzati.

  17. Re-inventare una comunità locale. La luxury sophistication di Campione del Garda e la memoria dimenticata

    OpenAIRE

    Visentin, Chiara

    2011-01-01

    Ci sono luoghi in cui la geografia provoca la storia. Nella nostra stretta contemporaneità ci sono consumi e comportamenti che possono reinventare completamente i luoghi. Conseguentemente cancellare la memoria di ciò che sono stati o ancor peggio trasfigurarla in caricature che del passato portano solo alcuni segni, trasformati in esagerazioni demodé. Ormai la cultura dello “shopping mall”, “in stile”, dei parchi a tema è entrata nel nostro quotidiano, studiata ed analizzata a fondo da sociol...

  18. Ralph Spaccatutto, ovvero il videogioco come repertorio culturale del cinema

    Directory of Open Access Journals (Sweden)

    Marco Teti

    2013-03-01

    Full Text Available L'articolo mette il film d'animazione "Ralph Spaccatutto" in relazione all'universo estetico e iconografico del videogioco. L'analisi viene fondata sulla nozione di 'repertorio culturale', che riprende i concetti di rimediazione e di convergenza culturale elaborati da Jay David Bolter, Richard Grusin e Henry Jenkins.

  19. La construcción de valores en el paradigma de la ciencia bibliotecológica The construction of values in the library science paradigm

    Directory of Open Access Journals (Sweden)

    Miguel Ángel Rendón Rojas

    2005-06-01

    Full Text Available En el artículo se investiga el problema de la recreación del elemento axiológico del paradigma de la Ciencia Bibliotecológica. Se realiza un análisis filosófico de la construcción de valores a partir de las ideas de varios pensadores, concluyendo que los valores son manifestaciones del ser y construcciones históricas del sujeto en su juego ontológico dentro de una comunidad. En el ámbito informativo-documental se analizan algunos códigos de ética profesional de Latinoamérica y se afirma que la comunidad bibliotecológica ha construido los valores siguiendo un proceso de formación antropo-ontológica de autodesarrollo y develamiento del ser. De ahí su objetividad, su necesidad y su fundamentación. Es tarea de cada sujeto individual incluirlo dentro de su proyecto existencial y sentirse miembro de la comunidad bibliotecológica.The problem of the recreation of the axiological element of the Library Science paradigm is studied. A phylosophical analysis of the construction of values from ideas taken from several thinkers is carried out, concluding that values are manifestations of the being and historical constructions of the subject´s ontological game within the community. In the informative/document field, some Latin American professional ethic codes are analyzed and it is stated that the librarian community has built its values following an anthropologic and ontologic construction process of selfdevelopment and selfrevealing of the being. That is where its objetivity, necessity and basis come from. It is an individual task to include it into an existential project and to feel a member of the librarian community.

  20. Fundamentos teóricos del Pensamiento complejo de Edgar Morin

    OpenAIRE

    Paulette Barberousse Alfonso

    2008-01-01

    Recibido 2 de noviembre, 2007 • Aprobado 1 de diciembre, 2007   Resumen. Ante lo que consideró la crisis del paradigma occidental de simplificación y disyunción, basado en la reducción y separación de los saberes, Edgar Morin planteó la emergencia de un nuevo paradigma de la complejidad, el cual intentaría articular y contextualizar las culturas científicas, las culturas de las humanidades y las culturas artísticas. Para llevar adelante tal propósito, se basó en la integración de ideas, conce...

  1. Los límites del escepticismo. Wittgenstein y la refutación del cartesianismo

    OpenAIRE

    Marrades Millet, Julián

    1989-01-01

    En su obra 'Sobre la certeza' Wittgenstein opera un giro metodológico en la epistemología, llevándola desde el análisis de las representaciones o contenidos de conciencia al análisis de las reglas de uso de fas expresiones relativas a la actividad del conocer. Con ello, Wittgenstein cuestiona los supuestos de la teoría del conocimiento que ha dominado la escena filosófica desde Descartes hasta Moore e inaugura un nuevo paradigma epistemológico, que se caracteriza por el escepticismo de fundam...

  2. Tríptico de la ingenería del software : Análisis, desarrollo y aplicaciones de metodología raise

    OpenAIRE

    Paganini, José Humberto; Vega, Ariel; Figueroa, Sebastián Marcos; Liberatori, Héctor; Rodríguez, Juan C

    2010-01-01

    El presente proyecto contempla los siguientes aspectos; i) el empleo para la construcción de software del paradigma del Tríptico de la Ingeniería del Software, compuesto por la Ingeniería del Dominio, Ingeniería de Requisitos y el Diseño del Software, ii) el estudio análisis posibles complementaciones del Método RAISE en general y el Lenguaje de Especificación Formal RSL en particular; iii) y el estudio de aplicaciones de la Lógica Computacional cómo una ciencia formativa y básica del context...

  3. La promozione del parto naturale: effetti di un ambulatorio dedicato sulla prevalenza del taglio cesareo

    Directory of Open Access Journals (Sweden)

    Valentina Simonetti

    2015-04-01

    Full Text Available Background. Il taglio cesareo (TC è una procedura chirurgica eseguita in tutto il mondo, spesso senza una reale necessità, con un trend in continuo aumento sopratutto nei paesi industrializzati. In Italia la prevalenza del TC è più elevata rispetto ad altri paesi europei. Tale pratica espone le donne a rischio di complicanze evitabili e aumenta i costi dell’assistenza sanitaria. Tra i fattori riconducibili al ricorso al TC vengono riportate: carenze organizzative, medicina difensiva, convinzione che sia una modalità elettiva di nascita, scarso supporto alla donna del personale sanitario nel percorso di accompagnamento alla nascita. Diverse evidenze suggeriscono che interventi educativi rivolti alle donne in gravidanza aumentano la probabilità del parto naturale (PN rispetto al cesareo: un ambulatorio dedicato al PN potrebbe risultare determinante nel dipanare dubbi ed incertezze della gestante e promuovere la scelta del parto naturale rispetto al TC. Obiettivi. Confrontare la prevalenza dei TC prima e dopo l’implementazione di un ambulatorio dedicato alla promozione del PN. Metodi. L’indagine è stata condotta consultando i dati delle cartelle cliniche delle pazienti afferenti al Dipartimento Materno-Infantile della Azienda USL di Pescara dal 1 febbraio al 31 ottobre 2011, prima dell’attivazione dell’ambulatorio, e dal 1 febbraio al 31 ottobre 2012, dopo l’attivazione dello stesso. Sono state incluse tutte le schede ostetriche delle donne con gravidanza a termine (37 settimane di gestazione; feto vivo in presentazione cefalica; precedente parto spontaneo; precedente TC eseguito in travaglio con buona dilatazione cervicale raggiunta; intervallo tra i parti di 18-24 mesi. Risultati. Sul totale delle cartelle esaminate (2.623, il campione per l’anno 2011 e 2012 è costituito rispettivamente da donne che hanno espletato prevalentemente il PN (62%; 68% con un’età media di 32.0±1.9 e 31.6±0.3, di nazionalità italiana (82%; 87

  4. Construcción del esquema mental para la apropiación del concepto de la integral

    OpenAIRE

    Puga, Karla Liliana; Miranda , Eduardo

    2012-01-01

    El trabajo que se presenta muestra los avances de una investigación con la que se espera obtener un acercamiento teórico a un esquema mental, –desde el marco de referencia APOE– para la apropiación del concepto de la Integral, para ello se pretende explorar, describir y explicar los niveles de construcción intra, inter y trans que subyacen en la apropiación del concepto. El trabajo se desarrolla dentro del paradigma constructivista, donde se concibe que el conocimiento se construye a partir d...

  5. Husserl y la fenomenología trascendental: Perspectivas del sujeto en las ciencias del siglo XX

    OpenAIRE

    Antonio Paoli Bolio

    2012-01-01

    Este artículo muestra de manera general la gran importancia de la fenomenología como un paradigma teórico clave, porque influyó de manera contundente en la ciencia y la filosofía del siglo xx. Su influencia se deja ver en los autores más conspicuos del existencialismo, del historicismo, de la hermenéutica, de la historia de la ciencia, de la filosofía analítica, de la llamada postmodernidad; su ascendiente es notable en personajes importantes de las místicas y las religiones contemporáneas. A...

  6. Gianfranco Marrone, L’invenzione del testo

    Directory of Open Access Journals (Sweden)

    Mariangela Bio

    2011-11-01

    Full Text Available Il libro di Gianfranco Marrone ha il merito di rispondere alle indeclinabili esigenze di superamento dei tradizionali paradigmi di ricerca sulla significazione e la società. L’originale percorso di analisi dell’autore, che coniuga da sempre la semiotica del testo con i processi comunicativi e le scienze sociali, prende avvio sulla base di alcune considerazioni: la significazione è un fenomeno collettivo, esito di continue e complesse negoziazioni di significati fra gli attori sociali (già Ferdinand de Saussure leggeva i segni, le lingue e i linguaggi come processi sociali; la realtà socioculturale, al tempo stesso, si nutre della modulazione, del fraintendimento, della traduzione interdiscorsiva che caratterizzano ineluttabilmente la circolazione dei testi al suo interno.

  7. Los nuevos paradigmas de la comunicación estética a través de la composición musical en la historia y ciencias de la música : análisis de cuatro casos de repertorio de música contemporánea: Obra "Secuencia III" (Luciano Berio), "Anaklasis" (K. Penderecki), "Ha venido, canciones para Silvia" (Luigi Nono) y "Viajeros del destino" (Mª Concepción Díaz).

    OpenAIRE

    Díaz González, Mª Concepción

    2013-01-01

    Trabajo fin de Máster. Máster Universitario en Comunicación y Educación en la Red : de la Sociedad de la Información a la Sociedad del Conocimiento. Especialidad: Subprograma de Investigación en Comunicación Digital en la Educación

  8. Mistica del Paradiso al limite del non rappresentabile. Par. XXX : word-painting dantesco e disegno Botticelliano – Analisi di un intercambio mediale

    OpenAIRE

    Klettke, Cornelia

    2012-01-01

    Questo saggio si dedica al problema dell’intercambio mediale fra il word-painting dantesco e il disegno botticelliano. Sulla base di un minuzioso paragone del Canto XXX del Paradiso con il disegno botticelliano che lo illustra possiamo formulare primi approcci per un sistema di corrispondenze sviluppato da Botticelli per la sua trasposizione figurativa del testo poetico. L’analisi dei dettagli e degli arrangiamenti delle forme rappresentate rivela una sensibile compenetrazione di Botticelli n...

  9. EL ROL SOCIAL DEL PROFESIONAL DE LA INFORMACIÓN: UN PUNTO DE VISTA DESDE ARGENTINA

    Directory of Open Access Journals (Sweden)

    Julio Díaz Jatuf

    2015-06-01

    Full Text Available Este artículo propone abordar, cuestiones conceptuales sobre el valor de la información en el contexto de la Sociedad de la Información y el Conocimiento, relacionados a los paradigmas, competencias profesionales y la necesaria ética del ejercicio de la disciplina. Se profundiza sobre el rol social del profesional, desde experiencias tangibles latinoamericana y argentinas.

  10. Gli usi innovativi del legno di piccole dimensioni in architettura

    OpenAIRE

    Colabella, Sofia

    2006-01-01

    1. Verso una reale eco-compatibilità del costruire in legno Introduzione 1.1 Aspetti ecologici, economici ed energetici nell’impiego del legno come materiale da costruzione. A partire dalla consapevolezza che l’azione ambientale da sola non riesce a esaurire la sfida, si postula la necessità di ogni piano di intervento di rispondere a una visione integrata e di definire gli impatti economici, sociali e ambientali. Lo sviluppo sostenibile, infatti, come descritto nei 27 Principi su ...

  11. LOS LÍMITES DE LA CARRERA DE PSICOLOGÍA Y EL NECESARIO CAMBIO DE PARADIGMA EN SU ENSEÑANZA

    Directory of Open Access Journals (Sweden)

    Luis G. Zarzosa Escobedo

    2015-01-01

    Full Text Available Se presenta un análisis del papel que desempeña una serie de factores que apuestan en contrade la efectividad de la enseñanza de la psicología en México, lo que se hace apoyándose en unenfoque sistémico que considera los cuatro niveles de análisis propuestos por Bronfenbrenner:microsistema, mesosistema, exosistema y macrosistema. Se analizan las motivaciones de losestudiantes, los dilemas de los docentes, la disfuncionalidad de los programas, el papel de lasobreoferta de estudios, la realidad laboral y las percepciones de los involucrados, así como laspolíticas públicas en materia educativa y la globalización del conocimiento. Todos los señalamientosapuntan a la necesidad de un cambio de paradigma en la enseñanza de la psicologíaque se vincule más estrechamente con el conocimiento internacional y las necesidades sociales.

  12. Cultura política, política exterior y caducidad del modelo del Estado como actor racional: el caso argentino

    OpenAIRE

    Escudé, Carlos

    2000-01-01

    Con su tradicional estilo, el autor revisa los textos que se han utilizado en la enseñanza de geografía en los niveles primario y secundario desde 1879 hasta 1986 para buscar responder a un interrogante sobre las causas del surgimiento del problema político-cultural que, según identifica en su artículo, crea una "trampa" en la que la racionalidad del político se opone a la racionalidad del Estado, que en consecuencia deja de operar como actor racional. Los cambios y paradigmas en la educación...

  13. Las representaciones sociales de la ESCNNA y su relación con los paradigmas co-existentes en el campo de la niñez.

    Directory of Open Access Journals (Sweden)

    Graciela Dilacio

    2012-05-01

    Full Text Available Este artículo se propone analizar las representaciones sobre la ESCNNA de operadores sociales de cuatro ciudades situadas en la frontera uruguayo-brasileña, su incidencia en la interpretación de las referidas situaciones y su relación con los principales paradigmas actualmente coexistentes en el campo de la niñez. Estas representaciones son relevantes en tanto condicionan las prácticas concretas de personas, organizaciones e instituciones ante las diferentes modalidades de la ESCNNA. No se trata de opiniones individuales, sino que impregnan las culturas de las instituciones responsables de desarrollar políticas de prevención, enfrentamiento y restitución de derechos de los y las personas afectadas por estas prácticas delictivas. A su vez su análisis nos proporcionará indicios para comprender las diferentes actitudes ante las situaciones de ESCNNA: naturalización, negación de su existencia, culpabilización de las víctimas, entre otras; y de los lugares que se asignan a los diferentes actores involucrados en la producción y reproducción del fenómeno. El trabajo de campo del que surge el material empírico en que se basa el trabajo es parte del proyecto “Estrategia regional de lucha contra la trata y el tráfico de niñas, niños y adolescentes para fines de explotación sexual en MERCOSUR”. El mismo, en Uruguay se focaliza en cuatro ciudades fronterizas con Brasil: Bella Unión; Rivera: Río Branco y Chuy. En una primera etapa se realizaron cerca de cien entrevistas en profundidad que permitieron contar con una aproximación diagnóstica del fenómeno en dichas ciudades.

  14. Indirect cannibalism by crèche-aged American White Pelican (Pelecanus erythrorhynchos) chicks

    Science.gov (United States)

    Bartos, Alisa J.; Sovada, Marsha A.; Igl, Lawrence D.; Pietz, Pamela J.

    2013-01-01

    At nesting colonies of American White Pelicans (Pelecanus erythrorhynchos), many chicks die from siblicide, severe weather, and disease; this results in carcasses available for scavenging by conspecifics (i.e., indirect cannibalism). Indirect cannibalism has not been reported previously for this species. We describe five cases of crèche-aged American White Pelican chicks consuming or attempting to consume dead younger chicks at two nesting colonies in the northern plains of North America. Cannibalism in the American White Pelican appears to be rare and likely plays no role in the species’ population ecology or dynamics; however, it might be an important survival strategy of individual chicks when food resources are limited.

  15. Riflessioni sulle pratiche educative osservate in un nido del Centro Nascita Montessori

    Directory of Open Access Journals (Sweden)

    Laura Franceschini

    2010-02-01

    Full Text Available L’articolo presenta una ricerca basata sull’osservazione di un contesto educativo di ispirazione montessoriana. La ricerca intendeva mettere in luce gli atteggiamenti, le proposte e le strategie delle educatrici, e le risposte dei bambini a queste sollecitazioni. Il testo si articola in una introduzione metodologica che illustra il tipo di servizio educativo, la metodologia di osservazione adottata e la traccia che ha guidato le osservazioni; seguono alcune considerazioni sull’autonomia del bambino, l’attenzione al singolo bambino e la cura del bambino, emerse dalla analisi delle osservazioni; conclude l’articolo la trascrizione di una delle tre osservazioni condotte.

  16. Continuatori balcanico-danubiani del Veneto "balota"

    Directory of Open Access Journals (Sweden)

    Giovan Battista Pellegrini

    1976-12-01

    Full Text Available E' merito di László Hadrovics di avere impostato una numerosa serie di ricerche etimologiche con un metodo originale che ha dato ampi frutti, fondato sullo studio globale di tanti dati, ma in primo luogo saldamente ancorato al minuzioso esame delle fonti e dei motivi storici e culturali che hanno occasionato i prestiti. I suoi contributi alia storia e all'etimologia di varie parole ungheresi costituiscono autentiche piccole monografie concentrate nel settore del lessico giudicato di norma "di etimologia difficile" nei dizionari specializzati; essi sono ora in buona parte riuniti in due volumetti: Jövevényszók-vizsģalatok (Indagini sui prestiti del 1965 e Szavak és szólások (Parole ed espressioni] del 1975. In questa seconda miscellanea, nel capitolo quinto dedicato ai "prestiti italiani" (o­ lasz jövevényszók, alle pp. 78-94 l' A. ha l' occasione di occuparsi della voceungherese labda 'palla' (pp. 86-89 che presenta varie corrispondenze nelle lingue slave e balcaniche, oggetto di tante discussioni, come si può vedere anche dai piu recenti dizionari etimoiogici.

  17. Letteratura, pubblicità e ritorno del represso

    Directory of Open Access Journals (Sweden)

    Francesco Ghelli

    2013-05-01

    Full Text Available Fin da quando ho avuto a che fare con l’ipotesi elaborata da Francesco Orlando secondo la quale la letteratura è sede di un ritorno del represso mi sono chiesto che cosa nella nostra epoca di deregulation, di caduta di censure e tabù, potesse occupare il posto del represso. Quali comportamenti, valori, convinzioni possono suscitare un tale scandalo da richiedere oggi nelle opere di fiction il baluardo di formazioni di compromesso, negazioni freudiane e ambivalenze? La letteratura dei giorni nostri, rispetto alla tradizione delineata da Orlando, sembra situarsi in una condizione postuma, al di là di una frattura che ha posto fine idealmente a una lunga storia di repressione, di morali coercitive e limitanti. Dopo tutto uno dei sociologi più influenti ai giorni nostri, Zygmunt Bauman, ha delineato il passaggio epocale da disagio della civiltà freudiano all’odierno disagio della libertà. Il problema del desiderio ai giorni nostri non sarebbe tanto lo scontro con un limite, un divieto, quanto invece una libertà indeterminata che rischia di tramutarsi in smarrimento, perdita di intensità e significato.

  18. A caccia del bosone di Higgs magneti, governi, scienziati e particelle nell'impresa scientifica del secolo

    CERN Document Server

    Maiani, Luciano

    2013-01-01

    Nel luglio 2012 veniva confermata sperimentalmente, presso i laboratori del CERN di Ginevra, l'esistenza del "bosone di Higgs", la più piccola di tutte le particelle subatomiche fino ad ora scoperte, teorizzata da Peter Higgs fin dal lontano 1964 e divulgata al mondo come "la particella di Dio". Una scoperta che costituisce un fondamentale passo avanti nella fisica delle particelle e nella conferma del modello standard dell'universo, in direzione di quella Teoria del Tutto, la teoria unificata delle forze, che la fisica insegue da decenni. Per giungere alla prima conferma sperimentale sono stati necessari quasi 50 anni di ricerche teoriche e la costruzione della macchina più grande del mondo, l'LHC, Large Hadron Collider, un anello lungo 27 chilometri situato a 100 metri di profondità nel territorio di Ginevra. Una sfida sul cui successo, all'inizio, pochi avrebbero scommesso e che si accompagna alla storia stessa del CERN, il Consiglio Europeo per la Ricerca Nucleare di cui Luciano Maiani è stato diretto...

  19. Contribución sobre los paradigmas de investigación

    Directory of Open Access Journals (Sweden)

    Carmen Ricoy Lorenzo

    2006-01-01

    Full Text Available Con el presente artículo se pretende indagar sobre las concepciones paradigmáticas que rodeen la investigación. Para esto, se realiza una revisión de los paradigmas dominantes en ciencias sociales y de la educación. A partir de los postulados revisados se avanza hacia una superación de la atomización paradigmática imperante históricamente. La temática abordada se asienta sobre un estudio teórico, analizando la doctrina que mantienen los diferentes paradigmas de investigación reconocidos actualmente en las ciencias sociales y de la educación. Desde un empeño riguroso y sistematizador con este trabajo se contribuye a examinar la difícil problemática forjada en torno a la antinomia paradigmática y se invita al lector a la discusión. Así mismo, la aportación recogida supone un punto de referencia para iniciar nuevas disertaciones en torno a la temática objeto de estudio. La posición que se defiende en este artículo se inclina hacia la combinación paradigmática en investigación para poder analizar solidamente y conocer los contextos educativos reales, de modo que se aporten nuevos hallazgos a la comunidad científica. Se estimula al lector a continuar avanzando en la línea propuesta para impulsar en la medida de lo posible el desarrollo de investigaciones desde una perspectiva multiparadigmática. Palabras clave: Educación. Contexto educativo. Paradigma de investigación.

  20. La struttura drammaturgica del film biografico nel cinema di Hollywood e nella televisione italiana

    OpenAIRE

    ARLANCH, FRANCESCO

    2007-01-01

    La tesi indaga le caratteristiche strutturali dei film di genere biografico prodotti nel contesto del cinema statunitense e della televisione italiana. Riconosciuto nel fatto che il personaggio protagonista è costruito ad imitazione della persona realmente esistita di cui porta il nome l'aspetto identificativo superficiale del film biografico, viene proposta la seguente, nuova interpretazione: quello biografico è un film la cui struttura drammaturgica esprime sulla forma di vita del proprio p...

  1. Modellazione Tridimensionale del Processo di Combustione di un Razzo a Propellente Solido

    OpenAIRE

    Bertacin, Roberto

    2013-01-01

    La regolazione dei sistemi di propulsione a razzo a propellente solido (Solid Rocket Motors) ha da sempre rappresentato una delle principali problematiche legate a questa tipologia di motori. L’assenza di un qualsiasi genere di controllo diretto del processo di combustione del grano solido, fa si che la previsione della balistica interna rappresenti da sempre il principale strumento utilizzato sia per definire in fase di progetto la configurazione ottimale del motore, sia per analizzare le e...

  2. Il sistema marittimo-portuale del Friuli Venezia Giulia. Aspetti economici, statistici e storici

    OpenAIRE

    Danielis, Romeo

    2011-01-01

    Il sistema marittimo-portuale del Friuli Venezia Giulia ha vissuto, e sta vivendo, una rapida trasformazione. La ricerca documentata in questo volume, finanziata dal Fondo Trieste, cerca di tracciarne le linee evolutive dal punto di vista economico, statistico e storico, valutando in che modo esso è interconnesso con il resto del sistema economico regionale, nazionale, internazionale, ed esaminando le caratteristiche dell’organizzazione del lavoro e dei modelli produttivi, dal 1987 al 2007, i...

  3. Paradigmas e cognições no campo da administração educacional: das políticas de avaliação à avaliação como política

    Directory of Open Access Journals (Sweden)

    José Alberto Correia

    2010-01-01

    constituir como un paradigma alternativo, no normativo y relacionado con la rehabilitación de los desconocimientos producidos por el paradigma de la evaluación, valorando sobre todo las mediaciones epistemológicas, institucionales y cognitivas.

  4. Addio Nando Orfei, uno dei padri del circo

    Directory of Open Access Journals (Sweden)

    Francesco De Filippo

    2015-07-01

    Full Text Available «Il circo è e sarà il più grande spettacolo del mondo». Nando Orfei sarà ricordato per questa frase, la "sua" frase, e per quella giacca bordeaux, improbabile e forte come tutti i colori e i gusti legati al mondo circense, secondo la legge che vuole lo spettatore affascinato e sopraffatto da lustrini, suoni e luci. Gusti forti, come il desiderio e l'adrenalina che a Nandino doveva pompargli in corpo ogni volta che alle spalle gli si chiudeva la porta in ferro lasciandolo isolato dal mondo, accerchiato da una decina di tigri o leoni. Come nelle immagini di un tempo o nelle vignette-simbolo della Settimana enigmistica: il domatore impomatato, la frusta, una sedia e una traboccante dose di fegato (o incoscienza. Chi lo ricorderà, lo farà facendo rimbalzare nel cervello questa immagine.

  5. O marketing relacional como novo paradigma-uma análise conceptual

    OpenAIRE

    Antunes, Joaquim; Rita, Paulo

    2008-01-01

    O presente artigo procura analisar a evolução e aceitação, por parte da comunidade científica e académica, da abordagem de marketing relacional como paradigma emergente. São objecto de estudo as insuficiências do marketing transaccional bem como as linhas e determinantes que contribuíram para o desenvolvimento do marketing relacional. Apresentam-se ainda as novas formas de actuação do marketing relacional e as respectivas implicações na gestão das organizações. O trabalho termina com um co...

  6. Cómo estudiarla conciencia: tres paradigmas para la psicología

    OpenAIRE

    Arturo Aguilar

    2001-01-01

    Gran parte de la confusión que existe en la psicología contemporánea podría reducirse si se llevara a cabo una integración de los diferentes paradigmas o puntos de vista. Por otra parte aunque la física clásica ha constituido hasta ahora el modelo a seguir para la ciencia, el concepto de conciencia no es necesario para la solución satisfactoria de los problemas físicos, excepto en el campo de la llamada mecánica cuántica; pero puede ser indispensable para resolver conceptualmente ...

  7. O novo paradigma da violência The new paradigm of violence

    OpenAIRE

    Michel Wieviorka

    1997-01-01

    O autor procura redimensionar o conceito de violência dentro do atual estado de globalização mundial. Crise internacional, narcotráfico, derrocada do bloco socialista no leste europeu, políticas assistenciais de organismos internacionais, conceitos de desenvolvimento e de subdesenvolvimento, terrorismo, sectarismo político e religioso, novas conceituações culturais e sociais são temas trabalhados pelo autor com vistas ao estabelecimento de um novo paradigma da violência.The author tries to re...

  8. Una nota sobre complejidad y paradigma cualitativo (A Note Regarding Complexity and Qualitative Paradigm)

    OpenAIRE

    Roberto Bueno Cuadra

    2014-01-01

    RESUMEN: En las ciencias sociales el tema de la complejidad se presenta con frecuencia en el marco de la discusión entre los paradigmas cuantitativo y cualitativo y en ese debate, casi siempre, es asociado con este último, sobre la base de que la complejidad implica, necesariamente, asumir un enfoque holístico, idiográfico, no reduccionista y comprensivo en las ciencias sociales. El presente artículo se propone argumentar en contra de ese supuesto mostrando que no se requiere ningún desplazam...

  9. Por uma antropologia benjaminiana: repensando paradigmas do teatro dramático

    OpenAIRE

    John C. Dawsey

    2009-01-01

    Este ensaio se apresenta como um canteiro de obras benjaminiano. A justaposição de figuras aparentemente distantes em relações bruscas e surpreendentes talvez provoque estranhamento. Mas as afinidades são reveladoras. Nos remoinhos dos estudos de Michael Taussig, busco uma composição teórica em contraponto: de um lado, Victor Turner e Clifford Geertz, cujos escritos nos levam a pensar possivelmente numa espécie de paradigma do teatro dramático na antropologia e, de outro, duas figuras às marg...

  10. Formazione sul campo: un utile strumento per avviare il percorso di accreditamento previsto dall’accordo Stato – Regioni del 16/12/2010

    Directory of Open Access Journals (Sweden)

    Pollis F.

    2012-01-01

    Full Text Available Per “Formazione sul campo” si intende una tipologia di formazione che si realizza in concomitanza della pratica lavorativa, quando questa si sostanzia in determinate azioni. Essa si sviluppa e si realizza direttamente mentre si lavora. Nasce interrogando e facendoci interrogare dall’esperienza e si propone di mettere al centro dei processi di apprendimento problemi operativi concreti e reali. Si collega alle esigenze delle organizzazioni che perseguono concretamente lo sviluppo della qualità dei servizi e trova terreno fertile laddove i professionisti lavorano mossi da spirito di ricerca. Il percorso formativo che è stato attivato dalla S.C. di Medicina Trasfusionale dell’Azienda Ospedaliera di Alessandria nell’ultimo quadrimestre del 2011, è nato dall’esigenza di dotare i medici volontari che operano in nome e per conto dell’Azienda stessa, attraverso le associazioni, delle competenze necessarie per la gestione della corretta selezione del donatore.

  11. The new "Jardin de Capucine" crèche brings a breath of fresh air for young CERN parents

    CERN Multimedia

    HR Department

    2011-01-01

    On 19 January 2011, CERN's Director-General, Rolf Heuer, signed an agreement with the company "Le Jardin de Zébulon" for the provision of 40 places at the "Jardin de Capucine", a new private crèche due to open this autumn.   In 2008, the "Jardin de Zébulon", a private bilingual crèche for children aged 1 to 4, was opened by Ariane Boucheron at the Technoparc industrial estate in Saint-Genis Pouilly (France). The following year, the number of places was increased from 20 to 37 to meet demand. The "Jardin de Zébulon" has taken in a number of children of CERN personnel ever since it was created. With no let-up in the demand for new crèche places, Ariane Boucher is currently engaged in the construction of a new centre, the "Jardin de Capucine", next-door to the existing crèche. Forty places at the new crèche will...

  12. Organophosphate and carbamate insecticides in agricultural waters and cholinesterase (ChE) inhibition in common carp (Cyprinus carpio)

    Science.gov (United States)

    Gruber, S.J.; Munn, M.D.

    1998-01-01

    Cholinesterase (ChE) activity was used as a biomarker for assessing exposure of common carp (Cyprinus carpio) to organophosphate and carbamate insecticides from irrigated agricultural waters. Carp were collected from a lake (Royal Lake) that receives most of its water from irrigation return flows and from a reference lake (Billy Clapp Lake) outside of the irrigation system. Results indicated that the mean whole-brain ChE activity of carp from Royal Lake (3.47 μmol/min/g tissue) was 34.2% less than that of carp from Billy Clapp Lake (5.27 μmol/min/g tissue) (p = 0.003). The depressed ChE activity in brain tissue of Royal Lake carp was in response to ChE-inhibiting insecticides detected in water samples in the weeks prior to tissue sampling; the most frequently detected insecticides included chlorpyrifos, azinphos-methyl, carbaryl, and ethoprop. Neither sex nor size appears to be a covariable in the analysis; ChE activity was not correlated with fish length or weight in either lake and there was no significant difference in ChE activity between the two sexes within each lake. Although organophosphate and carbamate insecticides can break down rapidly in the environment, this study suggests that in agricultural regions where insecticides are applied for extended periods of the year, nontarget aquatic biota may be exposed to high levels of ChE-inhibiting insecticides for a period of several months.

  13. The conserved proteins CHE-12 and DYF-11 are required for sensory cilium function in Caenorhabditis elegans.

    Science.gov (United States)

    Bacaj, Taulant; Lu, Yun; Shaham, Shai

    2008-02-01

    Sensory neuron cilia are evolutionarily conserved dendritic appendages that convert environmental stimuli into neuronal activity. Although several cilia components are known, the functions of many remain uncharacterized. Furthermore, the basis of morphological and functional differences between cilia remains largely unexplored. To understand the molecular basis of cilia morphogenesis and function, we studied the Caenorhabditis elegans mutants che-12 and dyf-11. These mutants fail to concentrate lipophilic dyes from their surroundings in sensory neurons and are chemotaxis defective. In che-12 mutants, sensory neuron cilia lack distal segments, while in dyf-11 animals, medial and distal segments are absent. CHE-12 and DYF-11 are conserved ciliary proteins that function cell-autonomously and are continuously required for maintenance of cilium morphology and function. CHE-12, composed primarily of HEAT repeats, may not be part of the intraflagellar transport (IFT) complex and is not required for the localization of some IFT components. DYF-11 undergoes IFT-like movement and may function at an early stage of IFT-B particle assembly. Intriguingly, while DYF-11 is expressed in all C. elegans ciliated neurons, CHE-12 expression is restricted to some amphid sensory neurons, suggesting a specific role in these neurons. Our results provide insight into general and neuron-specific aspects of cilium development and function. PMID:18245347

  14. Finally a crèche at CERN, thanks to the Staff Association

    CERN Multimedia

    Staff Association

    2013-01-01

    Setting up at CERN a collective structure to mind children younger than two years, a so-called “crèche”, has been discussed at least since the early 1990s. Then, in February 2001, the Equal Opportunities Advisory Panel produced a memo to the Director of Administration in which it “invites the CERN Management to re-consider the possibility of creating a crèche at CERN”. As a result an ad hoc task force (“Bethléem”) was set up, which based its work on an informal questionnaire sent to CERN families with small children. Its study came up with some relevant parameters for “should CERN Management intend to undertake a minimal effort toward solving the crèche problem for its staff members”. Nothing was undertaken at that time. In the framework of the 2005 five yearly review “Working Group 6: Crèche” made another study of public and private  cr&a...

  15. ¿Buscando un nuevo paradigma? La Unión Europea en busca de un nuevo concepto de seguridad en las Relaciones Internacionales

    Directory of Open Access Journals (Sweden)

    Franz KERNIC

    2008-10-01

    Full Text Available Este artículo presenta un análisis de los cambios fundamentales en la orientación teórica de la seguridad europea en el mundo post-Guerra Fría. El objetivo fundamental es investigar el desarrollo de nuevos conceptos de la seguridad europea en el contexto de la integración europea y analizar las principales posibilidades de establecer un nuevo paradigma de seguridad respecto al futuro desarrollo de la política de seguridad de la Unión Europea (UE. El punto de partida del análisis es el discurso social sobre nuevos riesgos y desafíos de la seguridad europea y la relación entre la percepción de una lista de nuevas amenazas y la formulación y formación de una nueva política de seguridad. El foco del análisis es la Unión Europea y los discursos contemporáneos en cuanto a la génesis de un nuevo paradigma de seguridad a escala de la UE y su Política Exterior y de Seguridad Común (PESC. This article presents an analysis of the fundamental changes affecting the theoretical orientation of the European security in the post-Cold War World. The main objective is to investigate the development of new European security concepts in the context of European integration and to analyze the chief possibilities of establishing a new security paradigm with regard to the future development of the security policy of the European Union (EU. The starting point of the analysis is the social discourse on new risks and challenges for the European security and the relation between the perception of a list of new menaces and the formulation and formation of a new security policy. The focus of the study is the European Union and the contemporary discourses concerning the genesis of a new security paradigm fit to scale of the EU and its Common Foreign and Security Policy (CFSP.

  16. Il disagio degli insegnanti tra psicologia e pedagogia: una indagine multidimensionale sul fenomeno del burnout

    Directory of Open Access Journals (Sweden)

    Francesca Botticelli

    2012-06-01

    Full Text Available A partire da un minuzioso esame della letteratura internazionale sui diversi versanti che costituiscono gli elementi chiave di questa ricerca (stress lavoro-correlato, burnout, formazione insegnanti il lavoro vuole analizzare il fenomeno del burnout degli insegnanti come fenomeno multi dimensionale. Si raggiunge questo obiettivo a partire dalla concezione del burnout come risultato di stress lavoro-correlato che si muove su dimensioni plurime, aventi carattere sia soggettivo che organizzativo. Per l‘apprezzamento delle prime sono stati utilizzati il Maslach Burnout Inventory (Maslach e Jackson 1986; validazione italiana Sirigatti e Stefanile, 1993; sul versante della salute organizzativa il Multidimensional Organizational Health Questionnaire (MOHQ; Avallone e Paplomatas 2005; sul versante dei principali sintomi lamentati dal campione di ricerca la Sympton Check List (SCL-90; Derogatis, 1977 e infine sulla percezione di sé Adjective Check List (ACL; Gough 1949; valid. It. Gough, Heilbrun, e Fioravanti, 1980 nella modalità di Sé reale . Il campione era costituito da 52 docenti di cui 28 maschi (53,8% e 24 femmine (46,2%. 50 anni l‘età media dei soggetti interpellati. L‘analisi dei risultati mostra la necessità di soluzioni al problema secondo più dimensioni e anche di una lettura pedagogica del fenomeno nel suo intrecciarsi con le dinamiche alla base della socialità contemporanea. Tale lettura e le soluzioni proposte si inscrivono infatti nel contesto ampio delle trasformazioni che investono a livello globale il mondo dell‘istruzione e la società nel suo complesso, generando un disagio che si coagula intorno alla perdita di senso del proprio essere nel mondo, quindi anche sul senso delle attività lavorative e dell‘educazione. Il contributo pedagogico è orientato quindi alla ricerca di senso da un lato, e al contrasto a livello istituzionale di pratiche volte a fare dell‘educazione un mercato e del suo assessment uno

  17. Max Weber, la borsa e la ‘crisi del credito’ del 2008

    Directory of Open Access Journals (Sweden)

    Carlo Rossetti

    2011-02-01

    Full Text Available A partire da una rilettura di opere, come Die Protestantische Ethik und der Geist der Kapitalismus e Die Boersenequete, l'articolo mostra che – in linea con quanto Max Weber aveva descritto – l'assenza di regole generali condivise e di controlli pubblici mette in crisi le fondamenta del sistema finanziario. La privatizzazione neoliberista degli organi di controllo della finanza e la creazione di oscuri strumenti finanziari hanno contribuito alla regressione dell'organizzazione giuridica dello Stato, mettendo a serio rischio il principio di calcolabilità razionale che per secoli ha costituito il fondamento della teoria economica. In conclusione, Weber contribuisce a cogliere uno dei nodi fondamentali della crisi americana contemporanea: l'erosione dell’autorità indipendente posta a tutela dell’integrità del sistema.

  18. Memorias del Seminario Internacional Cambio clímático: ciencia, historia y política

    OpenAIRE

    Hackman, Heide; Armenteras Pascual, Dolors; Rueda Delgado, Guillermo; Verschoor, Gerard; Guimarães, Roberto; Vargas Prieto, Alberto Miguel; Gómez, Ivone; Blanco, Gustavo Emilio; Cariño, Martha Micheline; Jiménez Rojas, Eliana; Tobón, Juan Fernando; Echeverri, Juan Alvaro; Palacio, Germán

    2012-01-01

    Poco es lo que entendemos sobre el comportamiento individual y colectivo, los paradigmas individuales y colectivos, los paradigmas de desarrollo y las respuestas institucionales y políticas al cambio climático. Por eso, en el marco del XI mes de la investigación, en la Universidad Nacional de Colombia Sede Amazonia, con el apoyo de los grupos de investigación Historia, Ambienta y Política: Limnología Amazónica; Etnología y lingüística Amazónica y Desarrollo Regional Amazónico; se realizó est...

  19. El impacto del Concilio Vaticano II en la historiografía sobre el catolicismo en Estados Unidos

    OpenAIRE

    2014-01-01

    El artículo analiza el impacto del Concilio Vaticano II en la historiografía sobre el catolicismo americano, siguiendo, de modo cronológico, la evolución de temas y paradigmas, antes y después del Concilio, y entre la generación que vivió el Concilio y la sucesiva. Se ha podido relevar un fuerte impacto del Concilio en el ámbito historiográfico, como fuerte fue el impacto del Concilio en el catolicismo americano. La eclesiología del Pueblo de Dios, así como el nuevo clima ecuménic...

  20. LEGGERE PER APPRENDERE: IL DIFFICILE CASO DEL TESTO DI STORIA

    Directory of Open Access Journals (Sweden)

    Simonetta Ciaccio

    2011-07-01

    Full Text Available La comprensione del manuale di storia da parte dello studente straniero che apprende l’italiano come lingua di scolarizzazione è il problema che viene affrontato in questo articolo. Nella prima parte, introduttiva, dell’articolo si richiamano alcuni aspetti relativi all’apprendimento dell’italiano come lingua di scolarizzazione e alla comprensione dei testi per lo studio e si evidenziano in particolare, le caratteristiche linguistico-testuali dei manuali scolastici di storia e le aree di difficoltà che gli apprendenti possono incontrare. Nella seconda parte viene esaminato, facendo riferimento anche agli indici di difficoltà gulpease, un capitolo tratto da un manuale di scuola media di cui vengono messi in evidenza i tratti lessicali, morfo-sintattici, testuali e di contenuto che possono risultare di difficile comprensione per l’apprendente. L’articolo si conclude con una serie di proposte di semplificazione e/o di facilitazione del testo preso in esame che lo rendano accessibile allo studente e che possano essergli di aiuto nell’apprendere i contenuti disciplinari proposti.     Reading for learning: The difficult case of history textbooks   Understanding history textbooks for foreign students learning Italian at school is the problem addressed in this article.  The first part discusses a few aspects of learning Italian at school and understanding texts and focuses on the textual-linguistic aspects of school history textbooks and the difficulties students may have with them.  The second part investigates a chapter from a middle-school history textbook, highlighting the lexical, morpho-syntactic, textual and content traits that may cause learners difficulty in comprehension, referring to the GULPEASE difficulty index levels.  The article concludes with a series of proposals for simplifying and/or facilitating the text examined in order to make it accessible to the student and offer help in learning the content.

  1. ECOFICCIONES E IMAGINARIOS DEL AGUA Y SU IMPORTANCIA PARA LA MEMORIA CULTURAL Y LA SOSTENIBILIDAD

    OpenAIRE

    Eloy Martos Núñez; Alberto Martos García

    2013-01-01

    La cultura del agua debe ser vinculada de forma especial a las manifestaciones del patrimonio cultural intangible de los pueblos, como las tradiciones orales o escritas, la simbología o los rituales, que conforman lo que llamamos los Imaginarios del Agua. Estos deben ser analizados y deconstruidos a la luz de los nuevos paradigmas, como la hermenéutica y la ecocrítica. De este modo, la mitografía ayuda a perfilar el significado profundo de la cultura del agua ante las nuevas demandas medioamb...

  2. Jacques Tati : vivienda experimental y espacio de trabajo a mediados del siglo XX

    OpenAIRE

    San Nicolás Juárez, Helia de

    2015-01-01

    La obra fílmica del director francés Jacques Tati podría considerarse como el perfecto reflejo del paradigma edificatorio de mediados del siglo XX en plena posguerra europea, una época ávida de transformaciones de las que el cine supo hacerse eco. Particularmente, el cine de Tati refleja las preocupaciones del ciudadano europeo de posguerra sobre las consecuencias de las masivas construcciones erigidas en sus devastados núcleos urbanos y la puesta en práctica de la ciudad funcional propuesta ...

  3. Expressões teóricas dos processos de libertação: novos paradigmas

    OpenAIRE

    Manuel Alfonso Díaz Muñoz

    2013-01-01

    O objeto deste artigo é descrever os eixos comuns às três expressões teóricas dos processos de libertação e apontar os novos paradigmas propostos perante os desafios que a contemporaneidade apresenta com a ajuda dos autores mais representativos de cada área: na teologia, Gustavo Gutiérrez; na filosofia, Enrique Dussel; na pedagogia, Paulo Freire. A análise dos novos paradigmas é feita a partir de James Cone (raç...

  4. Valoración del componente articulatorio del bucle fonológico del habla interior mediante una técnica conductual

    OpenAIRE

    Aguilar Alonso, Ángel; Aguilar Mediavilla, Eva María

    2008-01-01

    Se hace una breve revisión de diferentes modos y técnicas para evaluar el pensamiento verbal y el llamado componente articulatorio del bucle fonológico del habla interior. A continuación, se presenta un procedimiento de investigación que utiliza una técnica paradigmática de tres tareas: se trata de un paradigma conductual basado en el recitado de un texto previamente memorizado y ensayado bajo tres condiciones diferentes: tarea I, voz audible, tarea II, habla interior, tarea III, habla interi...

  5. La ricostruzione grafica del pavimento musivo di una villa romana

    Directory of Open Access Journals (Sweden)

    Caterina Gattuso

    2015-01-01

    Full Text Available Nel processo di analisi conoscitiva finalizzato alla conservazione e/o al restauro di un manufatto storico, la documentazione grafica offre un contributo importante ai fini della redazione del quadro anamnesico. Essa costituisce uno strumento conoscitivo che, nel rappresentare e registrare lo stato di conservazione nonché gli eventuali interventi di restauro cui il bene è stato sottoposto, permette di completare e di integrare le informazioni già ottenute mediante il dossier fotografico. In questo contesto si vuole dimostrare l’importanza del disegno informatico, da intendere come strumento utile per l’elaborazione di un corretto piano diagnostico, illustrando la ricostruzione grafica di una complessa pavimentazione musiva che decora un particolare ambiente di una villa di epoca romana posta sulle rive del lago d’Esaro nel comune di Roggiano Gravina (CS, ottenuta attraverso l’uso di un particolare software di design grafico e disegno vettoriale.

  6. Filosofia del linguaggio: una ipotesi di metodo per le neuroscienze

    Directory of Open Access Journals (Sweden)

    Andrea Bucci

    2013-08-01

    Full Text Available Già con Aristotele e il suo famoso "triangolo" la filosofia ha iniziato ad interessarsi al rapporto tra parola e realtà. Autori come Frege, Wittgenstein, Quine, Kripke hanno fatto oggetto del loro lavoro nozioni come sintassi, semantica e riferimento. Da Chomsky fino ai giorni nostri, anche grazie a studiosi italiani quali Gennaro Chierchia, si è cercata la soluzione a questi problemi da un punto di vista naturalistico. Specialisti del settore, come Vittorio Gallese, si sono spinti nell’impresa di dare al linguaggio ed alle nozioni elencate una caratterizzazione neurofisiologica. Di questi snodi e di un’ipotesi - forse azzardata - dello scrivente tratterà il presente articolo. Questo lavoro introduttivo sulla filosofia del linguaggio che ha tratto anche spunto dalla discussione sui neuroni specchio stimolata negli anni dalla rivista BrainFactor si prefigge un fine divulgativo ed è auspicabile che generi riflessioni ulteriori da parte di giovani studiosi.

  7. L’efficienza del trasferimento tecnologico nel contesto del Friuli Venezia Giulia

    OpenAIRE

    Priore, Riccardo; et al, ...

    2014-01-01

    I dati e i concetti sotto esaminati si riferiscono ad un’esperienza del Consorzio AREA Science Park che fornisce alla Regione Friuli Venezia Giulia servizi di trasferimento tecnologico attraverso i suoi brokers da oltre venti anni. Uno specifico know-how è stato dedicato alla valorizzazione di attività delle imprese e dei ricercatori di questa regione; la fruizione dei risultati della ricerca, in un’ideale catena di valori, prevede un flusso informativo diretto verso molteplici be...

  8. Trasmissione del sapere musicale e storia della cultura europea nei primi decenni del secolo XV

    Directory of Open Access Journals (Sweden)

    Matteo Nanni

    2013-12-01

    Full Text Available L’evoluzione storico-musicale nella prima metà del Quattrocento è caratterizzata dall’internazionalizzazione della cultura musicale europea ed si pone in continuità con il processo culturale del primo umanesimo. La categoria di ‘evoluzione’ e l’idea stessa di ‘rinascita’, ovvero quella “leggenda di un progresso” (Martin Le Franc, Johannes Tinctoris discussa da Reinhard Strohm, sono concetti che oggi devono essere letti non soltanto nel senso di una omologazione stilistica, ma anche come aspetto distintivo di una ricerca d’identità culturale. Anche dal punto di vista storico-musicale siamo di fronte alla costituzione di un nuovo gusto europeo nato dalla fusione di stili e di pratiche locali che si espanderà, grazie alla trasmissione delle compilazioni manoscritte, per tutto il continente e al quale aderiranno, in maniera disomogenea, anche compositori di regioni più remote.Il Concilio di Basilea non costituisce solo un dato storico circoscrivibile agli anni in cui si svolse il sinodo, così come non è da considerarsi solo un fatto empirico riguardante la sola città della Svizzera settentrionale. Esso deve piuttosto essere assunto come un evento paradigmatico per la storia della cultura del Quattrocento. Gli incontri fra intellettuali ed artisti, l’interazione fra musicisti di diverse regioni europee che si incontravano grazie ai frequentissimi spostamenti delle corti e delle cappelle, fanno del Concilio la piattaforma virtuale sia per la ricerca di una nuova identità culturale sia per la nascita di nuovi repertori e pratiche musicali. Il Concilio trascende quindi i confini contingenti della città di Basilea trasformandosi in una vera e propria “dinamica culturale” in cui i singoli individui contribuiscono alla continua trasmissione e fusione di esperienze musicali diventando vettori di una nuova mentalità musicale che raggiunse anche gli angoli più remoti dell’Europa.

  9. Nuevos Paradigmas en la Investigación en la Historia de la Contabilidad

    Directory of Open Access Journals (Sweden)

    Miriam Núñez Torrado

    2000-12-01

    Full Text Available En la última década se ha despertado un interés creciente por la historia de la contabilidad en diversos foros académicos. Ese interés ha impulsado un nuevo debate sobre las posibilidades metodológicas a la hora de acometer una investigación en este área. En este trabajo se presentan los dos paradigmas fundamentales de la historiografía contable, el positivista y el crítico, para a continuación proponer un nuevo paradigma integrador de ambas posiciones metodológicas. Ello se hará a partir de la consideración de la contabilidad como construcción social, en cuanto a conjunto de prácticas que influyen y configuran la realidad social, más allá de las asunciones que tradicionalmente se le atribuyen de racionalidad, objetividad y neutralidad. The last decade has seen the revival of a growing interest in accounting history in different academic fields. Such interest has pushed a new debate about methodological ways to undertake research in this area. This paper reviews the main paradigms in accounting historiography, the positivist and the critical, and proposes a new paradigm integrating both methodological positions. This is done by considering accounting as a social construction, as a set of practices that influence and form social reality, moving beyond conventionally conferred assumptions of rationality, objectivity and neutrality.

  10. La genómica nutricional: un nuevo paradigma de la investigación de la nutrición humana.

    Directory of Open Access Journals (Sweden)

    Felipe García Vallejo

    2009-11-01

    Full Text Available La relación entre la dieta y la salud es un hecho que ha sido ampliamente demostrado; sin embargo, existe un interés creciente en cuáles de los componentes de la dieta son biológicamente activos y cómo ellos ejercen su efecto funcional. Estas preguntas han sido ejes centrales del desarrollo de la genómica nutricional. Así, la genómica nutricional es la aplicación de las tecnologías utilizadas en la funcional para entender, a nivel genómico, el efecto que tienen los alimentos. Una de las preguntas más comunes en nutrición es ¿Qué y cómo comer? La aceptada individualidad metabólica que se ha predicado en los últimos años, impide que se pueda dar una respuesta general. Actualmente se sabe que el genoma es individualizado y que la expresión de su contenido informacional es un universo único, que depende no sólo de factores exógenos sino que es modulado de manera muy compleja por múltiples factores endógenos. Es pues un reto de conocimiento el comenzar a definir cuáles son las variables que intervienen para poder tener una dieta acorde con cada individuo. En este sentido, la genómica nutricional (o nutrigenómica, plantea el estudio del efecto de los alimentos a nivel molecular y genético. En tal contexto, el proyecto del genoma humano provee herramientas para poder entenderla y se convierte en un nuevo paradigma de la investigación en nutrición humana.

  11. Dall'attrezzatura all'attrattore: una procedura di supporto alla definizione delle attrezzature di interesse generale nei piani urbanistici nell’ottica del marketing territoriale

    OpenAIRE

    Atorino, Flavia

    2006-01-01

    Il presente lavoro è frutto dell’attività di ricerca svolta nei tre anni del Corso di Dottorato di Ricerca in Ingegneria delle Reti Civili e dei Sistemi Territoriali, XVIII ciclo, Sezione Governo del Territorio. Le ragioni che hanno portato ad affrontare il tema delle attrezzature di interesse generale (art. 2 del D.I: 1444/68) in relazione al contributo che esse offrono sia alla competitività dei territori sia alla qualità della vita nei contesti urbani, sono sostanzialmente due. Da un...

  12. L’altra memoria dei tracciati. La viabilità storica come chiave interpretativa del paesaggio

    Directory of Open Access Journals (Sweden)

    Marco Cillis

    2013-01-01

    Full Text Available Parlare di viabilità storica vuol dire abbandonare l’idea stereotipata della strada monumentale e ipotizzare che possa esistere un patrimonio minore per altisonanza, quanto mai fragile e diffuso. Il contributo persegue l'obiettivo di fornire alcune chiavi interpretative del paesaggio ponendo in relazione la struttura profonda dei luoghi con il permanere delle tracce storiche dei luoghi stessi attraverso il tema della strada. Partendo da alcune considerazioni sulla cartografia stradale di matrice storica, il tema viene declinato nell'ottica del “paesaggio della strada”, che da una dimensione puntuale degli elementi testimoniali, si espande ad una più vasta che trova nella strada il tema conduttore di un sistema identitario territoriale e delle sue trasformazioni

  13. L’arte del paesaggio e la sua trasformazione

    Directory of Open Access Journals (Sweden)

    Raffaele Milani

    2015-11-01

    Full Text Available Leggere il paesaggio significa capire la natura, la storia e la cultura di un luogo. Una lettura importante per recuperare i segni del passato, renderli visibili e accostarli a più recenti segni provenienti dalle nuove richieste di possibili trasformazioni. Le forme riconoscibili di un paesaggio rivelano pagine di una lunga storia, dalla tradizione alla modernità. Perché esso è moderno e antico allo stesso tempo. Il paesaggio esprime un’immagine di forme, una reazione sentimentale e allo stesso tempo un’esigenza d’astrazione. E’ categoria dell’oggetto e del soggetto. Dufrenne, in un secolo che sembrava avesse dimenticato la bellezza del paesaggio, aveva elogiato sin dal 1955 la percezione estetica della natura sottolineando una certa indistinzione del sensoriale e dell’affettivo. In generale si accenna a un’arte del paesaggio quando esso viene concepito e sentito in relazione allo sguardo pittorico, alla veduta, alla teatralizzazione della natura, alle suggestioni visive delle note di viaggio. Ma, se vogliamo veramente pensarlo come un’arte dell’origine, un’arte che precede i suoi riflessi nella riproduzione dell’arte figurativa, esso ci appare più ampiamente e profondamente unito a un insieme di aspetti che mettono in luce l’uomo tra natura, cultura, storia e mito. Quest’ultimo si fa poi strumento importantissimo nel cogliere e trasmettere il mistero, l’inesplicabile, l’invisibile. Il paesaggio è, allora, sia reale, un’arte fornita dal fare e dalla cultura di un popolo, sia mentale, legato alla rappresentazione e alla visione del mondo. Gli architetti e i paesaggisti che sono invitati a ridare dignità a un territorio degradato, o troppo alterato e manipolato, dovranno ricordarsi dell’interazione di queste due accezioni ed essere capaci di leggere e interpretare i segni della presenza dell’uomo e migliorare così l’aspetto dei luoghi. 

  14. Data from the Mars Science Laboratory CheMin XRD/XRF Instrument

    Science.gov (United States)

    Vaniman, David; Blake, David; Bristow, Tom; DesMarais, David; Achilles, Cherie; Anderson, Robert; Crips, Joy; Morookian, John Michael; Spanovich, Nicole; Vasavada, Ashwin; Yen, Albert; Bish, David; Chipera, Steve; Downs, Robert; Morrison, Shaunna; Farmer, Jack; Grotzinger, John; Stolper, Edward; Ming, Douglas; Morris, Richard; Rampe, Elizabeth; Treiman, Allan; Sarrazin, Philippe

    2013-01-01

    The CheMin instrument on the Mars Science Laboratory (MSL) rover Curiosity uses a Co tube source and a CCD detector to acquire mineralogy from diffracted primary X-rays and chemical information from fluoresced X-rays. CheMin has been operating at the MSL Gale Crater field site since August 5, 2012 and has provided the first X-ray diffraction (XRD) analyses in situ on a body beyond Earth. Data from the first sample collected, the Rocknest eolian soil, identify a basaltic mineral suite, predominantly plagioclase (approx.An50), forsteritic olivine (approx.Fo58), augite and pigeonite, consistent with expectation that detrital grains on Mars would reflect widespread basaltic sources. Minor phases (each <2 wt% of the crystalline component) include sanidine, magnetite, quartz, anhydrite, hematite and ilmenite. Significantly, about a third of the sample is amorphous or poorly ordered in XRD. This amorphous component is attested to by a broad rise in background centered at approx.27deg 2(theta) (Co K(alpha)) and may include volcanic glass, impact glass, and poorly crystalline phases including iron oxyhydroxides; a rise at lower 2(theta) may indicate allophane or hisingerite. Constraints from phase chemistry of the crystalline components, compared with a Rocknest bulk composition from the APXS instrument on Curiosity, indicate that in sum the amorphous or poorly crystalline components are relatively Si, Al, Mg-poor and enriched in Ti, Cr, Fe, K, P, S, and Cl. All of the identified crystalline phases are volatile-free; H2O, SO2 and CO2 volatile releases from a split of this sample analyzed by the SAM instrument on Curiosity are associated with the amorphous or poorly ordered materials. The Rocknest eolian soil may be a mixture of local detritus, mostly crystalline, with a regional or global set of dominantly amorphous or poorly ordered components. The Rocknest sample was targeted by MSL for "first time analysis" to demonstrate that a loose deposit could be scooped, sieved to

  15. 幽门螺杆菌cheA基因在细菌体外趋化和体内定植过程中的作用%Role of Helicobacter pylori cheA gene in chemotaxis in vitro and colonizationin vivo

    Institute of Scientific and Technical Information of China (English)

    陈光; 严杰; 徐丽慧; 吴盛海; 王贤军

    2010-01-01

    Objective To determine the effect of cheA gene of Helicobacter pylori in the bacterial chemotaxis in vitro and colonization in vivo. Methods The entire cheA and cheY genes were amplified and cloned from genomic DNA of H. pylori NCTC11637 strain. Subsequently, the prokaryotic expression systems of cheA and cheY genes were generated and the target recombinant proteins rCheA and rCheY were extracted by Ni-NTA affinity chromatography. Rabbits were immunized with either rCheA or rCheY for obtaining antisera, and rCheA-IgG and rCheY-IgG in the antisera were prepared using ammonium sulfate precipitation plus DEAE-52 column chromatography. A suicide plasmid of cheA gene was constructed and then a cheA gene knock-out mutant ( cheA - ) was generated based on homologous recombinant exchange using the suicide plasmid. The cheA- mutant was identified using PCR and sequencing. The phosphorylation levels of CheA and CheY molecules of cheA - and wild-type strain were determined by using rCheA-IgG and rCheY-IgG anchoring the target proteins and protein phosphorylation detection kit. The differences of chemotaxis in vitro and colonization in vivo between cheA- mutant and wild-type strain were compared using chemotactic model and BALB/c infection model of H. pylori. Results The cheA gene knock-out in genome of cheA- mutant was confirmed by the results of PCR and sequencing. After treated with 0. 001-0. 1 mol/L HCI for 10 min, the phosphorylation levels of CheA and CheY molecules of wild-type strain were rapidly descended from ( 59.6 ±11.5) μmol and (55.5 ± 10.2) μmol to ( 10.8 ± 2.6) and (5. 5 ± 1.2) μmol (P < 0.05 ), while the phosphorylation of CheY molecule of cheA - mutant was no markedly changed with a persistent lower level ( P >0.05). The diameters [(10-20) ± (2-3) mm] of chemotactic aggregative rings of cheA- mutant were significantly less than those [(16-24) ± (2-3)mm] of wild-type strain (P <0.05). The positive isolation rate (90%) of H. pylori in gastric

  16. Inserto speciale su Postmodernità, psicopatologia e psicoterapeuti Associazionismo, professione e postmodernità.Congresso Nazionale del Laboratorio di Gruppoanalisi Roma, 2-4 dicembre 2011

    Directory of Open Access Journals (Sweden)

    Nicolò Terminio

    2014-09-01

    Full Text Available Nella presentazione del Convegno nazionale del Laboratorio di Gruppoanalisi tenutosi a Roma dal 2 al 4 dicembre del 2011 l’accento veniva posto sulla necessità di «interrogarsi sui profondi cambiamenti che attraversano la nostra epoca». L’interrogativo centrale riguardava le forme del patire di «questa ineffabile contemporaneità» e le possibilità di rinnovamento degli psicoterapeuti

  17. IL COMMERCIO EQUO E SOLIDALE: PROSPETTIVE E RAGIONI DI UNA REGOLAMENTAZIONE TRA COOPERAZIONE ALLO SVILUPPO ED ESIGENZE DI TUTELA DEL CONSUMATORE

    OpenAIRE

    FILICE, ASSUNTA BARBARA

    2010-01-01

    Il commercio equo e solidale (Cees) è andato sviluppandosi nel mondo occidentale nel corso degli ultimi quaranta anni, quale risposta alla crescente consapevolezza del fatto che i vantaggi derivanti dagli scambi e dall’espansione del commercio internazionale non risultano equamente ripartiti tra tutti i Paesi e tra i vari strati della popolazione di ciascuno dei Paesi stessi. La progressiva estensione del fenomeno in termini di ampliamento delle aree geografiche coperte e di aumento del qu...

  18. La trascrizione del certificato di nascita del figlio di coniugi “same sex”. Filiazione omogenitoriale, ordine pubblico internazionale e interesse del minore nella recente giurisprudenza torinese

    Directory of Open Access Journals (Sweden)

    GUIDO NOTO LA DIEGA

    2015-01-01

    Full Text Available Le odierne fugaci riflessioni prendono le mosse da un decreto con cui, in data 29 Ottobre 2014, la Corte d’Appello di Torino, ribaltando la decisione di primo grado, ha imposto all’ufficiale dello stato civile di trascrivere l’atto di nascita di un bambino risultante ab origine figlio di due madri, le quali, una spagnola e una Italiana, sposatesi in Spagna nel 2009, avevano procreato in Spagna tramite un procedimento di fecondazione eterologa. Il decreto in parola è di grande rilevanza in quanto senza precedenti, posto che sinora ciò che, talvolta, si era arrivato a riconoscere era la c.d. stepchild adoption, cioè l’adozione del figlio del partner (nei casi considerati, in una relazione omosessuale. Andando per ordine, nel 2012, l’Ufficiale dello Stato civile di Torino a seguito di trasmissione ad opera del Consolato Generale d’Italia a Barcellona, respingeva la richiesta di trascrizione dell’atto di nascita di un minore nato nel capoluogo catalano, in quanto atto contrario all’ordine pubblico italiano. Dalla certificatión literal (copia integrale del certificado de nacimiento risultava che, in conformità al diritto spagnolo, il minore, cittadino spagnolo, era ab initio considerato hijo matrimonial delle comparenti, le quali, appunto, erano due donne omosessuali, di cui una aveva donato gli ovuli, mentre l’altra aveva portato avanti la gravidanza e il parto.

  19. Nuevos paradigmas empresariales y tecnológicos: innovación, modelos sociotécnicos y groupware

    OpenAIRE

    Sáez Vacas, Fernando

    1996-01-01

    La investigación actual parte de la organización tecnosocial como clave de la productividad. Se avanzan así modelos constructivos para optimizar la implantación y la transferencia de tecnología, puentes para nuevos paradigmas tecnológicos y empresariales.

  20. Revisión crítica del constitucionalismo en el Estado Mexicano = Critical review of the Mexican state constitutionalism

    OpenAIRE

    Polanco Polanco, Adrián

    2014-01-01

    Actualmente ha surgido un nuevo paradigma constitucional en el Estado Mexicano, en el cual se patenta la actitud activista por parte del poder judicial para realizar un control de convencionalidad ex officio, es claro que dicho redil provoca que se siguen

  1. En la búsqueda de características en eyecciones coronales de masa que discriminen entre dos paradigmas físicos en modelos de ECMs

    Science.gov (United States)

    Paissan, G.; Stenborg, G.; Rovira, M.

    Se conocen tres diferentes fenómenos de gran escala que ocurren en la atmósfera solar, denominados eyecciones coronales de masa (ECMs), protuberancias eruptivas y grandes fulguraciones de dos bandas. Estos fenómenos están estrechamente relacionados y podrían ser distintas manifestaciones de un único proceso físico. Las ECMs son definidas como eyecciones de gran escala de masa y flujo magnético desde la baja corona al espacio interplanetario. Desde su descubrimiento en los '70, muchos modelos han sido propuestos para explicar su origen y evolución. La explicación física de las ECMs es un tema de debate intenso. No obstante, los modelos pueden sintetizarse en dos grandes grupos: 1) los modelos de inyección de flujo y 2) los modelos de almacenamiento y liberación. En este trabajo, se presentan los estudios realizados con una serie de eventos observados con el coronógrafo MICA (Mirror Coronograph for Argentina), el telescopio en H-alfa HASTA (H-alpha Solar Telescope for Argentina) y los coronógrafos C2 y C3 de la sonda SOHO (Solar and Heliospheric Observatory). Los eventos que pudieron ser identificados como ECMs son contrastados dentro del esquema de los dos paradigmas teóricos propuestos.

  2. Cuerpos y territorios vaciados ¿En qué consiste el paradigma de la diferencia? ¿Cómo pensamos la diferencia?

    Directory of Open Access Journals (Sweden)

    Aurora Vergara Figueroa

    2014-06-01

    Full Text Available En este artículo se ofrece una reflexión acerca del paradigma de la diferencia y sus implicacionesen las relaciones sociales cotidianas mediadas por aspectos étnico-raciales, sexuales, de género y de clase. Se describe cómo algunas de las más firmes creencias de los seres humanostoman forma en los procesos de socialización. Se propone, así mismo, los conceptos “cuerpos vaciados” y “territorios vaciados” como categorías analíticas para discernir lo que implica la imposición de prejuicios o estereotipos en las relaciones que sostenemos, y para hacer explícito cómo el no pensar la diferencia críticamente implica anular a los otros. A manera de conclusión, se plantea el argumento de que pensar la diferencia es permitir ser y hacer, siempre y cuando estas acciones no signifiquen aniquilar a los demás.

  3. Plataforma logística del Bío-Bío, la globalización del espacio urbano

    Directory of Open Access Journals (Sweden)

    Sergio Baeriswyl Rada

    2015-04-01

    Full Text Available La velocidad de cambio del mundo contemporáneo no solo está afectando nuestro entorno económico, cultural y laboral, también lo está haciendo de manera profunda en el mundo de las ideas y de los conceptos, es decir, en la esfera del conocimiento y los múltiples paradigmas que han abrigado por años nuestra forma de vida y de organizar la ocupación de los territorios.

  4. Uso del modelo sistémico complejo para la mejora de la formación permanente del profesorado de los campos de aprendizaje

    OpenAIRE

    Garcia Segura, María Rosa; Fabregat Arimon, Marc; Badia Cabré, Roser; Pujol, Rosa M.

    2009-01-01

    La investigación ha sido realizada en el marco de un curso de formación del profesorado iniciado el año 2006 dirigido a los equipos educativos de los Campos de Aprendizaje (CdA). El objetivo es analizar el modelo de ciencia que los educadores tienen y transmiten mediante los contenidos de las actividades y los materiales didácticos. Los fundamentos teóricos parten del paradigma de la complejidad, como marco orientador de pensamiento, acción y ética; y del aprendizaje a través de modelos menta...

  5. Governo del territorio e grandi trasformazioni nella regione urbana milanese

    Directory of Open Access Journals (Sweden)

    Fulvia Pinto

    2010-02-01

    Full Text Available  Lo studio analizza le grandi trasformazioni in atto nella “regione urbana” milanese, esaminando gli strumenti, le strategie e le politiche seguite. Per “regione urbana” si intende un territorio che non fa riferimento a relazioni gerarchiche di tipo centro-periferico, bensì determina relazioni multi direzionali, a differenza dell’area metropolitana che viene definita in base a relazioni di dipendenza (economica, sociale, funzionale, ecc. di agglomerati esterni rispetto ad un capoluogo. La regione urbana milanese è uno dei poli economici e produttivi più attivi a livello nazionale ed europeo, tuttavia tale territorio è caratterizzato da una ridotta qualità urbana e ambientale e da fenomeni di polarizzazione e di frammentazione sociale in aumento, che hanno ripercussioni negative sulle prospettive di sviluppo dell'area. I più recenti strumenti di pianificazione dell’area milanese fanno riferimento alla coesione territoriale, cercando di disegnare una nuova struttura per il territorio frammentato e diffuso, consolidando il policentrismo della regione urbana, favorendo il riconoscimento di aggregazioni intermedie, al cui interno ricercare integrazione del sistema dei servizi, identità e appartenenze di area. Per attivare una politica di riqualificazione a livello urbano e territoriale, risulta fondamentale seguire forme di coordinamento tra i vari livelli di pianificazione. Particolare attenzione viene posta al problema della mobilità che richiede strategie particolari non solo del traffico quale effetto indotto, ma anche delle cause che lo producono, con riferimento specifico alla distribuzione sul territorio delle diverse attività, ad un corretto equilibrio tra insediamenti residenziali, produttivi e terziari. È necessario, dunque, individuare strumenti e procedure, capaci di perseguire un equilibrio dinamico tra i flussi attratti dalle attività insediate e i flussi “sostenibili” dalle infrastrutture di trasporto

  6. A lógica dominante do serviço em marketing : um novo paradigma?

    Directory of Open Access Journals (Sweden)

    Clara Isabel Koetz

    2012-01-01

    Full Text Available As diversas mudanças que vêm ocorrendo na disciplina de marketing têm sidoconsideradas, por diversos estudiosos da área, como um novo paradigma. Vargo eLusch (2004 apontam a emergência de uma nova lógica, cuja ênfase está nosaspectos intangíveis, como habilidades, informação e conhecimento e nainteratividade e conectividade dos relacionamentos, o qual poderia vir a substituir omodelo tradicional. O objetivo deste ensaio teórico é propor uma reflexão acerca daService Dominant Logic (SDL, proposta por Vargo e Lusch (2004, a fim deidentificar se, de fato, ela pode ser considerada um novo paradigma em marketing.Para tal, é realizado um exame do desenvolvimento teórico da disciplina, bem comoda estrutura teórica proposta pelos autores, com base na perspectiva filosóficocientíficae no conceito de paradigma de Kuhn (2006. A análise demonstra que omarketing evoluiu, por um lado, orientado pelas alterações impostas pelo ambiente;por outro lado, por meio de discussões teóricas que permitiram o avanço dadisciplina. Não houve, ao logo deste processo, nem mesmo com a lógica dominantedos serviços, uma ruptura drástica que possa ser considerada uma troca deparadigmas.Abstract The various changes that have happened within the marketing discipline havebeen considered by several scholars of the area as a new paradigm. Vargo andLusch (2004 suggest the emergence of a new model, whose emphasis is onintangible aspects such as skills, information and knowledge, as well as in theinteractivity and connectivity of the relationships, which could replace the traditionalparadigm. This article aims to discuss the Service Dominant Logic (SDL inmarketing, proposed by Vargo and Lusch (2004, aiming to identify if, in fact, thismodel can be considered a new paradigm in marketing. In order to do that, weconducted a review of the theoretical developments in marketing, and an exam of theauthors’ theoretical structure, considering Kuhn’s (2006 concept

  7. European analytical column No. 36 from the Division of Analytical Chemistry (DAC) of the European Association for Chemical and Molecular Sciences (EuCheMS)

    DEFF Research Database (Denmark)

    Karlberg, Bo; Emons, Hendrik; Andersen, Jens Enevold Thaulov

    2008-01-01

    European analytical column no. 36 from the division of analytical chemistry (DAC) of the European association for chemical and molecular sciences (EuCheMS)......European analytical column no. 36 from the division of analytical chemistry (DAC) of the European association for chemical and molecular sciences (EuCheMS)...

  8. How to Improve Students' Comprehension Concerning the Major Terms of Functional Groups?--In the Experiment of OrCheTaboo Game

    Science.gov (United States)

    Akkuzu, Nalan; Uyulgan, Melis Arzu

    2016-01-01

    In this research, for an effective learning of concepts in the scope of functional groups in organic chemistry, it has been developed as "Organic Chemistry Taboo (OrCheTaboo)" which is an educational activity by the researchers. The aim of this study is to analyze the effect of the game OrCheTaboo on learning of concepts related to…

  9. Travel as a Ritual toward Transformative Consciousness: Juxtaposing Che Guevara's Biography and Teacher Candidates' Narratives

    Science.gov (United States)

    Lea, YiShan

    2013-01-01

    This article discusses the development of critical consciousness by examining the biographical-narratives in relationship to the experiential accounts on travel. Biographical narratives are important cultural texts filled with history and cultural nuances. The biography of Ernesto Che Guevara has resonated with readers and viewers from around the…

  10. Responsabilidad social empresarial percibida desde una perspectiva sostenicéntrica, y su influencia en la reputación de la empresa y en el comportamiento del turista.

    OpenAIRE

    Alvarado Herrera, Alejandro

    2008-01-01

    RESUMEN El objetivo principal de esta tesis doctoral es estudiar la responsabilidad social empresarial (RSE) o corporativa percibida por el turista y sus dimensiones desde la perspectiva del paradigma del desarrollo sostenible, es decir, sus dimensiones económica, social y medioambiental, así como sus influencia, directas e indirectas, sobre la reputación de la empresa, las dimensiones cognitiva y afectiva de las actitudes del turista hacia la marca y las intenciones de compra y recomendac...

  11. Vorrei ma non posso. L'esperienza del non realizzato nella pratica artistica contemporanea. Un'intervista con Luca Trevisani

    Directory of Open Access Journals (Sweden)

    Valentina Rossi

    2014-12-01

    Full Text Available Le domande in questa intervista seguono e riprendono l’intervento di Luca Trevisani al convegno tenutosi nel novembre del 2013 presso il Museo del Novecento di Milano. Trevisani era stato invitato per “rappresentare” una nuova generazione di artisti, che, nati tra gli anni Settanta e i primi anni Ottanta si sono trovati ad operare proprio all’inizio del nuovo millennio.

  12. La teoria del ciclo vitale del risparmio di Modigliani cinquant’anni dopo

    Directory of Open Access Journals (Sweden)

    Mauro Baranzini

    2012-04-01

    Full Text Available In the early 50s Franco Modigliani and Richard Brumberg and Albert Ando, ​​formulated the life-cycle theory of consumption and saving, which has been a huge success and undisputed for at least three decades. However, since the early 80s the life-cycle theory has been criticized in an increasingly tight for at least four reasons. The first is the existence of a significant intergenerational transmission of wealth, due to factors exogenous to the model of the life cycle. The second reason is the increasing evidence that the rich continue to save a greater extent than the less fortunate, as, in fact, Keynes argued. The third reason is that there is increasing evidence, at least in Western Europe and Japan, young families, during twenty and thirty years of age, save a positive and growing share of their income, which arises in decided contrast to the original version of the life-cycle theory. Finally, a number of empirical studies have found that retirees dismiss a high proportion of their income. This requires a serious rethinking of the approach of the life-cycle theory, which affects both the economic analysis and economic policy. Nei primi anni ’50 Franco Modigliani, insieme a Richard Brumberg e ad Albert Ando, formulò la teoria del ciclo vitale del consumo e del risparmio, che ha riscosso un enorme e indiscusso successo per almeno tre decenni. Tuttavia, a partire dai primi anni ’80 la teoria del ciclo vitale è stata criticata in modo sempre più serrato, per almeno quattro ragioni. La prima consiste nell’esistenza di una significativa trasmissione intergenerazionale della ricchezza, da ricondurre a cause esogene al modello del ciclo vitale. La seconda ragione è rappresentata dalla crescente evidenza che i ricchi continuano a risparmiare in misura maggiore rispetto ai meno fortunati, come, in effetti, Keynes sosteneva. Il terzo motivo è che vi sono prove sempre più evidenti, almeno nell’Europa occidentale e in Giappone

  13. Verso la Rete Ciclabile del Mediterraneo. Il progetto CYRONMED

    Directory of Open Access Journals (Sweden)

    Raffaele Sforza

    2008-12-01

    Full Text Available Le reti ciclabili di breve, media e lunga percorrenza sono infrastrutture necessarie per favorire e diffondere l’uso, in condizioni di sicurezza, della bicicletta come mezzo di trasporto ordinario e non eccezionale, da scegliere per gli spostamenti brevi abituali e per il tempo libero. Quale mezzo migliore che la bici negli spostamenti casa-scuola, casa-lavoro? Le regioni del Sud Europa, come noto, scontano un grande ritardo culturale prima che infrastrutturale rispetto alla mobilità scolastica, lavorativa e turistica in bicicletta. Tutto ciò, nonostante le città scoppino di traffico e i ghiacciai si sciolgano per il surriscaldamento del pianeta dovuto alle emissioni di CO2. Per cercare di invertire la rotta, la Regione Puglia ha attivato e coordinato un partenariato internazionale composto, oltre che dallo stesso Ente anche dalle Regioni Campania, Calabria e Basilicata, delle Municipalità greche di Atene e Karditsa, dell’Ente del Turismo di Cipro e del Ministero dello Sviluppo Urbano di Malta, e ha concorso all’assegnazione di fondi del Programma Interreg IIIB Archimed (Arcipelago Mediterraneo messi a disposizione dal Ministero greco dell’Economia sulla Misura “Sviluppo di sistemi di trasporto efficaci e sostenibili”. L’obiettivo? Avviare il processo di pianificazione delle reti ciclabili a partire da uno studio di fattibilità degli itinerari ciclabili di media-lunga percorrenza delle retiEuroVelo® e Bicitalia® che attraversano i territori interessati. Tali itinerari di carattere transregionale e transnazionale, integrati con reti ciclabili locali e sovracomunali individuate all’interno delle aree vaste, possono contribuire a costruire quella necessaria rete di ciclovie per invogliare non più semplici appassionati della bicicletta, ma persone di tutte le età a muoversi sempre meno in auto e sempre più in bicicletta.

  14. Antropologia e finanzcapitalismo. Note a margine del dopo Brexit

    Directory of Open Access Journals (Sweden)

    Cristina Papa

    2016-08-01

    Full Text Available Questo articolo intende portare l’attenzione su una letteratura prevalentemente antropologica che si interroga sull’influenza del mondo della finanza sulle nostre vite quotidiane e sulla vita delle imprese. Si tratta di una letteratura poco presente nel dibattito antropologico in Italia ma l’ennesima crisi del dopo Brexit ci invita a considerare con più attenzione i nessi che a partire dalla finanza non solo attraversano settori economici differenti ma si allargano anche alla realtà sociale e culturale. L’etnografia della finanza, di cui si dà conto, e che si è sviluppata a partire dagli anni Novanta, evidenzia molteplici aspetti di questo mondo dalle forme di vita flessibili e competitive degli agenti di borsa, alla loro identità sociale, alla decostruzione dell’ideologia dell’infallibilità e razionalità delle pratiche finanziarie fino alla trasposizione ed estensione di queste pratiche e modelli all’economia reale delle imprese e alla diffusa e obbligata precarietà del lavoro non solo nei paesi più poveri. L’obiettivo è quello di suggerire linee di ricerca etnografica capaci di attraversare tradizionali partizioni del sapere antropologico con una finalità di analisi critica a partire dalla rilettura di nuove forme di disuguaglianza e di nuove contraddizioni.

  15. Pci e migrazioni interne nella Torino del “miracolo”

    OpenAIRE

    Michelangela Di Giacomo

    2015-01-01

    L’articolo si prefigge lo scopo di descrivere i mutamenti dell’elaborazione teorica e dell’azione politica del Pci nei confronti del fenomeno delle migrazioni interne degli anni ’60. Il punto di vista è la Torino capitale dell’automobile, in cui l’afflusso di grandi masse di nuova popolazione di origine meridionale impose trasformazioni del tessuto sociale, economico e urbanistico della città, obbligando tutti i soggetti politici a confrontarsi con quei mutamenti. La tesi che vi si sostiene è...

  16. Il calcolo del premio assicurativo per gli eventi catastrofali

    OpenAIRE

    Aversa, Monica

    2010-01-01

    Tra i problemi che pone la Matematica Attuariale ha un rilievo non indifferente la questione del calcolo del premio, ovvero il prezzo da far pagare all’assicurato per garantirgli la copertura assicurativa. Nella presente tesi si esaminano i più moderni principi di calcolo del premio per le assicurazioni danni, in particolare si considerano i rischi catastrofali e si utilizza come modello per il rischio “il danno cumulato” ovvero la variabile casuale S=X1+X2+…..+XN, con Xi≥0 variabili casuali ...

  17. Narrazioni di narrazioni: orientamento narrativo e progetto di vita (Federico Batini, Gabriel Del Sarto

    Directory of Open Access Journals (Sweden)

    Manuela Ladogana

    2007-03-01

    Full Text Available Il volume, denso di contenuti e ricco di riferimenti teorici, traccia con chiarezza le sue linee di sviluppo ed apre alla riflessione, anche pedagogica, sull’esigenza di recuperare la dimensione narrativa e autobiografica per la realizzazione di una pratica orientativa che guidi e sostenga il soggetto in orientamento verso la riscoperta e ricostruzione del proprio progetto di vita.

  18. La fine dei cieli di cristallo l’astronomia al bivio del '600

    CERN Document Server

    Buonanno, Roberto

    2010-01-01

    Questo libro parla del rapporto fra Galileo e alcuni scienziati della sua epoca comunemente considerati come esponenti dello "schieramento avverso". È l’epoca in cui la visione del cosmo cambia radicalmente: la cultura europea non appare più al centro della storia umana, la creazione dell’uomo si sposta all’indietro di una inimmaginabile quantità di anni e, infine, i cieli immutabili della cosmologia aristotelica, i cieli di cristallo, vengono definitivamente superati. L’Autore propone alcuni temi rilevanti per la scienza del ‘600 e sviluppa, all’interno di ogni capitolo, sia il punto di vista dello scienziato pisano che quello di un erudito della cultura barocca. Emerge così un quadro nel quale si comprendono le ragioni e i percorsi di coloro che, davanti allo sconvolgimento di una visione del mondo che era sopravvissuta duemila anni, cercano nelle Sacre Scritture una specie di autorizzazione a credere nelle scoperte di quegli anni. Athanasius Kircher, un gesuita tedesco che arriva a Roma nel...

  19. La vita è blending. Per una lettura integrata del film di Roberto Benigni

    Directory of Open Access Journals (Sweden)

    Emanuele Broccio

    2014-05-01

    Full Text Available Il notevole incremento di studi critici sulla Poetica Cognitiva sta riscattandola dall’accusa di offrire soltanto una nuova e seducente terminologia, guadagnandole invece la dignità di metodologia scientifica.Mosso dall’interesse che il fenomeno della integrazione concettuale (blending suscita, il mio intervento propone una lettura del film La vita è bella di Roberto Benigni proprio in funzione del suo organizzarsi intorno a un blending che ne sostiene l’intero impianto ideativo. Il film è stato molto criticato, oltre che per un certo impaccio tecnico nella messa in scena, per il fatto di condurre un racconto di morte e sterminio attraverso un punto di vista comico. Attraverso l’applicazione del blending, insieme ad altri strumenti di analisi classica, cercherò di dimostrare come la strutturazione del racconto intorno alla duplice contaminazione di realtà e fantasia, comico e tragico, lo sottrae dal rischio di scivolare nel melodramma e nel patetismo, mantenendo alta l’empatia dello spettatore.La mia lettura sottolinea dunque come tutto il film sia costruito su un continuo blending, e ne evidenzia le modalità di realizzazione, dimostrando, attraverso un’opera ampiamente nota e di vasto consenso, come le scienze cognitive possano offrire validi strumenti di analisi che precisano pregresse intuizioni critiche e illuminano zone dell’opera d’arte rimaste in ombra o confinate alla valutazione estetica.

  20. Le città del Jabal Nafusah Libico: strutture insediative e spazi abitativi.

    Directory of Open Access Journals (Sweden)

    Beniamino Polimeni

    2010-12-01

    Full Text Available L’interesse verso la zona del Jabal Nafusah, nella Libia nord occidentale, nasce dalla volontà di studiare un sistema di insediamenti e di trasformazioni del paesaggio che per caratteristiche ed esiti formali rappresentano un unicum all’interno del Maghreb. Il lavoro presentato, diviso in quattro sezioni, si propone come un possibile metodo di lettura delle forme urbane e delle architetture che le hanno generate, attraverso lo studio delle tre città berbere di Nalut, Cabao, Ulad Mahmud. Tre casi di studio significativi analizzati mediante gli strumenti del disegno e dell’analisi grafica con lo scopo di comprenderne l’organizzazione logica delle configurazioni e verificarne la continuità territoriale. L’obiettivo è quello di creare una sequenza storico/analitica che partendo dagli oggetti architettonici più minuti, i più vicini alla scala umana per struttura e dimensione, proceda fino all’estensione urbana e territoriale. Un metodo di analisi induttivo che seppur limitato ad una porzione circoscritta dà vita ad un valido processo di interpretazione formale.

  1. O novo paradigma da violência The new paradigm of violence

    Directory of Open Access Journals (Sweden)

    Michel Wieviorka

    1997-05-01

    Full Text Available O autor procura redimensionar o conceito de violência dentro do atual estado de globalização mundial. Crise internacional, narcotráfico, derrocada do bloco socialista no leste europeu, políticas assistenciais de organismos internacionais, conceitos de desenvolvimento e de subdesenvolvimento, terrorismo, sectarismo político e religioso, novas conceituações culturais e sociais são temas trabalhados pelo autor com vistas ao estabelecimento de um novo paradigma da violência.The author tries to requalify the concept of violence under the influences of a context of world globalization. International crisis, drug traffic, collapse of the socialist governments, concepts of development and under-development, terrorism, political and religious sectarisms, new culture and social conceptualizations, these are some of the themes which are discussed by the author with the objective to propose a new pardigm for violence.

  2. Criteri e metodi per l’adeguamento prestazionale del patrimonio architettonico degli anni trenta del Novecento. La Facoltà di Ingegneria di Bologna

    Directory of Open Access Journals (Sweden)

    Riccardo Gulli

    2012-12-01

    Full Text Available La riflessione su criteri e metodi idonei per il recupero del patrimonio architettonico esistente richiede di incentrare la tematica su azioni che sappiano coniugare l’istanza storica ed estetica con quella dell’innovazione tecnologica; il presente contributo intende mostrare come l’integrazione di componenti impiantistici ed edilizi, unitamente all’adozione di sistemi domotici di controllo e gestione del comfort interno, possa favorire l’adeguamento agli standard attuali pur preservando i caratteri originari.

  3. Tutela del sovraindebitamento incolpevole (L. 3/2012 o sanzione per omessa verifica del merito creditizio (art. 124 TUB? Il “piano del consumatore” in funzione punitiva

    Directory of Open Access Journals (Sweden)

    LARA MODICA

    2014-09-01

    Full Text Available Dopo il provvedimento apripista del giudice pistoiese (commentato pochi mesi fa da Enza Pellecchia in questa rivista, le omologazioni del “piano del consumatore” sovraindebitato cominciano a moltiplicarsi: ancora il Trib Pistoia 8 gennaio 2014 e poi Trib. Ascoli Piceno 4 aprile 2014, Trib. Catania 24 giugno 2014 e Trib Catania 17 giugno 2014 concedono i “benefici” di cui agli artt. 7 ss. della legge 3/2012 a famiglie finanziariamente vulnerabili, sulla scorta del comune presupposto della non colpevolezza del default. Al di là delle differenti vicende da cui scaturiscono, le decisioni citate confermano tutte, più o meno marcatamente, l’impressione a caldo che avevamo tratto già all’indomani della tormentata approvazione della l. n. 3, e cioè che il congegno esdebitatorio di nuovo conio fosse destinato inevitabilmente a caricarsi di un ruolo di supplenza della scarna ed inefficace disciplina in materia di prevenzione del sovraindebitamento, sub specie di doveri informativi e verifica del merito creditizio (artt. 124 ss. t.u.b., offrendosi quale sede elettiva per reagire ex post alla condotta scorretta o anche solo disinvolta dei finanziatori professionali.

  4. Seguimiento de dependientes del alcohol y/o de la cocaina despues de su salida de una Comunidad Terapeutica: estudio piloto

    OpenAIRE

    López-Fernández, Olatz; Ferrer Pérez, Xavier; Lafarga-Lebey, S.; Honrubia Serrano, Ma. Luisa; Tudela-Marí, M.

    2011-01-01

    Introducción Los avances en farmacoterapia del alcoholismo podrían propiciar un cambio de paradigma, basado en los nuevos programas de reducción del consumo de alcohol. Material y Método Este estudio revisa los fundamentos neurobiológicos y farmacoterapéuticos del alcoholismo, centrándose en los antagonistas opioides, el tratamiento orientado a la abstinencia y el orientado hacia la reducción del consumo de alcohol. Resultados 1. Los programas de tratamiento de la dependencia del alcohol pres...

  5. Cooperación jurídica internacional en materia de donación y trasplante de organos: hacia un nuevo paradigma

    Directory of Open Access Journals (Sweden)

    Joaquín Cayón de las CUEVAS

    2013-04-01

    Full Text Available RESUMEN El trasplante de órganos puede contribuir decisivamente no sólo a salvar vidas sino también a mejorar la calidad de las mismas. Sin embargo, el problema fundamental al que se enfrenta este tipo de terapias es la desproporción entre la oferta y la demanda. El número de donantes es, por definición, muy limitado y la donación puede no resultar posible por motivos diversos tales como la falta de autorización familiar o la ausencia de condiciones necesarias. Así las cosas, la dificultad en el acceso a las terapias de trasplante constituye el reflejo de una de las desigualdades en salud. Por otra parte, la escasez de órganos hace pervivir el indeseable fenómeno de la comercialización internacional. Resulta evidente que el problema de la insuficiencia de donantes afecta a toda la comunidad trasplantadora internacional dado que las necesidades de trasplantes son equivalentes en las diferentes regiones del mundo. En este sentido, el futuro pasa por propiciar una progresiva integración de las políticas públicas en materia de donación y trasplantes de órganos, superando el actual estadio de cooperación intergubernamental, loable pero insuficiente, para adentrarnos gradualmente en un nuevo paradigma de coordinación internacional de ámbito regional, condicionado a la previa armonización de la legislación de las naciones afectadas, que permita cifras homologables de donantes. Este nuevo paradigma de coordinación debe instrumentar mecanismos de prevención del fenómeno del turismo de trasplantes pero también facilitar y potenciar el intercambio internacional de órganos, removiendo desigualdades en el acceso al tratamiento trasplantador. RESUMO O transplante de órgãos pode ser valiosa não só para salvar vidas, mas também para melhorar a qualidade dos pacientes. No entanto, o problema fundamental dessas terapias é o desequilíbrio entre oferta e demanda. O número de doadores é muito limitado e a doação pode não ser

  6. Principia iuris: una teoría del Derecho no (neo)constitucionalista para el Estado constitucional

    OpenAIRE

    Prieto Sanchís, Luis

    2008-01-01

    La teoría del Derecho de Principia iuris asume el nuevo paradigma del Estado constitucional de Derecho y está especialmente diseñada para dar minuciosa cuenta del mismo. Sin embargo, se distancia de las construcciones más usuales del neoconstitucionalismo en dos aspectos capitales, que aquí son objeto de análisis. En el aspecto metodológico o conceptual, se mantiene firmemente la perspectiva ilustrada y positivista de la separación conceptual entre Derecho y moral, frente a las actuales revis...

  7. Una revisión del debate sobre las mujeres y la teoría moral

    OpenAIRE

    BENHABIB, Seyla

    1992-01-01

    Not available.

    La autora del artículo vuelve sobre el debate abierto en tomo a las implicaciones de los conocidos trabajos de Carel Gilligan para la presunta universalidad y pertinencia del llamado «paradigma de KohIberg » del desarrollo moral. Considera que, desde el punto de vista de la teoría feminista, no deben interpretarse los trabajos empíricos de Gilligan en el sentido de la propuesta de una «ética femenina del cuidado» como alternativa a la orientación universalist...

  8. Indagine preliminare sull'applicazione del metodo ermeneutico - fenomenologico alla process research

    Directory of Open Access Journals (Sweden)

    N. Allegri

    2012-09-01

    Full Text Available Secondo Di Nuovo (2007, affinché la psicoterapia possa definirsi sperimentalmente convalidabile occorre che si avvalga, per la verifica delle proprie ipotesi, della triplice procedura adottata dalle scienze naturali, che ottenga cioè una convalida logica, una convalida pragmatica e una convalida esplicativa. La convalida logica pertiene alla coerenza tra teoria psicopatologica, obiettivi terapeutici e tecniche di intervento, e ha lo scopo di acquisire una concordanza tra le nuove conoscenze e il corpus teorico che né è matrice. La convalida pragmatica concorre alla verifica degli effetti: una strategia d’intervento è valutata secondo criteri di efficacia e di utilità. Questo approccio è definito in letteratura “outcome research” in quanto fondato sulla valutazione del risultato per mezzo di confronti pre e post-terapia ed eventuali follow up (Migone, 1996. La convalida esplicativa pertiene invece all’ambito della “process research” che considera il processo terapeutico nel suo incedere: è l’evolversi del cambiamento del paziente a essere posto a tema dell’indagine attraverso momenti di assessment periodici (Di Nuovo, 2007; Migone, 1996. Questo tipo di approccio è finalizzato a fornire il senso di ciò che accade in terapia definendo, al di là dell’esito, perché il trattamento funziona o meno. Il “cambiamento” può essere valutato secondo modalità essenzialmente quantitative, qualitative o attraverso una procedura mista. La valutazione quantitativa, sostanziando l’effetto esperienziale della terapia in misurazioni psicometriche, prescinde però perlopiù dal «Chi» del paziente (e del terapeuta; coglie il “quanto” ma non il “come” del processo terapeutico (Liccione, 2011; Liccione, 2012; Allegri et al., 2011; Petesi et al., 2011. L’alternativa qualitativa, invece, attraverso metodologie come l’analisi del discorso e l’analisi narrativa intende cogliere il senso del processo clinico, con specifico

  9. La geografía y las distintas acepciones del espacio geográfico

    OpenAIRE

    Pillet Capdepón, Félix

    2004-01-01

    Con la incorporación de la geografía como ciencia social desde mediados del siglo XX, el estudio del espacio regional o concreto dio paso a distintas acepciones del espacio geográfico (abstracto, subjetivo y social) de la mano de diversos paradigmas, para concluir con el acercamiento de unas corrientes de pensamiento con otras, con un eclecticismo científico preocupado por el actual espacio local globalizado. After the acknowledgement of geography as a social science since the middle of...

  10. Crisis y transformaciones del trabajo en el nuevo modelo de acumulación

    OpenAIRE

    Zerda-Sarmiento, Álvaro

    2013-01-01

    La crisis generalizada y estructural por la que atraviesa el capitalismo mundial es la manifestación de las dificultades del modelo de acumulación que se comenzó a perfilar desde la década del 70 en los países desarrollados y que busca reacomodarse sobre la base de los planteamientos neoliberales y un nuevo paradigma tecno económico.  El nuevo patrón de acumulación ha tenido profundos impactos en el mundo del trabajo, que se manifiestan en todos los componentes de las relaciones laborales. En...

  11. La pluralidad en las estrategias del desarrollo internacional. Límites y posibilidades.

    OpenAIRE

    Karla Ambrosio Torres

    2005-01-01

    El presente trabajo, tiene como objetivo principal el dar cuenta del despliegue histórico del concepto de desarrollo y las implicaciones socioculturales relacionadas con las representaciones ideológicas y simbólicas que caracterizan a la modernidad, a partir de una mirada crítica. Para ello propone ver al paradigma de la modernidad como el resultado de un proceso histórico, el cuál puede ser identificado a partir de tres momentos específicos, el periodo del 1400, caracterizado por la expansió...

  12. Structural studies of conformational changes of proteins upon phosphorylation: Structures of activated CheY, CheY-N16-FliM complex, and AAA {sup +} ATPase domain of NtrC1 in both inactive and active states

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Seok-Yong

    2003-04-10

    Protein phosphorylation is a general mechanism for signal transduction as well as regulation of cellular function. Unlike phosphorylation in eukaryotic systems that uses Ser/Thr for the sites of modification, two-component signal transduction systems, which are prevalent in bacteria, archea, and lower eukaryotes, use an aspartate as the site of phosphorylation. Two-component systems comprise a histidine kinase and a receiver domain. The conformational change of the receiver domain upon phosphorylation leads to signal transfer to the downstream target, a process that had not been understood well at the molecular level. The transient nature of the phospho-Asp bond had made structural studies difficult. The discovery of an excellent analogue for acylphosphate, BeF{sub 3}{sup -}, enabled structural study of activated receiver domains. The structure of activated Chemotaxis protein Y (CheY) was determined both by NMR spectroscopy and X-ray crystallography. These structures revealed the molecular basis of the conformational change that is coupled to phosphorylation. Phosphorylation of the conserved Asp residue in the active site allows hydrogen bonding of the T87 O{gamma} to phospho-aspartate, which in turn leads to the rotation of Y106 into the ''in'' position (termed Y-T coupling). The structure of activated CheY complexed with the 16 N-terminal residues of FliM (N16-FliM), its target, was also determined by X-ray crystallography and confirmed the proposed mechanism of activation (Y-T coupling). First, N16-FliM binds to the region on CheY that undergoes a significant conformational change. Second, the ''in'' position of Y106 presents a better binding surface for FliM because the sidechain of Y106 in the inactive form of CheY (''out'' position) sterically interferes with binding of N16-FliM. In addition to confirmation of Y-T coupling, the structure of the activated CheY-N16-FliM complex suggested that the N16

  13. Testimonianze di vittime degli anni di piombo

    DEFF Research Database (Denmark)

    Cecchini, Leonardo

    Testimonianze di vittime degli anni di piombo In un articolo pubblicato nel 2008 sulla webzine Nazione indiana Christian Raimo criticava quello che poi Giovanni De Luna qualche anno dopo nel suo libro La Repubblica del dolore (2011) ha chiamato “paradigma vittimario”; cioè la presenza predominante...

  14. Approccio multifunzionale alla pianificazione forestale comprensoriale: sperimentazione metodologica di approfondimento sulla funzione protettiva del bosco

    OpenAIRE

    Cimini, Dora

    2013-01-01

    In Italia la situazione attuale degli strumenti di gestione e pianificazione forestale è caratterizzata da diversi livelli di scala. In questo studio è trattato il livello di pianificazione intermedio che corrispondente alla scala sub-regionale (territoriale) attraverso l’elaborazione del Piano Forestale d’Indirizzo Territoriale della Comunità Montana Cadore Longarone Zoldo. La prima parte del lavoro illustra la proposta metodologica multicriteriale per l’attribuzione di una funzione preminen...

  15. Le proposte del PIUSS per Massa. Un'idea di città

    OpenAIRE

    F. Alberti; P.B. Giorgieri

    2009-01-01

    Contributo pubblicato nella monografia n. 2/2009 della collana Architetture città e territorio dedicata alle trasformazioni urbane in Toscana riguardante le strategie del Piano urbano integrato per lo sviluppo sostenibile (PIUSS) di Massa, elaborato da S. Viviani, P. Giorgieri e F. Alberti per conto del Comune di Massa, che nel 2010 è stato presentato alla Regione Toscana e ammesso ai finanziamenti dei fondi strutturali europei (FESR). Nel testo si sintetizzano le principali strategie, consis...

  16. Il recupero dell'area "ex C.A.T." e del "Pomario Ducale"

    OpenAIRE

    P.B. Giorgieri; F. Alberti

    2009-01-01

    Contributo pubblicato nella monografia n. 2/2009 della collana Architetture città e territorio dedicata alle trasformazioni urbane in Toscana riguardante le strategie del Piano urbano integrato per lo sviluppo sostenibile (PIUSS) di Massa, elaborato da S. Viviani, P. Giorgieri e F. Alberti per conto del Comune di Massa, che nel 2010 è stato presentato alla Regione Toscana e ammesso ai finanziamenti dei fondi strutturali europei (FESR). Nel testo viene descritto il progetto per la realizzazion...

  17. Verso un vaccino autoadiuvante multivalente contro il virus del papilloma umano

    OpenAIRE

    Canali, Elena

    2011-01-01

    La scoperta che l’infezione persistente da tipi oncogeni del virus del papilloma umano (HPV) è causa necessaria per l’insorgenza di neoplasia cervicale ha guidato lo sviluppo di strategie di prevenzione primaria. Nonostante la dimostrata efficacia dei vaccini attualmente in commercio contro infezioni dai sierotipi più comuni di HPV, la limitata multivalenza contro tipi virali non inclusi nelle formulazioni, l’elevato costo di ciascuna dose e la necessità di personale paramedico per la sommini...

  18. Presentazione fotografica dell'installazione dimostrativa del Laboratorio di Domotica ISTI-CNR

    OpenAIRE

    Russo, Dario; Pillitteri, Loredana

    2014-01-01

    Presentazione FOTOGRAFICA dell'installazione dimostrativa del laboratorio di domotica ISTI-CNR (versione rivisitata ed ampliata del report Presentazione Laboratorio di Domotica ISTI-CNR, 2013-TR-011). Installazione che propone alcune soluzioni domotiche; vengono riprodotte, ovvero simulate, ambientazioni domestiche (ingresso, cucina, soggiorno, bagno, camera da letto) cui sono applicate una serie di soluzioni di automazione orientate al miglioramento della qualit? della vita degli ipotetici o...

  19. Il "Sogno" di un collezionista del Seicento napoletano. Maurizio Di Gregorio tra riscrittura e plagio

    OpenAIRE

    Daniela Caracciolo

    2011-01-01

    Nel 1614 escono a Napoli il Sogno e il Rosario delle stampe de tutti i poeti e poetesse antichi e moderni di numero 500 del domenicano e accademico ozioso Maurizio Di Gregorio. Il saggio prende in esame le strategie di riscrittura che sorreggono per intero la struttura dell'opera dove i testi di autori più o meno contemporanei (Tommaso Garzoni, Giovan Battista Rinaldi) sono sottoposti a un intenso lavoro di aggiornamento. L'analisi si concentra in particolar modo sui prelievi che nel Sogno ve...

  20. Integrazione dei dati di contesto nel modello matematico che utilizza le librerie DEVS

    OpenAIRE

    Capocchi, Laurent; Santucci, Jean François

    2013-01-01

    Le attività svolte nell’ambito dell’Azione 7.1.3 (cfr. documento “7.1.3_report_RAS”) hannoevidenziato la necessità di elaborare, per il Bacino del Rio San Gerolamo, i dati relativi allasuddivisione in sottobacini omogenei per comportamento idraulico, e i valori dei tempi dicorrivazione relativi a ciascuno di questi sottobacini.Tali dati sono infatti necessari per la calibrazione del modello matematico di simulazione delcomportamento idraulico di un bacino idrografico sul caso reale del bacino...