WorldWideScience

Sample records for che crescono nel

  1. nel cinema italiano contemporaneo

    African Journals Online (AJOL)

    italiano come era rappresentato nel cinema italiano del passato, per esempio in Rocco e i suoi ..... parole che Michele rivolge a Ioan ad un certo punto del film, “Si può .... temporaneo equilibrio e supporto in una inusuale relazione che va.

  2. Louis Blajan, Dottore in Medicina Veterinaria: Il dinamico veterinario che seppe traghettare l’Organizzazione Mondiale per la Sanità Animale (Office International des Épizooties: OIE nel mondo moderno

    Directory of Open Access Journals (Sweden)

    Anon.

    2010-03-01

    Full Text Available Nato il 10 aprile 1924 a Lahage (nell’Alta Garonna, in Francia, Louis Blajan si è spento lo scorso 10 febbraio 2010 a Mont-de-Marsan.Dopo aver frequentato il Lycée Pierre de Fermat di Tolosa, nel 1948 Louis completa gli studi presso la Scuola di Veterinaria di Tolosa. Nel 1949, si diploma all’Institut d’élevage et de médecine vétérinaire des pays tropicaux (IEMVT e dal 1949 al 1952 è nel territorio d’oltremare francese del Mali. Tornato in Francia, dal 1953 al 1968 Louis esercita come veterinario di Stato presso il Ministero dell’Agricoltura, responsabile per l’afta epizootica, la peste suina e la malattia di Newcastle, nonché come Presidente del Comitato consultivo per le malattie infettive. In seguito, viene nominato Ispettore capo veterinario e Responsabile per la politica di controllo delle frontiere.Nel 1952, Louis sposa Janine, moglie affezionata che lo appoggia con ardore in ogni fase della sua carriera e perde la vita in un incidente un mese prima che il marito vada in pensione nel 1990.Dal 1968 al 1977, Louis è Direttore tecnico di Cofranimex (Compagnie Française pour l’importation et l’exportation des animaux reproducteurs et leur semence e dal 1977 al 1978 riveste il ruolo di Direttore dell’Association pour le développement des techniques de l’élevage français (ADETEF.Louis entra a lavorare nell’Office International des Épizooties (oggi noto come Organizzazione Mondiale per la Sanità Animale o ‘OIE’ dove, dal 1978 al 1980, occupa la posizione di Direttore del Dipartimento tecnico. Due anni più tardi, nel 1980, viene eletto Direttore Generale, coronando il sogno di ogni professionista della medicina veterinaria e raggiungendo l’apice della propria carriera. Rieletto nel 1985, si ritira dalla vita lavorativa nel 1990.Durante gli anni in cui fu a capo dell’OIE, Louis seppe trasformare quella che all’epoca era una struttura antiquata in un’organizzazione internazionale moderna ed

  3. Introduzione. Donne che portano la parrucca

    Directory of Open Access Journals (Sweden)

    Claudia Mattalucci-Yılmaz

    2013-07-01

    Full Text Available Peruk takan kadınlar è l’opera che nel 1999 l’artista e cineasta turco Kutlug Ataman ha presentato alla Biennale di Venezia curata da Harald Szeemann. Quattro schermi giustapposti proiettano le testimonianze di donne che, per un periodo della loro vita, hanno portato una parrucca: un’attivista politica di sinistra che nel 1971, dopo il colpo di stato militare, utilizzava un nome in codice, una divisa delle Turkish Airlines e una parrucca per sfuggire al controllo della polizia; una giornalista, colpita da un tumore al seno, che ha portato una parrucca per mascherare gli effetti della chemioterapia; una studentessa musulmana che indossa una parrucca per frequentare l’università, in un contesto – quello turco – che in nome della laicità dello Stato, interdice l’uso nel foulard nelle scuole, nelle università e nella pubblica amministrazione; e infine un transessuale.

  4. Trent'anni che sconvolsero la fisica la storia della teoria dei quanti

    CERN Document Server

    Gamow, George

    1993-01-01

    Gli anni dal 1900 al 1930 hanno portato un profondo mutamento nella visione che l'uomo aveva dell'universo: tra la prima idea di Max Planck dei quanti di luce nel 1900, e la previsione dell'esistenza delle antiparticelle formulata da P. A. M. Dirac nel 1929, corre un periodo di emozionanti progressi nel campo della fisica teorica.

  5. La normativa italiana sui contratti di lavoro a tempo determinato nel settore della scuola è contraria al diritto dell’Unione: la Corte di Giustizia UE apre al risarcimento per i docenti che abbiano svolto supplenze annuali per la copertura di posti vacanti

    Directory of Open Access Journals (Sweden)

    Arando Plaia

    2015-01-01

    Full Text Available La Corte di Giustizia UE con sentenza 26 novembre 2014, cause riunite C-22/13, C-61/13, C-62/13, C-63/13, C-418/13, Mascolo, ha ritenuto che la normativa europea sul lavoro a tempo determinato, applicabile anche al settore pubblico della scuola (casi Rosado Santana, Marrosu Sardino e Adelener, osta ad un sistema di assunzione per svolgere “supplenze annuali” nelle scuole pubbliche che non prevede almeno una delle seguenti “misure di prevenzione”: l’indicazione delle “ragioni oggettive” che giustificano il rinnovo dei contratti; la determinazione della “durata massima totale dei contratti” o del “numero dei loro rinnovi”, in assenza peraltro di una misura sanzionatoria proporzionata, effettiva e dissuasiva, da applicarsi in caso di utilizzo abusivo di successione di contratti a tempo determinato (clausola 5 dell’accordo quadro 18 marzo 1999 allegato dir. 1999/70/CE. Sebbene dunque il settore dell’insegnamento implichi inevitabilmente una certa “flessibilità”, e la normativa europea non enunci un obbligo generale degli Stati membri di prevedere la sanzione della trasformazione dei contratti di lavoro a tempo determinato in contratti a tempo indeterminato (CGUE 3 luglio 2014, Fiamingo, causa C-362/13, la normativa italiana non prevede misure atte a “prevenire” o “sanzionare” l’utilizzo abusivo di successione di contratti a tempo determinato. Questo (e non altro il principio di diritto affermato dalla Corte di giustizia: la sentenza ribadisce l’assenza di misure di prevenzione imposte dalla disciplina europea nonché di una sanzione risarcitoria rispetto al ricorso abusivo ai contratti a tempo determinato nel settore scolastico.

  6. Che Guevara

    DEFF Research Database (Denmark)

    Cristoffanini, Pablo Rolando

    2014-01-01

    made Che Guevara a political, religious and cultural icon and an object of consumption, despite his total political and military failure in Bolivia and his violent death. Finally the article contrasts the meanings of his image in the original context with new research that calls into question...... with the achievements and connotations of the Cuban Revolution in the context of the Cold War. The current meanings of the image must be read in the context of the global consumer culture. The article analyzes and explains how a conjunction of factors such as communication strategies and the connotations of his image...

  7. El humanismo del Che Che's Humanism

    OpenAIRE

    Avelino Fernández Espert; Cristina Fernández Rivero

    2004-01-01

    Los autores, estudiosos de la raigal influencia del pensamiento y la obra del Comandante Dr. Ernesto Guevara de la Serna (Che) en Cuba y América, proyectan la estampa humanista de este revolucionario médico, con el empleo de las más trascendentes pinceladas históricas de un amplia hoja de vida en distintas latitudes del mundo. El Che, joven estudiante, médico graduado con prometedoras dotes que sabe ubicar al ser humano y sus valores por encima de un promisorio futuro como científico y profes...

  8. Book review, Patologie articolari nel cane e nel gatto, Filippo Maria Martini

    Directory of Open Access Journals (Sweden)

    Manuel Graziani

    2008-03-01

    Full Text Available Con il cambiare dei tempi, sono cambiate anche le priorità nell’ambito sempre più vasto degli animali da compagnia. Se, infatti, fino allo scorso decennio chi si occupava di ortopedia veterinaria aveva a che fare esclusivamente con pazienti traumatizzati, ora l’ortopedia e la traumatologia veterinaria devono fare i conti sempre più spesso con le patologie articolari. I motivi di questa inversione di tendenza sono molti e di diverso genere, certamente i più influenti riguardano la diffusione di soggetti atleti che sviluppano specifiche patologie, l’allungamento della vita media che espone i pazienti a malattie articolari degenerative un tempo prerogativa dell’uomo e la presenza di razze canine particolarmente predisposte a tali patologie. A ciò si aggiunga l’esigenza crescente dei proprietari degli animali, di comprendere a fondo quali siano le migliori cure per i propri compagni. Per questi motivi lo specialista in Ortopedia degli animali domestici, Filippo Maria Martini, ha redatto Patologie articolari nel cane e nel gatto: un volume che non vuole essere un manuale sulle tecniche chirurgiche (nonostante al suo interno vengano comunque descritte, piuttosto un manuale pratico in grado da una parte di fornire gli strumenti necessari per comprendere, interpretare e diagnosticare le patologie articolari; dall’altra di dare le basi teoriche per impostare un protocollo terapeutico in modo corretto ed emettere una prognosi adeguata. Tutto ciò nella convinzione che un buon clinico non possa limitarsi ad eseguire una visita e ad impostare una terapia, ma debba necessariamente stilare un elenco di esami utili ai fini della definizione della diagnosi, discuterne con il proprietario e consigliare il più adeguato protocollo diagnostico e terapeutico.

  9. La Pubblica Amministrazione in uno scenario che cambia

    Directory of Open Access Journals (Sweden)

    Renzo Carlucci

    2009-03-01

    Full Text Available Questo numero, mirato alle implicazioni dell'utilizzo del dato territoriale nel contesto delle PA, le Pubbliche Amministrazioni, si arricchisce di un contenuto ulteriore, particolarmente spaziale; GEOmedia esce infatti in coincidenza con una manifestazione che possiamo considerare la vetrina mediterranea privilegiata per la promozione culturale, scientifica e commerciale delle istituzioni e del segmento dell’industria aerospaziale europea ed italiana.

  10. El humanismo del Che Che's Humanism

    Directory of Open Access Journals (Sweden)

    Avelino Fernández Espert

    2004-08-01

    Full Text Available Los autores, estudiosos de la raigal influencia del pensamiento y la obra del Comandante Dr. Ernesto Guevara de la Serna (Che en Cuba y América, proyectan la estampa humanista de este revolucionario médico, con el empleo de las más trascendentes pinceladas históricas de un amplia hoja de vida en distintas latitudes del mundo. El Che, joven estudiante, médico graduado con prometedoras dotes que sabe ubicar al ser humano y sus valores por encima de un promisorio futuro como científico y profesional de la medicina. El artículo dedica atención especial a sus conceptos sobre el hombre, su vida e historia y a su proverbial apego a una ética revolucionaria de elevado calibre. El artículo contribuye al enriquecimiento de los conocimientos sobre el desarrollo histórico del humanismo médico cubano, al proyectarlo en la figura de uno de sus más míticos modelosThe authors, studious of the extraordinary influence of Commandant and Dr. Ernesto Guevara de la Serna 's thought in Cuba and America, unveil the humanist perspective of this revolutionary doctor, through the most transcendental historical events in this man's life in different latitudes of the world. Che, young student, medicine doctor with promising gifts that knew how to place the human being and his values above his promissory future as scientific and medicine professional. The article dedicates special attention to his concepts about men, as well as his life and history and to his proverbial attachment to valuable revolutionary ethics. The article contributes to the enrichment of knowledge on the historical development of Cuban medical humanism, by reflecting this in the figure of one of its most mythical models

  11. Notas sobre el che

    Directory of Open Access Journals (Sweden)

    Virginia Bertolotti

    2010-06-01

    Full Text Available In the present work, I review, in the first place, the bibliography that summarizes the discussion surrounding the etymology of the word che. Then, I analyze the uses of this term in the diachrony as in the synchrony of the Río de la Plata Spanish, which allows me to propose a classification of the uses of the word che in this region. In the third part of the article, I discuss the categorial adscrption of the word che. Finally, the categorial analysis of the diachronic and synchronic empirical evidence allows me to conclude that the vocative uses of the term are a loan from the nominal determinant of the guaraní language, and not a phonic change in the Spanish interjection, thus resolving the etymological issues.

  12. Innovazione nel mobile learning

    Directory of Open Access Journals (Sweden)

    Immaculada Arnedillo-Sànchez

    2008-01-01

    Full Text Available Descrizione, da una prospettiva europea, dell’innovazione nel settore del mobile learning e l’utilizzabilita’ del mobile learning in contesti educativi. Vengono illustrate i principali progetti europei di m-learning e si esamina le prospettive pedagogiche e teoriche relative al campo.

  13. Book review, Principi di video-otoendoscopia nel cane e nel gatto, Giovanni Ghibaudo

    Directory of Open Access Journals (Sweden)

    Manuel Graziani

    2011-12-01

    Full Text Available Per il veterinario libero professionista le malattie auricolari dei cani e dei gatti sono il pane quotidiano, ciò nonostante il loro studio è progredito lentamente anche perché molti veterinari trovavano difficoltà nell’effettuare l’otoscopia e nel riconoscere la patologia otologica. L’avvento del video-otoscopio ha permesso di rilevare le malattie e i cambiamenti dell’orecchio. L'autore ha pertanto sentito la necessità di sviluppare i principi di video-otoendoscopia nel cane e nel gatto e inserirli in un’opera, unica in Italia nel suo genere, basandosi sulla propria esperienza clinica e sul materiale iconografico presente in letteratura. Nell’agile libro ci sono 94 figure video-otoscopiche che fanno comprendere visivamente la normale anatomia e le malattie dell’orecchio. Sono presentati 68 casi in cui è visibile l’immagine dell’orecchio esterno, sempre accompagnata da visioni video-otoscopiche di ciò che sta succedendo nel canale uditivo più in profondità. Nella prima parte del volume viene descritta l’anatomia dell’orecchio esterno e medio, sono fornite le informazioni essenziali per un corretto approccio e per la gestione delle otiti, per la preparazione del paziente e, infine, vengono indicati strumenti e metodiche di video-otoendoscopia. La seconda parte, attraverso immagini endoscopiche, illustra l’aspetto dell’orecchio normale del cane e del gatto. Successivamente, immagini endoscopiche chiare ed esemplificative accompagnano la descrizione delle lesioni presenti in corso di otiti acute, croniche e neoplastiche. Lo stesso schema è stato seguito nell’illustrare l’aspetto normale e alterato della membrana timpanica e dell’orecchio medio. Per ogni causa di otite sono state affiancate, a un testo essenziale d’immediata comprensione, immagini endoscopiche per una collezione iconografica il più possibile completa. Inoltre, Giovanni Ghibaudo fornisce utili consigli per esempio sull’utilizzo di spugne

  14. Immagine e visione performativa nel Medioevo

    Directory of Open Access Journals (Sweden)

    Carla Bino

    2014-12-01

    Full Text Available During the Middle Ages, images had to be tied to the truth. Otherwise, they were considered idols. And the idols are always dangerous and, therefore, banned. So, to be justified, the imago had to be true or really refer to truth. It follows that the images were not considered just objects ‘to see’, but were perceived as almost ‘alive bodies’, real bodies: they could act as if were actually present. This essay studies the image concept in Christian thought, with particular attention to Eastern Europe, in connection to the patristic and conciliar sources. The result is the shift of its ontological meaning: contrary to the mimetic idea of greek-hellenistic culture, the christian image is an ‘impression of similarity’. This conceptual revolution implies change of visualization strategies, which are specifically performative: ‘seeing the icon’ is doing something which involves ‘physically’ the viewer, as if he came into a scene and became an actor.Nel Medioevo le immagini dovevano essere legate alla verità. Altrimenti erano considerate idoli. E gli idoli sono sempre pericolosi e, per questo, vietati. Dunque, per essere legittima l’imago doveva essere vera o davvero rimandare alla verità. Il risultato è che le immagini non erano considerate semplicemente oggetti ‘da guardare’, ma venivano percepite quasi come ‘corpi vivi’ e reali che potevano agire, quasi come se fossero realmente presenti. Il saggio analizza il concetto di immagine all’interno del pensiero cristiano, in particolar modo orientale, riconducendolo alle fonti patristiche e conciliari. Ciò che risulta evidente è lo spostamento del suo significato ontologico che, diversamente dalla concezione mimetica della cultura greco-ellenistica, fa dell’immagine un’‘impressione di somiglianza’. Questa rivoluzione concettuale determina anche il cambiamento delle dinamiche della visione che assume caratteristiche performative: ‘vedere l’icona’

  15. Il lungo freddo storia di Bruno Pontecorvo, lo scienziato che scelse l'URSS

    CERN Document Server

    Mafai, Miriam

    2012-01-01

    Nelle parole della grande giornalista recentemente scomparsa, la documentata narrazione della storia di Bruno Pontecorvo, fisico nucleare di fama mondiale che, nel pieno della Guerra fredda, scelse di abbandonare l'Occidente e di lavorare e vivere nell'Unione Sovietica. Grazie alla capacità della Mafai nel ricostruire gli eventi cruciali della vita di Pontecorvo in un nuovo quadro rivelatore, "Il lungo freddo" non offre solo un'inedita prospettiva sulla drammatica corsa alla bomba atomica - dalle decisive scoperte del Progetto Manhattan alla tragica esplosione di Hiroshima, dalla prima atomica sovietica alla bomba all'idrogeno - ma rappresenta soprattutto la memoria collettiva di una generazione che ha posto la politica al centro delle proprie scelte di vita. E svela i drammi umani di un conflitto che per più di quarant'anni ha diviso il mondo.

  16. All’origine dei differenziali salariali di genere nel settore non profit. il caso delle cooperative sociali italiane

    Directory of Open Access Journals (Sweden)

    Federica D’Isanto

    2013-01-01

    Full Text Available L’elevata quota di lavoratrici nelle organizzazioni non profit potrebbe indurre a rite-nere le cooperative sociali un luogo ideale per la manodopera femminile, proprio perché in questo tipo di istituzioni le donne avrebbero maggiori possibilità di impiego e mag-giori opportunità di accedere a posizioni di potere organizzativo (data la peculiare natu-ra democratica che caratterizzerebbe tali istituzioni. Sebbene l’aumento della parteci-pazione femminile nel mercato del lavoro sociale abbia un impatto positivo sul tasso di crescita dell’economia, è stato dimostrato che la predominanza delle donne nel settore nonprofit non solo non riesce sempre a tradursi in un’attenuazione delle discriminazioni di genere in termini di carriera, retribuzione e accesso a ruoli di comando, ma rischia anche di implicare, tramite la mancata valorizzazione del loro apporto, la svalutazione economica dell’intero settore. I dati, infatti, confermano la presenza di potenti meccani-smi discriminatori rispetto al genere, tanto più sorprendenti quanto più si consideri l’elevata presenza di donne tra i lavoratori di queste organizzazioni.In Italia nel 2007 è emerso che il 74% della forza lavoro nel settore nonprofit era co-stituito da donne.Questo lavoro ha due obiettivi. In primo luogo (e per la prima volta nel contesto ita-liano, si propone di studiare le caratteristiche di questa composizione femminile della forza lavoro, utilizzando la banca dati ICSI 2007 (Indagine Cooperative Sociali Italia-ne; in secondo luogo, di analizzare il rapporto esistente tra differenziali salariale di ge-nere e segregazione.I principali risultati sono che anche nel settore non profit esiste un differenziale sala-riale di genere di circa il 16% in favore degli uomini (dato conforme alla media degli altri paesi europei; che esiste la segregazione femminile (orizzontale e verticale e che questa spiega quasi interamente l’esistenza di questo differenziale salariale.

  17. Dissidenze statali contemporanee. Guerra, internazionalizzazione e sviluppo informale nel Somaliland

    Directory of Open Access Journals (Sweden)

    Luca Ciabarri

    2015-03-01

    Full Text Available Il termine somalizzazione sembra in questo inizio secolo aver completamente sostituito l’espressione balcanizzazione, suo omologo perfetto per i secoli XIX e XX, per alludere ad un rischio a cui molte crisi internazionali (Siria, Libia, Mali, Afghanistan… vi è in effetti un lungo elenco potrebbero tendere: il rischio cioè del precipitare nell’anarchia e nel disordine totale, nella lotta settaria, così rappresentata, senza logica e senza sbocco. L’articolo intende analizzare da un punto di vista etnografico uno specifico paesaggio sociale all’interno di queste aree di crisi, in particolare all’interno dell’area somala, per mettere in luce, piuttosto che la disconnessione e l’eccezionalità di queste zone, le forme della loro connessione con il mondo degli Stati più ampio. Il commercio informale transfrontaliero, e la sovrapposizione tra movimenti di beni, di persone e di denaro, è preso ad esempio in questo studio di caso per mostrare le profonde ambiguità e contraddizioni di queste forme di relazione. Dinamiche regionali che intrecciano percorsi di persone e merci, che alimentano confini reali e ideologici, che avvicinano o allontanano gli attori in campo in forme inattese e che sono irriducibili rispetto a macro discorsi fondati sul pericolo di radicalizzazioni islamiche o violenze settarie sono qui proposte come determinanti decisive per poter comprendere i percorsi verso il conflitto e verso la pace nelle aree contemporanee di dissidenza e vuoto statale.

  18. Paolo Lago, La nave, lo spazio e l’altro. L’eterotopia della nave nella letteratura e nel cinema

    Directory of Open Access Journals (Sweden)

    Marina Guglielmi

    2017-05-01

    Full Text Available L’eterotopia, quando si radica nel progetto critico di uno studioso, può assumere la fisionomia di un “rovello” personale. Lo è stato per Michel Foucault che nel 1966 ha cristallizzato in una definizione e in una prima tassonomia i «luoghi reali fuori da tutti i luoghi» (Utopie, eterotopie, Napoli, Cronopio, 2006: 13, i contro-spazi «che si oppongono a tutti gli altri e sono destinati a cancellarli, a compensarli, a neutralizzarli o a purificarli» (ibid.: 12.

  19. Appropriazioni debite: reti sociali e gerarchie nel consumo locale dell’aiuto umanitario. Il campo rifugiati di Darwanaje-Somaliland

    Directory of Open Access Journals (Sweden)

    Luca Ciabarri

    2013-07-01

    Full Text Available Come altre zone del Corno d’Africa, la regione dell’Awdal è un’area di lunga presenza dell’aiuto umanitario internazionale. È un’area, considerando gli ultimi 30 anni, di emergenza strutturale (Piguet 1998, prodotto di una serie ricorrente di destabilizzazioni politiche e sociali – si pensi alla grande carestia del 1974 che ha colpito l’intera regione, alla guerra dell’Ogaden tra Etiopia e Somalia nel 1977-78 e infine al conflitto civile somalo, cominciato nel Nord nel 1988 ma preceduto da continue tensioni per tutti gli anni Ottanta – a cui hanno fatto seguito interventi esterni d’aiuto.

  20. La natura impervia come strada verso la virtù. La figura di Catone nel IX libro del Bellum civile

    Directory of Open Access Journals (Sweden)

    Vittoria Prencipe

    2016-12-01

    Full Text Available La relazione tra uomo e natura è indagata da svariati punti di vista, oggi come nell’antichità, come si evince dalla breve riflessione sul tema riportata nel primo paragrafo del saggio, che sarà incentrato, per il resto, su una sola delle visioni emerse nella letteratura e nella filosofia greca e latina antica.

  1. La pedofilia, tra stigmatizzazione e prevenzione: uno sguardo nel canton Ticino

    OpenAIRE

    Manetti, Sara; Jaffé, Philip D.

    2014-01-01

    La pedofilia è un disturbo della preferenza sessuale che viene spesso confusa con il comportamento sessuale abusante verso i bambini. Se in determinati casi la pedofilia coincide con degli atti criminali, va precisato che molte persone affette da questo disturbo dimostrano un grande senso di responsabilità e moralità nel decidere di non soddisfare i propri impulsi sessuali in nome del rispetto dell’integrità del bambino. Tuttavia, l’opinione pubblica fatica a differenziare il pedofilo dall’ab...

  2. SYM1, l’ortologo di lievito del gene umano MPV17, codifica per una proteina indotta da stress che modula lo stato bioenergetico e morfogenetico del mitocondrio

    OpenAIRE

    Dallabona, Cristina

    2010-01-01

    Mutazioni nel gene MPV17 causano l’insorgenza di una forma epatocerebrale della sindrome da deplezione del DNA mitocondriale. MPV17 codifica per una piccola proteina idrofobica localizzata nella membrana mitocondriale interna con funzione sconosciuta. Per cercare di chiarire le basi molecolari che causano la patologia, abbiamo utilizzato il lievito S. cerevisiae come organismo modello grazie alla presenza di un ortologo di MPV17: SYM1. Abbiamo dimostrato che la proteina Sym1 è essenziale per ...

  3. IL DUELLO NEL RINASCIMENTO E IL RIPENSAMENTO ETICO SUL DUELLO DI FRANCESCO PATRIZI

    Directory of Open Access Journals (Sweden)

    Fulvio Šuran

    2012-01-01

    Full Text Available In questa prima parte del saggio ci soff ermeremo in modo particolare al periodo che intercorre tra la seconda metà del XV secolo e la prima metà del XVI secolo, in quanto è in questo lasso di tempo che si trovano serie e chiare testimonianze riguardanti la questione del duello. E questo sia nelle opere letterarie che in quelle riguardanti la precettistica. Per quanto riguarda quelle di precettistica, oltre al gran numero di trattati, è da tener presente anche il gran numero delle loro riedizioni, specialmente di quelli più famosi. Dove, oltre all'immancabile comunanza d’interessi fra poeti epici e trattatisti del duello, si noterà anche una sostanziale identità terminologica - per esempio sia i poeti sia i trattatisti ritengono che il duello sia una ‘prova’ di giudizio fi nale. Questo non comporta, nel contempo, una convergenza di convinzioni fi losofi che, in quanto, come si vedrà, il duello letterario diff erisce da quello reale proprio per la sua diversa comprensione fi losofi ca del combattere. Pertanto con la presente relazione si cercherà di dispiegare la problematica che questo istituto di per sé ha comportato nel periodo storico preso in considerazione. Il duello infatti si configurava come una questione sociale tutt'altro che irrilevante per la sua connotazione ambivalente di ordalia – quale forma particolare di rapporto fra uomo e sacro – e di inculpata tutela – quale forma particolare di ricorso alla violenza privata a tutela di un fondamentale diritto naturale. In tutti e due i casi si tratta di una forma di onore, sia individuale sia nobiliare, del quale il Patrizi ne discuterà la fondatezza interpretandolo specialmente in qualità di virtù. In questa defi nizione dell'onore – che il Patrizi aff ronta con un gusto platonico – si possono scorgere questioni di alta portata politica, che ponevano sotto varia forma la questione dei rapporti tra individuo e Stato. In tal modo il duello d’onore assumeva un

  4. La Verità nel Nuovo CPC: Da una Costruzione Ermeneutica

    Directory of Open Access Journals (Sweden)

    Paulo Junior Trindade dos Santos

    2016-10-01

    Full Text Available Analizza il rapporto tra il diritto, la Verità e il Nuovo CPC. I poteri istruttivi di un processo devono essere ripensati per l'inaugurazione della costruzione della verità nel suo senso ermeneutico. La struttura inquisitoria imposta dal principio della libera convinzione del giudice ha diretto e mediare il collegamento con la filosofia della coscienza. Il giudice deve scoprire la verità con la storicità dei fatti riportati nei registri, il risultato di un insieme di prova, che  lo  distingue  da  decisioni  infondate  che  modellano  la  stessa  filosofia  della coscienza, che è al centro di arbitrarietà magistratura per quanto riguarda la vostra decisione.

  5. La mimesis al servizio della giustizia nel film di Angelopoulos Anaparastassi

    Directory of Open Access Journals (Sweden)

    Paola Fallerini

    2012-05-01

    Full Text Available Un uomo viene ucciso dalla moglie e dal suo amante in uno sperduto villaggio dell’Epiro. L’episodio, ispirato ad un fatto di cronaca, è l’espediente narrativo del primo lungometraggio di Theo Angelopoulos, Anaparastassi (Ricostruzione di un delitto, 1970, nel quale la ricostruzione delle dinamiche del delitto si traduce in una critica al sistema giudiziario che, concentrato soprattutto nella ricerca dei colpevoli, non tiene conto di situazioni di degrado economico sociale e morale. Il film di Angelopoulos è stato girato durante la dittatura dei Colonnelli: in un clima di sopraffazione e censura il regista riesce a inserire all’interno della trama apparentemente innocua di un giallo-poliziesco una forte denuncia nei confronti del sistema sociale e politico. La mimesis è qui intesa come ricostruzione del reale e come interpretazione, dove il traguardo della verità assoluta diventa una utopia che mette in discussione il sistema giudiziario stesso. Si parte dall’assunto che il diritto e la legge hanno bisogno di una rappresentazione per poter esercitare la propria funzione: operano su una scena che non è mai la realtà, anche se reali sono gli effetti della funzione giudicatrice. Questo corto circuito tra realtà e rappresentazione nel sistema giudiziario viene analizzato da Angelopoulos ricorrendo anche ai temi del mito, del ritorno e dell’esilio, e affidandosi alla struttura narrativa del giallo, pur tradendone sistematicamente le regole: non c’è mistero dietro a questo delitto, lo spettatore viene accompagnato alla scoperta di meccanismi e leggi di portata universale, dove non sono le risposte che contano piuttosto la scoperta di nuovi interrogativi probabilmente senza soluzione. In questo film sono già presenti gli elementi stilistici che caratterizzeranno le opere successive del regista greco, primo tra tutti l’effetto di straniamento attraverso il quale è possibile risolvere la dicotomia tra realtà e rappresentazione.

  6. Che: His Own Worst Enemy

    Science.gov (United States)

    2015-04-01

    comprised of Green Berets, to go to Bolivia and train a Ranger battalion 40 in counter-insurgency operations. Leading this 16-man team was Maj...York: Routledge & Kegan Ltd., 1987. Sinclair, Andrew. Che Guevara. New York: The Viking Press, 1970. Study of the “Diary of ‘Che’ Guevara in

  7. LA LINGUA ITALIANA E LE SCUOLE ITALIANE NEL TERRITORIO ISTRIANO

    Directory of Open Access Journals (Sweden)

    Chiara De Battisti

    2011-02-01

    Full Text Available L’articolo ricostruisce brevemente, dal punto di vista storico, le vicende della comunità italiana in Istria per contestualizzarne i mutamenti di carattere linguistico e socioculturale che essa ha vissuto, in particolare dal secondo dopoguerra ad oggi. Sulla base di studi e indagini  recenti, vengono prese in esame le lingue e i dialetti parlati dalla comunità italiana, la realtà multilingue e multiculturale dell’Istria attuale,  le istituzioni italiane presenti nel territorio istriano e la loro attività finalizzata alla permanenza della lingua e cultura italiana nella regione. In particolare si ricostruisce la storia della scuola di lingua italiana, le sue origini, il suo declino dopo la cessione dell’Istria alla Yugolaslavia e durante i difficili e drammatici anni dell’esodo di molti italiano dalla regione, la sua rinascita ed evoluzione dal 1980 ad oggi. Delle scuole di lingua italiana, che attualmente operano sia nel territorio istriano che fa parte della Slovenia sia in quello che fa parte della Croazia, si analizza la loro distribuzione nella regione, la loro organizzazione, il ruolo della lingua italiana come materia, come lingua di scolarizzazione e come lingua straniera, i problemi, ancora aperti, della formazione degli insegnanti e dei libri di testo, e si valuta la loro possibilità di evoluzione e di sviluppo.     Italian language and Italian schools in the territory if Istria   This article briefly discusses, from the historical point of view, the Italian community in Istria to contextualize the linguistic and socio cultural changes that have taken place in the region, especially after WWII. Based on recent surveys and studies, languages and dialects spoken in the Italian community, the multilungual and multicultural reality of Istria are examined, as well as the Italian institutions in the Istrian territory and their efforts to conserve Italian language and culture in the area.  In particular, the history of

  8. Democrazia e potere giudiziario nel pensiero di Tocqueville

    Directory of Open Access Journals (Sweden)

    Roberto Giannetti

    2012-07-01

    Full Text Available Nella sua recensione al secondo volume della Democrazia in America John Stuart Mill proponeva una vera e propria chiave di lettura dell’opera del pensatore francese. Con il termine “democrazia – scriveva il filosofo inglese – Tocqueville non intende, in genere, uno specifico tipo di governo. […] Per democrazia [egli] intende eguaglianza delle condizioni, e l’assenza totale dell’aristocrazia, sia essa costituita da privilegi politici o dalla superiorità conferita dall’importanza e dal potere sociale. […] [Nelle istituzioni democratiche] Tocqueville non vede un aggravamento dei più seri mali tipici di una condizione democratica della società, ma piuttosto un loro correttivo”. Soltanto tenendo ferma la distinzione analitica tra assetto sociale e istituzioni politiche si poteva cogliere l’originalità della posizione di Tocqueville nei confronti della democrazia rispetto alla maggior parte dei suoi contemporanei i quali, prigionieri del ricordo dell’esperienza giacobina, non si rendevano conto che, “per combattere i mali che l’eguaglianza può produrre, c’è un solo rimedio efficace: la libertà politica”. La chiave di lettura suggerita da Mill, per quanto acuta e illuminante, necessita tuttavia di un’integrazione. Se è vero che le istituzioni della democrazia politica rappresentano utili rimedi per eliminare, o comunque attenuare, le conseguenze negative prodotte dall’assetto sociale democratico, è altrettanto vero che il mantenimento della libertà in una società in cui si è affermata e consolidata l’égalité des conditions ha bisogno anche di istituzioni e di vincoli ulteriori. È partendo da questa considerazione che si può tentare di comprendere il ruolo centrale che nell’opera di Tocqueville, globalmente considerata, assumono le riflessioni sul rapporto tra democrazia e potere giudiziario. Il pensatore francese ne parla diffusamente nel suo diario di viaggio e soprattutto nel primo volume della

  9. Sé come un altro: l’etica della reciprocità nel pensiero di Paul Ricoeur

    Directory of Open Access Journals (Sweden)

    Francesca Sacchetti

    2012-03-01

    Full Text Available All’interno del panorama fenomenologico la proposta di Paul Ricoeur si configura come una sorta di “via di uscita” rispetto alle aporie in cui cade la fenomenologia husserliana nel suo tentativo di accedere all’ “altro da sé” a partire dal solipsismo trascendentale. La comprensione analogica, basata sul meccanismo dell’appresentazione, in Ricoeur cede il posto ad una filosofia pratica di stile kantiano, fondata sul rispetto, che fa dell’alterità una dimensione costitutiva essenziale della propria soggettività. Nel saggio in primo luogo si analizzerà la critica generale che Ricoeur muove all’idealismo husserliano, mentre in un secondo momento si evidenzierà come il passaggio di Ricoeur dalla fenomenologia all’ermenuetica comporti anche un significativo cambiamento nel modo di affrontare e risolvere il problema dell’intersoggettività. Apparirà infine evidente come il percorso ricoeuriano sia fin dall’inizio segnato ed animato da una forte tensione.

  10. Infrastrutture e pianificazione paesaggistica nel rinnovato Codice dei Beni culturali e del Paesaggio

    Directory of Open Access Journals (Sweden)

    Saverio Santangelo

    2012-08-01

    Full Text Available Le infrastrutture agiscono sul paesaggio con effetti sia diretti, e spazialmente limitati, che indiretti, e non precisamente limitati nello spazio e nel tempo. Gli effetti indiretti, in particolare, riguardano anche le infrastrutture che non vediamo, perché nel sottosuolo, o di cui vediamo solo gli elementi puntuali e materiali di reti prevalentemente immateriali. In quest’ultimo caso si tratta dei sistemi di flusso delle informazioni, che oggi e ancor più in prospettiva, insieme ai sistemi per la produzione locale di energia (segnatamente fotovoltaico ed eolico, rafforzano le tendenze all’indifferenza dei fattori localizzativi di attività e residenze. Tutto questo da un lato consente riduzioni dei suoli impegnati e, per alcuni versi, la stessa salvaguardia del paesaggio (possono ridursi le reti fisiche per il trasporto di energia elettrica e gas, ed esempio, ma dall’altro favorisce nuove domande di suolo a fini urbanizzativi e di infrastrutture, non soltanto stradali, per servire ed accedere alle nuove aree interessate dalla domanda, e quindi comporta altri impatti sul paesaggio.

  11. LE PAROLE DEI LIBRI NEL "VOCABOLARIO MILANESE-ITALIANO" DI FRANCESCO CHERUBINI. RIFLESSI DEL MONDO EDITORIALE (MILANESE NEL LESSICO DIALETTALE

    Directory of Open Access Journals (Sweden)

    Edoardo Buroni

    2016-09-01

    Full Text Available Oltre che come lessicografo e dialettologo, Francesco Cherubini spese gran parte della sua vita professionale occupandosi di libri: il vasto mondo editoriale di stamperie, tipografie e cartiere costituisce uno dei settori specialistici più rappresentati nel Vocabolario milanese-italiano, opera contraddistinta da una particolare attenzione alle voci di arti e mestieri. Questo saggio fornisce un regesto ragionato e commentato di tali lemmi, sottolineando la grande competenza del compilatore e la forte componente autobiografica che emergono dalle “parole dei libri”. Words about books in Francesco Cherubini’s “Vocabolario milanese-italiano”. Reflections of the (milanese world of publishing in dialect As well as being a lexicographer and dialectologist, Francesco Cherubini spent much of his professional life dealing with books: the vast world of publishing, printing and the paper industry was one of the most specialized sectors represented in the Vocabolario milanese-italiano, a work characterized by a particular focus on arts and crafts terminology. This paper provides an annotated summary and comments on such items, emphasizing the great responsibility of the compiler and the strong autobiographical component emerging from the “words of books”.

  12. Gli studi provenzali nel percorso critico di Cesare De Lollis

    Directory of Open Access Journals (Sweden)

    Diego Stefanelli

    2015-12-01

    Full Text Available L’intervento indaga l’attività di provenzalista di Cesare De Lollis. Sulla scia dell’opera del maestro Ernesto Monaci essa si concentrò inizialmente sull’edizione di codici provenzali e sullo studio dei primordi della provenzalistica nell’umanesimo italiano. Seguì l’edizione dell’opera di Sordello (1896 che innescò un’aspra polemica con Francesco Torraca, da collocarsi nel contesto della querelle tra critica estetica ed erudita. In seguito, la letteratura dei trovatori fu studiata da De Lollis nel suo rapporto con quella italiana. Ripercorrendo i suoi principali interventi di materia provenzale posteriori all’edizione di Sordello, si dimostra come proprio dal confronto tra le due letterature De Lollis individuò una  linea (che dagli ultimi provenzali arrivava fino a Dante, passando per gli stilnovisti e Guittone caratterizzata dal primato della forma. Tale linea fu fondamentale per l’elaborazione di una delle idee forti della critica dello studioso, la dialettica tra tradizione letteraria codificata e margini di libertà espressiva degli autori in essa operanti, che sarà alla base dei Saggi sulla forma poetica italiana dell’Ottocento.The article focuses on Cesare De Lollis’ studies on Occitan Litterature. At first, following Ernesto Monaci’s example, he worked on the editions of Occitan codes and he studied the beginnings of Occitan philology during the Italian Umanesimo. In 1896 he published the critical edition of Sordello, entering into debate with Francesco Torraca: this debate has to be set in the context of the querelle between critica estetica e critica erudita, that was very strong in Italy at the end of XIX century. After the Sordello’s edition, De Lollis studied the relationship between Occitan and Italian Litterature and he identified a poetic tradition (the last troubadours, Guittone, the stilnovisti, Dante, characterized by the importance of the forma. He focused also on the dialectic between a

  13. Il capriolo nel Pollino: ieri, oggi e domani

    Directory of Open Access Journals (Sweden)

    Alberto Sangiuliano

    2003-10-01

    Full Text Available Fino agli inizi del secolo scorso, il capriolo conservava molto probabilmente un?ampia diffusione in tutta la Calabria settentrionale con una distribuzione pressoché continua, dal Massiccio del Pollino alla Catena Costiera. La contrazione dell?area di distribuzione iniziò verosimilmente già nel sec. 19°, acuendosi tra le due guerre mondiali, con l?estinzione della specie a nord del fiume Lao e sulla Catena Costiera. Cacciabile fino ai primi anni ?70 e in seguito perseguitato dal bracconaggio, il capriolo continuava nel suo inesorabile declino negli anni ?80 e ?90. L?areale era stimato essere di circa 7500 ha, più o meno circoscritto alla impervia Valle del Fiume Argentino (Orsomarso e alle aree limitrofe, con una stima di consistenza intorno a poche decine di individui. Solo in seguito all?istituzione del Parco Nazionale del Pollino, si è registrata una graduale inversione di tendenza: studi della seconda metà degli anni ?90 hanno individuato un?area di presenza stabile e accertata di poco inferiore a 6.000 ha, e una periferica di presenza sporadica e/o probabile (circa 9.000 ha. In seguito a una Convenzione stipulata nel 2000 tra l?Ente Parco e l?Università di Siena, è in corso uno studio sull?ecologia e conservazione del capriolo nel Parco Nazionale del Pollino, per favorire l?incremento della locale popolazione di capriolo. Per la determinazione della distribuzione della specie, mensilmente sono stati effettuati percorsi fissi diurni, notturni (con faro e avvistamenti da punti di visibilità, oltre che una serie di escursioni periodiche in aree di presenza incerta. Inoltre è stata condotta una valutazione dell?idoneità ambientale per la specie mediante l?utilizzo di tecniche statistiche multivariate (Analisi di Regressione Logistica Multipla. I nostri dati sembrano indicare che l?area di distribuzione ?storica? si sia notevolmente ampliata soprattutto in direzione nord, nord-est ed est, dove la presenza della specie è stata

  14. Cholinesterase (ChE) response and related mortality among birds fed ChE inhibitors

    Science.gov (United States)

    Ludke, J.L.; Hill, E.F.; Dieter, M.P.

    1975-01-01

    Patterns of mortality and inhibition of brain and plasma ChE in birds treated with ChE inhibitors were studied in an attempt to determine the validity of using ChE activity as a monitoring and diagnostic technique. Analysis of brain ChE activity proved to be reliable for diagnosing and monitoring effects of selected ChE inhibitors in birds. Brain ChE inhibition exceeding 20% indicated exposure, and inhibition greater than 50% was sufficient for diagnosing cause of death. Individuals that died from dietary exposure to parathion or carbofuran had brain ChE activities below 55% of normal; although individuals could survive with brain ChE activity lower than 50%. Problems associated with collection, storage, and analysis of tissues for ChE activity are discussed.

  15. Il Centro Nascita Montessori. Dal neonato in famiglia al bambino e alla famiglia nel servizio educativo

    Directory of Open Access Journals (Sweden)

    Laura Franceschini

    2010-02-01

    Full Text Available Intervento al Workshop Internazionale “Infanzie e Famiglie in Europa”, del 16 ottobre 2009, presso la Facoltà di Scienze della Formazione, Via Filippo Re, 6 Bologna (Aula Magna. L’intervento illustra i valori fondativi del Centro Nascita Montessori dalle sue origini ai giorni nostri attraverso un percorso che si è allargato nel tempo: dalla focalizzata attenzione e cura al neonato in famiglia o nel brefotrofio fino agli anni ’60 alla cura della crescita del bambino nei servizi educativi e alla cura della relazione con le famiglie dagli anni ‘70 in poi. Tale espansione del campo di interesse e d’indagine operativa ha arricchito il patrimonio di competenze e di conoscenze del C.N.M..

  16. Camões e Tasso: l’Oriente nel poema eroico

    Directory of Open Access Journals (Sweden)

    Anna Cerbo

    2011-11-01

    Full Text Available Questo contributo si è proposto lo studio della presenza dell’Oriente nel poema epico europeo del Cinquecento. La struttura e l’elaborazione del discorso si sono basate soprattutto sul confronto di due opere: la Gerusalemme liberata di T. Tasso e I Lusiadi di L. de Camões . L’analisi testuale e la metodologia comparatistica hanno portato alla conoscenza storico-ideologica, culturale-letteraria e linguistica dei due poemi, e hanno consentito di rilevare le affinità e le differenze nel rapporto con l’’altro’ e nella rappresentazione dell’‘altro’ da parte dei due Poeti, entrambi attenti allo sguardo incrociato dell’Occidente e dell’Oriente. Tra i risultati conseguiti aggiungiamo che  è stato possibile individuare una comune retorica dell’‘alterità’ nella letteratura europea del Rinascimento.

  17. Prefazione—aspetti relativi al benessere animale nel trasporto a lunga distanza

    Directory of Open Access Journals (Sweden)

    Gardner Murray

    2008-03-01

    Full Text Available Il trasporto di animali all'interno dello stesso paese e tra paesi, regioni e continenti si incrementa significativamente e si evolve nella sua natura. Le statistiche dell'International Trade Centre of the United Nations Conference on Trade and Development and the World Trade Organization mostrano che il valore del commercio mondiale di animali vivi ammontava a 8,7 bilioni di dollari americani nel 2000 e a 12,1 bilioni di dollari americani nel 2005. Questa cifra già enorme aumenterebbe se fossero presi in considerazione gli animali degli zoo, la fauna selvatica e il traffico illecito.La storia del trasporto animale risale a migliaia di anni fa. Resta tutt'oggi molto praticato però con le misure appropriate a tutela del benessere degli animali. Nel 21mo secolo, quello che cambia è la natura stessa del trasporto (terra, aria e mare, il volume di traffico e la coscienza sociale a proposito di tematiche come il benessere e la richiesta che gli animali vengano trattati in maniera umana e conformemente ai più opportuni sistemi moderni. Questo ha incrementato i volumi dei trasporti creando una condizione senza precedenti per quanto riguarda il rischio di diffusione di malattie infettive, incluse quelle trasmissibili all'uomo.Il centro dell'interesse pubblico sul benessere animale riguarda fattori come la carenza di infrastrutture e di investimenti per quando riguarda la formazione, la ricerca e il miglioramento degli standard, così come l'indifferenza e la negligenza. Le ditte per il trasporto di animali vivi vengono diffidate quando non provvedono a queste mancanze.Fortunatamente, un numero di paesi ha anticipato queste problematiche ed ha introdotto una serie di attività a supporto di pratiche atte a migliorare il benessere degli animali. Molti hanno ammesso la chiara connessione tra benessere animale, sanità e pratiche d'allevamento, ed hanno istituito una politica adatta a ricomprendere queste attività all'interno di un servizio pubblico

  18. Censura e doppiaggio nelle forme narrative del cinema italiano, nel cruciale passaggio al sonoro degli anni Trenta

    Directory of Open Access Journals (Sweden)

    Antonio Catolfi

    2015-10-01

    Full Text Available Il cinema italiano durante gli anni Venti conosce una profonda crisi determinata da vari fattori, tra cui il fallimento dell’Unione cinematografica italiana. I film muti prodotti in Italia passano dai 1029 del 1911 ai 415 del 1920. Sono solo 23 nel 1929. Nel 1930 si tocca il fondo con 18 film italiani e 374 stranieri. Dal 1932 al 1933 invece riprendono in modo lento a crescere: 1931 (27 italiani e 262 stranieri, 1932 (31 italiani e 229 stranieri, 1933 (36 italiani e 260 stranieri probabilmente grazie al cinema sonoro che inizia a diffondersi e ad altre concause. Dopo il successo negli Stati Uniti del film il Cantante di Jazz l’industria si converte rapidamente alla possibilità di rendere sonora la pellicola. In Italia il Cantante di Jazz arriva due anni dopo, il 19 aprile 1929. Appena nato il sonoro nel cinema, l’industria cinematografica italiana deve affrontare subito il problema delle barriere linguistiche che causava una difficoltà enorme per la commerciabilità dei prodotti italiani fuori dai confini nazionali. L’avvento del regime fascista non aiuta la situazione della crisi generale del cinema italiano perché nella sua prima fase il regime non si occupa del cinema in maniera diffusa.

  19. Accademie teatrali fiorentine nel quartiere di Santa Croce tra Sei e Settecento: tra attori dilettanti, gioco d’azzardo e primi tentativi impresariali

    Directory of Open Access Journals (Sweden)

    Francesca Fantappiè

    2011-10-01

    Full Text Available Il saggio approfondisce il funzionamento delle accademie teatrali fiorentine a cavallo tra XvII e XvIII secolo sotto più punti di vista: localizzazione dei teatri, repertorio e circolazione degli interpreti, aspetti di amministrazione economica, rapporti con il potere e, nella fattispecie, con la dinastia medicea. Emerge la concentrazione nel quartiere di Santa Croce di Firenze di una buona parte delle accademie di dilettanti, che per alcuni decenni offrono una produzione drammaturgica alternativa a quella del teatro degli attori professionisti, esclusi dal mercato fiorentino nell’ultima fase medicea. Sulle motivazioni di questo fenomeno sono qui proposte ipotesi alternative alla vulgata storiografica che vede in questi anni il nadir culturale nella storia del Granducato e della famiglia al potere. Ci si sofferma, inoltre, sul problema di una possibile definizione di sistema teatrale fiorentino, con particolare attenzione alla disanima dei primi tentativi di adozione di un modello impresariale nel teatro in musica.

  20. Sorveglianza della circolazione ambientale dei poliovirus nel Lazio

    Directory of Open Access Journals (Sweden)

    A.M. Patti

    2003-05-01

    Full Text Available Ancora oggi in tutto il mondo il vaccino antipolio più utilizzato è l’OPV costituito da virus viventi attenuati che vengono eliminati per un periodo di tempo variabile dal soggetto vaccinato. L’immissione di virus vaccinali nell’ambiente è stata in passato, e lo è tuttora nelle zone endemiche, estremamente importante per assicurare e la competizione con il poliovirus selvaggio e una immunità di gregge. Nei paesi polio-free, ed in futuro in tutto il mondo, la circolazione di virus vaccinali potrebbe viceversa diventare un punto critico in grado di inficiare i risultati dell’eradicazione. Infatti i virus vaccino derivati, replicando, retromutano verso la neurovirulenza e/o accumulano mutazioni che alla fine conferiscono loro caratteristiche del tutto diverse dai ceppi parentali; inoltre possono anche ricombinarsi con il selvaggio o con altri enterovirus assumendo caratteristiche di virulenza e di trasmissibilità interumana che emergono con lo scoppio di focolai epidemici. Obiettivo del presente progetto è stata la valutazione della circolazione dei poliovirus e degli eventuali virus vaccino derivati in matrici ambientali nella regione Lazio nel periodo 1996-2002. Metodo: sono stati analizzati 26 campioni di liquami e 36 campioni di acque superficiali contaminate da liquami. Le particelle virali sono state concentrate mediante ultra filtrazione tangenziale (10.000 NMWR – Millipore. I concentrati sono stati seminati su cellule BGM ed L20B. I virus isolati sono stati identificati con antisieri specifici (RIUM e sui poliovirus, presso l’ISS, sono stati effettuati la differenziazione intratipica, il sequenziamento della regione VPI/2A, il sequenziamento della regione 5’ NCR e la regione codificante la polimerasi virale. Risultati e conclusioni: sono stati isolati complessivamente 6 poliovirus di cui 4 da acque superficiali. I virus erano tutti Sabin-kike e retromutati ma non ricombinanti. I dati ottenuti sottolineano l

  1. Nel bosco sacro. Realtà, finzione, magia e natura ne Il ramo d’oro di James G. Frazer

    OpenAIRE

    Dimpflmeier, Fabiana

    2014-01-01

    ‘E così il coro accenna a una legge segreta’ : così vien voglia di commentare la raccolta dei dati in Frazer.(Ludwig Wittgenstein, Note sul Ramo d’oro di Fraser)Per certi versi, è di simili ‘infedeltà creative’ che si nutre il progresso della conoscenza.(Fabio Dei, La discesa agli inferi) Nel 1922, dopo tre edizioni arrivate ad espandersi fino a dodici volumi, l’antropologo vittoriano James G. Frazer pubblica l’editio minor de Il ramo d’oro, consacrandosi a fortuna quasi imperitura. Contraria...

  2. Un modello italiano per l’economia nel Brasile di Getúlio Vargas: la «Carta del Lavoro» del 1927

    Directory of Open Access Journals (Sweden)

    Mario G. Losano

    2012-01-01

    Full Text Available Il corporativismo fu uno degli elementi caratterizzanti dello Stato fascista, che con esso intendeva ricollegarsi alla tradizione medievale italiana. Oscillando tra storia e «invented tradition», con esso il governo fascista proponeva una soluzione alla crisi economica degli anni Trenta e un’alternativa allo Stato tanto liberale quanto comunista, cioè una «terza via». Del corporativismo italiano vengono sinteticamente esaminate le origini, l’evoluzione e la struttura, dedicando particolare attenzione alla Carta del Carnaro del 1920, il documento che lo preparò durante l’avventura di Fiume di Gabriele d’Annunzio. Il corporativismo, come modello di gestione economica che negava la lotta di classe, si diffuse in Europa e fuori di essa nell’epoca delle dittature. L’attenzione si concentra sul Brasile, nella sua transizione dalla República Velha alla dittatura di Getúlio Vargas, iniziata nel 1930 e durata fino al 1954, anche se in modo istituzionalmente non unitario. All’interno del movimento che l’accompagnò, l’«Integralismo», il filosofo Miguel Reale (1910–2006 propugnò un corporativismo democratico. Il modello corporativo italiano si riflette in alcune parti della vasta «Consolidação das Leis do Trabalho», emanata da Vargas nel 1943. Essa costituisce un chiaro esempio della legislazione sociale che accompagnò molte dittature del XX secolo e che, nel caso del Brasile, ebbe effetti anche dopo la caduta del regime. La «Consolidação» riguardava però soltanto i lavoratori urbani, mentre il Brasile era una società prevalentemente agraria. Per questo vengono passare in rassegna le misure a favore dei diritti sociali dei lavoratori urbani e agrari prese dai governi di Juscelino Kubitschek (1902–1976 e di João Goulart (1919–1976, nonché, infine, la tutela accordata nel 1964 ai lavoratori agrari dallo Statuto della Terra.

  3. Dicty_cDB: CHE636 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHE636 (Link to dictyBase) - - - Contig-U11696-1 CHE636P (Link... to Original site) CHE636F 174 CHE636Z 123 CHE636P 277 - - Show CHE636 Library CH (Link to library) Clone ID CHE636 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11696-1 Original site URL http://dict...ne RP11-15H22, WORKING DRAFT SEQUENCE, 23 unordered pieces. 40 0.19 3 AC149612 |AC149612.1 Ictalurus punctat... %: cytoskeletal 4.0 %: mitochondrial >> prediction for CHE636 is nuc 5' end seq. ID CHE636F 5' end seq. >CH

  4. Structural Insight inot the low Affinity Between Thermotoga maritima CheA and CheB Compared to their Escherichia coli/Salmonella typhimurium Counterparts

    Energy Technology Data Exchange (ETDEWEB)

    S Park; B Crane

    2011-12-31

    CheA-mediated CheB phosphorylation and the subsequent CheB-mediated demethylation of the chemoreceptors are important steps required for the bacterial chemotactic adaptation response. Although Escherichia coli CheB has been reported to interact with CheA competitively against CheY, we have observed that Thermotoga maritima CheB has no detectable CheA-binding. By determining the CheY-like domain crystal structure of T. maritima CheB, and comparing against the T. maritima CheY and Salmonella typhimurium CheB structures, we propose that the two consecutive glutamates in the {beta}4/{alpha}4 loop of T. maritima CheB that is absent in T. maritima CheY and in E. coli/S. typhimurium CheB may be one factor contributing to the low CheA affinity.

  5. Innovazioni finanziarie e organizzazione delle transazioni nel mercato azionario. (Financial innovations and the organisation of stock market trading

    Directory of Open Access Journals (Sweden)

    J.A. KREGEL

    2013-12-01

    Full Text Available Gli economisti non sono mai stati troppo interessato alle istituzioni che compongono i mercati o al  processo di formazione dei prezzi in essi , avendo invece scelto di studiare la possibilità dell'esistenza di " equilibrio " prezzi in condizioni di concorrenza . Alla luce del recente crollo del mercato azionario , tuttavia , è chiaro che la Borsa di New York non è un mercato competitivo , nel senso di coinvolgere un numero sufficientemente elevato di acquirenti e venditori in modo che nessuna singola operazione ha un impatto permanente sulla determinazione dei prezzi. Questo lavoro suggerisce che è i recenti cambiamenti nella struttura di mercato concorrenziale , che hanno aumentato la volatilità dei prezzi e reso difficile , se non impossibile , per il sistema di " specialista " la formazione dei prezzi al lavoro. Proposte di cambiamento nell'organizzazione del mercato di scambio devono pertanto essere giudicati rispetto delle vigenti condizioni di concorrenza imperfetta , piuttosto che il mercato perfetto idealeEconomists have never been overly interested in either the institutions comprising markets or the process of price formation in them, having instead chosen to study the possibility of the existence of “equilibrium” prices under competitive conditions. In light of the recent stock market crash, however, it is clear that the New York Stock Exchange is not a competitive market in the sense of engaging a sufficiently large number of buyers and sellers so that no individual transaction has a permanent impact on the determination of prices. This work suggests that it is the recent changes in competitive market structure which have increased the volatility of prices and made it difficult, if not impossible, for the “specialist” system of price formation to work. Proposals for change in the organisation of market trading should thus be judged relative to the prevailing imperfectly competitive conditions, rather than the ideal

  6. Crèche and School

    CERN Multimedia

    EVE et École

    2018-01-01

    IMPORTANT DATES Enrolments 2018-2019 Enrolments to the Crèche and School for the school year 2018-2019 will take place on 5, 6 and 7 March 2018 from 10 am to 1 pm at the Crèche and School of the CERN Staff Association. Registration forms will be available from Thursday 1st March 2018. For more information, please visit the website: http://nurseryschool.web.cern.ch/. * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * Saturday 3 March 2018 Open Day at Crèche and School of the CERN Staff Association Are you considering enrolling your child to the Crèche and School of the CERN Staff Association? If you work at CERN, then this event is for you: come visit the school and meet the Management on Saturday 3 March 2018 from 10 to 12 am It will be our pleasure to present to you our structure, its projects and premises, and answer any questions you may have. Please sign up for one of the two sessions via Doodle before Wednesd...

  7. Che cos’è l’antiziganismo?

    Directory of Open Access Journals (Sweden)

    Leonardo Piasere

    2012-01-01

    Full Text Available Abstract – IT Chi è zingaro? Colui che chiamo zingaro, che assegno a questa identità e che costituisco come "altro" dal resto della società. In questo senso, la storia degli zingari si confonde con quella dell'"antiziganismo", un neologismo che denota una pratica antica. Ma si può dire che la comparsa della nuova parola è legata agliodierni intrecci tra politiche multiculturali da un lato e politiche neoliberiste dall’altro?Abstract – FRQui est Tsigane? Celui que je nomme Tsigane, que j'assigne à cette identité et que je constitue en "autre" du reste de la société. Dans ce sens, l'histoire des Tsiganes se confond avec celle de l'"antitsiganisme", un néologisme qui recouvre une pratique ancienne. Mais peut-on dire que l'apparition de ce nouveau mot estliée aux croisements actuels entre les politiques multiculturelles d'une part, et les politiques néolibéralesde l'autre? Abstract – EN Who is Gypsy? The person I call Gypsy, to whom I assign this identity, is that I establish as "other" than the rest of society. In this sense, the history of Gypsies merges with that of "antigypsism", a neologism that denotes an ancient practice. But can it be said that the appearance ofthis new word is linked to the current entanglement between multi-cultural politics on one side and neo-liberalist politics on the other?

  8. Dante deutsch: Riflessioni sulle traduzioni tedesche della ‘Divina Commedia’ nel Novecento (George e Borchardt

    Directory of Open Access Journals (Sweden)

    Thomas Klinkert

    2016-06-01

    Full Text Available Malgrado il pregiudizio secondo il quale la poesia in generale e la Divina Commedia in particolare sarebbero intraducibili, quest'ultima dal Settecento in poi è stata tradotta in tedesco – sia parzialmente che completamente – più di centosettanta volte. Non solo i romantici ma anche i filologi dell'Ottocento hanno contribuito in maniera decisiva a questa intensa ricezione. Nel Novecento la pratica della traduzione è stata portata avanti da due grandi poeti: Stefan George e Rudolf Borchardt. Un'analisi selettiva del primo canto dell’Inferno e delle traduzioni di George e Borchardt mostrerà alcune trasformazioni specifiche del testo dantesco a seconda delle scelte linguistiche dei due poeti.

  9. Il commercio dei captivi nel Mediterraneo di età moderna (secc. XVI - XVIII. Orientamenti e prospettive attuali di ricerca

    Directory of Open Access Journals (Sweden)

    Bosco, Michele

    2014-02-01

    Full Text Available Da oltre un ventennio, il tema della guerra da corsa e quello del commercio dei captivi nel Mediterraneo di età moderna, ad esso strettamente connesso, sono oggetto di rinnovato interesse da parte della storiografia internazionale. Soprattutto in Italia, Spagna e Francia (ma anche altrove, ricerche sistematiche hanno permesso di ricostruire diversi aspetti della schiavitù nel Mediterraneo di età moderna: modalità della cattura, condizioni di vita dei prigionieri, riscatti, conversioni. Non solo storici, ma anche antropologi, economisti, storici delle religioni e del diritto hanno dato il loro contributo alla ricerca, tradottosi in raccolte di saggi o in volumi monografici; tale abbondante produzione ha innanzitutto mostrato chiaramente come la guerra da corsa e il commercio dei captivi abbiano rappresentato a lungo un elemento cruciale della storia dei paesi che si affacciano sul Mediterraneo, dal medioevo all’età moderna, giungendo fino ai primi decenni del secolo XIX. Nelle prossime pagine proveremo a ricostruire, a grandi linee, l’evoluzione del dibattito storiografico sull’argomento, in modo da far emergere le questioni ancora aperte e di individuare nuovi possibili percorsi di indagine, che sfruttino in particolare le serie documentarie ancora scarsamente utilizzate o meritevoli di ulteriori ricerche.

  10. Solidarietà e protezione nel lavoro familiare anche dopo le recenti riforme

    Directory of Open Access Journals (Sweden)

    Lucia Venditti

    2012-01-01

    Full Text Available Riassunto – Lo studio esamina la disciplina del lavoro familiare attraverso una compiuta ricognizione delle fonti normative e delle inerenti tendenze interpretative. In particolare vengono considerati i profili dei confini dell’area identificata da tale disciplina ed i suoi riflessi in termini di definizione, anche giurisprudenziale, della prestazione lavorativa. L’indagine mostra che nel tempo le tutele si sono evolute nel senso di dare rilievo ai contenuti economici della collaborazione prestata dal familiare ed agli aspetti previdenziali.Abstract – The study deals with the regulation of “family work” by reconstructing the full array of relevant legislative sources, doctrine interpretations and jurisprudence trends. In particular, it focuses on the identification of the boundaries of the area of family work and on its consequences in terms of the definition of the relevant profile of the work relation with the family member, also considering what stated by the jurisprudence. The study shows that, overtime, applicable safeguards have evolved towards giving increasing relevance both to the economic content of the work relation and to the duly recognition of retirement insurance rights.

  11. Dicty_cDB: CHE687 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHE687 (Link to dictyBase) - - - Contig-U16336-1 - (Link to Or...iginal site) CHE687F 622 - - - - - - Show CHE687 Library CH (Link to library) Clone ID CHE687 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16336-1 Original site URL http://dictycdb.b...KFINQCINEIKEELKGDMQKKTVAVQKLTYIQ MLGFDISWASFKIVEVMSCNKFSSKRIGYLAASQSFNEGTDVIVLATHQIRKDFLSSNQS EAYLALNCLSNICT...LGFDISWASFKIVEVMSCNKFSSKRIGYLAASQSFNEGTDVIVLATHQIRKDFLSSNQS EAYLALNCLSNICTTDLARELANDILTLLSTQKTHILKRAITVLYKIF

  12. Che legend elab ka 40 aastat hiljem / Evelyn Kaldoja

    Index Scriptorium Estoniae

    Kaldoja, Evelyn, 1980-

    2007-01-01

    Ilmunud ka: Postimees : na russkom jazõke 9. okt. lk. 10. Argentinas sündinud ja 1967. aastal hukatud revolutsionääri Ernesto Che Guevara poliitikukarjäärist, tema panusest Kuuba revolutsiooni ja poliitikasse. Ernesto Che Guevara mälestamisest Ladina-Ameeerika riikides. Lisa: Kuuba revolutsioon; Che Guevara elu

  13. Misura della sezione d'urto totale e Dello scattering elastico all'energia Nel centro di massa di $\\sqrt{s}=1.8$ TeV

    Energy Technology Data Exchange (ETDEWEB)

    Paoletti, Riccardo [Univ. of Pisa (Italy)

    1991-01-01

    La produzione di eventi elastici è stata misurata al Collider Tevatron del Fermi National Accelerator Laboratory (Batavia. 11.~ U .S.A.) alla energia nel centro di massa. di √s = 1800 GeV, nell'intervallo 0.06 < I t I< 0.24. Sono forniti dettagli sull'esperimento CDF che ha compiuto la misura e sui criteri di selezione degli eventi.

  14. La crisi energetica nel mondo e in Italia da Enrico Fermi ed Edoardo Amaldi a oggi

    CERN Document Server

    Salvini, Giorgio

    2007-01-01

    Enrico Fermi e il suo allievo Edoardo Amaldi, grandi padri della Scuola di fisica nucleare italiana, hanno promosso l'impiego pacifico dell'energia nucleare: Fermi con il primo reattore a Chicago nel 1942, Arnaldi con i suoi contributi a tutti gli usi pacifici, dalla medicina alla produzione di energia. L'Italia, però, ha fatto eccessivo ricorso al petrolio, di cui non è produttrice. La ricerca è rimasta molto indietro rispetto a quella degli altri paesi e la politica sta dedicando pochissimi sforzi a questa gravissima situazione. Ragioni economiche, nonché ambientali, esigono ora una revisione e una ricontestualizzazione del problema. Durante un importante Convegno, tenutosi a Roma il 15 e 16 maggio 2007, alcuni tra i più noti ed esperti fisici italiani e stranieri hanno discusso proprio di questo problema. L'intento del volume, che raccoglie gli interventi del Convegno romano, è quello di fornire dati e informazioni che mettano il lettore in condizione di farsi un'idea propria, libera da pregiudizi, s...

  15. Don Juan: eine Tragödie. Intertestualità faustiana e riscrittura tragica nel racconto di E. T. A. Hoffmann

    Directory of Open Access Journals (Sweden)

    Francesco Marola

    2017-11-01

    Full Text Available Il mito letterario di don Giovanni, sorto nella commedia, attorno al 1800 viene riformulato in direzione del tragico. La trasformazione inizia con la versione operistica di Mozart-Da Ponte e trova compimento nel racconto di Hoffmann, che proietta il nuovo tono tragico del finale mozartiano su tutto il mito. L’articolo intende porre in rilievo la presenza nel Don Juan di numerosi richiami intertestuali al Faust di Goethe, finora non pienamente rilevati dalla critica, attraverso i quali è possibile leggere tale riscrittura tragica come una dichiarata sintesi dei due miti, in cui don Giovanni assume il ruolo di Faust-Mefistofele e donna Anna quello di Gretchen. La riscrittura del mito culmina nel finale rispecchiamento del narratore in Anna-Gretchen. Ma il valore del tragico è relativizzato in Hoffmann dall’ironica autocoscienza dell’artista romantico: confinato nel mondo fantastico dell’arte, risulta privo di senso nella prosaica realtà della vita borghese.

  16. Restrizioni strutturali e teoria linguistica nel discorso bilingue

    Directory of Open Access Journals (Sweden)

    Antonio Piga

    2015-01-01

    grammatical’ and which on the other hand are those considered as ‘non-grammatical’ or ‘impossible’, (c the possible existence of grammatical constraints and models that may govern the compatibility of constituents of the two codes in contact. Riassunto - L’obiettivo del presente contributo è quello di offrire un panorama rappresentativo di un fenomeno largamente diffuso in Sardegna: l’alternanza linguistica da parte degli immigranti durante le varie interazioni con i parlanti sardi. La commutazione di codice rappresenta infatti una di quelle strategie discorsive cui ricorrono gli apprendenti durante le varie fasi di acquisizione di una L2, allo scopo di soddisfare eventuali esigenze comunicative e compensare le carenze nella competenza linguistica durante i vari scambi interazionali con gli interlocutori nativi nel paese in cui temporaneamente soggiornano. In questa indagine verrà esaminata non tanto la commutazione di codice italiano/inglese, italiano/spagnolo, ecc. quanto piuttosto l’inclusione della varietà dialettale sarda fra le lingue che gli immigrati adoperano nelle diverse interazioni sociali con i parlanti nativi allo scopo di “accelerare l’assimilazione nel gruppo dominante” (Loi Corvetto 2000: 42.Il corpus consiste di circa trenta ore di registrazione di parlato spontaneo. Si è ritenuta infatti prioritaria la possibilità di osservare e esaminare la produzione linguistica di parlanti che interagissero in contesti situazionali i più naturali possibili, pertanto le tecniche adoperate nella raccolta del corpus rispondono principalmente all’ esigenza di poter ottenere dati relativi al parlato naturale, non sorvegliato, di cui è possibile disporre solamente se i parlanti non sanno di essere registrati.Da un punto di vista metodologico, si tratterà in primo luogo di individuare: (a le caratteristiche morfologiche e sintattiche del discorso bilingue italiano/campidanese da parte degli apprendenti italiano L2, vale a dire quali categorie

  17. Vagare e invaghirsi: derive magmatiche nel web

    Directory of Open Access Journals (Sweden)

    Daniela Ranieri

    2003-09-01

    Full Text Available La dimensione virtuale delle nuove tecnologie, dove 'virtuale' non vuole certo significare qualcosa come 'falso' o 'illusorio', è il giardino ideale dove pascolare le delizie (e le croci di una passione che non può terminare perché ad essa è preclusa l'esperienza del possesso. Allora gli occhi si fanno avidi contenitori di immagini, i polpastrelli si caricano dell'elettricità dell'incontro, gli organi sono sollecitati ad interagire con l'interfaccia della tecnologia e a farsi essi stessi interfaccia, anche solo per diminuire le probabilità del rigetto dell'impianto mentale tecnologico. Il fruitore del Web, lacerando lo specchio del monitor (Alice, certo, ma anche Alien, mette in atto la sua performance di interazione e significazione motoria, che è diversa ad ogni connessione e lungo lo scandire del nuovo tempo espresso in bps, e che proprio per questo è quanto mai body-art, deriva teatrale-tecnologica dell'arte concettuale o, a questo punto, concezionale, generatrice di ibridi Avatar.

  18. Tempi che cambiano, luoghi che si trasformano: i mutamenti nei nuraghi fra l’età del Bronzo ed il Primo Ferro

    Directory of Open Access Journals (Sweden)

    Mauro Perra

    2017-01-01

    Full Text Available Riassunto: Il lungo percorso della Civiltà Nuragica, compreso fra XVII e X-IX secolo a.C., si caratterizza come un’epoca di grandi trasformazioni che si susseguono nel tempo e lasciano visibili tracce in un paesaggio mutevole, come in un succedersi di macroscopiche unità stratigrafiche. Si trasformano profondamente così non solo i monumenti ed il paesaggio, ma anche le stesse strutture sociali e politiche delle comunità nuragiche fino alla trasfigurazione del ricordo in mito nei centri cerimoniali o santuari. Abstract: The long trajectory of the Nuragic civilisation (17th - 10th/9th centuries B.C. is characterised by a succession of dramatic changes leaving visible traces in a varying landscape, like stratigraphy on a regional scale. These changes affect not only the Nuragic monuments and landscape but also the social and political institutions of Nuragic communities, culminating in a transfiguration of memory and a new mythology apparent in ceremonial centres and sanctuaries.

  19. GIUSTIZIA, PENA E MISERICORDIA NELL’ISTITUTO DEL MATRIMONIO NEL DIRITTO ROMANO

    Directory of Open Access Journals (Sweden)

    Paolo Giuseppe Maria Lobiati

    2017-12-01

    Full Text Available Il tema della giustizia e della pena può essere riscontrato anche nella risoluzione del conflitto tra coniugi già a partire dal diritto romano arcaico. Si tratteggerà, quindi, l’evoluzione dell’istituto del divortium nel sistema giuridico romano a partire dalla sua nascita come risposta al ius vitae ac necis del marito sulla moglie, passando per il ripudio unilaterale e concludendosi con la dissoluzione del vincolo. L’analisi proseguirà attraverso uno sguardo sulla normativa di merito nell’età classica per poi soffermarsi sulla normativa del Tardo Impero che, incontrandosi con il Cristianesimo, fu soggetta a modificazioni in virtù delle spinte che la dottrina patristica sull’indissolubilità forniva. Si metterà in luce come il ius di cui si tratta, che vide la nascita del divortium quale risposta di un coniuge alle ingiustizie perpetrategli dall’altro, arrivò a doversi confrontare con la dottrina Cristiana che, nell’ambito matrimoniale, sostenendo la tutela del vincolo, riuscì a compiere un bilanciamento delle istanze sociali e religiose attraverso l’istituto della separazione come “pena misericordiosa”. La cuestión de la justicia y la pena puede ser individuada en la resolución de conflictos entre cónyuges a partir del derecho romano arcaico. Se delinea, por tanto, la evolución del instituto del divortium en el sistema jurídico romano desde su nacimiento como respuesta al ius vitae ac necis del marido sobre la mujer, pasando por el repudio unilateral y acabando con la disolución del vínculo. El análisis proseguirá considerando la normativa en la edad clásica hasta llegar a la normativa del Bajo Imperio que, encontrando el Cristianismo, sufrirá modificaciones a causa del empuje de la doctrina patrística sobre la indisolubilidad. Veremos como el ius en cuestión, que ve el nacimiento del divortium como respuesta de un cónyuge a las injusticias recibidas por parte del otro, tuvo que medirse con la doctrina

  20. Prevalenza di Campylobacter termotolleranti nel pollo da ingrasso in Italia

    Directory of Open Access Journals (Sweden)

    Giacomo Migliorati

    2010-12-01

    Full Text Available In Italia, nel periodo 5 febbraio-15 dicembre 2008, in applicazione della Decisione 516/2007/CE, sono state eseguite le attività di campionamento e analisi previste dal relativo Piano di sorveglianza. Tra gli obiettivi, la rilevazione dell’entità di contaminazione da Campylobacter termotolleranti nel pollo da ingrasso allevato in Italia. Sono stati selezionati 48 mattatoi avicoli, distribuiti in undici regioni italiane, in cui sono stati prelevati intestini ciechi e carcasse di pollo da ingrasso appartenenti a 393 lotti di macellazione. In 284 lotti (72,3% è stato isolato Campylobacter spp.: il 52,1% è risultato contaminato da C. jejuni, il 55,6% da C. coli e l’1,1% da C. lari. Nel 13,0% di quelli positivi (37 lotti sono stati rilevati contemporaneamente C. jejuni e C. coli. Dall’esame degli intestini ciechi, Campylobacter spp. è risultato presente in 251 lotti di macellazione (63,9%, in particolare, C. jejuni nel 48,2%, C. coli nel 50,6% e C. lari nell’1,2%. Le carcasse appartenenti a 182 lotti (46,3% sono risultate contaminate da C. jejuni nel 40,7% e C. coli nel 57,7% dei lotti positivi, C. lari non è stato isolato. I livelli di contaminazione riscontrati nelle carcasse sono risultati compresi tra 10 e 1,6 × 107 UFC/g.

  1. Il cavo orale nel paziente obeso

    OpenAIRE

    Faggella, Antonella

    2008-01-01

    Le condizioni di sovrappeso ed obesità anche in età evolutiva sono aumentate negli ultimi decenni al punto che, secondo l'Organizzazione Mondiale della Sanità, sono diventate un problema di salute pubblica in tutti i Paesi occidentali. Questa tesi è nata nell’obiettivo di individuare caratteristiche odontostomatologiche in pazienti affetti da obesità; il gruppo campione(80 pazienti, età media 10,5 anni) è stato suddiviso in due sottogruppi: sottogruppo A comprendente 54 pazienti affetti da...

  2. Calibrazioni a terra e prestazioni in volo di spettrometri ad immagine nel visibile e nel vicino infrarosso per l'esplorazione planetaria

    Science.gov (United States)

    Filacchione, Gianrico

    2006-10-01

    Nel corso dell’ultimo decennio l’esplorazione planetaria ha potuto beneficiare dei dati prodotti dagli spettrometri ad immagine: grazie a questa nuova classe di strumenti, realizzati per l’osservazione in remoto di superfici ed atmosfere planetarie, è possibile acquisire dati iperspettrali con elevati poteri risolutivi spaziali e spettrali. Il principale vantaggio offerto dagli spettrometri ad immagine, rispetto alle camere ed agli spettrometri puntuali, è rappresentato dalla capacità di misurare, identificare e mappare le unità composizionali delle superfici planetarie; queste informazioni permettono di investigare sia l’evoluzione geochimica delle superfici sia la dinamica e la composizione delle atmosfere. Sebbene i primi spettrometri ad immagine siano stati francesi (Phobos/ISM, Imaging Spectrometer for Mars) e statunitensi (Galileo/NIMS, Near Infrared Mapping Spectrometer), il nostro paese nel corso degli ultimi anni è stato in grado di proporre alla com unità spaziale internazionale degli strumenti dalle elevate prestazioni che sono stati infatti accettati come payload scientifici su diverse missioni interplanetarie: dai canali visibili di VIMS (Visual and Infrared Mapping Spectrometer) su Cassini (Nasa, JPL, ESA, ASI) e di OMEGA (Observatoire pour la Minéralogie, l’Eau, les Glacies et l’Activitè de Mars) su MarsExpress (ESA) ai due VIRTIS (Visible and Infrared Thermal Imaging Spectrometer) su Rosetta (ESA) e VenusExpress (ESA) fino a VIR-MS (Visible and Infrared Mapping Spectrometer) su Dawn (Nasa). In questo momento inoltre altri due spettrometri sono in avanzata fase di studio: JIRAM (Jovian InfraRed Auroral Mapper) su Juno (missione New Discovery Nasa) e VIHI (Visible and Infrared Hyperspectral Imager) integrato nel payload italiano di remote sensing SIMBIO-SYS di BepiColombo (missione cornerstone ESA). La realizzazione di uno spettrometro ad immagini da utilizzare su una missione interplanetaria richiede un’accurata analisi in fase

  3. Una Prefazione nel contesto del 13 novembre

    Directory of Open Access Journals (Sweden)

    Nicola Colaianni

    2015-11-01

    Full Text Available Come regolarsi verso le minoranze, ordinarsi coesi nelle società multiculturali e multireligiose dei giorni nostri? Domanda angosciosa e drammatica al cospetto dell’orrenda strage di Parigi, che ho negli occhi mentre scrivo. Come gli altri di cui continua la scia sanguinosa, da Charlie Hebdo fino all’11 settembre di New York, quest’ultimo atto terroristico mira a distruggere i valori fondamentali delle nostre società: la dignità della vita, la libertà, la solidarietà, la pace. Guerra, infatti, è la parola che si sente risuonare. “Siamo in guerra”, s’ode da ogni angolo dell’Occidente. “Guerra!”, allora, dev’essere la risposta, innanzitutto nei territori dominati dalle organizzazioni terroristiche: come se dopo la seconda guerra mondiale con la Carta delle Nazioni Unite non avessimo attributo al Consiglio di sicurezza l’azione di polizia internazionale proprio per evitare il “flagello della guerra”. E un atteggiamento bellico anche sul piano interno: tolleranza zero, chiusura dei confini, legislazione dell’emergenza e misure estreme di polizia nei nostri paesi, dove attraverso le comunità d'immigrati, magari ormai di seconda o terza generazione, s'infiltrano i terroristi. La casa bruci

  4. l'italiano che cambia: apocalisse o palingenesi? alcune riflessioni ...

    African Journals Online (AJOL)

    User

    idea that a real linguistic apocalypse is to be found on one hand, in what. Calvino ... nell'italiano contemporaneo da una prospettiva che, audacemente, definiamo ...... 'terrore semantico', cioè la fuga di fronte a ogni vocabolo che abbia di.

  5. Le ricerche di marketing nel settore bancario assicurativo

    OpenAIRE

    U. Filotto; A. Omarini; C. Saibene

    2012-01-01

    Il capitolo illustra come l'economia aziendale abbia sempre considerato rilevante nelle scelte strategiche, l'orientamento al cliente e ai competitori e come questo ritrovi una sua espressione anche nel contesto e nella cultura bancaria.

  6. Il mondo secondo la fisica quantistica segreti e meraviglie della scienza che sta cambiando la nostra vita

    CERN Document Server

    Fracas, Fabio

    2017-01-01

    Questo libro è un'avventura esclusiva e affascinante. Un viaggio, anche nel tempo, alla scoperta di qualcosa di nuovo e di straordinario: la Fisica Quantistica, nelle sue logiche, nelle sue potenzialità, nelle sue applicazioni e nei suoi possibili sviluppi. All'interno del volume vengono ricostruiti passo dopo passo i momenti fondamentali del pensiero quantistico, le questioni su cui si sono interrogati i più grandi scienziati degli ultimi decenni, e i diversi contesti nei quali si sono evoluti i principali modelli della Meccanica Quantistica. Sullo sfondo delle ricerche più attuali - come per esempio quella sulle onde gravitazionali che ha portato al Nobel per la Fisica 2017 -, vengono indagati anche i rapporti esistenti fra Fisica Quantistica, Relatività Einsteiniana e Teoria delle Stringhe. Inoltre, fra i tanti temi trattati nelle sue pagine, trovano spazio persino le incredibili ricadute che gli studi sulla Fisica Quantistica stanno avendo negli ambiti della medicina e delle ricerche sul cervello e s...

  7. Administrative environmental proceedings in the electromagnetic pollution field; Procedure autorizzatorie nel settore dell'inquinamento da campi elettromagnetici

    Energy Technology Data Exchange (ETDEWEB)

    Fracchia, Fabrizio [Bocconi Univ., Milano (Italy). IDC Istituto di diritto comparato

    2005-05-15

    The aim of the research at issue is to understand the general aspects of administrative environmental proceedings in the electromagnetic pollution field, as they are regulated in Italy both by the Law of February 22, 2001, No. 36 and by the art. 87 of the Legislative Decree of August 1, 2003, No. 259 (by means of this decree, Italy implemented a package of EU Directives -2002/19/EC, 2002/20/EC, 2002/21/EC and 2002/22/EC - in the TLC sector; entered into force on September 16, 2003, it introduced the so-called Unique Code on Electronic Communications) [Italian] Il lavoro ha ad oggetto l'analisi delle procedure autorizzatorie nel settore dell'inquinamento da campi elettromagnetici disciplinate dalla legge 22 febbraio 2001, n. 36 e dall'art. 87, d.lgs. 1 agosto 2003, n. 259 (codice delle comunicazioni elettroniche). Dopo aver registrato la presenza, all'interno di siffatti procedimenti, delle tradizionali funzioni assegnate al procedimento amministrativo, l'indagine individua nel dettaglio i principi stabiliti dalla normativa e i caratteri dell'autorizzazione, indugiando in particolare sul profilo del margine di discrezionalita sussistente in capo all'amministrazione. L'angustia di questo spazio di discrezionalita viene tra l'altro collegato alla rilevanza che, nel settore in esame, risulta avere il principio di precauzione. Specifica attenzione e dedicata al procedimento delineato dall'art. 87, d.lgs. 259/2003, cit.: vengono analizzati i titoli di legittimazione ivi disciplinati, i rapporti con l'istituto della valutazione di impatto ambientale, le fasi procedimentali, la conferenza di servizi e i limiti di applicabilita del meccanismo del silenzio assenso, il tutto avendo come riferimento essenziale il tema della precauzione, il principio di doverosita e la loro valenza normativa.

  8. Organizational models for new economy in the public and the private one; Modelli organizzativi per la new economy nel pubblico e nel privato

    Energy Technology Data Exchange (ETDEWEB)

    Amicucci, F.; Battaglia, F. [Rome Univ., Rome (Italy). Facolta' di Economia Aziendale; Di Marco, R.A. [ENEA, Funzione Centrale Informatica, Sede Centrale, Rome (Italy)

    2001-07-01

    globalization in progress has created numerous opportunities thanks to strong growth in the commerce and in the investments with the consequent increase of the income and prosperity. This amazing conjuncture has brought some economists to speak of a new economic model: an economy that is able use the resources of the innovation and the increases of productivity to give place to an economic development that him grows in the time. The explosion of the technological information represents the fulcrum of the increase of productivity that have fed the economic expansion of these last ten years. The optimization in the use of the resources and the continuous rationalization of the operations they are been able to happen thanks to the new solutions in net, to the easiest access to information through the use of Internet and to the exploitation of these new means of communications particularly in the transactions business to business. Technology and the economy of the nets therefore they are imposing like one of the most powerful drivers for economic growth, for the ability to create new places of employment and new professions to strengthen the ability to compete on the global markets. Arriving to the appointment late with the economy on line often means to not succeed in entering at all or to lose occasions that will be exploited without hesitation from more ready competitors to gather these new opportunities. To the enterprises therefore he requires to undertake the road of this change hocking resources in the organizational restructuring and in the technological adjustment. [Italian] Storicamente i modelli organizzativi hanno seguito una evoluzione che ha evidenziato un trend parallelo alla complessita' del mercato, presentando via via diversi meccanismi di coordinamento. Fino a ieri il modello vincente era quello gerarchico che pero' non e' di certo immune da limiti. A partire dall'Ottocento e soprattutto nel Novecento esperti di organizzazione hanno studiato

  9. Organizational models for new economy in the public and the private one; Modelli organizzativi per la new economy nel pubblico e nel privato

    Energy Technology Data Exchange (ETDEWEB)

    Amicucci, F; Battaglia, F [Rome Univ., Rome (Italy). Facolta' di Economia Aziendale; Di Marco, R A [ENEA, Funzione Centrale Informatica, Sede Centrale, Rome (Italy)

    2001-07-01

    globalization in progress has created numerous opportunities thanks to strong growth in the commerce and in the investments with the consequent increase of the income and prosperity. This amazing conjuncture has brought some economists to speak of a new economic model: an economy that is able use the resources of the innovation and the increases of productivity to give place to an economic development that him grows in the time. The explosion of the technological information represents the fulcrum of the increase of productivity that have fed the economic expansion of these last ten years. The optimization in the use of the resources and the continuous rationalization of the operations they are been able to happen thanks to the new solutions in net, to the easiest access to information through the use of Internet and to the exploitation of these new means of communications particularly in the transactions business to business. Technology and the economy of the nets therefore they are imposing like one of the most powerful drivers for economic growth, for the ability to create new places of employment and new professions to strengthen the ability to compete on the global markets. Arriving to the appointment late with the economy on line often means to not succeed in entering at all or to lose occasions that will be exploited without hesitation from more ready competitors to gather these new opportunities. To the enterprises therefore he requires to undertake the road of this change hocking resources in the organizational restructuring and in the technological adjustment. [Italian] Storicamente i modelli organizzativi hanno seguito una evoluzione che ha evidenziato un trend parallelo alla complessita' del mercato, presentando via via diversi meccanismi di coordinamento. Fino a ieri il modello vincente era quello gerarchico che pero' non e' di certo immune da limiti. A partire dall'Ottocento e soprattutto nel Novecento esperti di organizzazione hanno studiato un modello

  10. I concetti di "materia", "forma" e "ordine" nel pensiero teorico musicale medievale e contemporaneo

    Directory of Open Access Journals (Sweden)

    Cecilia Panti

    2011-01-01

    Full Text Available La dimensione teorica della musica occidentale, nella sua evoluzione storica, ha inevitabilmente fatto uso di concetti essenziali alla definizione di come il suono è musicalmente organizzato o organizzabile. Fra questi, risultano imprescindibili le nozioni di materia, forma e ordine, che implicano rispettivamente, nei pur diversi ambiti linguistici e contesti storico-filosofici di riferimento, ciò di cui è fatta la musica, ciò a cui la materia sonora tende, e come tale tensione è realizzata. Scopo di questo contributo è una valutazione d’insieme sulla valenza filosofica e l’uso di tali concetti nel pensiero musicale occidentale altomedievale e in quello del Novecento, che nonostante la distanza cronologica presentano convergenze significative. Nel Medioevo, un lungo processo di elaborazione teorico-pratica permise la matematizzazione dello spazio (e, più tardi, anche del tempo musicale, attraverso l’adattamento di moduli melodici, trasmessi oralmente, alle strutture scalari desunte dalla teoria greco-boeziana. La forma e l’ordo musicali furono quindi riferiti ai criteri fisico-matematici atti a distinguere nella materia sonora, in sé disorganica e indefinita, ciò che è musicale da ciò che non lo è. Tale concezione sparisce con l’affermarsi del sistema tonale, ove il suono fisico è concepito come “pre-formato” e “pre-ordinato” nella gamma scalare e nei vincoli attrattivi “naturali” degli armonici. In conseguenza, i concetti di forma e ordine abbandonano il contesto acustico, andando a definire i criteri teorici della composizione artistica, in linea con l’idea filosofica del loro esprimere la coerenza logico-sintattica dell’“insieme organico” (la Formenlehre teorizzata da Widmann. Nell’ambito del pensiero musicale del Novecento, la crisi del sistema tonale e la messa a punto di nuove modalità e tecniche di produzione del suono hanno riorientato la valenza significante e l’uso di questi tre concetti

  11. Il movimento degli scioperi nel XX secolo

    Directory of Open Access Journals (Sweden)

    Maria Theresa Schorer Petrone

    1983-06-01

    Full Text Available Cella, Gian Primo (organizador. Il movimento degli scioperi nel XX secolo. Bologna, Società Editrice Mulino, 1979. (primeiro parágrado do texto "O movimento das greves no século XX" constitui o resultado de laboriosa pesquisa realizada por um grupo de sociólogos— Guido 13oglioni, Lorenzo Bordogna, Gian Primo Cella, Pietro Kemeny, Giancarlo Provasi, Guido Romagnoli e Gian Enrico Rusconi — ligados às universidades de Turim, Parma, Trento e Cagliari.  Analisando com técnicas de quantificação, os mais variados aspectos das greves ocorridas desde o início deste século até 1970 na Grã Bretanha, Alemanha, Itália, França e nos Estados Unidos, e considerando esses niovimentos' os indicadores mais significativos da ação operária enquanto Manifestação sindical e reinvindicativa, acreditavam que poderiam de-teCtar as relações entre ação operária e as 'mudanças sociais.  O livro em questão é o resultado da primeira fase desta pesquisa em que se procurou reconstruir os movimentos grevistas e suas formas, chegando-se a construir modelos explicativos .

  12. Natural gas prices in Italy. Tariffs geographical distribution; Metano. Paese che vai, prezzo che trovi

    Energy Technology Data Exchange (ETDEWEB)

    Marrocchelli, A. [ENEA, Rome (Italy). Centro Ricerche Casaccia

    2000-11-01

    The annual report on services and activity carries at some evaluations of data concerned the natural gas market: total consumption, costs and prices in Italy and comparative evaluations with other european countries. [Italian] La relazione annuale sullo stato dei servizi e sull'attivita' svolta, presentata dal Presidente dell'Autorita' per l'energia elettrica e il gas, porta ad alcune considerazioni sui dati che riguardano il mercato del gas naturale: i consumi totali, i costi e i prezzi in Italia, il confronto con i costi e i prezzi praticati negli altri paesi europei.

  13. Buchi neri nel mio bagno di schiuma l’enigma di Einstein

    CERN Document Server

    Vishveshwara, C V

    2008-01-01

    "Le bolle stavano turbinando tutto intorno a me e massaggiavano il mio corpo ... Mentre me la godevo in questo fantastico bagno di bolle, i miei occhi si fecero pesanti e mi lasciaii trasportare in un dormiveglia sublimamente estatico". Così inizia l’incontro di Alfie con una vasca da bagno eccezionale e rivelatrice, acquistata da un vicino misterioso di nome Al. L’Enigma di Einstein, ovvero buchi neri nel mio bagno di schiuma, racconta la storia della teoria della gravitazione, dai suoi primordi fino agli ultimi sviluppi in astrofisica, focalizzandosi sulla teoria della relatività generale di Albert Einstein e sulla fisica dei buchi neri. Tramite conversazioni avvincenti e diagrammi scarabocchiati su tovaglioli di carta, si susseguono a ruota i rudimenti della relatività, dello spazio-tempo e di molti aspetti della fisica moderna. In scenette narrate con abilità pedagogica e notevole talento letterario, il lettore s’imbatterà nelle lezioni informali che un astrofisico cosmopolita tiene al suo amic...

  14. Il mito della precarietà: quando la precarietà è un valore che decostruisce l’immaginario della precarietà

    Directory of Open Access Journals (Sweden)

    Antonio Casillo

    2011-07-01

    Full Text Available Oggi la ricerca del posto “fisso” sembra essere il sogno irraggiungibile di molti giovani precari e la “flessibilità”, una parola d’ordine con cui si aspirava a riformare il mondo del lavoro e che tanto in voga sembrava essere negli anni ’90, è diventata sinonimo di incertezza, precarietà, se non addirittura sfruttamento. Ma c’era chi proprio nel lavoro che oggi definiremo precario, vedeva l’unica possibilità per restare libero dalle leggi di mercato e dai potenti poteri editoriali Newyorkesi. In questo articolo proviamo a gettare uno sguardo al mito letterario con cui, il rifiutare un posto fisso, significava rivendicare la propria libertà, un mito romantico certo, e sicuramente distante dalla realtà, ma che ha affascinato un’intera generazione di scrittori, poeti, musicisti. Da Jack London, passando attraverso la San Francisco Renaissance e la Beat Generation, fino ad arrivare al fenomeno della così detta generazione Hippy, il sogno americano sembrava essere quello di una frontiera mobile in cui, la strada, sembrava non avere mai fine.

  15. CheMentor Software System by H. A. Peoples

    Science.gov (United States)

    Reid, Brian P.

    1997-09-01

    CheMentor Software System H. A. Peoples. Computerized Learning Enhancements: http://www.ecis.com/~clehap; email: clehap@ecis.com; 1996 - 1997. CheMentor is a series of software packages for introductory-level chemistry, which includes Practice Items (I), Stoichiometry (I), Calculating Chemical Formulae, and the CheMentor Toolkit. The first three packages provide practice problems for students and various types of help to solve them; the Toolkit includes "calculators" for determining chemical quantities as well as the Practice Items (I) set of problems. The set of software packages is designed so that each individual product acts as a module of a common CheMentor program. As the name CheMentor implies, the software is designed as a "mentor" for students learning introductory chemistry concepts and problems. The typical use of the software would be by individual students (or perhaps small groups) as an adjunct to lectures. CheMentor is a HyperCard application and the modules are HyperCard stacks. The requirements to run the packages include a Macintosh computer with at least 1 MB of RAM, a hard drive with several MB of available space depending upon the packages selected (10 MB were required for all the packages reviewed here), and the Mac operating system 6.0.5 or later.

  16. Che cos'è la conoscenza? un universo in espansione

    CERN Document Server

    Franceschini, Guiliano

    2017-01-01

    Il testo propone un viaggio nell'universo della conoscenza, tra le galassie di conoscenza (religione, scienza, arte), nel cervello (percezione, apprendimento, memoria) e nell'etica (dalla conoscenza all'educazione). Le argomentazioni si espandono attraverso un registro comunicativo intuitivo, tra divulgazione e speculazione, attraverso esempi e riferimenti concreti, rivolgendosi in alcuni casi direttamente al lettore.

  17. Cinema ed enogastronomia nel portale turistico della Regione Toscana

    OpenAIRE

    Corinto, Gian Luigi

    2016-01-01

    Il presente lavoro tratta il caso della Regione Toscana che dal 2005 ha affidato alla Fondazione Sistema Toscana la missione di coordinare strategicamente le attività di promozione territoriale, tra cui le attività della film commission e del portale web dedicato al turismo. Lo scopo è quello di analizzare il modello di promozione degli itinerari enogastronomici e cinematografici come presentato dal portale turistico toscano. L'analisi dimostra che la scoperta dell'enogastronomia regionale è ...

  18. Infezioni gastroenteriche e fonti di rischio da balneazione nel mare Adriatico

    Directory of Open Access Journals (Sweden)

    N. Schinaia

    2003-05-01

    Full Text Available

    Obiettivi: gli obiettivi generali della ricerca sono stati: stimare un eccesso di rischio di insorgenza di gastroenterite a seguito di attività di balneazione o consumo di prodotti ittici nel mare Adriatico; misurare nuovi parametri microbiologici di inquinamento marino.

    Metodi: sono stati condotti i seguenti studi: 1 caso controllo; 2 uno studio di prevalenza (beach survey per descrivere la frequenza di alcune patologie (dell’orecchio, delle vie aeree superiori, della cute rispetto alla balneazione o meno; 3 identificazione di nuovi patogeni nelle acque di balneazione (quali virus o Cryptosporidium parvum.

    Risultati: l’analisi dei fattori di rischio nello studio caso controllo non ha evidenziato un aumento di gastroenterite associata a balneazione. Gli episodi gastroenterici osservati nei casi erano prevalentemente sostenuti da Salmonella sp. e la modalità di infezione era legata ad alcuni alimenti quali la maionese. Il risultato principale dello studio di beach survey è stato che la balneazione nel mare Adriatico non è associata ad un aumento significativo di patologie serie, quali gastroenterite acuta.

    Tuttavia, è stato possibile evidenziare un aumento di rischio statisticamente significativo per forme morbose lievi, quali congiuntivite e dermatite aspecifica, fra chi ha fatto il bagno in mare e chi no. Tale aumentato rischio è stato soprattutto osservato nei bambini e ragazzi al di sotto di 15 anni. I risultati di microbiologia sperimentale dimostrano il ruolo svolto dalle acque marine quale pabulum idoneo alla sopravvivenza delle oocisti di C. parvum. Sono stati validati protocolli di diagnostica molecolare per l’identificazione di enterovirus, rotavirus e reovirus nelle acque di balneazione.

    Conclusioni: l’epidemiologia può contribuire a studiare i rapporti fra balneazione e salute all’interno di una visione generale di salute

  19. Nascita e destino della soggettività. Dai ruoli professionali ai processi di cura, attraverso una lettura di "Quel che resta del giorno" di Kazuo Ishiguro

    Directory of Open Access Journals (Sweden)

    Gabriele Profita

    2017-07-01

    Full Text Available Questa riflessione affronta un tema assai rilevante per le professioni di cura, con uno sguardo particolare alla psicoterapia. Per chiarire il ruolo della soggettività e della nascita e maturazione di un ruolo professionale riporterò un’analisi di un testo letterario attraverso il quale sarà più agevole scoprire come si forma l’identità di un ruolo professionale e come si avvia alla sua maturazione e alla sua codificazione. In particolare quali sono i rischi legati ad una sua rigida codificazione rivolta alla sua normatività tecnica? Mi propongo di tracciare un confronto con alcune forme di costruzione della soggettività che nel corso dei secoli hanno fondato il modello dell’uomo occidentale nelle sue articolazioni professionali.

  20. IL LINGUAGGIO DEL DIRITTO E DELLA BUROCRAZIA NEL XIX SECOLO TRA APERTURE E ISTANZE PURISTICHE

    Directory of Open Access Journals (Sweden)

    Francesca Fusco

    2016-09-01

    Full Text Available L’articolo prende in esame la produzione lessicografica dell’Ottocento dedicata alla lingua degli uffici. Il linguaggio del diritto e quello dell’amministrazione (considerato una derivazione meno prestigiosa del primo hanno da sempre costituito una lingua distinta da quella parlata comunemente. Tale lingua, ancorata alla tradizione latina fino al XVIII secolo, a partire dagli ultimi anni del Settecento subisce un forte rinnovamento in virtù dell’influenza francese, giunta prima attraverso le idee rivoluzionarie e poi con la dominazione napoleonica. Ulteriori innovazioni nella lingua giuridico-amministrativa sono portate dall’unificazione nazionale e dalla conseguente necessità di avere una lingua comune atta a esprimere i concetti tecnici richiesti dalle istituzioni. Tutto ciò fa sì che la lingua degli uffici diventi un coacervo di arcaismi, neologismi, dialettismi e stranierismi, spesso oggetto di critica da parte dei puristi più intransigenti. Da qui i numerosi i repertori lessicali e i dizionari che, a partire dall’Elenco del Bernardoni e dalle Voci ammissibili del Gherardini, si occupano della lingua delle leggi e dell’amministrazione su posizioni più o meno puristiche, nel più ampio contesto di costruzione di un italiano lingua nazionale. The language of law and bureaucracy in the  19th century, from innovation to purism The article examines nineteenth century lexicographical production dedicated to language used in offices. The language of law and administration (the latter considered a less prestigious derivation of the former has always been a distinct language from that commonly spoken. This type of language, anchored to the Latin tradition until the eighteenth century, underwent a major change due to French influence, first through revolutionary ideas and then with Napoleonic domination. Further innovations in legal and administrative language were brought about by national unification and the consequent need for

  1. Ricerca della Supersimmetria ad ATLAS nel canale h->bb

    CERN Document Server

    Di Sipio, Riccardo

    Il Modello Standard (MS), fino ad una scala di energie di circa 100GeV, e' attualmente la teoria che descrive con il migliore accordo sperimentale il mondo delle particelle elementari e le loro interazioni. Tuttavia, e' ampiamente riconosciuto che questa non pu`o essere considerata una “teoria ultima” per diverse ragioni. Ci si aspetta quindi che che il MS sia valido fino ad una scala energetica di cutoff MW ∼100GeV, oltre la quale bisogna ricorrere ad una “Nuova Fisica”. Questa scala di energie viene spesso identificata con quella delle Grand Unified Theories (GUT), in cui sono unificate le interazioni Forte ed Elettrodebole, ed e' nell’ordine di MGUT ∼ 10^15 GeV. L’unico aspetto non ancora verificato sperimentalmente del MS e' il settore di Higgs. La supersimmetria fornisce una soluzione al problema della gerarchia perch ́e implica un ugual numero di gradi di libert`a bosonici e fermionici, i quali danno contributi di segno opposto nelle correzioni a loop che cancellano esattamente le diver...

  2. Studi d'idoneità ambientale su grande scala a fini conservazionistici: il caso del Capriolo italico nel P.N. del Pollino

    Directory of Open Access Journals (Sweden)

    Alessandro Massolo

    2003-10-01

    Full Text Available Nonostante la loro grande diffusione negli ultimi decenni, i modelli di valutazione ambientale (MVA trovano tuttoggi scarsa applicazione pratica. Molte difficoltà s?incontrano non solo nel loro concreto utilizzo, ma anche nella validazione e applicazione. Spesso, il problema fondamentale consiste nella difficoltà di reperire dati biologici e geografici su grande scala che siano attendibili e omogenei. La gestione spesso però richiede valutazioni su grande scala e il problema diventa quindi rilevante. Nel presente lavoro sono descritte alcune procedure di modellizzazione e verifica a partire dai risultati di uno studio condotto sul capriolo nel Parco Nazionale del Pollino. A tale scopo, sono state utilizzate due delle più diffuse tecniche statistiche multivariate (Analisi della Funzione Discriminante e Regressione Logistica, confrontando modelli formulati con e senza l?uso di indici di complessità del paesaggio come variabili predittive. L?analisi è stata condotta a grande scala compatibilmente con le stime delle dimensioni degli home range della specie. Lo sviluppo di più modelli ha permesso di verificare l?adeguatezza delle tecniche utilizzate e l?efficacia dei più comuni indici di paesaggio, nel predire la distribuzione della specie. Le analisi ambientali sono state effettuate mediante l?uso di ArcView 3.2 e della sua estensione Patch Analyst, a partire da cartografia informatizzata come la carta di uso del suolo Corine Land Cover e i punti quotati IGMI. I modelli sono stati formulati da un set di dati provenienti dell?Appennino centro-settentrionale e validati con un set di dati locali (area di distribuzione e avvistamenti diretti, raccolti tra il 2001 e il 2003. Il confronto tra i modelli si è basato sulle loro capacità di classificazione (sensitività e sensibilità. Gli indici di paesaggio sono risultati critici nel predire correttamente la distribuzione della specie. Nella fase di validazione sui dati di partenza 3 dei 4 modelli

  3. A crèche on the Meyrin CERN site

    CERN Multimedia

    Association du personnel

    2013-01-01

    A few months ago (see Echo 175) we announced the opening, at the end of August, of a crèche at the CERN Staff Association’s nursery school. After a very active summer, where a new floor was added to the canteen building, the new school year started in excellent conditions and, as expected, the new crèche opened on Tuesday 27 August. This crèche, with 13 full-time equivalent places, can accept 18 children aged between three months and two years in a space fully refitted to care for the little ones. A specially designed space for breastfeeding helps mothers working on the site to respect their baby's rhythm. In compliance with the standards of supervision in the canton of Geneva six educators take care of the children in shifts. This new space is fully integrated in the nursery school so that now the crèche, Kindergarten and school of the CERN Staff Association can welcome children aged from three months to six years, from Monday to Friday, and...

  4. à l'encoche sèche

    African Journals Online (AJOL)

    Chez Hevea brasiliensis, la production de latex est affectée par l'encoche sèche qui se manifeste par l'arrêt de l'écoulement de ... coagulation pour donner le caoutchouc naturel. ..... relationship between latex sugar content, the metabolic ...

  5. Crèche and School - Important dates

    CERN Multimedia

    Staff Association

    2018-01-01

    Enrolments 2018-2019 Enrolments to the Crèche and School for the school year 2018-2019 will take place on 5, 6 and 7 March 2018 from 10 am to 1 pm at the Crèche and School of the CERN Staff Association. Registration forms will be available from Thursday 1st March 2018. For more information, please visit the website: http://nurseryschool.web.cern.ch/. * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * Saturday 3 March 2018 Open Day at Crèche and School of the CERN Staff Association Are you considering enrolling your child to the Crèche and School of the CERN Staff Association? If you work at CERN, then this event is for you: come visit the school and meet the Management on Saturday 3 March 2018 from 10 to 12 am It will be our pleasure to present to you our structure, its projects and premises, and answer any questions you may have. Please sign up for one of the two sessions via Doodle before Friday 2 March 2018: htt...

  6. Che cos'è la vita ?, Scienza e umanesimo

    CERN Document Server

    Schrödinger, Erwin

    1988-01-01

    A cento anni dalla nascita di Erwin Schrödinger (Viena 1887), il suo pensiero e il suo lavoro mantengono inalterati la loro attualità, come dimostra la nuova pubblicazione di molti dei suoi testi e i numerosi convegni che gli vengono dedicati.

  7. Enzymatic processes in the textile industry; Enzimologia nel tessile. Biopreparazione del cotone ed uso degli enzimi nell'industria tessile. 1. Parte

    Energy Technology Data Exchange (ETDEWEB)

    Galante, Y. [Lamberti SpA, Albizzate, VA (Italy)

    2001-04-01

    In the last years, the textile industry has become one of the main field of industrial applications of enzymes. From traditional desizing to enzymatic stone washing to bio polishing of cellulosic fibers to protease treatment of silk and wool to catalase utilization after bleaching, textile processing has evolved into a field of primary importance for modern enzymology. A number of new recombinant and/or bioengineered enzymes (e.g., cellulases) have been recently introduced into textile processing and finishing dye houses. [Italian] Nel presente articolo, suddiviso in due parti, viene presentato un approccio enzimatico integrato nella filiera tessile, in cui dimostriamo che e' possibile e conveniente applicare in un singolo processo differenti enzimi (ad esempio, amilasi, pectinasi, catalasi, cellulasi) in successione od in contemporaneo, in combinazione con ausiliari chimici facilmente biodegradabili.

  8. Care and education in the Danish Créche

    DEFF Research Database (Denmark)

    Broström, Stig; Hansen, Ole Henrik

    2010-01-01

    This article seeks to identify the relation between policy and lived life, for the small child in the Danish crèche. To accomplish this, the article integrates demography, traditions, national curriculum and psychological, educational, and recent developments in research. It is an attempt to reveal...... research articles. It is used in the exploration of meanings of political, social, and cultural phenomena as experienced by the involved individuals themselves, in their natural context. It is a presumption that the child’s development is a consequence of emotional and cognitive stimulation. To outline...... that, it is vital to emphasize the influence that policy causes on educational practice in the crèche, e.g., the conceptualization of education and care....

  9. Che-1 gene silencing induces osteosarcoma cell apoptosis by inhibiting mutant p53 expression

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Ming; Wang, Dan, E-mail: danwangwdd@163.com; Li, Ning

    2016-04-22

    The transcriptional cofactor Che-1 is an RNA polymerase II (Pol II) which is involved in tumorigenesis, such as breast cancer and multiple myeloma. Che-1 can also regulate mutant p53 expression, which plays roles in many types of cancer. In this study, we aimed to investigate the effects and specific mechanism of Che-1 in the regulation of osteosarcoma (OS) cell growth. We found that Che-1 is highly expressed in several kinds of OS cells compared with osteoblast hFOB1.19 cells. MTT and flow cytometry assays showed that Che-1 depletion by siRNA markedly suppressed MG-63 and U2OS cell proliferation and promoted apoptosis. The chromatin immunoprecipitation (ChIP) assay verified the presence of Che-1 on the p53 promoter in MG-63 and U2OS cells carrying mutant p53. Further studies showed that Che-1 depletion inhibited mutant p53 expression. Notably, our study showed that the loss of Che-1 inhibits proliferation and promotes apoptosis in MG-63 cells by decreasing the level of mutant p53. Therefore, these findings open the possibility that silencing of Che-1 will have therapeutic benefit in OS. - Highlights: • Che-1 is highly expressed in several kinds of OS cells. • Che-1 depletion suppressed MG-63 and U2OS cell growth. • Che-1 is existed in the p53 promoter in MG-63 and U2OS cells. • Che-1 depletion inhibited mutant p53 expression. • Che-1 depletion inhibits cell growth by decreasing the level of mutant p53.

  10. Crystallization and preliminary X-ray crystallographic analysis of Thermotoga maritima CheA P3-P4-P5 domains in complex with CheW

    International Nuclear Information System (INIS)

    Park, SangYoun; Kim, Keon Young; Kim, Sunmin; Crane, Brian R.

    2012-01-01

    T. maritima CheA P3-P4-P5 domains were crystallized in complex with CheW. Low-resolution diffraction data were collected to ∼8 Å using synchrotron X-ray radiation. The CheA–CheW complex plays a key role in bacterial chemotaxis signal transduction by initiating phosphotransfer to response regulators via coupling to the chemoreceptors. CheA (P3-P4-P5 domains) and CheW from Thermotoga maritima were overexpressed in Escherichia coli and crystallized as a complex at 298 K using ammonium dihydrogen phosphate as a precipitant. X-ray diffraction data were collected to ∼8 Å resolution at 100 K using synchrotron radiation. The crystal belonged to space group I222 or I2 1 2 1 2 1 , with unit-cell parameters a = 184.2, b = 286.4, c = 327.7 Å. The asymmetric unit may contain six to ten CheA–CheW molecules

  11. L’ITALIANO CHE INCLUDE: LA LINGUA PER NON ESSERE STRANIERI. ATTENZIONI E PROPOSTE PER UN PROGETTO DI FORMAZIONE LINGUISTICA NEL TEMPO DELLA PLURALITÀ

    Directory of Open Access Journals (Sweden)

    Graziella Favaro

    2016-09-01

    Thoughts and proposals for language training in a plural world We present a document created by Group 1 of the National Observatory for the integration of foreign students and inter-culture “Teaching Italian as a second language and an enhancement of multilingualism”. The paper explores the aspects of Italian L2 in multicultural contexts and situations, the type of learners and their individual needs. Based on this analysis, thoughts and proposals on language training for adults and children, on the enhancement of multilingualism and on teacher training are formulated.

  12. Vertebroplasty in the treatment of back pain; La vertebroplastica nel trattamento delle sindromi algiche del rachide

    Energy Technology Data Exchange (ETDEWEB)

    Muto, Mario; Muto, Emanuale; Izzo, Roberto; Diano, Alvaro Antonio; Lavagna, Arcangelo; Di Furia, Ugo [Istituto di Neuroradiologia AORN Cardarelli, Napoli (Italy)

    2005-03-01

    e sotto controllo TC in 5 pazienti affetti da neoplasia vertebrale. Non abbiamo mai effettuato la flebografia prima del trattamento. In 55 pazienti l'approccio e' stato bilaterale, mentre nei rimanenti e' stato monolaterale. Il posizionamento dell'ago e la iniezione del cemento e' stata effettuata sempre sotto controllo scopico. Le quantita' di cemento iniettate sono state variabili a livello dorsale o lombare con volumi compresi tra 12 e 4 ml. Il cemento utilizzato e' a bassa viscosita' opacizzato con diossido di zirconio, tantalio o solfato di bario sterile. Risultati: I risultati sono stati sicuramente migliori nei pazienti affetti da osteoporosi e da angiomi vertebrali (successo nel 95% e 90% dei casi nel giro di 24-72 ore) rispetto ai pazienti affetti da neoplasie secondarie del rachide (successo del 77% dei casi). Abbiamo riscontrato fughe di cemento extravertebrali vascolari o discali in 39 pazienti ma solo in 2 casi tali fughe hanno determinato la comparsa di una sintomatologia clinica radicolare per diffusione epidurale. Non abbiamo riscontrato mai nella nostra esperienza fratture a vertebre adiacenti trattate con vertebroplastica. Discussione e conclusioni: Sebbene i primi casi di vertebroplastica siano stati effettuati per il trattamento degli angiomi vertebrali, si e' subito passati ad applicare tale tecnica anche al trattamento dei crolli vertebrali da osteoporosi o da lesioni secondarie. La RM svolge un ruolo chiave nella corretta selezione dei pazienti da trattare mentre la TC puo' essere utile per valutare l'integrita' del muro posteriore del metamero. La controindicazione assoluta e' data da infezioni sistemiche e locali mentre quelle relative dalla estensione epidurale della neoplasia, dalla vertebra plana, dalla presenza di segni clinici di interessamento mielico o radicolare e da eventuali disturbi della coagulazione. I risultati da noi ottenuti evidenziano un successo che e

  13. Crystallization and preliminary X-ray crystallographic analysis of CheW from Thermotoga maritima: a coupling protein of CheA and the chemotaxis receptor

    International Nuclear Information System (INIS)

    Park, SangYoun; Crane, Brian R.

    2011-01-01

    CheW from T. maritima has been crystallized (space group P6 3 , unit-cell parameters a = b = 61.265, c = 361.045 Å). Diffraction data have been collected to 3.1 Å resolution using synchrotron X-ray radiation. The CheW protein plays a key role in bacterial chemotaxis signal transduction by coupling CheA to chemotaxis receptors. CheW from Thermotoga maritima has been overexpressed in Escherichia coli and crystallized at 298 K using ammonium sulfate as a salt precipitant. X-ray diffraction data have been collected to 3.10 Å resolution at 100 K using synchrotron radiation. The crystal belonged to space group P6 3 , with unit-cell parameters a = b = 61.265, c = 361.045 Å. The asymmetric unit may contain four to six CheW molecules

  14. Finally, a crèche at CERN!

    CERN Multimedia

    Anaïs Schaeffer

    2013-01-01

    After many years of discussion, the CERN Staff Association’s first crèche will open its doors in September to welcome up to 20 babies and toddlers.   A delicate operation: the installation of 11 modules above the Nursery's School canteen. Image: Sigrid Knoops. The CERN Staff Association’s Nursery School, which will soon turn 50, is pleased to announce the establishment of CERN’s first crèche. This project, which has come to fruition over the past academic year with the support of the CERN Management, meets an established and growing need among the Laboratory’s personnel and users. As a modular construction, the Nursery School’s new second floor was assembled above the existing canteen in a matter of days. Its 11 modules are ultra-modern – they’re even equipped with underfloor heating. “Thanks to this extension, we will be able to accept around twenty babies at the start of the academ...

  15. Perché io credo in colui che ha fatto il mondo

    CERN Document Server

    Zichichi, Antonino

    1999-01-01

    Fin troppo spesso si sente dire che il mondo della scienza e quello della religione sono in completa opposizione e che non condividono alcuna esperienza o caratteristica in comune. Nulla potrebbe essere più falso di queste affermazioni secondo Antonino Zichichi, che in quest'opera afferma come la ricerca scientifica e l'esperienza religiosa abbiano in comune molto più di quanto si possa pensare.

  16. QUESTIONI ATTRIBUTIVE NEL MEDIOEVO SPAGNOLO "IL LIBRO DE ALEXANDRE"

    OpenAIRE

    MERCURI, LOREDANA

    2011-01-01

    Oggetto di studio è stato il Libro de Alexandre, un poema spagnolo della prima metà del XIII secolo, di cui si è tentata un'attribuzione più certa utilizzando un nuovo sistema informatico. Gli studi critici finora effettuati, infatti, sono discordi sull’argomento, poiché i due manoscritti conservati dell’opera riportano nella strofa finale del poema il nome di Juan Lorenzo de Astorga (ms. O) e il nome di Gonzalo de Berceo (ms. P). Nell'elaborato dopo aver introdotto i tratti che caratterizzan...

  17. Heterozygous Che-1 KO mice show deficiencies in object recognition memory persistence.

    Science.gov (United States)

    Zalcman, Gisela; Corbi, Nicoletta; Di Certo, Maria Grazia; Mattei, Elisabetta; Federman, Noel; Romano, Arturo

    2016-10-06

    Transcriptional regulation is a key process in the formation of long-term memories. Che-1 is a protein involved in the regulation of gene transcription that has recently been proved to bind the transcription factor NF-κB, which is known to be involved in many memory-related molecular events. This evidence prompted us to investigate the putative role of Che-1 in memory processes. For this study we newly generated a line of Che-1(+/-) heterozygous mice. Che-1 homozygous KO mouse is lethal during development, but Che-1(+/-) heterozygous mouse is normal in its general anatomical and physiological characteristics. We analyzed the behavioral characteristic and memory performance of Che-1(+/-) mice in two NF-κB dependent types of memory. We found that Che-1(+/-) mice show similar locomotor activity and thigmotactic behavior than wild type (WT) mice in an open field. In a similar way, no differences were found in anxiety-like behavior between Che-1(+/-) and WT mice in an elevated plus maze as well as in fear response in a contextual fear conditioning (CFC) and object exploration in a novel object recognition (NOR) task. No differences were found between WT and Che-1(+/-) mice performance in CFC training and when tested at 24h or 7days after training. Similar performance was found between groups in NOR task, both in training and 24h testing performance. However, we found that object recognition memory persistence at 7days was impaired in Che-1(+/-) heterozygous mice. This is the first evidence showing that Che-1 is involved in memory processes. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.

  18. CHE COSA RESTA DI CHERUBINI OGGI? DUE CASI DI STUDIO

    Directory of Open Access Journals (Sweden)

    Emanuele Miola

    2016-09-01

    Full Text Available A partire dagli anni Duemila, il fenomeno delle cosiddette risorgenze dialettali si è manifestato, nel panorama linguistico italiano, anche attraverso l’emergenza dei dialetti negli ambiti propri della Comunicazione Mediata dal Computer e, specialmente, sui siti internet creati ‘dal basso’, come l’enciclopedia libera e multilingue online Wikipedia. In questo articolo, si esaminerà il lascito di Cherubini e del suo Vocabolario milanese-italiano sull’edizione regionale lombarda della Wikipedia: gli articoli di quest’ultima saranno passati in rassegna, sia dal punto di vista ortografico, comparando le scelte del lessicografo milanese con quelle più in voga online, sia dal punto di vista morfo-sintattico, discutendo in questo secondo caso la presenza e la produttività di alcuni verbi sintagmatici. What remains of Cherubini today? Two case studies Since the beginning of the twenty-first century, the phenomenon of dialect resurgence has manifested in Italy through the emergence of dialects in Computer Mediated Communication, especially, on bottom-up created Web sites, like the free, multilingual, online encyclopedia Wikipedia. In this article, we will examine the legacy of Cherubini and his Milanese-Italian dictionary on the regional Lombard version of Wikipedia. We will review the articles both in terms of spelling, comparing the choices of Milanese lexicographer with those most utilized currently online, and from a morpho-syntactic point of view, discussing the presence and the productivity of some phrasal verbs.

  19. Dal carnalis concubitus all’heretica pravitate. Sesso, matrimonio ed eresia nel tribunale di Jacques Fournier (1318-1325

    Directory of Open Access Journals (Sweden)

    Irene Bueno

    2009-07-01

    Full Text Available Amore, sessualità e matrimonio sono tematiche ricorrenti nei documenti inquisitoriali due-trecenteschi ed entrano con forza nel registro di Jacques Fournier, vescovo-inquisitore di Pamiers (1318-1325. Il significato di questi racconti non si può comprendere senza chiarire quale interesse essi rivestissero agli occhi dell’autorità ecclesiastica: i rapporti adulterini, incestuosi, omosessuali di imputati e imputate sono in effetti mediati dalla figura di Fournier nell’ambito di una corte che sovrappone competenze vescovili e inquisitoriali. Collegando condotte ed affermazioni licenziose alle posizioni antimatrimoniali dei catari, il vescovo stabilisce in sede processuale un nesso fra carnalis concubitus extraconiugale ed heretica pravitate. Ogni trasgressione allo spazio sacro del matrimonio diventa indizio di eresia e contribuisce a disegnare un ritratto dissoluto e vizioso di eretici ed eretiche, funzionale al successo e alla popolarità della repressione.Love, sex, and marriage are recurring themes in inquisition records of the thirteenth and fourteenth centuries, and especially in the register of Jacques Fournier, bishop-inquisitor of Pamiers from 1318 to 1325. The significance of these confessions cannot be  understood without indicating the ecclesiastical authority’s interest: adultery, incest and homosexual relations of the accused are in fact mediated by Fournier within a court that superimposes episcopal and inquisitorial competences. Linking licentious conducts and libertine statements to the anti-matrimonial tenets of the Cathars, the bishop establishes, during the trial, a connection between sexual sin and heretical crime. Any transgression of the sacred space of marriage is understood to be an indication sign of heresy and contributes to depict a dissolute and vicious portrait of the heretical believers, which is ultimately functional to the success and popularity of repression.

  20. Altruisti, cooperativi e morali: Perché è più facile esserlo domani che oggi

    NARCIS (Netherlands)

    Giacomantonio, M.; de Dreu, C.K.W.

    2013-01-01

    Un portafogli smarrito e ritrovato. Una donazione ad un ente che si occupa di ricerca sulle malattie degenerative. Una tangente non accettata. Un divorzio che si conclude senza il ricorso al tribunale. Alla base di tutti questi eventi vi è la tendenza umana a cooperare, ad essere altruisti e ad

  1. Discovering Che-1/AATF: a new attractive target for cancer therapy

    Directory of Open Access Journals (Sweden)

    Simona eIezzi

    2015-04-01

    Full Text Available The transcriptional cofactor Che-1/AATF is currently emerging as an important component of the DNA damage response machinery, the complex signaling network that maintains genome integrity and prevents tumorigenesis. Moreover this protein is involved in a wide range of cellular pathways, regulating proliferation and survival in both physiological and pathological conditions. Notably, some evidence indicates that dysregulation of Che-1/AATF levels are associated with the transformation process and elevated levels of Che-1/AATF are required for tumor cell survival. It is for these reasons that Che-1/AATF has been regarded as an attractive, still theoretical, therapeutic target for cancer treatments. In this review, we will provide an updated overview of Che-1/AATF activities, from transcriptional regulation to DNA damage response.

  2. I Samaritani nel contesto storico, geografico e religioso

    Directory of Open Access Journals (Sweden)

    Stanisław Wypych

    2005-09-01

    Full Text Available Il termine „Samaritani” deriva dal verbo ebraico šāmar “vigilare”, „custodire”. Gli Assiri, dopo aver conquistato la capitale Samaria (722 deportarono circa 40 mila Israeliti in Mesopotamia i quali conservarono la tradizione dei profeti del Regno del Nord: Elia, Eliseo, Amos ed Osea. Nella regione di Samaria rimasero circa 100 mila Israeliti, ma vi arrivarono molti altri popoli dalla Siria, Assiria, Persia, Media e dal mondo ellenistico. Così si formò una comunità assai composita che adottò un rito speciale. Dopo il periodo di deportazione (di esilio, quando i rimpatriati Giudei si dedicarono al rinnovamento del culto e alla ricostruzione del tempio di Gerusalemme, i Samaritani espressero il desiderio di parteciparvi. Ma il loro desiderio fu respinto dai rimpatriati. Allora i Samaritani, per ragioni politiche, si opposero alla ricostruzione delle mura di Gerusalemme e costruirono un proprio tempio sul monte Garizim (328 che fu distrutto da Giovanni Ircano (128, procurando una profonda spaccatura tra Giudei e Samaritani. Spesso si parla di „scisma dei Samaritani”. In realtà si tratta piuttosto di due correnti religiose, basate sul Pentateuco. I Samaritani sono monoteisti, considerano Mosè come un profeta, indirizzano le preghiere a Dio tramite i patriarchi e Mosè, accettano il Pentateuco, considerano il monte Garizim come un luogo santo, hanno il proprio calendario liturgico e riti religiosi. Gesù non predicò la buona novella ai Samaritani (non si trovano tracce nella fonte Q e in Marco. I due evangelisti testimoniano che Gesù non era contro i Samaritani (vedi la parabola del buon Samaritano – Luca 10,30-35 ed il colloquio con la Samaritana – Giov. 4,4-42. I discepoli di Gesù ben presto, con un notevole successo, cominciarono a predicare il messaggio del loro Maestro ai Samaritani (cf. Atti 8,1-6.

  3. La moisson des Argonautiques et la poétique d’Apollonios dans le chant III Harvesting in Argonautica and Apollonios' poetics in book III La mietitura delle Argonautiche e la poetica di Apollonio nel canto III

    Directory of Open Access Journals (Sweden)

    Françoise Létoublon

    2013-05-01

    Full Text Available Un’analisi comparativa dei paragoni presenti nel canto III delle Argonautiche e di quelli omerici mostra che Apollonio s’ispira fortemente ai suoi modelli, in modo particolare nella forma ed nel lessico. Eppure, nella maggior parte dei casi, egli porta i confronti omerici lontano dal loro contesto d’origine per adattarli ai suoi intenti. Nella prima parte del canto III, i similitudini rispondono alla volontà comune di evidenziare le pene che l’amore suscita nell’animo e nel comportamento di Medea. Nella seconda parte, le prove che Giasone deve superare danno luogo, in modo sorprendente, ad immagini guerriere funzionali alla descrizione dei preparativi, ma in seguito Apollonio ricorre ad un lessico artigianale ed agricolo per evocare dei compiti che consistono effettivamente nell’aggiogare e tirare una coppia di tori, in un’aratura, in una semina ed in una mietitura. L’aspetto più notevole è che molti paragoni riuniti verso la fine del canto non sembrano trovare un corrispondente in alcun modello omerico, come se il racconto di questa prova inedita avesse progressivamente liberato Apollonio dalla sua dipendenza da Omero.A detailed survey of the similes in Argonautica III, compared to the Homeric similes, shows that Apollonius very largely draws his inspiration from his models, mainly in the form and the words. However, he shifts the Homeric similes away from their original context to re-model them to his personal intention. In the first part of book III, the similes follow a common desire to show how many troubles love provokes in Medea’s soul and behaviour. In the second part, Jason’s ordeals provide the occasion for war images describing the preparation of the hero, but thereafter Apollonius resorts to a craftsmanship and agricultural register for evoking tasks that actually consist of hitching up, ploughing, sowing and harvesting. The most remarkable fact is that some comparisons grouped near the end of the book seem

  4. NELS 2.0 - A general system for enterprise wide information management

    Science.gov (United States)

    Smith, Stephanie L.

    1993-01-01

    NELS, the NASA Electronic Library System, is an information management tool for creating distributed repositories of documents, drawings, and code for use and reuse by the aerospace community. The NELS retrieval engine can load metadata and source files of full text objects, perform natural language queries to retrieve ranked objects, and create links to connect user interfaces. For flexibility, the NELS architecture has layered interfaces between the application program and the stored library information. The session manager provides the interface functions for development of NELS applications. The data manager is an interface between session manager and the structured data system. The center of the structured data system is the Wide Area Information Server. This system architecture provides access to information across heterogeneous platforms in a distributed environment. There are presently three user interfaces that connect to the NELS engine; an X-Windows interface, and ASCII interface and the Spatial Data Management System. This paper describes the design and operation of NELS as an information management tool and repository.

  5. L'affresco di Cola d'Amatrice nel chiostro del convento dell'Annunziata ad Ascoli Piceno / The fresco by Cola dell’Amatrice in the refectory of the Annunziata convent in Ascoli Piceno

    Directory of Open Access Journals (Sweden)

    Monica Peroni

    2012-07-01

    Full Text Available La compulsazione di alcuni fondi conservati negli archivi di Ancona e Ascoli Piceno ha consentito di ricostruire parzialmente la vicenda conservativa di un pregevole affresco realizzato da Cola dell’Amatrice nel Refettorio della chiesa dell’Annunziata di Ascoli Piceno. Dalla prima notizia relativa ad una proposta di distacco, agli inizi del Novecento, fino al definitivo rifiuto di tale intervento nel 1916, i documenti rinvenuti rivelano alcuni passaggi di un lungo dibattito che vide  opinioni e personalità diverse confrontarsi - e spesso contrapporsi - sul complesso tema del restauro. E’ grazie alla ferma decisione con cui il Ministero della Pubblica Istruzione ne impedì il distacco se, ancora oggi, è possibile apprezzare l’affresco del Filotesio nella sua «sede naturale, nel proprio luogo di origine, dove ess[o] ha[nno] un significato ed un valore assolutamente speciali» (Icilio Bocci. The consultation of some fonds held in the archives of Ancona and Ascoli Piceno allowed to partially reconstruct the conservative vicissitude of the fine fresco painted by Cola dell’Amatrice in the refectory of the Annunziata convent in Ascoli Piceno. From the first news regarding a proposal for the fresco’s detachment, until the definitive rejection of such operation in 1916, founded documents reveal some steps of a long controversy that saw different opinions and personalities contending – and often opposing – on the complex issue of restoration. Thanks to the firm decision of the Ministry of Education, that prevented the fresco’s detachment, today it is possible to contemplate it «in its natural home, in itsplace of origin, where it has a very special meaning and value» (Icilio Bocci.

  6. Fra uncini e uncinate. Riflessioni sulla parodia nel Cinquecento

    Directory of Open Access Journals (Sweden)

    Nicola Catelli

    2010-06-01

    Full Text Available L’articolo prende in considerazione una sequenza del poemetto pornografico La Puttana errante di Lorenzo Venier (1530 ca. che presenta una versione parodica dell’episodio di Angelica e dell’eremita narrato nell’Orlando furioso. Dopo un puntuale raffronto fra i due testi, l’analisi giunge a constatare come tale parodia venga utilizzata non tanto in termini di contestazione o correzione di un modello illustre, quanto come proposta critica di un rapporto con le fonti letterarie stratificato e ironicamente distaccato.This article analyses a sequence of Lorenzo Venier’s pornographic poem La Puttana errante (about 1530 that offers a parodic version of the episode of Angelica and the hermit in Orlando furioso. After a comparison between the texts, the article suggests that Venier’s parody is not a contestation or correction of the illustrious model, but a proposal of a stratified, detached and ironic relation with the sources.

  7. His Excellency Professor Dr Che-Ho Wei, Chairman, National Science Council Executive Yuan, Republic of China

    CERN Multimedia

    Patrice Loïez

    2002-01-01

    Photo 01: Professor Dr. Che-Ho Wei signing the Guest Book with CERN Director-General, L. Maiani. Photo 02: Professor Dr. Che-Ho Wei. Photo 03::Professor Dr. Che-Ho Wei shaking hands with CERN Director-General, L. Maiani.

  8. Technical analysis and economic effect of an industrial initiative in the photovoltaic sector; Effetto dell' analisi tecnica ed economica di una iniziativa industriale nel settore dell'energia fotovoltaica

    Energy Technology Data Exchange (ETDEWEB)

    Ciorba, U.; Pauli, F. [ENEA, Funzione Centrale Studi, Centro Ricerche Casaccia, Rome (Italy); Menna, P. [ENEA, Funzione Centrale Studi, Centro Ricerche Portici, Naples (Italy)

    2001-07-01

    interdipendenze economiche, valutiamo l'impatto sul sistema produttivo di una domanda finale di moduli fotovoltaici per complessivi 5 MW p di potenza. Tale domanda, che corrisponde a una spesa di 16.3 milioni di euro, attiva (direttamente e indirettamente) un incremento di produzione pari a 57.6 milioni di euro, quando le celle sono prodotte in Marocco. Nell'ipotesi che le celle siano importate, invece, l'incremento di produzione e' di 22.3 milioni di euro. L'impatto sull'occupazione, in termini di creazione di posti di lavoro, ammonta a 2570 unita' nel primo caso e 489 nel secondo. La ricaduta produttiva e occupazionale della domanda di moduli dipende fortemente dalla disponibilita' dei beni intermedi a livello locale.

  9. Los marcadores che y boludo: ¿un caso de rivalidad conversacional?

    Directory of Open Access Journals (Sweden)

    Markéta Šmídová

    2016-11-01

    Full Text Available It has been recently suggested that the Argentinian conversational marker che is being replaced by another typical expression, boludo. The purpose of the present paper is to provide a pilot comparative study of these two Argentinian markers in order to examine their free interchangeability and to refute it eventually. A commutation test has been used as a basic tool to compare the behavior and functions of che and boludo and the results have helped to reveal contexts in which it would be inadmissible or inappropriate to employ boludo instead of che due to the possible violation of politeness norms. In the article, che and boludo are considered mainly from the sociolinguistic and pragmatic approaches although some important cultural phenomena are discussed as well.

  10. I sei numeri dell'universo le forze profonde che spiegano il cosmo

    CERN Document Server

    Rees, Martin

    2002-01-01

    È possibile che sei semplici numeri, sei costanti universali, diano conto dell'infinita varietà e della stupefacente complessità del cosmo? L'astrofisico Martin Rees ci mostra che non soltano ciò è possibile, ma in quei sei numeri sono scritti la storia, la struttura e il futuro dell'universo, e che perfino la comparsa della vita sulla terra, e dunque la nostra stessa esistenza, non sarebbe concepibile se uno solo di quei valori numerici, definiti nell'istante che segnò la nascita del mondo, fosse differente. I sei numeri dell'universo ci introducono così ad alcune delle questioni più profonde su cui si interroga oggi la scienza.

  11. Award ceremony for the "Crèche and School" competition

    CERN Multimedia

    Staff Association

    2018-01-01

    Whenever there is a competition, there are obviously participants – and especially winners! The awards ceremony for the competition to find a new name for the CERN Staff Association's Crèche and School took place on 15 May. During the ceremony, jointly led by Céline Grobon (President of the Crèche and School Steering Committee), Carole Dargagnon (Headmistress of the Crèche and School) and Jean-Baptiste Zenner (Staff Association delegate), the proposals selected by the jury were rewarded. The first place went to Marie-Luz Cavagna for her proposal "Le jardin des petits chercheurs", and the second place to Sarah Palluel for her proposal "Le Jardin des Zélectrons". Finally, Aude Mourey and Sandra Fleury tied for third place with their respective proposals "Les petits atomes" and "La crèche des particules". Can we find the winning name of the competition among...

  12. MSL Chemistry and Mineralogy X-Ray Diffraction X-Ray Fluorescence (CheMin) Instrument

    Science.gov (United States)

    Zimmerman, Wayne; Blake, Dave; Harris, William; Morookian, John Michael; Randall, Dave; Reder, Leonard J.; Sarrazin, Phillipe

    2013-01-01

    This paper provides an overview of the Mars Science Laboratory (MSL) Chemistry and Mineralogy Xray Diffraction (XRD), X-ray Fluorescence (XRF) (CheMin) Instrument, an element of the landed Curiosity rover payload, which landed on Mars in August of 2012. The scientific goal of the MSL mission is to explore and quantitatively assess regions in Gale Crater as a potential habitat for life - past or present. The CheMin instrument will receive Martian rock and soil samples from the MSL Sample Acquisition/Sample Processing and Handling (SA/SPaH) system, and process it utilizing X-Ray spectroscopy methods to determine mineral composition. The Chemin instrument will analyze Martian soil and rocks to enable scientists to investigate geophysical processes occurring on Mars. The CheMin science objectives and proposed surface operations are described along with the CheMin hardware with an emphasis on the system engineering challenges associated with developing such a complex instrument.

  13. Che a 1: recombinant expression, purification and correspondence to the natural form.

    Science.gov (United States)

    Barderas, Rodrigo; Villalba, Mayte; Rodríguez, Rosalía

    2004-12-01

    Pollinosis to chenopods is one of the main causes of allergy in desertic regions and it is increasing in the South of Europe and Western USA. Che a 1 is a major allergen for chenopod-allergic subjects and belongs to the Ole-e-1-like family of proteins. Pichia pastoris yeast has been used as expression system to produce the recombinant form of Che a 1 (rChe a 1). The allergen was isolated using a gel permeation column and reverse-phase/high-performance liquid chromatography. Molecular characterization was performed using Edman degradation, mass spectrometry and concanavalin A staining. Sera from patients allergic to chenopod pollen, as well as polyclonal and monoclonal antibodies raised against Ole e 1, were used in immunoblotting, ELISA and inhibition assays for immunological characterization of rChe a 1. The allergen was purified to homogeneity with a final yield of 15 mg/l of cell culture and showed a glycosylated character. N-terminal amino acid sequence of rChe a 1 and molecular mass were according to those of the protein isolated from chenopod pollen. The recombinant allergen maintained the IgG and IgE epitopes of the natural allergen deduced from the immunological assays. Structural and in vitro immunological properties of rChe a 1 produced in P. pastoris were equivalent to those of the natural form of the allergen and, thus, it could be used in testing patients allergic to chenopods. 2004 S. Karger AG, Basel.

  14. I diritti sindacali nel titolo III dello Statuto dei lavoratori

    Directory of Open Access Journals (Sweden)

    Alessandro Riccobono

    2011-12-01

    Full Text Available Sommario: 1. I diritti sindacali: struttura del titolo III e differenze rispetto al titolo II dello Statuto dei la­voratori. – 2. I limiti all’esercizio dell’attività sindaca­le privilegiata. – 2.1. segue: la selezione dei soggetti protetti. – 2.2. segue: il criterio dimensionale e la no­zione di unità produttiva. – 2.3. segue: il contempera­mento con interessi pari o sovraordinati. – 3. Il diritto di assemblea tra istanze di democrazia diretta e afflati di democrazia rappresentativa. – 3.1. I soggetti legitti­mati alla convocazione. – 3.2. Il dibattito sulla titolari­tà, individuale o collegiale, del potere di convocazione. – 3.3. L’oggetto dell’assemblea. – 3.4. Il luogo di svol­gimento dell’assemblea. – 3.5. Assemblea in orario di lavoro. – 3.6. Imputazione del monte orario e diritto alla conservazione della retribuzione. – 3.7. Il ruolo della contrattazione collettiva. – 4. Il referendum: struttura e funzione. – 4.1. I contenuti e le modalità di svolgimento. – 5. Il trasferimento dei dirigenti sindaca­li: profili generali. – 5.1. Il rapporto con i divieti di di­scriminazione ex art. 15 st. lav. – 5.3. I soggetti benefi­ciari. – 5.4. L’ambito di applicazione oggettivo. – 5.5. L’applicazione dell’art. 22 nel pubblico impiego. Cen­ni. – 6. Il diritto di affissione. Profili generali. – 6.1. Ti­pologia ubicazione e distribuzione dei canali informa­tivi. – 6.2. Contenuti delle comunicazioni e limiti alla defissione unilaterale da parte del datore di lavoro. – 7. I locali delle Rsa. – 7.1. Le caratteristiche dei locali: idoneità, dotazioni, ubicazione. – 7.2. Sulla possibilità di ingresso da parte dei sindacalisti esterni. – 7.3. La disciplina apprestata per le articolazioni aziendali di minori dimensioni.

  15. Le metriche utilizzate per la valutazione delle performance nel settore bancario e assicurativo

    OpenAIRE

    Luciano Munari; Antonella Caru'; Federica Ielasi

    2012-01-01

    Il capitolo descrive i risultati della ricerca che riguardano la parte relativa alle metriche utilizzate dalle imprese bancarie e assicurative per la misurazione dei risultati relativi all'attività marketing

  16. Overexpression, purification, crystallization and preliminary X-ray analysis of CheY4 from Vibrio cholerae O395

    International Nuclear Information System (INIS)

    Biswas, Maitree; Khamrui, Susmita; Sen, Udayaditya; Dasgupta, Jhimli

    2011-01-01

    The chemotaxis response regulator CheY4 from V. cholerae has been cloned, overexpressed, purified and crystallized in monoclinic and hexagonal space groups; the crystals diffracted to 1.67 and 1.9 Å resolution, respectively. Chemotaxis and motility greatly influence the infectivity of Vibrio cholerae, although the role of chemotaxis genes in V. cholerae pathogenesis is poorly understood. In contrast to the single copy of CheY found in Escherichia coli and Salmonella typhimurium, four CheYs (CheY1–CheY4) are present in V. cholerae. While insertional disruption of the cheY4 gene results in decreased motility, insertional duplication of this gene increases motility and causes enhanced expression of the two major virulence genes. Additionally, cheY3/cheY4 influences the activation of the transcription factor NF-κB, which triggers the generation of acute inflammatory responses. V. cholerae CheY4 was cloned, overexpressed and purified by Ni–NTA affinity chromatography followed by gel filtration. Crystals of CheY4 grown in space group C2 diffracted to 1.67 Å resolution, with unit-cell parameters a = 94.4, b = 31.9, c = 32.6 Å, β = 96.5°, whereas crystals grown in space group P3 2 21 diffracted to 1.9 Å resolution, with unit-cell parameters a = b = 56.104, c = 72.283 Å, γ = 120°

  17. Sociosemiotica e generi comunicativi: una proposta per analizzare la comunicazione nel web

    Directory of Open Access Journals (Sweden)

    Nicola Cavalli

    2003-12-01

    Full Text Available Il web può essere definito come uno spazio antropologico, uno spazio di significati caratterizzato dalla rivoluzione dei concetti spazio/temporali. Per analizzare la comunicazione web con un modello che possa essere valido anche per altri tipi di comunicazione viene proposto l'approccio sociosemiotico. In quest'ambito viene sviluppato il concetto di genere comunicativo, che vuole essere la chiave per analizzare la comunicazione e trarre indicazioni sulle carateristiche sociali della comunità di riferimento.

  18. Tra il mediterraneo e il fonte battesimale: Musulmani a Napoli nel XVI secolo

    OpenAIRE

    Varriale, Gennaro

    2013-01-01

    Il saggio analizza la presenza di musulmani a Napoli durante il Cinquecento, quando la capitale vive una profonda trasformazione urbanistica, che è vincolata alla immigrazione di comunità esogene e al conflitto contro il Turco. Le ostilità tra la Casa d’Austria e la Sublime Porta condizionano inevitabilmente la vita dei maomettani, che appartengono a tre grandi categorie: schiavi, franchi o esuli. Secondo la propria condizione gli islamici occupano diversi spazi cittadini. I musulmani di Napo...

  19. La spirale dell’azzardo: una subcultura del gioco che “evapora” le relazioni / La spirale du jeu de hasard : une sous-culture qui empêche toute relation / The gambling: a subculture of game that “burns” the relationships

    Directory of Open Access Journals (Sweden)

    Molin Valentina

    2011-07-01

    Full Text Available In this paper I have analysed the characteristics of what I define the “gambling subculture”, which is detectable in certain gaming environments and in subgroups of particularly “rabid” players. Within these subcultures there have been identified rules and sanctions, values, consolidate behaviours, characterization of relationships and interactions, and the conclusion is that what is built within the gambling environment is a separate universe, an “outer reality”, in which the values of the world “outside” change. It was also possible to conclude that, to join the gambling world for a gambler – learning its rules, sharing its values, developing relations inside it – represents a stimulus for gambling habits, as it allows to consider as “normal” their behaviour thanks to positive feedback from their groups of fellow players, and to the neutralization of possible negative feedback from “non-players”.Nel presente contributo vengono analizzate le caratteristiche di quella che ho definito “subcultura dell'azzardo”, rilevabile in determinati ambienti ludici e in sotto-gruppi di giocatori particolarmente “accaniti”. Di queste forme di subcultura sono state individuate norme e sanzioni, valori, comportamenti consolidati, caratterizzazione delle relazioni e delle interazioni, giungendo alla conclusione che quello che viene costruito negli spazi di gioco rappresenta un universo separato, un “extraluogo”, nel quale vengono scritte nuove regole e nel quale cambiano i valori rispetto al mondo “esterno”. È stato possibile inoltre concludere che l'adesione all'“universo gioco” – l'interiorizzazione delle sue norme, la condivisione dei suoi valori, lo sviluppo di relazioni al suo interno – rappresenta un fattore di mantenimento della condotta ludica, poiché permette di considerare “normale” il proprio comportamento grazie ai rinforzi positivi che giungono dal gruppo dei compagni-giocatori e alla

  20. The Azospirillum brasilense Che1 chemotaxis pathway controls swimming velocity, which affects transient cell-to-cell clumping.

    Science.gov (United States)

    Bible, Amber; Russell, Matthew H; Alexandre, Gladys

    2012-07-01

    The Che1 chemotaxis-like pathway of Azospirillum brasilense contributes to chemotaxis and aerotaxis, and it has also been found to contribute to regulating changes in cell surface adhesive properties that affect the propensity of cells to clump and to flocculate. The exact contribution of Che1 to the control of chemotaxis and flocculation in A. brasilense remains poorly understood. Here, we show that Che1 affects reversible cell-to-cell clumping, a cellular behavior in which motile cells transiently interact by adhering to one another at their nonflagellated poles before swimming apart. Clumping precedes and is required for flocculation, and both processes appear to be independently regulated. The phenotypes of a ΔaerC receptor mutant and of mutant strains lacking cheA1, cheY1, cheB1, or cheR1 (alone or in combination) or with che1 deleted show that Che1 directly mediates changes in the flagellar swimming velocity and that this behavior directly modulates the transient nature of clumping. Our results also suggest that an additional receptor(s) and signaling pathway(s) are implicated in mediating other Che1-independent changes in clumping identified in the present study. Transient clumping precedes the transition to stable clump formation, which involves the production of specific extracellular polysaccharides (EPS); however, production of these clumping-specific EPS is not directly controlled by Che1 activity. Che1-dependent clumping may antagonize motility and prevent chemotaxis, thereby maintaining cells in a metabolically favorable niche.

  1. A CheR/CheB fusion protein is involved in cyst cell development and chemotaxis in Azospirillum brasilense Sp7.

    Science.gov (United States)

    Wu, Lixian; Cui, Yanhua; Hong, Yuanyuan; Chen, Sanfeng

    2011-12-20

    We here report the sequence and functional analysis of cstB of Azospirillum brasilense Sp7. The predicted cstB contains C-terminal two PAS domains and N-terminal part which has similarity with CheB-CheR fusion protein. cstB mutants had reduced swarming ability compared to that of A. brasilense wild-type strain, implying that cstB was involved in chemotaxis in A. brasilense. A microscopic analysis revealed that cstB mutants developed mature cyst cells more quickly than wild type, indicating that cstB is involved in cyst formation. cstB mutants were affected in colony morphology and the production of exopolysaccharides (EPS) which are essential for A. brasilense cells to differentiate into cyst-like forms. These observations suggested that cstB was a multi-effector involved in cyst development and chemotaxis in A. brasilense. Copyright © 2010 Elsevier GmbH. All rights reserved.

  2. The new Meyrin crèche takes its first steps

    CERN Multimedia

    2008-01-01

    The new Meyrin crèche was inaugurated on 10 October and already caters for 16 children of CERN personnel. Copyright: Laurent Barlier. Copyright: Robert Tillmann. At the end of August, the new Meyrin crèche in Champs-Fréchets, the Espace de Vie Enfantine (EVE), welcomed its first intake of infants. They included 16 children of members of the CERN personnel who are benefiting from the agreement signed in 2007 with the commune of Meyrin (see Bulletin n°43&44/2007). The crèche was officially inaugurated on 10 October with several CERN representatives in attendance, including HR Department Head, Enrico Chiaveri, and Head of the Relations with the Host States Service, Friedmann Eder. The following day, EVE held an open day for the inhabitants of Meyrin and interested members of the CERN personnel. The new 1516 m2 building ‘s spaces have very clean and ...

  3. Storie ‘vere’ ed eroine dei romanzi. Rappresentare la Somalia in 'Ilaria Alpi. La ragazza che voleva raccontare l’inferno' e 'Non dirmi che hai paura'

    Directory of Open Access Journals (Sweden)

    Simone Brioni

    2016-09-01

    Full Text Available ‘True’ Stories and Heroines in Novels: The Representation of Somalia in Ilaria Alpi: The Young Woman Who Wanted to Narrate Hell and Don’t Tell Me You Are AfraidThis article analyses Gigliola Alvisi’s Ilaria Alpi: La ragazza che voleva raccontare l’inferno [Ilaria Alpi: The Young Woman Who Wanted to Narrate the Hell] (2014 and Giuseppe Catozzella’s Non dirmi che hai paura [Don’t Tell Me You Are Afraid] (2014, two novels that deal with two recent events in Somali and Italian history, the killing of the journalist Ilaria Alpi in Mogadishu in 1994 and the death of Samia Yosuf Omar while she was trying to reach the Italian shores from Libya by boat. Alvisi’s text is analysed in comparison with other fictional and journalistic representations of Ilaria Alpi, while Non dirmi che hai paura is examined through what Catozzella considers the two constitutive dimensions of the novel: documentation and identification. Drawing on Stefano Jossa’s reflections on the construction of literary heroes, the article challenges Alvisi’s and Catozzella’s claims that they represent ‘true stories’. The article also argues that the main characters of these literary works are portrayed as heroines and role models for the emancipation of Muslim women.

  4. Crèche and School: Open Day on Saturday, 3 March

    CERN Multimedia

    EVE et École

    2018-01-01

    Open Day at Crèche and School of the CERN Staff Association Are you considering enrolling your child to the Crèche and School of the CERN Staff Association? If you work at CERN, then this event is for you: come visit the school and meet the Management on Saturday 3 March 2018 from 10 to 12 am It will be our pleasure to present to you our structure, its projects and premises, and answer any questions you may have. Please sign up for one of the two sessions via Doodle before Wednesday 28 February 2018: https://doodle.com/poll/3qvrb6m73pktqbft

  5. Il fantasma dell'universo che cos'è il neutrino

    CERN Document Server

    Votano, Lucia

    2015-01-01

    Ben prima della luce, a un decimillesimo di secondo dal Big Bang, i neutrini sono apparsi nell'universo. Dopo un secondo il brodo primordiale si era raffreddato abbastanza da consentire loro di muoversi liberi e ancora oggi, dopo quasi quattordici miliardi di anni, sono numerosissimi. Ma che cosa sono i neutrini? Elusivi come fantasmi, camaleontici, viaggiano indenni attraverso la materia arrivando dritti sino a noi dagli angoli più remoti e nascosti dell'universo. Per saperne di più seguiremo i fisici che li studiano in laboratori sotterranei o in luoghi estremi come i ghiacciai polari o le profondità marine.

  6. A crèche for CERN staff The Staff Association project

    CERN Multimedia

    Association du personnel

    2006-01-01

    For many years, the Staff Association has supported the demand for the creation of a crèche for the children of CERN staff. Several studies have been carried out without leading to a concrete plan. The fact that the CERN population is getting younger and the shortage of local facilities have led to a more urgent demand for this type of social service over the past few years. Furthermore, the Equal Opportunities Panel had already recommended that crèche places be made available.

  7. Negare l'acqua. La strategia dello Stato islamico per il controllo delle risorse idriche e il diritto all’acqua delle donne nel Vicino Oriente

    Directory of Open Access Journals (Sweden)

    Desirée A.L. Quagliarotti

    2016-04-01

    Full Text Available In un contesto di ineguale distribuzione delle risorse idriche, di crescita demografica e di sviluppo economico, l’acqua assume sempre più il ruolo divariabile strategica in grado di alterare gli equilibri geopolitici soprattutto in quelle aree in cui le fonti idriche sono condivise tra più paesi. Obiettivo dell’articolo è quello di analizzare il contenzioso idrico del bacino del Tigri e dell’Eufrate dove la storica disputa per la gestione e l’accaparramento delle acque condivise tra Turchia, Siria e Iraq è acuita dall’effetto del cambiamento climatico e dall’ingresso di nuovi attori nel controllo della risorsa. L’aumento della frequenza e dell’intensità dei periodi di siccità amplifica il gap tra domanda e offerta idrica mentre il nuovo ordine idropolitico disegnato dall’espansione dello Stato Islamico, limita l’accesso alla risorsa da parte delle fasce più deboli delle popolazioni. Particolarmente penalizzate sono le donne a cui viene quotidianamente affidato l’arduo compito di gestire le scarse risorse idriche e di allocarle tra i diversi usi. Il controllo da parte dello Stato islamico delle grandi dighe lungo il corso dei due fiumi, l’utilizzo dell’acqua come strumento di pressione e il conseguente deterioramento qualitativo e quantitativo della risorsa, non solo aumentano la quantità di lavoro che le donne devono impiegare per la raccolta e la distribuzione dell’acqua ma minacciano la sicurezza alimentare e la salute loro e delle loro famiglie.

  8. Demonstrating the Open Data Repository's Data Publisher: The CheMin Database

    Science.gov (United States)

    Stone, N.; Lafuente, B.; Bristow, T.; Pires, A.; Keller, R. M.; Downs, R. T.; Blake, D.; Dateo, C. E.; Fonda, M.

    2018-04-01

    The Open Data Repository's Data Publisher aims to provide an easy-to-use software tool that will allow researchers to create and publish database templates and related data. The CheMin Database developed using this framework is shown as an example.

  9. Reading Strategies: Issues in the Computerization of Machiavelli's "Il demonio che prese moglie".

    Science.gov (United States)

    Morgan, Leslie Zarker

    1994-01-01

    The ideal computer-based foreign language reading program must include cognitive background, a learning taxonomy, sound computer design, and knowledge of what is needed for the specific language. Machiavelli's "Il demonia che prese moglie" is chosen for study due to its historical interest. (63 references) (CK)

  10. Selezione invernale dell'habitat e densità del cervo (Cervus elaphus e del capriolo (Capreolus capreolus nel Parco Nazionale d'Abruzzo

    Directory of Open Access Journals (Sweden)

    R. Latini

    2003-10-01

    Full Text Available Nel Parco Nazionale d'Abruzzo è stata studiata la selezione dell'habitat invernale di cervo e capriolo da aprile a maggio del 2000 e del 2002, in un'area caratterizzata da boschi di faggio, rimboschimenti a pino nero e pascoli. È stata utilizzata la tecnica del pellet group count, su transetti lineari larghi 2 metri, individuati ogni 100 m di quota, lungo le isoipse da 1350 a 1950 m s.l.m. Sono stati percorsi 61 km ed è stata campionata un'area di 12 ha. Per ogni gruppo di escrementi (1583 per il cervo e 946 per il capriolo sono state rilevate l'altitudine, la pendenza, l'esposizione e il tipo di vegetazione. È stato assunto che tutti gli habitat fossero ugualmente disponibili ed accessibili e che le disponibilita fossero conosciute (Alldredge et al., 1998. I dati raccolti sono stati elaborati applicando il test del Χ², la statistica di Bonferroni (Neu et al., 1974 e l'indice Jacobs (Jacobs, 1974. Il cervo ha selezionato aree comprese tra 1300 e 1500 m s.l.m. (p<0.01, un range altimetrico più ristretto rispetto al capriolo che seleziona anche le quote piu elevate, comprese cioè tra 1300 e 1700 m s.l.m. (p<0.01. Entrambi i cervidi selezionano le zone più scoscese (21°-60° (p<0.01: Il cervo seleziona le classi d'esposizione comprese tra sud-est ed ovest (p<0.01, mentre il capriolo i versanti sud-ovest e ovest (p<0.01. Entrambe le specie preferiscono ambienti di transizione ed evitano le zone di bosco maturo ed i pascoli d'alta quota (p<0.01. Utilizzando il tasso di defecazione è stata calcolata la densità delle due specie (Mayle, 1999 che è risultata di 2.7 cervi/100 ha e 1.0 caprioli/100 ha. Le due specie selezionano le stesse risorse, suggerendo, così come riscontrato da altri autori (Welch, 1989, una convergenza per quanto riguarda l'uso invernale dell'habitat. La scelta d'aree poste a quote medio-basse, di zone scoscese e di versanti meridionali potrebbe essere legata alla minore altezza e persistenza

  11. Inwentarz fary chełmińskiej i jej biblioteki z XV wieku

    Directory of Open Access Journals (Sweden)

    Mateusz Superczyński

    2017-07-01

    Full Text Available Artykuł niniejszy prezentuje edycję nieznanego szerzej dotychczas inwentarza fary chełmińskiej i wykazu księgozbioru biblioteki farnej z XV w., które znajdują się w księdze miejskiej Chełmna – kopiariuszu przywilejów i dokumentów, założonej przez pisarza Konrada Bitschina w 1431 r. Przekaz źródłowy daje obraz biblioteki fary chełmińskiej jako ośrodka kultury w XV-wiecznym Chełmnie. Pozwala także na porównanie trzech zachowanych spisów księgozbiorów średniowiecznego Chełmna, a więc z klasztoru Franciszkanów z XIII wieku, biblioteki farnej i zrekonstruowanego spisu biblioteki Braci Wspólnego Życia z końca XV stulecia, które pochodzą z różnych okresów i odzwierciedlają przemiany w duchowości, teologii i zainteresowaniach naukowych ówczesnych elit intelektualnych miasta. Podczas gdy księgozbiory biblioteki franciszkanów czy farnej oddają ducha średniowiecznej scholastyki czy nominalizmu, to wydania, które posiadali Bracia Wspólnego Życia, zwiastują nadejście humanizmu. Odnotowane przez pisarza miejskiego tytuły, mimo zniekształceń,pozwalają także na identyfikację i odnalezienie wśród nich fundamentalnych dla średniowiecznej teologii, liturgii, historii i filozofii dzieł.

  12. Quando il museo comunica l’impresa: identità organizzativa e sensemaking nel museo Salvatore Ferragamo / When the museum communicates the company: organizational identity and sensemaking in Salvatore Ferragamo museum

    Directory of Open Access Journals (Sweden)

    Floriana Iannone

    2016-06-01

    Full Text Available I musei d’impresa rappresentano una forma di memoria organizzativa che può e deve essere usata in maniera consapevole per lo sviluppo e la comunicazione dell’identità e dell’immagine dell’impresa. Oggetto del lavoro è l’analisi del ruolo strategico che il museo può assumere come strumento di narrazione dell’identità d’impresa. Il framework teorico è basato sui costrutti dell’identità organizzativa e del sensemaking nonché sul paradigma narrativo. In particolare, l’indagine esplorativa chiarisce la natura e il contenuto dell’identità organizzativa della Ferragamo SpA, considerando il museo d’impresa come asset in grado di comunicare ed esaltare i valori identitari dell’impresa. Ferragamo rappresenta un exemplum di come un’impresa heritage-based possa adoperare la storia nella “narrazione” allo scopo di dialogare con i suoi stakeholders esterni e interni rafforzando autenticità e credibilità nel marchio.  The paper assumes that corporate museums are a form of organizational memory to be strategically used for the development and the communication of a company’s identity and image. Object of the work is the analysis of corporate museum’s strategic role in telling the company. The theoretical framework is based on organizational identity and sensemaking topics together with the narrative paradigm. The exploratory study clarifies the organizational identity nature of the Ferragamo SpA, considering the corporate museum as an asset communicating what is core about the company. Ferragamo can be considered as an exemplum of how a heritage based company can manage the story in “narrative” in order to communicate to its external and internal stakeholders reinforcing the authenticity and the credibility of the brand.

  13. The Emotional Communication in Hearing Questionnaire (EMO-CHeQ): Development and Evaluation.

    Science.gov (United States)

    Singh, Gurjit; Liskovoi, Lisa; Launer, Stefan; Russo, Frank

    2018-06-11

    The objectives of this research were to develop and evaluate a self-report questionnaire (the Emotional Communication in Hearing Questionnaire or EMO-CHeQ) designed to assess experiences of hearing and handicap when listening to signals that contain vocal emotion information. Study 1 involved internet-based administration of a 42-item version of the EMO-CHeQ to 586 adult participants (243 with self-reported normal hearing [NH], 193 with self-reported hearing impairment but no reported use of hearing aids [HI], and 150 with self-reported hearing impairment and use of hearing aids [HA]). To better understand the factor structure of the EMO-CHeQ and eliminate redundant items, an exploratory factor analysis was conducted. Study 2 involved laboratory-based administration of a 16-item version of the EMO-CHeQ to 32 adult participants (12 normal hearing/near normal hearing (NH/nNH), 10 HI, and 10 HA). In addition, participants completed an emotion-identification task under audio and audiovisual conditions. In study 1, the exploratory factor analysis yielded an interpretable solution with four factors emerging that explained a total of 66.3% of the variance in performance the EMO-CHeQ. Item deletion resulted in construction of the 16-item EMO-CHeQ. In study 1, both the HI and HA group reported greater vocal emotion communication handicap on the EMO-CHeQ than on the NH group, but differences in handicap were not observed between the HI and HA group. In study 2, the same pattern of reported handicap was observed in individuals with audiometrically verified hearing as was found in study 1. On the emotion-identification task, no group differences in performance were observed in the audiovisual condition, but group differences were observed in the audio alone condition. Although the HI and HA group exhibited similar emotion-identification performance, both groups performed worse than the NH/nNH group, thus suggesting the presence of behavioral deficits that parallel self

  14. A cheZ-Like Gene in Azorhizobium caulinodans Is a Key Gene in the Control of Chemotaxis and Colonization of the Host Plant.

    Science.gov (United States)

    Liu, Xiaolin; Liu, Wei; Sun, Yu; Xia, Chunlei; Elmerich, Claudine; Xie, Zhihong

    2018-02-01

    Chemotaxis can provide bacteria with competitive advantages for survival in complex environments. The CheZ chemotaxis protein is a phosphatase, affecting the flagellar motor in Escherichia coli by dephosphorylating the response regulator phosphorylated CheY protein (CheY∼P) responsible for clockwise rotation. A cheZ gene has been found in Azorhizobium caulinodans ORS571, in contrast to other rhizobial species studied so far. The CheZ protein in strain ORS571 has a conserved motif similar to that corresponding to the phosphatase active site in E. coli The construction of a cheZ deletion mutant strain and of cheZ mutant strains carrying a mutation in residues of the putative phosphatase active site showed that strain ORS571 participates in chemotaxis and motility, causing a hyperreversal behavior. In addition, the properties of the cheZ deletion mutant revealed that ORS571 CheZ is involved in other physiological processes, since it displayed increased flocculation, biofilm formation, exopolysaccharide (EPS) production, and host root colonization. In particular, it was observed that the expression of several exp genes, involved in EPS synthesis, was upregulated in the cheZ mutant compared to that in the wild type, suggesting that CheZ negatively controls exp gene expression through an unknown mechanism. It is proposed that CheZ influences the Azorhizobium -plant association by negatively regulating early colonization via the regulation of EPS production. This report established that CheZ in A. caulinodans plays roles in chemotaxis and the symbiotic association with the host plant. IMPORTANCE Chemotaxis allows bacteria to swim toward plant roots and is beneficial to the establishment of various plant-microbe associations. The level of CheY phosphorylation (CheY∼P) is central to the chemotaxis signal transduction. The mechanism of the signal termination of CheY∼P remains poorly characterized among Alphaproteobacteria , except for Sinorhizobium meliloti , which

  15. l'altra metà futurista: la donna nel futurismo, le donne del futurismo

    African Journals Online (AJOL)

    User

    altro con l'amplesso più totale della vita” è seguito dal brusco ritorno alla realtà di sé stessi e la domanda cosciente e terrificante “si, ma noi cosa siamo? Ci conosciamo?” (Ginanni, 1919:45). Si arriva alla constatazione desolante che rimane.

  16. L'organizzazione delle funzioni Marketing nel settore bancario e assicurativo

    OpenAIRE

    M.C. Cito; U. Filotto; A. Omarini

    2012-01-01

    Il capitolo intende presentare i risultati della ricerca realizzata presso un campione di banche e assicurazioni circa le caratteristiche della funzione marketing, le iniziative che riguardano la pianificazione delle attività nonchè il grado di interdipendenza e integrazione con le altre funzioni aziendali.

  17. Vie femminili di liberazione. Il movimento transnazionale delle bhikkunī nel Sudest asiatico

    Directory of Open Access Journals (Sweden)

    Alessandra Chiricosta

    2016-04-01

    Full Text Available La lotta per il riconoscimento dell’ordinazione delle bhikkunī nell’ambito del Buddhismo theravāda, come sostiene Tanaporn Pichitsakulachai, può essere interpretata come una forma di femminismo religioso. Il movimento per la “rifondazione” del monachesimo femminile nei paesi del Sud e Sudest Asiatico e’ una realta’ fluida e policentrica, che cerca non solo di rinegoziare i ruoli tradizionalmente imposti alle donne, ma sfida i principi stessi su cui il concetto di “tradizione” viene costruito. La questione della rifondazione dell’ordine delle bhikkunī viene qui letta come spazio di movimento di network interculturali di donne, che riflettono la filosofia del Socially Engaged Buddhis (SEB. La dimensione relazionale e transnazionale che tali network pongono in essere puo’ offrire una differente prospettiva in grado di fornire una via di superamento delle dicotomie politiche e teoretiche che hanno a lungo guidato la lettura di fenomeni connessi all’ agency delle donne in contesti post coloniali.

  18. Open Day at Crèche and School of the CERN Staff Association

    CERN Multimedia

    Staff Association

    2018-01-01

    In the morning of Saturday, 3 March 2018, the Crèche and School of the CERN Staff Association opened its doors for parents who wished to visit the establishment. Once again, the Open Day was a great success and brought together more than 50 families for two information sessions, which included: a general presentation of the establishment by the Headmistress, and a visit of the facilities led by the Headmistress and her deputy. At the end of the visit, parents were invited for a drink. This was an opportunity for both parents and professionals to have interesting discussions regarding the general conditions of the establishment and the pedagogical approach applied in the crèche and the school. The management team was delighted to offer the parents the opportunity to participate in this event, where everyone could express their views, ask questions and find answers in a friendly and relaxed atmosphere.

  19. Sulle ipotesi che stanno alla base della geometria e altri scritti scientifici e filosofici

    CERN Document Server

    Riemann, Bernhard

    1994-01-01

    Il volume raccoglie, oltre al testo della lezione del 1854 che dà il titolo all'opera, alcuni scritti di carattere scientifico e filosofico di Riemann. A saggi di argomento scientifico si affiancano scritti di argomento più direttamente metodologico. La concezione della scienza che ci viene offerta da questi scritti è assai significativa del personaggio e della sua epoca. Per Riemann la matematica non è un mero strumento esteriore da applicare, appunto dall'esterno, ai fenomeni. Al contrario, essa consente di spingersi con il rigore necessario oltre alla superficie dei fenomeni e di penetrare sempre più a fondo nella realtà, nell'ottica di un sistema unitario e quasi metafisico del sapere scientifico.

  20. Il museo che non c’è. Note sulla dispersione del patrimonio in Gran Bretagna

    Directory of Open Access Journals (Sweden)

    Caroline Patey

    2011-03-01

    Full Text Available Indifferente alla loro recente moltiplicazione come al sodalizio che vi si celebra con l’architettura di grido, un fantasma si aggira per i musei. Sordo al nome di Jean Nouvel (Reina Sofia, Louvre quanto a quelli di Herzog & De Meuron (Tate Modern, impermeabile ai fasti del British Museum (Norman Foster come ai restauri della Tate Britain (James Stirling, disinteressato alle fortune del ‘nuovo’ Victoria and Albert Museum e malinconico come si addice alla sua natura, il fantasma invita a interrogare tanta luccicante spettacolarità e forse a non dimenticare che, per quanto custode di memoria e guardiano di culture, il museo è anche il luogo dove vengono consumate, direttamente o meno, amnesie e damnatio memoriae e in nome del quale continuano a perpetrarsi non poche violazioni e disseminazioni.

  1. Site-specific and synergistic stimulation of methylation on the bacterial chemotaxis receptor Tsr by serine and CheW

    Directory of Open Access Journals (Sweden)

    Weis Robert M

    2005-03-01

    Full Text Available Abstract Background Specific glutamates in the methyl-accepting chemotaxis proteins (MCPs of Escherichia coli are modified during sensory adaptation. Attractants that bind to MCPs are known to increase the rate of receptor modification, as with serine and the serine receptor (Tsr, which contributes to an increase in the steady-state (adapted methylation level. However, MCPs form ternary complexes with two cytoplasmic signaling proteins, the kinase (CheA and an adaptor protein (CheW, but their influences on receptor methylation are unknown. Here, the influence of CheW on the rate of Tsr methylation has been studied to identify contributions to the process of adaptation. Results Methyl group incorporation was measured in a series of membrane samples in which the Tsr molecules were engineered to have one available methyl-accepting glutamate residue (297, 304, 311 or 493. The relative rates at these sites (0.14, 0.05, 0.05 and 1, respectively differed from those found previously for the aspartate receptor (Tar, which was in part due to sequence differences between Tar and Tsr near site four. The addition of CheW generated unexpectedly large and site-specific rate increases, equal to or larger than the increases produced by serine. The increases produced by serine and CheW (added separately were the largest at site one, ~3 and 6-fold, respectively, and the least at site four, no change and ~2-fold, respectively. The rate increases were even larger when serine and CheW were added together, larger than the sums of the increases produced by serine and CheW added separately (except site four. This resulted in substantially larger serine-stimulated increases when CheW was present. Also, CheW enhanced methylation rates when either two or all four sites were available. Conclusion The increase in the rate of receptor methylation upon CheW binding contributes significantly to the ligand specificity and kinetics of sensory adaptation. The synergistic effect of

  2. LA LINGUA FILMATA: "L'UOMO CHE VERRÀ" DI GIORGIO DIRITTI

    Directory of Open Access Journals (Sweden)

    Marta Idini

    2016-02-01

    Full Text Available La lingua filmata appare oggi uno dei campi linguistici in cui il dialetto torna ad essere scelta registica e veicolo di nuove istanze comunicative, in stretta relazione con un nuovo modo di intendere e praticare il cinema. Il presente articolo introduce il lettore alla consuetudine cinematografica del dialetto, analizzandone la presenza e le funzioni che gli sono state attribuite nei decenni trascorsi e presenti, e guarda a L’Uomo che verrà quale espressione attuale di una nuova risorgenza dialettale all’interno delle pellicole nostrane. Attraverso un’analisi attenta dei fenomeni vernacolari in esso presenti, l’indagine si sofferma sulle motivazioni e l’efficacia comunicativa cui perviene l’uso del dialetto e si interroga su quale grado di realismo o mimesi linguistica Diritti abbia raggiunto. Language of film: "L’uomo che verrà" by Giorgio DirittiLanguage in films is one of the fields where dialect becomes a choice and a vehicle for new communicative demands, closely related the new way of understanding and practicing the cinema. This article introduces the reader to the use of dialect in films, analyzing the presence and functions that have been attributed to it in the past and present decades, and looks at L’Uomo che verrà as an expression of the new resurgence of dialect in Italian films. Through careful analysis of the vernacular, the paper focuses on the motivations and the communicative effectiveness of the use of dialect and questions the degree of realism or linguistic mimesis that Diritti was able to reach.

  3. CheShift-2 resolves a local inconsistency between two X-ray crystal structures

    International Nuclear Information System (INIS)

    Vila, Jorge A.; Sue, Shih-Che; Fraser, James S.; Scheraga, Harold A.; Dyson, H. Jane

    2012-01-01

    Since chemical shifts provide important and relatively accessible information about protein structure in solution, a Web server, CheShift-2, was developed for structure interrogation, based on a quantum mechanics database of 13 C α chemical shifts. We report the application of CheShift-2 to a local inconsistency between two X-ray crystal structures (PDB IDs 1IKN and 1NFI) of the complex between the p65/p50 heterodimer of NFκB and its inhibitor IκBα. The availability of NMR resonance assignments that included the region of the inconsistency provided an opportunity for independent validation of the CheShift-2 server. Application of the server showed that the 13 C α chemical shifts measured for the Gly270-Pro281 sequence close to the C-terminus of IκBα were unequivocally consistent with the backbone structure modeled in the 1IKN structure, and were inconsistent with the 1NFI structure. Previous NOE measurements had demonstrated that the position of a tryptophan ring in the region immediately N-terminal in this region was not consistent with either structure. Subsequent recalculation of the local structure in this region, based on the electron density of the deposited structure factors for 1IKN, confirmed that the local backbone structure was best modeled by 1IKN, but that the rotamer of Trp258 is consistent with the 1NFI structure, including the presence of a hydrogen bond between the ring NεH of Trp258 and the backbone carbonyl group of Gln278. The consensus between all of these measures suggests that the CheShift-2 server operates well under circumstances in which backbone chemical shifts are available but where local plasticity may render X-ray structural data ambiguous.

  4. Report to EuCheMS Division of Analytical Chemistry on CITAC Activity

    DEFF Research Database (Denmark)

    Andersen, Jens Enevold Thaulov; Wegsheider, Wolfhard

    Although the CITAC organisation [1] was founded on traceability, it embraces a variety of concepts allocated specifically to quality assurance. Collaboration with other organisations that promote practices and procedures of quality assurance is essential, and appointed liaison persons...... are encouraged to support this effort. In continuation of this aim a close contact to EuCheMS is desired together with contacts to IUPAC, ISO/REMCO, BIPM/CCQM, ILAC, EA, APLAC, EUROMET, SIM, APMP, AOACI, IAEA, IFCC and SADCMET....

  5. La macchina che cerca Dio. Nasce LHC forse scoprira' Higgs elusiva particella della creazione

    CERN Multimedia

    Bianucci, P

    2003-01-01

    "LEON Lederman, premio Nobel per la fisica, l'ha misticamente definita la particella di Dio perche' sarebbe il pilastro sul quale si appoggia tutta la materia dell'universo che conosciamo. Piu' tecnicamente, e' la "particella di Higgs", un bosone previsto dal Modello Standard del microcosmo la cui esistenza sarebbe necessaria per giustificare, anche quantitativamente, la massa di tutte le particelle" (1/2 page).

  6. The Pseudomonas aeruginosa chemotaxis methyltransferase CheR1 impacts on bacterial surface sampling.

    Directory of Open Access Journals (Sweden)

    Juliane Schmidt

    Full Text Available The characterization of factors contributing to the formation and development of surface-associated bacterial communities known as biofilms has become an area of intense interest since biofilms have a major impact on human health, the environment and industry. Various studies have demonstrated that motility, including swimming, swarming and twitching, seems to play an important role in the surface colonization and establishment of structured biofilms. Thereby, the impact of chemotaxis on biofilm formation has been less intensively studied. Pseudomonas aeruginosa has a very complex chemosensory system with two Che systems implicated in flagella-mediated motility. In this study, we demonstrate that the chemotaxis protein CheR1 is a methyltransferase that binds S-adenosylmethionine and transfers a methyl group from this methyl donor to the chemoreceptor PctA, an activity which can be stimulated by the attractant serine but not by glutamine. We furthermore demonstrate that CheR1 does not only play a role in flagella-mediated chemotaxis but that its activity is essential for the formation and maintenance of bacterial biofilm structures. We propose a model in which motility and chemotaxis impact on initial attachment processes, dispersion and reattachment and increase the efficiency and frequency of surface sampling in P. aeruginosa.

  7. X-Ray Diffraction on Mars: Scientific Discoveries Made by the CheMin Instrument

    Science.gov (United States)

    Rampe, E. B.; Blake, D. F.; Ming, D. W.; Bristow, T. F.

    2017-01-01

    The Mars Science Laboratory Curiosity landed in Gale crater in August 2012 with the goal to identify and characterize habitable environments on Mars. Curiosity has been studying a series of sedimentary rocks primarily deposited in fluviolacustrine environments approximately 3.5 Ga. Minerals in the rocks and soils on Mars can help place further constraints on these ancient aqueous environments, including pH, salinity, and relative duration of liquid water. The Chemistry and Mineralogy (CheMin) X-ray diffraction and X-ray fluorescence instrument on Curiosity uses a Co X-ray source and charge-coupled device detector in transmission geometry to collect 2D Debye-Scherrer ring patterns of the less than 150 micron size fraction of drilled rock powders or scooped sediments. With an angular range of approximately 2.52deg 20 and a 20 resolution of approximately 0.3deg, mineral abundances can be quantified with a detection limit of approximately 1-2 wt. %. CheMin has returned quantitative mineral abundances from 16 mudstone, sandstone, and aeolian sand samples so far. The mineralogy of these samples is incredibly diverse, suggesting a variety of depositional and diagenetic environments and different source regions for the sediments. Results from CheMin have been essential for reconstructing the geologic history of Gale crater and addressing the question of habitability on ancient Mars.

  8. Verona/Milano, andata e ritorno. Appunti sulla presenza dei pittori veronesi a Milano nel XIX secolo / Verona/Milano, there and back. Notes on Verona’s painters in Milan in the 19th Century

    Directory of Open Access Journals (Sweden)

    Elena Casotto

    2013-11-01

    Full Text Available Lo studio intende illustrare (quando possibile anche attraverso le testimonianze scritte degli artisti le vicende dei pittori veronesi che, nel secolo XIX, cercano e in molti casi trovano fortuna a Milano, il centro artistico più aggiornato e vivace di tutto il Nord Italia, rinomato soprattutto per la sua Accademia e le frequentatissime esposizioni. Questa “migrazione” si verifica perché Verona, durante il periodo della dominazione asburgica (1815 – 1866, diviene il perno del sistema militare del regno Lombardo-Veneto e, conseguentemente, il suo sviluppo è subordinato alle necessità delle numerose compagnie militari che stazionano o transitano sul suo territorio. Si incrementano quindi l’edilizia militare, i mezzi di comunicazione per collegamenti di lunga distanza, ma non lo sviluppo urbanistico della città e la nascita di piccole industrie e commerci che possano favorire la popolazione civile. In questa situazione anche il mercato dell’arte languisce, sia per la carenza di committenti pubblici e privati, sia per le poche occasioni di promozione che si organizzano in questi difficili anni. A ciò si aggiunga che anche l’Accademia cittadina vive un momento di stagnazione, dovuta in parte agli obsoleti metodi di insegnamento e in parte alla mancanza di fondi, che causano un tale abbassamento di qualità nell’insegnamento per cui gli artisti qui formati si rivelano impreparati a competere con i colleghi provenienti da altre realtà del paese. Dopo L’Unità d’Italia e, soprattutto, dopo la riforma dell’Accademia veronese (1873, i rapporti tra Verona e Milano, invece, si fanno più complessi: non sono più solamente i pittori veronesi a recarsi nel capoluogo lombardo per studiare e per esporre, ma anche gli autori lombardi non disdegnano le manifestazioni della città veneta e addirittura ambiscono a ottenere e di fatto, spesso, ottengono, la direzione dell’Accademia scaligera. Si deve infine notare che il legame tra le

  9. Pretreatment with P-Nitrophenyl Phosphoramides: Spontaneous Reactivation of Blood ChE after Oral Administration to Guinea Pigs

    National Research Council Canada - National Science Library

    Polhuijs, M

    1997-01-01

    ... and of the reference compounds pyridostigmine and physostigmine has been studied in the guinea pig, as determined by measuring spontaneous reactivation of blood ChE inhibited by these pretreatment compounds...

  10. La fuga dell’‘Io’ narrativo nel romanzo del dopoguerra spagnolo

    Directory of Open Access Journals (Sweden)

    Rosa Pignataro

    2014-10-01

    Full Text Available Il contributo consiste in una proposta di analisi di alcuni dei romanzi più significativi del dopoguerra spagnolo a partire dagli anni ’40 fino agli anni ’60-’70. Mi soffermo ad analizzare la ‘fuga’ dell’‘Io’ dalla narrazione in La familia de Pascual Duarte e La colmena, di Camilo José Cela, El camino di Miguel Delibes e Volverás a Región di Juan Benet. Il primo dei romanzi in esame è marcato dalla presenza forte ed imperante del yo narrativo di Pascual che rappresenta appieno la rotondità dell’autobiografia. La ‘fuga’, l’allontanamento, la disgregazione fino alla totale rottura del patto narrativo tra autore e lettore comincia a concretizzarsi con un romanzo della decade successiva, El camino, in cui un narratore onnisciente filtra l’esperienza autobiografica attraverso gli occhi dei bambini. Il passo successivo è la moltiplicazione infinita della rappresentazione del sé in un mosaico di voci e personaggi narranti ne La colmena. La fuga dell’‘Io’, poi, trova la piena realizzazione nell’opera benetiana Volverás a Región che stigmatizza il totale anonimato narrativo dato da un narratore onnisciente ma che, infrangendo le regole ‘tradizionali’ della narrazione, introduce il lettore in uno spazio dai contorni indefiniti, labili, opachi dove l’‘Io’ fluttua, rivela ciò che i personaggi dicono e sentono ma, confondendone nomi e vicende, testimonia la condizione di rovina dell’esistenza umana.

  11. Controllo strategico e valutazione delle performance nel settore dell’alta moda

    OpenAIRE

    Terzani, Simone

    2006-01-01

    [italiano] La tesi approfondisce il settore dell’alta moda e del lusso individuandone i caratteri fondamentali, nonché le peculiarità delle aziende che in tale settore operano. Si procede poi ad un esame della dottrina in materia di controllo di gestione ed in particolare di controllo strategico e ci si sofferma sulle caratteristiche del modello balanced scorecard. Il lavoro comprende una analisi empirica su casi concreti di imprese del settore per individuarne gli strumenti di controllo impi...

  12. Il patrimonio scomodo del Novecento europeo nel progetto Atrium a Forlì

    Directory of Open Access Journals (Sweden)

    Elena Pirazzoli

    2013-09-01

    Full Text Available Il Novecento ha lasciato tracce difficili nelle città d'Europa. I regimi che si sono succeduti hanno trasformato urbanisticamente e architettonicamente l'intero territorio e oggi è complesso relazionarsi con questi segni. Il progetto europeo Atrium - Architecture of Totalitarian Regimes in Urban Managements si propone di valorizzare, con attenta cura e senza intenti mistificatori, proprio il “patrimonio scomodo” di 11 paesi dell'Europa del sud.

  13. Origini Concettuali di Errori che si Riscontrano Nel Confrontare Numeri Decimali e Frazioni=Conceptual Sources of Difficulties Concerning the Ordering of Decimal Numbers and the Comparison of Fractions.

    Science.gov (United States)

    Bonotto, C.

    1993-01-01

    Examined fifth-grade students' survey responses to investigate incorrect rules that derive from children's efforts to interpret decimals as integers or as fractions. Regarding fractions, difficulties arise because only the whole-part approach to fractions is presented in elementary school. (Author/MDH)

  14. Osteoid osteoma: our experience using radio-frequency (RF) treatment; L'osteoma osteoide: nostra esperienza nel trattamento mediante radiofrequenza (RF)

    Energy Technology Data Exchange (ETDEWEB)

    Mastrantuono, Donato; Martorano, Domenico; Verna, Valter; Mancini, Andrea; Faletti, Carlo [U.O.A. di Radiologia Diagnostica C.T.O., Torino (Italy). Dipartimento di Diagnostica per Immagini

    2005-03-01

    maggiori. L'intervento ha richiesto l'anestesia generale unicamente nel trattamento delle lesioni localizzate al bacino; per gli altri pazienti e' stata sufficiente l'anestesia periferica. La remissione completa della sintomatologia dolorosa e' stata riferita da tutti i pazienti dopo un periodo massimo di 3 settimane. Discussione e conclusioni: Con due anni di esperienza, a nostro parere, il trattamento percutaneo con RF dell'osteoma osteoide si pone come metodica di prima scelta rispetto alla chirurgia tradizinale, nei confronti della quale si dimostra scarsamente invasivo, di rapida esecuzione, ripetibile e con sensibile riduzione dei costi. Inoltre consente il carico precoce e la dimissione del paziente in giornata o il giorno successivo al ricovero. Relativamente al periodo considerato, anche i risultati clinici sono migliori con il 100% della remissione dei sintomi in tutti i pazienti trattati ed assenza di recidiva in quelli (attualmente 4 su 21) che hanno raggiunto i due anni di follow-up.

  15. La ballata E5 e le sue varianti nel codice degli abbozzi

    Directory of Open Access Journals (Sweden)

    Giulia Ravera

    2016-07-01

    Full Text Available La ballata petrarchesca Amor, che ’n cielo e ’n cor gentile alberghi (E5, composta per il musico Confortino e destinata alla definitiva esclusione dal Canzoniere, è un componimento profondamente complesso, oltre che caratterizzato da un’intrigante vicenda redazionale. E5 appare infatti imperniata sull’ambiguità tra due poli opposti, amoroso e religioso, in un gioco di contrapposizioni che rende difficile scegliere in via definitiva tra un’interpretazione sentimentale ed una lettura morale o addirittura penitenziale. La ballata è inoltre caratterizzata dall’evidente ed esteso riuso della tradizione lirica ed in particolare dei modelli stilnovistici, non solo e non tanto sul piano degli stilemi e delle immagini, quanto in termini di concezione amorosa. Il rapporto con queste fonti risulta problematico, tra ripresa e negazione, e rappresenta un ulteriore nodo significativo rispetto all’interpretazione del componimento. La graduale evoluzione della ballata, di cui possono essere identificate per lo meno tre versioni distinte, sembra accentuare gli elementi di complessità e le sovrapposizioni semantiche. Infine, l’analisi formale e contenutistica di E5 favorisce la formulazione, pur senza pretesa di certezza, di ipotesi sulle ragioni della sua sorte extravagante

  16. Distinct Domains of CheA Confer Unique Functions in Chemotaxis and Cell Length in Azospirillum brasilense Sp7.

    Science.gov (United States)

    Gullett, Jessica M; Bible, Amber; Alexandre, Gladys

    2017-07-01

    Chemotaxis is the movement of cells in response to gradients of diverse chemical cues. Motile bacteria utilize a conserved chemotaxis signal transduction system to bias their motility and navigate through a gradient. A central regulator of chemotaxis is the histidine kinase CheA. This cytoplasmic protein interacts with membrane-bound receptors, which assemble into large polar arrays, to propagate the signal. In the alphaproteobacterium Azospirillum brasilense , Che1 controls transient increases in swimming speed during chemotaxis, but it also biases the cell length at division. However, the exact underlying molecular mechanisms for Che1-dependent control of multiple cellular behaviors are not known. Here, we identify specific domains of the CheA1 histidine kinase implicated in modulating each of these functions. We show that CheA1 is produced in two isoforms: a membrane-anchored isoform produced as a fusion with a conserved seven-transmembrane domain of unknown function (TMX) at the N terminus and a soluble isoform similar to prototypical CheA. Site-directed and deletion mutagenesis combined with behavioral assays confirm the role of CheA1 in chemotaxis and implicate the TMX domain in mediating changes in cell length. Fluorescence microscopy further reveals that the membrane-anchored isoform is distributed around the cell surface while the soluble isoform localizes at the cell poles. Together, the data provide a mechanism for the role of Che1 in controlling multiple unrelated cellular behaviors via acquisition of a new domain in CheA1 and production of distinct functional isoforms. IMPORTANCE Chemotaxis provides a significant competitive advantage to bacteria in the environment, and this function has been transferred laterally multiple times, with evidence of functional divergence in different genomic contexts. The molecular principles that underlie functional diversification of chemotaxis in various genomic contexts are unknown. Here, we provide a molecular

  17. L’immaginazione al lavoro. Che cosa e come conosciamo dal romanzo

    Directory of Open Access Journals (Sweden)

    Gianluca Consoli

    2011-12-01

    Full Text Available L’articolo delinea i fondamenti di un’epistemologia del romanzo, rispondendo alle domande di base: che cosa e come possiamo conoscere attraverso il romanzo. A partire dalla definizione del romanzo come racconto di finzione, viene sviluppata  una posizione di cognitivismo radicale, per la quale il romanzo (a produce conoscenza modale; (b giustifica questa conoscenza in base al principio della verosimiglianza; (c favorisce l’apprendimento per esperienza in virtù dell’esemplificazione immaginativa. Le tesi proposte vengono corroborate in riferimento ai recenti dati sperimentali ottenuti dalle scienze cognitive, in particolare dalla psicologia cognitiva, sull’immaginazione, la finzione, la simulazione.

  18. Analisi della sovrapposizione spaziale teorica tra siti di interesse comunitario e grandi carnivori nel Friuli Venezia Giulia e relative implicazioni conservative

    Directory of Open Access Journals (Sweden)

    Carla Fabro

    2003-10-01

    %, max.=42%; nessun centroide dei cluster è risultato all'interno di un SIC. Le aree generate dai centroidi con raggio di 5 (7.500 ha e 10 (30.000 ha km sono coperte rispettivamente per il 17% e 18% da siti SIC. Per l'orso, le aree individuate come minimo poligono convesso, sono risultate interessate in tutti i cluster dalla presenza di SIC (n=20 che occupano superfici pari mediamente al 28% dell'area (min.=2%, max.=43%; due centroidi dei cluster sono risultati all'interno di siti SIC. Le aree generate dai centroidi con raggio di 5 e 10 km coincidono rispettivamente per il 18% e 15% della superficie, con siti SIC. Seppur i segni indiretti possano fornire solo un'indicazione teorica e generale sul ruolo della Rete Natura 2000 per la conservazione dei grandi carnivori nel Friuli, emerge la necessità di ampliare la superficie dei SIC e/o di adottare piani di rigorosa tutela (art. 12 Direttiva Habitat, al fine di raggiungere un'efficace stato di conservazione per queste specie.

  19. Crew Health Care System (CHeCS) Design Research, Documentations, and Evaluations

    Science.gov (United States)

    CLement, Bethany M.

    2011-01-01

    The Crew Health Care System (CHeCS) is a group within the Space Life Science Directorate (SLSD) that focuses on the overall health of astronauts by reinforcing the three divisions - the Environmental Maintenance System (EMS), the Countermeasures System (CMS), and the Health Maintenance System (HMS). This internship provided opportunity to gain knowledge, experience, and skills in CHeCS engineering and operations tasks. Various and differing tasks allowed for occasions to work independently, network to get things done, and show leadership abilities. Specific exercises included reviewing hardware certification, operations, and documentation within the ongoing Med Kit Redesign (MKR) project, and learning, writing, and working various common pieces of paperwork used in the engineering and design process. Another project focused on the distribution of various pieces of hardware to off-site research facilities with an interest in space flight health care. The main focus of this internship, though, was on a broad and encompassing understanding of the engineering process as time was spent looking at each individual step in a variety of settings and tasks.

  20. Finally a crèche at CERN, thanks to the Staff Association

    CERN Multimedia

    Staff Association

    2013-01-01

    Setting up at CERN a collective structure to mind children younger than two years, a so-called “crèche”, has been discussed at least since the early 1990s. Then, in February 2001, the Equal Opportunities Advisory Panel produced a memo to the Director of Administration in which it “invites the CERN Management to re-consider the possibility of creating a crèche at CERN”. As a result an ad hoc task force (“Bethléem”) was set up, which based its work on an informal questionnaire sent to CERN families with small children. Its study came up with some relevant parameters for “should CERN Management intend to undertake a minimal effort toward solving the crèche problem for its staff members”. Nothing was undertaken at that time. In the framework of the 2005 five yearly review “Working Group 6: Crèche” made another study of public and private  cr&a...

  1. La chiesa che si fa presepe: visita al Presepe della Chiesa del Rosario di Mottola

    Directory of Open Access Journals (Sweden)

    Susy Bigontina

    2012-01-01

    Full Text Available Abstract – IT In occasione del Natale, la vie della città di Mottola (Ta, Italia fioriscono di presepi, che i visitatori possono liberamente ammirare. Quella del presepe è una tradizione molto sentita dagli abitanti della cittadina pugliese, nella quale viene allestito un grande presepe che occupa e cela l’intera navata della Chiesa del Ss. Sacramento e Rosario. Gli allestitori, appartenenti ad una storica Confraternita locale dedicano settimane a costruire un presepe plastico della Betlemme nella notte di Natale, che mescola icone della tradizione italiana della Natività – alcuni pezzi, ad esempio, sono preziosi manufatti di scuola napoletana – ed elementi naturali tipici della terra delle gravine. Il presepe del Rosario, inoltre, mostra un’interessante ricerca dell’effetto prospettico e forse un ancor più interessante cornice di ciclicità, ottenuta tramite l’alternanza del giorno e della notte, musica ed effetti sonori, che proietta la scena verso un orizzonte atemporale. Questo articolo nasce dalla visita degli autori a Mottola, in occasione della presentazione del libro La Settimana Santa a Mottola, di cui essi sono stati co-autori, e quindi rappresenta il frutto di un nuovo capitolo di lavoro con la viva comunità mottolese ed i suoi riti. Abstract – FR Pour l'occasion de Noël, les rues de la villes de Mottola (Ta, Italie sont embellies de crèches que les visiteurs peuvent admirer en toute liberté. La tradition de la crèche est une tradition très ressentie par les habitants de la petite ville pugliaise, dans laquelle on prépare une grande crèche qui occupe et cache tout le nef de l'église du très Ss. Sacramento e Rosario. Les préparateurs qui appartiennent à une Confrérie historique locale dédient plusieurs semaines pour la construction d'une crèche comme celle de Betleemme de la nuit de Noël - certaines pièces, par exemple, sont de précieux produits manufacturés provenant de l'école napolitaine - et

  2. Serum cholinesterase polymorphism (CHE1 and CHE2 loci) among several Indian groups from Amazon region of Brazil, and segregation of the C5 variant in families.

    Science.gov (United States)

    Guerreiro, J F; Santos, S E; Aguiar, G F

    1989-04-01

    Eight Indian tribes from the Amazon region of Brazil (Araweté, Arara, Yamamadi, Kararaô, Karitiana, Waiampi, Surui and Cinta Larga) were studied for the distribution of the atypical and C5 variants of serum cholinesterase. None of them presented the CHE1*A allele, but the C5 variant was found in the Araweté (20.4%), Kararaô (15.6%), Karitiana (50.5%), Surui (12.3%) and Cinta Larga (19.6%) tribes. The frequency of the C5+ phenotype in the Karitiana is the highest reported thus far in human populations. Segregation studies considering the C5 variant were made among the Karitiana, and also among the Urubu-Kaapor and Munduruku tribes previously studied by Guerreiro et al [1987a, 1987b]. Most of the data were in agreement with the genetic hypothesis, but they also revealed a significant lack of the C5+ phenotype in offspring from C5+ X C5+ matings, as well as the occurrence of two C5+ children from C5- X C5- unions, in the Urubu-Kaapor tribe.

  3. The new "Jardin de Capucine" crèche brings a breath of fresh air for young CERN parents

    CERN Multimedia

    HR Department

    2011-01-01

    On 19 January 2011, CERN's Director-General, Rolf Heuer, signed an agreement with the company "Le Jardin de Zébulon" for the provision of 40 places at the "Jardin de Capucine", a new private crèche due to open this autumn.   In 2008, the "Jardin de Zébulon", a private bilingual crèche for children aged 1 to 4, was opened by Ariane Boucheron at the Technoparc industrial estate in Saint-Genis Pouilly (France). The following year, the number of places was increased from 20 to 37 to meet demand. The "Jardin de Zébulon" has taken in a number of children of CERN personnel ever since it was created. With no let-up in the demand for new crèche places, Ariane Boucher is currently engaged in the construction of a new centre, the "Jardin de Capucine", next-door to the existing crèche. Forty places at the new crèche will...

  4. An "Ideal" Home for Care: Nel Noddings, Thomas Hill Green, and an Ontological Support for a Phenomenology of Care

    Science.gov (United States)

    Decoste, Jordan; Boyd, Dwight

    2009-01-01

    This paper is grounded in a deep appreciation of Nel Noddings' "ethics of care" as an important contribution to moral philosophy and moral education. We seek to offer some philosophical reflections that have the potential to strengthen this important alternative to mainstream ethics and to how moral education might be conceived and practiced…

  5. Memoria implicita e alfabetizzazione visiva nel contesto museale / Implicit memory and visual literacy in museums

    Directory of Open Access Journals (Sweden)

    Annalisa Banzi

    2014-06-01

    Full Text Available Storici dell’arte ed esperti del settore museale lamentano la difficoltà del pubblico a “leggere” le opere esposte in un museo di arti visive. Guardare e cogliere gli aspetti relativi alla grammatica visiva di un oggetto sono abilità che si apprendono, in generale non sono innate o spontanee. I fruitori potrebbero beneficiare di un metodo che sviluppa e potenzia le loro capacità visive. Lo scopo di questo articolo è presentare e valutare se un modello basato sul priming percettivo, una forma di memoria implicita, possa migliorare la metodologia per leggere gli aspetti visivi del patrimonio artistico. A complemento del lavoro proposto, vengono qui introdotti anche alcuni risultati preliminari di un nuovo promettente approccio sperimentato, che consiste nella analisi dei segnali elettroencefalografici dei soggetti coinvolti, raccolti attraverso un dispositivo per EEG durante la fase di verifica dell’esperimento sul priming percettivo. Art historians and museum practitioners complained about the lack of “reading skills” in observing artworks by museum visitors. Reading and analysing visual grammar aspects of an artistic object are skills that require learning: not innate or spontaneous. Museum goers could benefit from method developing and enhancing their visualization skills. The purpose of this article is to present and assess whether a model based on “visual-perceptual priming”, a form of implicit memory, could improve the methodology of reading visual aspects of artworks. We also introduce some preliminary results obtained from a promising new approach consisting the analysis of electroencephalographic signals from individuals, collected through an EEG device during the experiment on the visual-perceptual priming

  6. La sismicità nella zona di Nocera Umbra nel periodo maggio-luglio 1979.

    Directory of Open Access Journals (Sweden)

    P. IUZZOLINI

    1979-06-01

    Full Text Available We are going to describe the seismic crisis which has interested Nocera
    Umbra area (Perugia from the middle of May to the beginning
    of August 1979, which has been recorded by a seismic station, installed in
    the town.
    Various events have had magnitude ranging from 1.3 to 2.9. The
    registrata da una stazione sismica installata nel paese.
    approximately.
    Data' elaboration has allowed to point out that the hypocentre' depth
    increases, considerably, from Est to West.
    At last, it represents a possible correlation between observed distribution
    and geological structures of the interested area.

  7. Data from the Mars Science Laboratory CheMin XRD/XRF Instrument

    Science.gov (United States)

    Vaniman, David; Blake, David; Bristow, Tom; DesMarais, David; Achilles, Cherie; Anderson, Robert; Crips, Joy; Morookian, John Michael; Spanovich, Nicole; Vasavada, Ashwin; hide

    2013-01-01

    The CheMin instrument on the Mars Science Laboratory (MSL) rover Curiosity uses a Co tube source and a CCD detector to acquire mineralogy from diffracted primary X-rays and chemical information from fluoresced X-rays. CheMin has been operating at the MSL Gale Crater field site since August 5, 2012 and has provided the first X-ray diffraction (XRD) analyses in situ on a body beyond Earth. Data from the first sample collected, the Rocknest eolian soil, identify a basaltic mineral suite, predominantly plagioclase (approx.An50), forsteritic olivine (approx.Fo58), augite and pigeonite, consistent with expectation that detrital grains on Mars would reflect widespread basaltic sources. Minor phases (each XRD. This amorphous component is attested to by a broad rise in background centered at approx.27deg 2(theta) (Co K(alpha)) and may include volcanic glass, impact glass, and poorly crystalline phases including iron oxyhydroxides; a rise at lower 2(theta) may indicate allophane or hisingerite. Constraints from phase chemistry of the crystalline components, compared with a Rocknest bulk composition from the APXS instrument on Curiosity, indicate that in sum the amorphous or poorly crystalline components are relatively Si, Al, Mg-poor and enriched in Ti, Cr, Fe, K, P, S, and Cl. All of the identified crystalline phases are volatile-free; H2O, SO2 and CO2 volatile releases from a split of this sample analyzed by the SAM instrument on Curiosity are associated with the amorphous or poorly ordered materials. The Rocknest eolian soil may be a mixture of local detritus, mostly crystalline, with a regional or global set of dominantly amorphous or poorly ordered components. The Rocknest sample was targeted by MSL for "first time analysis" to demonstrate that a loose deposit could be scooped, sieved to <150 microns, and delivered to instruments in the body of the rover. A drilled sample of sediment in outcrop is anticipated. At the time of writing this abstract, promising outcrops are

  8. Astrobiological Significance of Definitive Mineralogical Analysis of Martian Surface Samples Using the CheMin XRD/XRF Instrument

    Science.gov (United States)

    Feldman, S. M.; Blake, D. F.; Sarrazin, P.; Bish, D. L.; Chipera, S. J.; Vaniman, D. T.; Collins, S.

    2004-01-01

    The search for evidence of habitability, or of extant or extinct life on Mars, will initially be a search for evidence of past or present conditions supportive of life. The three key requirements for the emergence of life are thought to be liquid water; a suitable energy source; and chemical building blocks. CheMin is a miniaturized XRD/XRF (X-Ray diffraction / X-ray fluorescence) instrument which has been developed for definitive mineralogic analysis of soils and rocks on the Martian surface. The CheMin instrument can provide information that is highly relevant to each of these habitability requirements as summarized below.

  9. Fractional derivatives. An introduction; Derivate frazionarie. Che cosa sono, a cosa servono

    Energy Technology Data Exchange (ETDEWEB)

    Dattoli, G. [ENEA, Div. Fisica Applicata, Centro Ricerche Frascati, Rome (Italy)

    2001-07-01

    In this item is presented a brief survey of fractional calculus and of the relevant applications. In the work are discussed different points of view of the operation of fractional derivative and present a unifying definition. The role played by fractional derivatives and integrals within the framework of integral transform is analyzed. [Italian] In questo articolo si traccia un profilo del cosidetto calcolo frazionario e delle relative applicazioni a problemi di matematica pura ed applicata. Si discutono varie definizioni dell'operazione di derivata frazionaria, non tutte coincidenti fra loro, e si mostra come sia possibile proporre una definizione univoca che inglobi tutte le altre. Si analizza infine il ruolo giocato dalle derivate e dagli integrali frazionari e, piu' in generale, quello degli operatori differenziali ad esponente frazionario, nell'ambito della teoria delle rappresentazioni integrali.

  10. CheD: chemical database compilation tool, Internet server, and client for SQL servers.

    Science.gov (United States)

    Trepalin, S V; Yarkov, A V

    2001-01-01

    An efficient program, which runs on a personal computer, for the storage, retrieval, and processing of chemical information, is presented, The program can work both as a stand-alone application or in conjunction with a specifically written Web server application or with some standard SQL servers, e.g., Oracle, Interbase, and MS SQL. New types of data fields are introduced, e.g., arrays for spectral information storage, HTML and database links, and user-defined functions. CheD has an open architecture; thus, custom data types, controls, and services may be added. A WWW server application for chemical data retrieval features an easy and user-friendly installation on Windows NT or 95 platforms.

  11. Studio dei fattori che influenzano la digeribilità della fibra nella bovina da latte: approcci dinamici

    OpenAIRE

    Bonfante, Elena

    2017-01-01

    I ruminanti sono altamente specializzati nella digestione della fibra. In condizioni di ottima funzionalità digestiva, sono le particelle di foraggio ad essere trattenute per lungo tempo nel rumine dove possono essere degradate dai batteri cellulosolitici. Nonostante queste conoscenze, la stima della degradabilità ruminale delle porzioni potenzialmente degradabili delle fibre è stata notevolmente sottostimata da taluni modelli dinamici di razionamento. Studi più recenti realizzati da Kriz...

  12. IL POTERE DEL SOGNO: MUSICA E STRUTTURA NEL FILM EYES WIDE SHUT DI

    Directory of Open Access Journals (Sweden)

    Emanuele Ferrari

    2008-09-01

    Full Text Available Resumen: En la película Eyes Wide Shut (traducida al español como Ojos bien cerrados la tendencia no narrativa y antisicológica de la cinematografía de Kubrick alcanza su máxima expresión. No obstante la apariencia, la película no cuenta una historia o un proceso en marcha, ni siquiera se ocupa del interior de los personajes. Al contrario, el tema explorado por Kubrick es el enigma de lo visible, la sobreabundancia del sentido que emana de las imágenes. Luces, colores ambientes y fisonomías crean un mundo lleno de sentido, pero indescifrable. La realidad, luminosa y brillante para el ojo, resulta opaca e impenetrable a la razón. En este cuadro la música es un elemento fundamental que aumenta significativamente la complejidad del conjunto. El artículo examina algunas de las sofisticadas estrategias con las cuales Kubrick relaciona sonidos e imágenes según una concepción altamente evolucionada que excluye el puro y simple acompañamiento musical a las imágenes. Si lo visible es de por sí rico en sentido, lo audible no lo es menos y la interacción entre estas dos dimensiones conlleva a la enseñanza de la paradoja. Música e imagenes proceden según un juego de desfases y de contradicciones que multiplican los indicios con los cuales la realidad se vuelve legible, hasta sumergirla en una total ambigüedad. Los personajes -y espectadores- se encuentran tan perdidos en un laberinto de sentido que hipnotiza y fascina sin jamás revelar su propio secreto.Abstract: In Eyes Wide Shut la tendenza non narrativa e antipsicologica del cinema di Kubrick raggiunge un apice. Nonostante l’apparenza, il film non racconta una storia o un processo in divenire, né si occupa dell’interioritá dei personaggi. Al contrario, il tema esplorato da Kubrick è l’enigma del visibile, la sovrabbondanza del senso che promana dalle immagini. Luci, colori, ambienti e fisionomie creano un mondo pieno di senso, ma indecifrabile. La realtá, luminosa e

  13. PO.RA project. An analysis on gas radon concentrations in soil versus fluctuations in the groundwater table; Progetto PO.RA.. Analisi della concentrazione di gas radon nel non saturo in relazione alla soggiacenza della falda freatica

    Energy Technology Data Exchange (ETDEWEB)

    Serentha' , C.; Torretta, M. [Agenzia Regionale per la Protezione dell' Ambiente della Lombardia, Dipartimento di Monza, Monza (Italy)

    2001-09-01

    Man is daily exposed to natural radiation, mainly due to cosmic rays and natural radioactive elements, whose most important radioactive daughters are {sup 222}Rn (radon) and {sup 220}Rn (thoron). Being these ones gaseous, they can spread through the ground, reaching the atmosphere and accumulating in rooms, where their concentrations may be very high. As radon exhalation is strongly connected with the hydrogeological features of the environment, this study tried to find a relationship between fluctuations in the groundwater table and gas radon concentrations in soil, in order to try estimates of indoor radon concentrations. [Italian] L'uomo e' quotidianamente esposto ad una radioattivita' di origine naturale, dovuta principalmente ai raggi cosmici ed alla presenza di alcuni elementi radioattivi naturali, i cui discendenti radioattivi piu' importanti sono il {sup 222}Rn (radon) e il {sup 220}Rn (thoron). Tali elementi, a causa della loro natura gassosa, si possono diffondere attraverso il terreno e raggiungere l'atmosfera sovrastante; cio' puo' provocarne l'accumulo in ambienti chiusi, dando luogo a concentrazioni anche elevate con possibili conseguenze sulla salute. Poiche' l'esalazione del gas radon e' foremente legata alle caratteristiche idrogeologiche dell'ambiente, in questo lavoro si e' cercato di definire una relazione che legasse le variazioni della soggiacenza della falda freatica alle variazioni della concentrazione del gas radon nel non saturo, al fine di verificare se sia possibile effettuare un'attivita' previsionale applicabile ai rilievi di gas radon indoor.

  14. “Economic heritage impact assessment” come strumento per valutare gli impatti dei grandi progetti di riqualificazione delle città costiere siti Unesco. Il caso studio di Torre Annunziata nel golfo di Napoli

    Directory of Open Access Journals (Sweden)

    Mariarosaria Angrisano

    2015-12-01

    Full Text Available Quest’articolo parte dallo studio delle città portuali storiche, siti UNESCO, che oggi affrontano la sfida della riqualificazione dei waterfront urbani attraverso la conservazione del patrimonio culturale e paesaggistico. Le raccomandazioni sull’ “Historic Urban Landscape”, e gli strumenti operativi promossi dall’ICOMOS “Guidance on Heritage Impact Assessments for Cultural World Heritage Properties” del 2011, si configurano come le più recenti disposizioni concernenti la conservazione, protezione e valorizzazione del patrimonio culturale (Fusco Girard, 2010. La Guida ICOMOS è stata considerata lo strumento più adatto per valutare gli impatti dei grandi progetti di riqualificazione dei waterfront urbani sul patrimonio culturale. Per comprendere al meglio tale strumento è stata fatta un’applicazione per valutare gli impatti del Grande Progetto Pompei sul waterfront di Torre Annunziata, città costiera nel Golfo di Napoli sito UNESCO. A questa fase di analisi segue una riflessione su come migliorare l’Heritage Impact Assessment, come strumento capace di valutare non soltanto gli impatti culturali ma anche quelli economici, per parlare di “economia del patrimonio culturale”. La proposta ultima è quella di affiancare al processo di “Heritage Impact Assessment” una valutazione degli impatti economici, attraverso un’analisi costi-benefici, per quantificare in termini monetari la convenienza degli investimenti nella conservazione del patrimonio storico urbano delle città costiere, proponendo una “Economic Heritage Impact Assessment” (EHIA. Tale metodo, elaborato dall’autrice all’interno della tesi di dottorato “Il paesaggio storico urbano delle città costiere: sfide e opportunità. Il caso Torre Annunziata”, offre la possibilità di superare la sola valutazione degli impatti culturali proposta dall’ICOMOS.

  15. Distribuzione e consistenza della popolazione di Scoiattolo grigio Sciurus carolinensis Gmelin, 1788 nel levante genovese

    Directory of Open Access Journals (Sweden)

    Martina Venturini

    2005-06-01

    Full Text Available Abstract Distribution and population size of the Grey squirrel Sciurus carolinensis Gmelin, 1788 in Province of Genova (NW Italy In Liguria, the Grey squirrel population originated from an introduction of five pairs in an urban park (Genoa Nervi in 1966. A first study, carried out in the 1996 by interviews, located a second group 3 km far, in Bogliasco locality. In this study, conducted in 2001-04, the population size of Genoa Nervi and the presence of the species in surrounding areas were investigated. In 2002 the population size was estimated in 115/286 individuals by distance sampling method, while, by direct observation, it varied from 80 individuals (2004 to 114 individuals (2003. The sampling by hair tubes in surrounding areas confirmed the presence of a group of grey squirrels in Bogliasco and excluded a further dispersal of the species. Riassunto In Liguria, la popolazione di Scoiattolo grigio Sciurus carolinensis ha avuto origine dall'introduzione di 5 coppie nei parchi urbani di Genova Nervi nel 1966. Un primo studio condotto nel 1996 ha localizzato, tramite interviste, un secondo nucleo a 3 km di distanza, in località Bogliasco. Il presente studio, condotto nel 2001-2004, è stato finalizzato alla valutazione della consistenza della popolazione nei parchi di Nervi, mediante il metodo distance sampling e osservazioni dirette, e all'accertamento della presenza della specie nelle aree circostanti mediante l'utilizzo di hair tube. La stima della popolazione con il metodo distance sampling è risultata di 115/286 individui nel 2002, mentre quella ottenuta mediante osservazioni dirette è variata da 80 individui nel 2004 a 114 individui nel 2003. Gli accertamenti compiuti nelle aree circostanti i parchi di Nervi hanno consentito di confermare la presenza di un nucleo di scoiattoli a Bogliasco e di escludere un'ulteriore espansione della specie.

  16. L'economia statunitense: debolezza della "forte" ripresa (The U.S. economy: the weakness of the "strong" recovery

    Directory of Open Access Journals (Sweden)

    Wynne Godley

    2009-12-01

    Full Text Available Le prospettive strategiche dell’economia statunitense (o di altri paesi possono venire valutate analizzando i bilanci finanziari del suoi principali settori, che sono tra loro collegati da un coerente sistema di contabilità. L’espansione del periodo 1992-2000, accompagnata da un crescente avanzo di bilancio, venne accolta da un’ondata di autocompiacimento negli Stati Uniti e si ritenne che potesse durare all’infinito. Tuttavia l’esame dei bilanci rivela che la configurazione delle forze trainanti era insostenibile e che l’orientamento della politica fiscale doveva drasticamente cambiare a un certo punto. Alla fine, vi è stata in effetti un’enorme espansione fiscale che evitò un’imminente recessione. Tuttavia la nuova configurazione dei bilanci finanziari rivela nuovamente una situazione insostenibile, con il debito pubblico, quello estero e quello privato che crescono in modo eccessivamente veloce. La crescita sostenuta nel medio termine può essere raggiunta solo se si verifica una prolungata espansione nella domanda netta di esportazioni, per la quale tuttavia il resto del mondo non sembra ben preparato. The strategic outlook of the U.S. economy (or other countries can be assessed by analyzing the financial statements of its main sectors, which are connected together by a coherent system of accounting. The expansion of the period 1992-2000, accompanied by a growing surplus, was greeted by a wave of complacency in the United States and it was thought that it could last forever. However, the examination of financial statements reveals that the configuration of the driving forces was unsustainable and that the orientation of fiscal policy was to change dramatically at some point. In the end, there was in fact a huge fiscal expansion that prevented an imminent recession. However, the new configuration of the financial statements reveals again an untenable situation, with the public debt, the foreign and the private grow too

  17. L’economia statunitense: debolezze della “forte” ripresa (The US Economy: Weakness of the 'Strong' Recovery

    Directory of Open Access Journals (Sweden)

    Wynne Godley

    2012-04-01

    Full Text Available The strategic prospects for the US (or any economy can be evaluated by reference to the financial balances of its main sectors, which are related to one another by a consistent accounting system. The 1992-2000 expansion, accompanied by a rising budget surplus, was greeted by a storm of self-congratulation in the US and widely expected to last indefinitely. But inspection of the balances revealed that the configuration of driving forces was unsustainable and that the fiscal stance should drastically change at some stage. Eventually, there has indeed been a huge fiscal expansion which warded off an incipient recession. But the new configuration of financial balances again reveals an unsustainable situation, with government, foreign and private debt all rising excessively fast. Sustained growth in the medium term can only be achieved if there is now a prolonged expansion in net export demand--for which the rest of the world does not seem to be well prepared. Le prospettive strategiche dell’economia statunitense (o di altri paesi possono venire valutate analizzando i bilanci finanziari del suoi principali settori, che sono tra loro collegati da un coerente sistema di contabilità. L’espansione del periodo 1992-2000, accompagnata da un crescente avanzo di bilancio, venne accolta da un’ondata di autocompiacimento negli Stati Uniti e si ritenne che potesse durare all’infinito. Tuttavia l’esame dei bilanci rivela che la configurazione delle forze trainanti era insostenibile e che l’orientamento della politica fiscale doveva drasticamente cambiare a un certo punto. Alla fine, vi è stata in effetti un’enorme espansione fiscale che evitò un’imminente recessione. Tuttavia la nuova configurazione dei bilanci finanziari rivela nuovamente una situazione insostenibile, con il debito pubblico, quello estero e quello privato che crescono in modo eccessivamente veloce. La crescita sostenuta nel medio termine può essere raggiunta solo se vi ora

  18. Lessons Learned from the Crew Health Care System (CHeCS) Rack 1 Environmental Control and Life Support (ECLS) Design

    Science.gov (United States)

    Williams, David E.

    2006-01-01

    This paper will provide an overview of the International Space Station (ISS) Environmental Control and Life Support (ECLS) design of the Crew Health Care System (CHeCS) Rack 1 and it will document some of the lessons that have been learned to date for the ECLS equipment in this rack.

  19. Efficient Computation of Sparse Matrix Functions for Large-Scale Electronic Structure Calculations: The CheSS Library.

    Science.gov (United States)

    Mohr, Stephan; Dawson, William; Wagner, Michael; Caliste, Damien; Nakajima, Takahito; Genovese, Luigi

    2017-10-10

    We present CheSS, the "Chebyshev Sparse Solvers" library, which has been designed to solve typical problems arising in large-scale electronic structure calculations using localized basis sets. The library is based on a flexible and efficient expansion in terms of Chebyshev polynomials and presently features the calculation of the density matrix, the calculation of matrix powers for arbitrary powers, and the extraction of eigenvalues in a selected interval. CheSS is able to exploit the sparsity of the matrices and scales linearly with respect to the number of nonzero entries, making it well-suited for large-scale calculations. The approach is particularly adapted for setups leading to small spectral widths of the involved matrices and outperforms alternative methods in this regime. By coupling CheSS to the DFT code BigDFT, we show that such a favorable setup is indeed possible in practice. In addition, the approach based on Chebyshev polynomials can be massively parallelized, and CheSS exhibits excellent scaling up to thousands of cores even for relatively small matrix sizes.

  20. Molecular Interaction and Cellular Location of RecA and CheW Proteins in Salmonella enterica during SOS Response and Their Implication in Swarming.

    Science.gov (United States)

    Irazoki, Oihane; Aranda, Jesús; Zimmermann, Timo; Campoy, Susana; Barbé, Jordi

    2016-01-01

    In addition to its role in DNA damage repair and recombination, the RecA protein, through its interaction with CheW, is involved in swarming motility, a form of flagella-dependent movement across surfaces. In order to better understand how SOS response modulates swarming, in this work the location of RecA and CheW proteins within the swarming cells has been studied by using super-resolution microscopy. Further, and after in silico docking studies, the specific RecA and CheW regions associated with the RecA-CheW interaction have also been confirmed by site-directed mutagenesis and immunoprecipitation techniques. Our results point out that the CheW distribution changes, from the cell poles to foci distributed in a helical pattern along the cell axis when SOS response is activated or RecA protein is overexpressed. In this situation, the CheW presents the same subcellular location as that of RecA, pointing out that the previously described RecA storage structures may be modulators of swarming motility. Data reported herein not only confirmed that the RecA-CheW pair is essential for swarming motility but it is directly involved in the CheW distribution change associated to SOS response activation. A model explaining not only the mechanism by which DNA damage modulates swarming but also how both the lack and the excess of RecA protein impair this motility is proposed.

  1. Molecular interaction and cellular location of RecA and CheW proteins in Salmonella enterica during SOS response and their implication in swarming

    Directory of Open Access Journals (Sweden)

    Oihane Irazoki

    2016-10-01

    Full Text Available In addition to its role in DNA damage repair and recombination, the RecA protein, through its interaction with CheW, is involved in swarming motility, a form of flagella-dependent movement across surfaces. In order to better understand how SOS response modulates swarming, in this work the location of RecA and CheW proteins within the swarming cells has been studied by using super-resolution microscopy. Further, and after in silico docking studies, the specific RecA and CheW regions associated with the RecA-CheW interaction have also been confirmed by site-directed mutagenesis and immunoprecipitation techniques. Our results point out that the CheW distribution changes, from the cell poles to foci distributed in a helical pattern along the cell axis when SOS response is activated or RecA protein is overexpressed. In this situation, the CheW presents the same subcellular location as that of RecA, pointing out that the previously described RecA storage structures may be modulators of swarming motility. Data reported herein not only confirmed that the RecA-CheW pair is essential for swarming motility but it is directly involved in the CheW distribution change associated to SOS response activation. A model explaining not only the mechanism by which DNA damage modulates swarming but also how both the lack and the excess of RecA protein impair this motility is proposed.

  2. European analytical column No. 36 from the Division of Analytical Chemistry (DAC) of the European Association for Chemical and Molecular Sciences (EuCheMS)

    DEFF Research Database (Denmark)

    Karlberg, Bo; Emons, Hendrik; Andersen, Jens Enevold Thaulov

    2008-01-01

    European analytical column no. 36 from the division of analytical chemistry (DAC) of the European association for chemical and molecular sciences (EuCheMS)......European analytical column no. 36 from the division of analytical chemistry (DAC) of the European association for chemical and molecular sciences (EuCheMS)...

  3. El Che - más que médico

    Directory of Open Access Journals (Sweden)

    Natalia I. Osorio Curbelo

    2015-12-01

    Full Text Available Revolucionario, dirigente político, comandante guerrillero, intelectual y médico.  Uno de los íconos del siglo XX.  Nació en Rosario, Argentina, el 14 de junio de 1928. En 1938, con apenas 10 años, el padre le enseñó a jugar Ajedrez en el transcurso del año, deporte que no dejaría de practicar nunca más y lo estudiaría por siempre. En 1939 supo de la existencia de Cuba, pues teniendo 11 años, cuando vivía en Alta Gracia, en Buenos Aires se desarrollaba la VII Olimpiada de Ajedrez y el más conocido de los ajedrecistas cubanos José Raúl Capablanca, obtuvo la medalla de Oro en el primer tablero, convirtiéndose en noticia mundial. La gran pasión por el juego ciencia  se puso de manifiesto durante toda su vida, jugó Ajedrez cuando estaba viajando en un avión, cuando  estuvo detenido en alguna estación policial o, simplemente, a las tres de la madrugada recibía una delegación mexicana para jugar una partida después de conversar sobre los temas generales comunes. Ernesto Guevara, eternamente Che, revolucionario integral y multifacético, sintió gran afición por los deportes y aunque por lo general se le cita como amante del ajedrez y el fútbol, también, desde niño, practicó con derroche de coraje y voluntad otros no tan divulgados. A sus prácticas deportivas también se entregó con la voluntad, coraje y pasión que lo caracterizaron a lo largo de su vida. Luego del triunfo de la Revolución cubana, en la que ganó  los grados de Comandante, hubo  un deporte priorizado  en la vida del Che: el Ajedrez.  Dos veces ganó en los campeonatos patrocinados por el Ministerio de Industria, que él presidía,  y participó, además, en los Torneos del INDER donde ascendió, por los resultados alcanzados, a la primera categoría. Se enfrentó en partidas simultáneas a varios de los mejores jugadores de esos días, entre ellos los grandes maestros soviéticos Victor Korchnoi y Mijail Tal y el argentino Miguel Najdorf, d

  4. International cooperation in healthcare: model of IRCCS Policlinico San Donato and Bambini Cardiopatici nel Mondo Association for congenital heart diseases.

    Science.gov (United States)

    Frigiola, Alessandro; Moussaidi, Nadia; Giamberti, Alessandro; Pomé, Giuseppe; Isgrò, Giuseppe; Youssef, Tammam; Reali, Matteo; Varrica, Alessandro; Nuri, Halkawt A; Cirri, Silvia; Carminati, Mario; Menicanti, Lorenzo; Ferrari, Roberto; Ranucci, Marco

    2016-04-28

    Cooperation activity in training programmes promoted by IRCCS Policlinico San Donato and Bambini Cardiopatici nel Mondo Association is a model of cooperation between people as an alternative intervention in promoting the right to healthcare, especially offering programmes of training and medical care on cardiovascular and congenital heart disease. This new strategy, implemented in several developing countries, has absolutely contributed to the improvement of the medical services concerning the diagnostic and surgical approach in the treatment of paediatric and adult cardiovascular disease. To strengthen this kind of activity, both IRCCS Policlinico San Donato and Bambini Cardiopatici nel Mondo have introduced a global perspective aiming at the realization of surgical missions 'in situ', building new cardiac surgery units in collaboration with the local partners, which are mainly university hospitals. They, furthermore, support financially the scholarship and accommodation in favour of medical and paramedical staff.

  5. DISEGUAGLIANZE DEI REDDITI E POVERTA' DELLE FAMIGLIE ATTRAV ERSO DATI AMMINISTRATIVI. UN'INDAGINE LONGITIDINALE NEL COMUNE DI BRESCIA

    OpenAIRE

    COMUNE, MARIA ELENA

    2012-01-01

    In questo studio, attraverso la realizzazione di un’indagine longitudinale basata su dati amministrativi, sono stati ricostruiti i redditi delle famiglie residenti nel comune di Brescia per gli anni 2005-2008, in una prospettiva trasversale e longitudinale, individuando situazioni di disuguaglianza, di disagio e povertà economica di alcune fasce della popolazione. L’indagine longitudinale è stata realizzata mediante il record-linkage tra i dati amministrativi provenienti dall’Anagrafe comunal...

  6. La lingua2 nel Web. Prospettive digitali per la didattica dell’italiano a stranieri

    Directory of Open Access Journals (Sweden)

    Roberto Quaggia

    2013-07-01

    Full Text Available L'articolo si compone di due parti. Nella prima si espongono alcuni punti focali del dibattito sul rapporto tra glottodidattica e tecnologie digitali (dai dispositivi mobili ai software per la comunicazione, fino agli attuali socialnetwork. In particolare l’attenzione è rivolta sul fatto che la lingua della comunicazione digitale costituisce una varietà linguistica dal confronto con la quale l’insegnamento di una L2 non può ormai prescindere, e che le tecnologie digitali della comunicazione, se correttamente adottate fuori e dentro la classe, consentono di ridurre il confine tra apprendimento guidato e acquisizione spontanea di una lingua seconda. Filo conduttore della riflessione è il concetto di “competenza comunicativa digitale”, che si aggiunge alle componenti della competenza linguistico-comunicativa indicate dal Quadro Comune Europeo di Riferimento per le Lingue. Nella seconda parte del lavoro, dal taglio più didattico, si presenta una serie di strumenti e di esperienze di insegnamento/apprendimento della L2 con l’uso delle tecnologie digitali. In particolare ci si sofferma sulle opportunità offerte dal Web 2.0, simulando la creazione di una piattaforma per l’insegnamento/apprendimento dell’italiano L2 completamente online. Non si tratta di una semplice piattaforma per l’e-learning (o d-learning, ma di una vera e propria rete per l’insegnamento, l’apprendimento, la comunicazione e la formazione che trasforma il modo in cui si usa, si apprende e si insegna una L2. L2 on the Web. Digital perspectives for teaching italian to foreignersThe article consists of two parts. In the first we illustrate some focal points in the debate on the relationship between language teaching and digital technologies (from mobile devices to communication software and current social networks. In particular, we focus on the fact that the language of digital communication is a linguistic variety which L2 teaching can no longer ignore, and

  7. Da questa parte del mare. Gianmaria Testa ed Erri De Luca nel secolo delle migrazioni

    Directory of Open Access Journals (Sweden)

    Isabella Maria Zoppi

    2009-11-01

    Full Text Available Gianmaria Testa's album Da questa parte del mare (2006 expresses a fifteen-year-long meditation about the theme of the great migrations which have marked the Twentieth Century. That same theme is considered by Erri De Luca as the only possible, epic narration of the contemporary world. On the one hand, Testa's project finds its starting point from the song-writer's capacity of observing and interpreting common stories as well as from his considerations about the changing of History; on the other hand, it takes origin from the reading of Erri De Luca's novels and lyrics, especially those of Solo andata. Righe che vanno troppo spesso a capo (2005. Within Testa's Da questa parte del mare, their lyrical voices and artistic and human perspectives seem somehow to cross and melt. Through his songs, Testa tells in an original way the new human geography traced by the migrant phenomenon across the Mediterranean and Europe.

  8. Un 'ambasciata veneta a Clarenza presso Caterina di Valois nel 1341, da documenti inediti

    Directory of Open Access Journals (Sweden)

    Tzavara, Angeliki

    2003-12-01

    Full Text Available In 1341, a Venetian ambassade arrived at Clarenza in order to meet the only Empress in name latin, Catherine de Valois, who was with her son Robert in Morea, so as to consolidate her power. The reason of the diplomatic mission was the continuous protestations made by the Venetians against the intollerance and and the erosion of their ancient commercial privileges. The objectives of the ambassade were no only to demand a compensation but, above all, to ask for the reaffirmation of the merchants'privileges by the new lords of the Principate.

    Nel 1341, un'ambasciata veneta giunse a Clarenza presso l'imperatrice latina titulare di Costantinopoli Caterina di Valois, la quale si trovava in Morea, assieme al figlio Roberto, per consolidare il proprio potere. Le cause dell'invio della missione diplomatica erano state le continue proteste del Veneziani per il clima d'intolleranza e per l'erosione degli antichi privilegi commerciali. Gli obiettivi dell'ambasciata erano sì chiedere gli indennizi, ma soprattutto riaffermare nei confronti dei nuovi signori del principatoi privilegi già goduti dai mercanti.

  9. Cherenkov and scintillation light separation on the CheSS experiment

    Science.gov (United States)

    Caravaca, Javier; Land, Benjamin; Descamps, Freija; Orebi Gann, Gabriel D.

    2016-09-01

    Separation of the scintillation and Cherenkov light produced in liquid scintillators enables outstanding capabilities for future particle detectors, the most relevant being: particle directionality information in a low energy threshold detector and improved particle identification. The CheSS experiment uses an array of small, fast photomultipliers (PMTs) and state-of-the-art electronics to demonstrate the reconstruction of a Cherenkov ring in liquid scintillator using two techniques: based on the photon density and using the photon hit time information. A charged particle ionizing a scintillation medium produces a prompt Cherenkov cone and late isotropic scintillation light, typically delayed by several ns. The fast response of our PMTs and DAQ provides a precision well below the ns level, making possible the time separation. Furthermore, the usage of the new developed water-based liquid scintillators (WbLS) enhances the separation since it allows tuning of the Cherenkov/Scintillation ratio. Latest results on the separation for pure liquid scintillators and WbLS will be presented.

  10. Start of enrolment for the Champs-Fréchets crèche (EVE)

    CERN Multimedia

    HR Department

    2008-01-01

    As announced in Bulletin 43/2007, CERN signed an agreement with the commune of Meyrin on 17 October 2007 under which 20 places will be reserved for the children of CERN personnel in the Champs-Fréchets day care centre (EVE), which will open on Monday, 25 August, and CERN will contribute to the funding. This agreement allows members of the CERN personnel (employees and associates) access to the crèche, for children aged between 4 months and 4 years, irrespective of where they are living. Applications for the school year starting autumn 2008 will be accepted from Monday 17 March until Monday 30 June 2008. Members of the personnel must complete the enrolment formalities with the Meyrin infant education service themselves: Mairie de Meyrin Service de la Petite Enfance 2 rue des Boudines Case postale 367 - 1217 Meyrin 1 - Tel. + 41 (0)22 782 21 21 mailto:meyrin@meyrin.ch http://www.meyrin.ch/petiteenfance Application forms (in PDF) can be downloaded from the website of the com...

  11. La carriera di un economista. che cosa? Perchè? Come? (An economist’s career: what? why? how?

    Directory of Open Access Journals (Sweden)

    R. TRIFFIN

    2013-12-01

    Full Text Available Il documento è un contributo ad una serie di ricordi e riflessioni sulle esperienze professionali di illustrieconomisti con Banca Nazionale del Lavoro Quarterly Review iniziate nel 1979. In esso Robert Triffin fornisce riflessioni personali sulla sua carriera, il suo marchio personale di economia pratici, e la sua filosofia di vita.The paper is a contribution to a series of recollections and reflections on the professional experiences of distinguished economists which the Banca Nazionale del Lavoro Quarterly Review started in 1979. In it Robert Triffin provides personal reflections on his career, his personal brand of practical economics, and his life philosophy.JEL: B31

  12. LE SOLUTRÉEN ANCIEN EN ARDÈCHE (FRANCE: UNE RÉVISION CRITIQUE DES INDUSTRIES LITHIQUES

    Directory of Open Access Journals (Sweden)

    Sophie Guegan

    2013-11-01

    Full Text Available S’inscrivant dans un travail de Doctorat sur les peuplements des deux rives de la vallée du Rhône au Maximum Glaciaire, cet article propose un état des connaissances sur la phase ancienne du Solutréen en Ardèche (rive droite du Rhône, donnant lieu à une révision critique des industries lithiques s’y rapportant. En effet, depuis les travaux de P.E.L. Smith et J. Combier, et plus récemment le travail d’A. Barbiero consacré aux pointes à face plance et pointes à cran d’une collection ancienne à la Baume d’Oullins (Gard-Ardèche, France, aucun réexamen global n’avait été entrepris. Trois gisements de référence pour cette phase ancienne, ont ainsi été sélectionnés: les grottes d’Oullins (Gard-Ardèche, France, de Chabot (Gard, France et de Granouly (Ardèche, France. Nous présentons ici les réslutats préliminaires à cette étude. En premier lieu, une approche typologique a été menée principalement autour de la pointe à face plane, objet emblématique de cette phase, permettant d’en préciser les principaux caractères. Dans un deuxième temps, une approche technologique a permis de confirmer l’homogénéité dans les choix techniques des Solutréens entre l’Ardèche et les régions du Sud-Ouest et du Bassin Parisien. Enfin, une étude des matières premières, a révélé pour l’heure des choix économiques étonnants pour le contexte paléo-climatique, avec des déplacements vers le nords et un franchissement du Rhône.In the frame of a doctoral dissertation on the Late Glacial Maximum occupations of both sides of the Rhône valley, this paper presents a state of the art and a critical reappraisal of the lithic assemblages from the early phases of the Solutrean in Ardeche (right bank of the Rhône river. Indeed, since the works of P.E.L. Smith and J. Combier, except the work of A. Barbiero, on the unifacial leaf-points and shouldered points from Baume d'Oullins, no complete study of these

  13. Méthodes de levée de dormance de la noix de cola fraîche ( Cola ...

    African Journals Online (AJOL)

    Cette étude avait pour objectif de proposer une méthode efficace de germination de la noix de cola fraîche, en vue d'une réduction significative du délai de germination à travers un test comparatif de traitement de la noix par blessure, humidification et chaleur. Méthodologie et résultats: L'étude a été mise en place selon un ...

  14. “Nell’occhio che riscopre la luce”: tempo, Storia e memoria nella poesia di Salvatore Quasimodo

    OpenAIRE

    Alessandro Martini

    2015-01-01

    La riflessione sul rapporto dell’uomo con il tempo e con la storia percorre senza soluzione di continuità l’opera poetica di Salvatore Quasimodo. Spesso a disagio in una dimensione temporale fissa e definita, schiacciato tra dolore dell’esilio, insensatezza della guerra e crisi del dopoguerra, il poeta interroga gli evi passati e le ere future in cerca di un’armonia che appare il più delle volte sfuggente.

  15. The chemotaxis-like Che1 pathway has an indirect role in adhesive cell properties of Azospirillum brasilense.

    Science.gov (United States)

    Siuti, Piro; Green, Calvin; Edwards, Amanda Nicole; Doktycz, Mitchel J; Alexandre, Gladys

    2011-10-01

    The Azospirillum brasilense chemotaxis-like Che1 signal transduction pathway was recently shown to modulate changes in adhesive cell surface properties that, in turn, affect cell-to-cell aggregation and flocculation behaviors rather than flagellar-mediated chemotaxis. Attachment to surfaces and root colonization may be functions related to flocculation. Here, the conditions under which A. brasilense wild-type Sp7 and che1 mutant strains attach to abiotic and biotic surfaces were examined using in vitro attachment and biofilm assays combined with atomic force microscopy and confocal microscopy. The nitrogen source available for growth is found to be a major modulator of surface attachment by A. brasilense and could be promoted in vitro by lectins, suggesting that it depends on interaction with surface-exposed residues within the extracellular matrix of cells. However, Che1-dependent signaling is shown to contribute indirectly to surface attachment, indicating that distinct mechanisms are likely underlying flocculation and attachment to surfaces in A. brasilense. © 2011 Federation of European Microbiological Societies. Published by Blackwell Publishing Ltd. All rights reserved.

  16. IL NOME IN LIS NEL SEGNATO DI ADULTI UDENTI: UNA INDAGINE PRELIMINARE SUL CORPUS LISAU

    Directory of Open Access Journals (Sweden)

    Matteo La Grassa

    2016-09-01

    Full Text Available L’indagine presenta i primi risultati emersi dall’analisi di una parte del corpus LISAU (LIS di Adulti Udenti sulla produzione segnata del sintagma nominale in LIS da parte di informanti udenti che hanno appreso la LIS come L2 in età adulta. Scopo dell’indagine è cominciare a tracciare una linea di ricerca nell’ambito della linguistica acquisizionale con riferimento all’acquisizione della LIS come L2 da parte di udenti. Il corpus LISAU include il segnato di 7 informanti udenti con livello di competenza omogenea che hanno terminato un corso di terzo livello presso la sede Ente Nazionale Sordi di Prato e di 2 informanti sordi segnanti nativi considerati come gruppo di controllo. L’analisi si è incentrata sulla realizzazione dei nomi di prima e di seconda classe rilevando anche forme non citazionali, sulla realizzazione di forme plurali e sulle modalità di accordo tra nomi e aggettivi. Dalla maggior parte dei dati analizzati si rileva la piena competenza degli informanti nella realizzazione del sintagma nominale. Nouns Signed by hearing adults in LIS: a preliminary survey on the LISAU corpus The results of an analysis concerning part of the LISAU (LIS of  Hearing Adults corpus related to the production of the noun phrase in LIS by hearing informants who learned the LIS L2 in adulthood are presented. The purpose of the investigation was to outline the process with regard to the acquisition of LIS L2 by hearing adults. The LISAU corpus is composed of the sign language of 7 hearing informants with a homogeneous level of competence who completed a third-level course at the Ente Nazionale Sordi in Prato. LISAU also includes the sign language of 2 deaf native signers, considered the control group. The analysis focuses on the first and second-class nouns, including non-citation forms, plural forms and noun-adjective agreement. Most of the analyzed data reveals the informants’ full competence in creating noun phrases.

  17. Evidence based medicine (EBM) and evidence based radiology (EBR) in the follow-up of the patients after surgery for lung and colon-rectal carcinoma; Medicina basata sulle evidenze (EMB) e radiologia basata sulle evidenze (EBR) nel follow-up dei pazienti operati per tumore del polmone e del colon

    Energy Technology Data Exchange (ETDEWEB)

    Giovagnoni, Andrea; Ottaviani, Letizia; Mensa' , Anna; Durastanti, Martina; Floriani, Irene; Cascinu, Stefano [Marche Univ., Ancona (Italy). Azienda ospedaliera Umberto I, Istituto di radiologia, oncologia clinica

    2005-04-01

    real costs of the follow-up programmes implemented in the 40 patients considered and the theoretical costs derived from the guide-line recommendations (an excess of 99.06% for lung cancer, and 93.6% for colon cancer). Conclusions: Our findings can serve as a basis to start a discussion within the scientific community about the role of radiological follow-up in cancer patients with the aim of defining a more rational use of resources. [Italian] Scopo: a) Utilizzare la metodologia di Evidence Based Medicine (EBM) nella definizione del ruolo della radiologia nel follow-up post chirurgico dei pazienti con neoplasia solida; b) valutare le eventuali discrepanze tra il modello teorico ed i protocolli clinici attualmente in uso; c) confrontare i costi degli esami radiologici ricavati da un campione di pazienti osservato con quelli ideali che si sarebbero sostenuti se i pazienti fossero stati seguiti secindo le raccomandazioni fornite dalle linee guida delle Societa Scientifiche Internazionali. Materiale e metodi: Sono stati ricercati (utilizzando banche dati tradizionali e di editoria secondaria) i lavori scientifici e le linee guida degli ultimi dieci anni inerenti l'impatto clinico dell'imaging nel follow-up dei pazienti con tumori solidi (polmone, colon). Utilizzando la metodologia delle revisioni sistematiche proprie della EBM. Sono stati scelti i lavori piu significativi per numero di pazienti inclusi e livello di affidabilita. Sono stati valutati i seguenti parametri: timing delle indagini, sopravvivenza, periodo libero di malattia, qualita della vita, morbilita indotta, costi, aspetti psicologici. In una seconda fase stato analizzato retrospettivamente il follow-up clinico strumentale di 40 pazienti consecutivi affetti da tumore del colon (20 pazienti) e polmone (20 pazienti) giunti alla nostra osservazione nel periodo 1998-2004, valutato il costo reale e confrontato con quello teorico. Risultati: La revisione sistematica della letteratura ha permesso di

  18. Inspiring our future citizens and scientists: follow the Blue Paths (Percorsi nel Blu)!

    Science.gov (United States)

    Mioni, Erika; Stroobant, Mascha; Merlino, Silvia; Traverso, Roberto

    2016-04-01

    Very often we hear about scientific communication and education as separate and disconnected domains: in fact while the first one is seen more as a moment of disclosure for disseminating results and latest achievements and consequences (a look to our direct future), the second is, instead, identified as a formative moment in the long term, that often is based on obsolete and dated programs that refer to the past. What would happen if these two domains were, instead, considered as inseparable? As stated by Andrea Schleicher (OECD): "Schools have to prepare students for jobs that have not yet been created, technologies that have not yet been invented and problems that we don't know will arise." How to manage this challenge? The European Commission has proposed seven recommendations to follow for improving Science education and to bring more and more young people closer to STEM (Science, Technology, Engineering and Mathematics) disciplines. Especially three of them (Reccomendation n. 1, 4 and 7) pin out the to-do list for improving communication an education in Science, indicating that "a primary goal of science education across the EU should be to educate students both about the major explanations of the material world that science offers and about the way science works. Moreover teachers of science of the highest quality should be provided for students in primary and lower secondary school; moreover the emphasis in science education before 14 should be on engaging students with science and scientific phenomena (extended investigative work and 'hands-on' experimentation and not through a stress on the acquisition of canonical concepts). Last but not least: good quality teachers, with up to date knowledge and skills, are the foundation of any system of formal science education. Systems to ensure the recruitment, retention and continuous professional training of such individuals must be a policy priority in Europe". Blue Paths (Percorsi nel Blu) is a transversal

  19. Reconocimiento Mapu-Che de Chile: Tratado ante Constitución, Historia frente a Derecho

    Directory of Open Access Journals (Sweden)

    Bartolomé CLAVERO SALVADOR

    2011-04-01

    Full Text Available Desde el año 1991, el compromiso adquirido por los sucesivos gobiernos chilenos para reconocer a nivel constitucional la presencia indígena en el ordenamiento del Estado ha puesto de manifiesto el desconocimiento académico y jurídico mutuo por parte de Chile con respecto a las evidencias para una reposición de Mapu-Che. El presente trabajo hace un recorrido histórico y jurídico por las formas de relación entre el Estado chileno y el Estado Mapu, que hasta la conquista chilena de Mapu en la década de los ochenta del siglo XIX se manifestaron a través de Tratados y Parlamentos que implicaban un reconocimiento mutuo de ambas entidades en una esfera internacional. Las comisiones de estudios, informes oficiales e invocaciones de verdad para un nuevo trato, primero de las Naciones Unidas, y después de la República de Chile, han observado estas evidencias de la significación constitucional e internacional de los Tratados, pero Chile ha convertido su peculiar forma de reconocimiento constitucional de la presencia indígena en un alarde de unidad e indivisibilidad nacional. Este encubrimiento nace del deseo de mantener una Constitución exclusiva, al que se une la certeza de que otra forma de reconocimiento obligaría a un replanteamiento de las propias raíces de los fundamentos constitucionales de la República de Chile.

  20. Changing City. Insediamenti dispersi nel contesto irlandese / Changing City. Dispersed Urbanism in an Irish Context

    Directory of Open Access Journals (Sweden)

    Susanne Dunne

    2013-09-01

    Full Text Available Questo saggio si interroga sull’efficacia dei metodi di progettazione urbana tradizionali nel contesto della città dispersa e cerca di esplorare nuove strategie di sovrapposizione da utilizzare al fine della rigenerazione o della riqualificazione dell’ambiente urbano a bassa densità. L'articolo illustra i progetti degli studenti elaborati durante il workshop di progettazione urbana intitolato "Città in cambiamento" svoltosi presso la Nantes School of Architecture (coordinato da Susan Dunne, in cui gli studenti hanno esplorato tre città Irlandesi (Belfast, Limerick e Tallaght. Le tre città sono accomunate da condizioni di bassa densità edilizia e di dispersione urbana con conseguenti problematiche socio-economiche. Un approccio progettuale flessibile e interdisciplinare costituisce la base per le proposte di progetto di seguito descritte creando nuove situazioni in grado di contrastare l’attuale tendenza di progettare lo sviluppo urbano attraverso risposte formaliste. / This brief essay questions the use of traditional urban design methods in the dispersed city and seeks to explore new overlapping strategies to be used when regenerating or invigorating the low density urban environment. The article illustrates various student projects generated during the urban design workshop "Changing Cities" in Nantes School of Architecture (led by design tutor Susan Dunne where the students explored three cities in Ireland (Belfast, Limerick and Tallaght.The three cities that have in common low density dispersed urban conditions that go hand in hand with a high concentration of socio-economic problems. An interdisciplinary flexible design approach forms the basis for the project proposals creating new situations and new energies as opposed to master planning a formal response.

  1. Lettere di Vilfredo Pareto all’amico Roberto Michels: confini e confine nel Trattato di Sociologia Generale del 1916

    Directory of Open Access Journals (Sweden)

    Raffaele Federici

    2017-08-01

    Full Text Available In questa ricerca di senso fra la fine di un'epoca e la nuova visione del mondo, c’è, nei due Autori, quello che potrebbe chiamarsi una betweenness: Pareto, quasi un franco-italiano, e Michels, un italiano-tedesco, anzi un più che italiano. Nella linea di faglia rappresentata dal primo conflitto mondiale, i due sociologi sono in una doppia relazione interiore appunto franco-italiana Pareto e italo-tedesca Michels e una relazione esteriore fra il mondo di ieri e il mondo successivo al cataclisma che fu la prima guerra mondiale, quando ben quattro imperi colossali erano stati smembrati (l’Impero Russo, l’Impero Tedesco, l’Impero Austro-ungarico e l’Impero ottomano, nello stesso tempo in cui Emile Durkheim guardava con inquietudine alla disgregazione delle vecchie comunità tradizionali, dove il senso della crisi del tempo investe non solo le persone e i comportamenti, ma il mondo logico stesso. Lo scambio epistolare avviene nella stessa terra: Pareto a Celigny, sul lago di Ginevra , e Michels a Basilea , lungo le rive del Reno. Vi è, fra i due sociologi un profondo rispetto, che vedrà Robert Michels dedicare allo “scienziato e amico Vilfredo Pareto con venerazione” un’opera importante come “Problemi di sociologia applicata” pubblicata solo tre anni dopo il Trattato di Sociologia Generale del Maestro. In questa antologia di saggi Robert Michels, probabilmente composti fra il 1914 e il 1917, negli anni del grande cataclisma, anzi concepiti prima «dell’insediamento di questa terribile corte suprema di cassazione di tutte le nostre ideologie, che è la guerra» , quindi contemporanea al Trattato, il Maestro viene citato tre volte, come Max Weber, ma, de facto, la presenza di Pareto è continua. In particolare, il richiamo al Maestro è iscritto a due piste di ricerca: da una parte la realtà della ricerca sociologica e del suo amplissimo spettro di analisi e dall’altra la teoria della circolazione delle elités. È proprio

  2. Le autorità indipendenti nel settore bancario.( Indipendent authorities in the banking sector

    Directory of Open Access Journals (Sweden)

    Luca Papi

    2014-12-01

    Full Text Available Negli ultimi anni la diffusione delle autorità indipendenti ha rappresentato un importante tratto distintivo dell’evoluzione istituzionale di gran parte dei paesi. La corrispondente delega di poteri è stata giustificata con la necessaria autonomia dal potere politico ed economico, nell’ipotesi che le autorità indipendenti siano la risposta istituzionale più efficace per perseguire gli interessi pubblici. Questa impostazione si basa su tre principali presupposti la cui validità è storicamente e geograficamente determinata. Il lavoro esamina le autorità indipendenti del settore bancario e finanziario, spiegandone l’evoluzione e i profili di autonomia e di accountability. I cambiamenti della regolamentazione e del ruolo delle autorità vengono messi in relazione agli sviluppi internazionali e alla loro continua trasformazione, anche alla luce delle ricorrenti crisi finanziarie. Infine il lavoro si interroga su quale debba essere l’assetto istituzionale ottimale in termini di divisione/integrazione delle responsabilità di vigilanza in ambito bancario/finanziario.  

  3. Sistemi WebGIS e Inventario IFFI per la Prevenzione nel Rischio Frane

    Directory of Open Access Journals (Sweden)

    Italo Di Giovanni

    2013-02-01

    Full Text Available Frane ed alluvioni sono molto frequenti sul territorio italiano: ciò è dovuto soprattutto alle caratteristiche geologico geomorfologiche (75% del territorio italiano è montano-collinare e quelle climatiche, che determinano un alto rischio idrogeologico dell’Italia con conseguente impatto a livello socio-economico, sia per il numero di vittime sia per i danni prodotti ad abitazioni, industrie, infrastrutture, beni culturali e ambientali, ed agricoltura.WebGIS system and IFFI Inventory for Prevention in Landslide RiskGeological, geomorphological and climatic characteristics determine a high landslide risk in Italy, with a consequent impacton the socio-economic level. As part of the IFFI Project, a WebGIS archive was created toprovide a framework of the distribution of landslides. Final result: nearby 485.000 landslides have been recorded in Italy. Moreover in Italy the remediation of the damages, due to landslides and floods, cost more than secure the lands. Today, in the framework of prevention, landslide monitoring cannot be ignored by the authorities allowing control conditions that can become extremely dangerous, with damages to property and/or people.

  4. The relationship between constructivist supervisory practices, school climate, and student proficiency in reading, mathematics, and science: Evidence from NELS:88

    Science.gov (United States)

    Molnar, John Alexander

    In an effort to improve instruction and student learning, school reform efforts have become prevalent. School reformers have examined many aspects of the school experience, including learning theories such as behaviorism and constructivism, the changing roles of teachers and supervisors, and even the concept of the school itself. The theoretical framework for this study centered around constructivist learning theory. The study itself focused on the application of constructivist learning theory to the supervisory process. The study examined five areas of interest: (a) teachers' perceptions of constructivist supervisory behavior; (b) teachers' perceptions of efficacy and control in the classroom; (c) teachers' perceptions of school climate; (d) teachers' perceptions of job satisfaction, and (e) the influences of each of the aforementioned on student proficiency in mathematics, reading, and science. Data for the study was drawn from the first follow-up survey of the National Educational Longitudinal Study of 1988 (NELS: 88). NELS: 88 investigated a wide variety of factors that influence the educational process. The first follow-up focuses on environmental factors that affect teachers and students. Variables were selected from the NELS:88 data set that represented the areas to be examined. Factor analysis and correlational analysis were applied to ensure that the variables were measuring distinct constructs and to determine ways they could be grouped for analysis. Multiple linear regression analysis was applied to determine relationships among the individual and composite variables, controlling for student and teacher demographic factors. The results of the study suggest that varying relationships do exist between constructivist supervisory practices and the constructs measuring school climate and job satisfaction. The results also suggest that varying relationships exist between each of these factors and student proficiency in mathematics, reading, and science

  5. AV e attività di eccellenza. Nuove opportunità localizzative nel sistema Roma-Napoli

    Directory of Open Access Journals (Sweden)

    Adriana Galderisi

    2008-06-01

    Full Text Available Il contributo propone una lettura delle possibili influenze della realizzazione delle reti AV sulla localizzazione/distribuzione di attività di eccellenza, quali attività direzionali, di management, di servizio alle imprese e alla pubblica amministrazione, con specifico riferimento alla tratta AV Roma-Napoli. A partire da una caratterizzazione delle attività di eccellenza, se ne evidenzia anzitutto la spiccata tendenza alla concentrazione urbana, la dipendenza da efficaci connessioni sia immateriali che materiali e la rilevanza assunta dalla variabile temporale nelle scelte localizzative (Sassen, 2001. Quindi, in riferimento ad alcune esperienze europee, si esaminano i principali effetti, in termini di attrazione/concentrazione di tali attività, connessi alla realizzazione delle reti AV (Sands 1993; Vickerman e Ulied, 2006; Gemeente Amsterdam, 2007. Sulla base di tali considerazioni e tenendo conto delle più recenti definizioni e metodi di misura dell’accessibilità (Axhausen et al. 2006; Spiekermann, Wegener, 2005, lo studio propone un indicatore di “accessibilità” finalizzato ad individuare e graduare, in ragione dei livelli di accessibilità, un sistema di luoghi urbani interconnessi mediante reti su ferro (AV e reti metropolitane e regionali dai quali le attività di eccellenza potranno massimizzare il proprio bacino di utenza. L’individuazione di un sistema di luoghi urbani a diverso grado di accessibilità consente di evidenziare le numerose opportunità per la localizzazione di attività di eccellenza che si dischiudono a seguito della riduzione dei tempi di spostamento consentita dalle reti AV. In tal senso, l’indicatore proposto può costituire un utile supporto alle decisioni sia per l’attore pubblico consentendo di governare e orientare i processi di trasformazione conseguenti alla realizzazione della rete AV, estendendone i benefici dalle aree di stazione a più ampie porzioni urbane sia per l’investitore privato

  6. La nascita imperfetta delle cose la grande corsa alla particella di Dio e la nuova fisica che cambierà il mondo

    CERN Document Server

    AUTHOR|(CDS)2068901

    2016-01-01

    In quel preciso momento, un centesimo di miliardesimo di secondo dopo il Big Bang, si è deciso il nostro destino. In un universo in cui materia e antimateria si equivalevano, e che quindi avrebbe potuto, in ogni istante, tornare a essere pura energia, può essere bastata una leggerissima preferenza del bosone di Higgs per la materia anziché per l'antimateria ed ecco che si è prodotto il mondo che abbiamo sotto gli occhi. "Ecco qua il minuscolo difetto, la sottile imperfezione da cui è nato tutto. Un'anomalia che dà origine a un universo che può evolvere per miliardi di anni." Se tutto nasce da lì, dobbiamo capire in ogni dettaglio quel momento cruciale, ricostruirlo fotogramma per fotogramma, al rallentatore e da diverse angolature. Per questo al Cern di Ginevra è stato realizzato Lhc, l'acceleratore di particelle più potente del mondo, il posto più simile al primo istante di vita dell'universo che l'uomo sia stato in grado di costruire. Per questo da anni i migliori fisici del mondo lavorano giorno...

  7. The structure and dynamic properties of the complete histidine phosphotransfer domain of the chemotaxis specific histidine autokinase CheA from Thermotoga maritima

    International Nuclear Information System (INIS)

    Vu, Anh; Hamel, Damon J.; Zhou Hongjun; Dahlquist, Frederick W.

    2011-01-01

    The bacterial histidine autokinase CheA contains a histidine phosphotransfer (Hpt) domain that accepts a phosphate from the catalytic domain and donates the phosphate to either target response regulator protein, CheY or CheB. The Hpt domain forms a helix-bundle structure with a conserved four-helix bundle motif and a variable fifth helix. Observation of two nearly equally populated conformations in the crystal structure of a Hpt domain fragment of CheA from Thermotoga maritima containing only the first four helices suggests more mobility in a tightly packed helix bundle structure than previously thought. In order to examine how the structures of Hpt domain homologs may differ from each other particularly in the conformation of the last helix, and whether an alternative conformation exists in the intact Hpt domain in solution, we have solved a high-resolution, solution structure of the CheA Hpt from T. maritima and characterized the backbone dynamics of this protein. The structure contains a four-helix bundle characteristic of histidine phosphotransfer domains. The position and orientation of the fifth helix resembles those in known Hpt domain crystal and solution structures in other histidine kinases. The alternative conformation that was reported in the crystal structure of the CheA Hpt from T. maritima missing the fifth helix is not detected in the solution structure, suggesting a role for the fifth helix in providing stabilizing forces to the overall structure.

  8. A STUDY ON THE CONFLICTING IDEAS OF BLACK WOMEN'S ROLES IN SULA AND NEL'S FRIENDSHIP AS SEEN IN TONI MORRISON'S SULA

    Directory of Open Access Journals (Sweden)

    Helen Hendaria Kamandhari

    2001-01-01

    Full Text Available Toni Morrison's Sula portrays the conflicting ideas of two black women, Sula and Nel who used to settle themselves as soulmates. Starting as friends of deepest emotion and sharing all the deepest dark secrets in Medallion, Sula and Nel continue their journeys of life in separation and come to the gate of adulthood which drags them to meet again in different encounter. Those years of separation between both of them have set enough barriers on their relationship to know each other better as they used to in the past. Sula's and Nel's teenagehood which has been spent on different places brought them into an unending conflict of black women's roles in their relationships as friends.

  9. Il diritto all’assistenza linguistica dell’imputato straniero nel procedimento penale. Indagine conoscitiva presso il tribunale di Trieste

    OpenAIRE

    Mometti, Francesca

    2014-01-01

    Interviste a magistrati in servizio presso il Tribunale di Trieste e a interpreti/traduttori attivi presso la stessa istituzione hanno consentito di far emergere in che misura e attraverso quali pratiche venga garantito il diritto all’assistenza linguistica in ambito penale. L’incrocio tra i dati derivanti dall’analisi di un campione di fascicoli di liquidazione e quelli relativi ad alcuni fascicoli dibattimentali ha rivelato come si concretizzi nella prassi quotidiana la garanzia del diritto...

  10. Il Conto di Sostituzione nel sistema monetario internazionale. (The substitution account: the problem, the techniques and the politics

    Directory of Open Access Journals (Sweden)

    S. MICOSSI

    2013-12-01

    Full Text Available Il presente articolo sostiene che in una prospettiva a lungo termine molti dei problemi e delle difficoltà che hanno causato il progetto conto di sostituzione ( SA da rottamare non sono così convincenti come in precedenza sembravano essere .  Le ragioni che hanno impedito un accordo dall'essere raggiunto ad Amburgo vengono quindi considerate . La potenziale utilità di un sistema di sostituzione è poi valutata contro la prospettiva di persistenti squilibri nei pagamenti dell'economia mondiale e di un sistema di riserva emergente multi-valuta .The present paper argues that in a longer-term perspective many of the problems and difficulties which caused the Substitution Account (SA project to be scrapped are not as compelling as they previously appeared to be. The authors first review the purposes of the SA before looking at its main technical features. The reasons which prevented an agreement from being reached in Hamburg are then considered. The potential usefulness of a substitution scheme is then assessed agains the prospect of persisting payments imbalances in the world economy and of an emerging multi-currency reserve system. JEL: F33

  11. Wikipedia come attività di empowerment personale e sociale di studenti e insegnanti nel progetto “Veneto in Wikipedia”

    Directory of Open Access Journals (Sweden)

    Corrado Petrucco

    2016-11-01

    apprendimento; per gli insegnanti si registra una notevole fiducia in Wikipedia che cresce dopo l’esperienza fatta e contribuisce a considerarla strumento efficace nella didattica, motivante e di empowerment personale e sociale.

  12. The Crèche and School structure of the CERN Staff Association is looking for a new name

    CERN Multimedia

    Staff Association

    2018-01-01

    The CERN Staff Association is launching a competition to find a new name to replace the current acronym EVEE (Espace de Vie Enfantine et École). The competition is open to everyone from Thursday, 1 February 2018 to Thursday, 15 March. All participants can send their name suggestions via the form available on the websites of the Staff Association and the Crèche and School. Good luck to all – may the best one win! P.S. The Rules of the Competition are available on both websites

  13. Determination of the Index of Consumption of Petroleum of the Calcining Kiln of the Ernesto Che Guevara Commander Undertaking

    Directory of Open Access Journals (Sweden)

    Yarilys Gaínza-Delgado

    2016-07-01

    Full Text Available This work presents the results obtained in carrying out the mass and energy balances in the calcining kiln of the company commander Ernesto Che Guevara, for determining the consumption index of petroleum used for obtaining nickel oxide through thermal decomposition of the basic nickel carbonate. It was shown that for a production of basic nickel carbonate of              12 t / h with 69% moisture, it is necessary to feed about 1100 kg / h of fuel, for an consumption index of 91.67 kg of fuel per ton of load.

  14. Allestimenti museali, mostre e aura dei materiali tra le due guerre nel pensiero di Amedeo Maiuri / Museum displays, exhibitions and aura of materials between WWI and the WWII in Amedeo Maiuri’s thinking

    Directory of Open Access Journals (Sweden)

    Gabriella Prisco

    2016-12-01

    Full Text Available Obiettivo di questo studio è l’approfondimento di un aspetto poco noto dell’attività del soprintendente archeologo della Campania Amedeo Maiuri, ossia il suo pensiero e le sue realizzazioni in campo museale negli anni Trenta, sia attraverso allestimenti stabili, sia la partecipazione ad alcune grandi mostre-evento. Nessuno di tali allestimenti è sopravvissuto; ci si è avvalsi pertanto di immagini, documenti d’archivio e testi d’epoca, con particolar riguardo a quanto Maiuri stesso illustrò in contributi dedicati ai singoli allestimenti, ma soprattutto nel rapporto redatto in occasione della conferenza di Madrid del 1934 dedicata ai musei. Da questo percorso emerge il ritratto di un Maiuri ben informato sulle più aggiornate linee di tendenza sul tema, alcune delle quali – come il doppio percorso dedicato a grande pubblico e studiosi, il diradamento degli oggetti da esporre, lo schiarimento delle pareti – egli applicò costantemente, all’interno di allestimenti dove si coglie un’eco dei musei di ambientazione. Nella sua partecipazione alle due grandi mostre (quella “Augustea della Romanità” e la “Prima Mostra Triennale delle Terre Italiane d’Oltremare” che videro protagonista l’archeologia, si coglie infi ne un attaccamento all’esposizione di originali che contrasta con la prevalente volontà dell’epoca di abdicare all’aura dei materiali a favore di allestimenti più liberi, ma anche maggiormente piegati alle necessità della propaganda, fi no a confl iggere con i fondamenti stessi della disciplina di cui pure Maiuri fu un insigne rappresentante. The aim of this study is the deepening of a little-known aspect of the activity of the Superintendent Archaeologist of Campania, Amedeo Maiuri, his thinking and his accomplishments on the museum fi eld in the ‘30, both through permanent displays, both for participation in some large exhibitions-event. None of these displays has survived; there has therefore made

  15. Paramenide e Platone (e Aristotele nel Contre Colote de Plutarque Parménide et Platon (et Aristote dans le Contre Colotès de Plutarque Parmenides and Plato (and Aristote in Plutarch'sAgainst Colotes

    Directory of Open Access Journals (Sweden)

    Mauro Bonazzi

    2013-05-01

    Full Text Available The chapters dedicated to Parmenides and Plato play a decisive role in the composition strategy of the Adversus Colotem, since this is where Plutarch most clearly defines the background dualist thesis that will help demonstrate that Platonism is superior to Epicurism. By showing Parmenides too as a dualist engaged in distinguishing between the sensible and the intelligible world, Plutarch structures a history of ancient philosophy entirely focused on Plato. These chapters also bear witness of another centre of interest, namely Aristoteles (§ 14, who, despite the criticism he aimed at the theory of ideas, is not completely refuted, but rather used as a possible ally against epicurean materialists, Plutarch’s true bête noire.Les chapitres consacrés à Parménide et Platon jouent un rôle décisif dans la stratégie de composition de l’Adversus Colotem : c’est là en effet que Plutarque définit de la manière la plus claire la thèse dualiste de fond qui va servir à démontrer la supériorité du platonisme sur l’épicurisme. En présentant Parménide lui aussi comme un dualiste occupé à distinguer entre monde sensible et monde intelligible, Plutarque articule une histoire de la philosophie antique entièrement centrée sur Platon. Les chapitres témoignent ensuite d’un autre centre d’intérêt, avec la mention d’Aristote (§ 14, lequel, malgré les critiques qu’il adresse à la théorie des idées, n’est pas complètement réfuté, mais plutôt utilisé comme un allié possible contre les matérialistes épicuriens, la véritable « bête noire » de Plutarque.I capitoli dedicati a Parmenide e Platone giocano un ruolo decisivo nella strategia compositiva dell’Adversus Colotem: è qui infatti che Plutarco delinea nel modo più chiaro la tesi dualistica di fondo che servirà a dimostrare la superiorità del platonismo sull’epicureismo. Presentando anche Parmenide come un dualista, impegnato a distinguere tra mondo

  16. Sulphides balance in tanning leather district in Tuscany: evaluation of H{sub 2}S emissions and estimation of their impact on the air quality of the area; Bilancio dei solfuri nel comprensorio del cuoio: valutazione delle emissioni di dirogeno solforato e del loro impatto sulla qualita' dell'aria della zona

    Energy Technology Data Exchange (ETDEWEB)

    Campi, B.; De Blasi, E.; Vanni, D.; Scali, C. [Pisa Univ., Pisa (Italy). Dipt. di Ingegneria Chimica, Chimica Industriale e Scienza dei Materiali; Spinazzola, A. [ARPAT-Agenzia Regionale per la Protezione Ambientale della Toscana, Pisa (Italy). Dipt. di Protezione Ambientale, Sez. locale di San Romano

    2000-09-01

    'operazione di pickel risulti preponderante rispetto alle emissioni dagli impianti di depurazione che pure, a causa delle quantita' di sulfuri trattati, hanno un peso potenziale elevato. L'andamento della concentrazione media di inquinante in aria misurata nel triennio considerato mostra come la qualita' dell'aria sia notevolmente migliorata passando dal 1997 al 1999.

  17. Il contributo delle scienze criminologiche per la formazione degli esperti nel settore della sicurezza / La contribution des sciences criminologiques à la formation des professionnels dans le domaine de la sécurité / The contribution of criminological sciences to the training of experts in the field of security

    Directory of Open Access Journals (Sweden)

    Balloni Augusto

    2013-03-01

    Full Text Available L’evolversi della criminalità comune e organizzata comporta un maggior grado di vulnerabilità per tutte quelle realtà pubbliche e private che producono ricchezza di tipo economico, culturale o di altro tipo. Di conseguenza la sicurezza diventa centrale e fondamentale e si presenta come un problema complesso, a volte di difficile interpretazione e soluzione, a causa della molteplicità dei fattori in gioco, delle esigenze di budget e della necessità di adeguarsi continuamente alle diverse richieste che sono in rapporto anche al manifestarsi di nuove forme di criminalità e di altri eventi dannosi.E’ necessario sottolineare come, in tema di sicurezza, sia indispensabile che l’esperienza pratica giunga ad una chiara comprensione della realtà. Quando si affronta il problema della sicurezza occorre tentare di tradurre diverse opinioni (per esempio quelle dei fisici, dei criminologi, degli economisti, degli imprenditori, ecc. in un linguaggio scientifico.E’ evidente che la sicurezza, inserita nella dinamica degli eventi sociali, dipende da molti fattori, tanto che in Italia il concetto di sicurezza si è sviluppato, ad esempio, in diverse direttive: la locuzione pubblica sicurezza; la sicurezza sociale; la sicurezza intesa come security. Risulta quindi impellente attuare strategie di difesa e di prevenzione che si colleghino ad elevati standard di sicurezza ed a scelte oculate per quanto riguardo l’aspetto economico e l’attenzione a minacce reali. In una tale prospettiva emerge il concetto di rischio che diventa di fondamentale importanza nel collegamento all’attività di prevenzione del crimine e alla difesa dei beni e delle persone da eventi dannosi di natura volontaria. Perciò sicurezza, dinamica del rischio, strategie di tutela dei beni e delle persone sono in stretta connessione così che nella loro analisi non si può prescindere dallo sviluppo delle tecnologie e delle scienze umane e sociali, tenendo conto della

  18. Crèche and School of the Staff Association: a programme for children from 2 to 4 year old

    CERN Multimedia

    Staff Association

    2018-01-01

    Find out how children between the ages of two to four and their families can benefit from the Staff Association Crèche and School programme. Classes for children aged between two and four years have been set-up to ensure the initial transition from home to school is as smooth as possible. Children attend mornings only and are welcomed by the same group of teaching staff throughout the week, allowing the children to establish a link between their home life and the crèche/school. The challenge of these classes is to offer the children a happy environment where they can feel emotionally secure, and the teaching staff can create a harmonious atmosphere allowing them to learn by moving, manipulating, exchanging, making mistakes… playing. Creativity takes a central role as it enables the child to express him or herself and increase their ability to handle their emotions constructively. According to Albert Einstein ‘Play is the highest form of research’. &nbs...

  19. The Drosophila gene CheB42a is a novel modifier of Deg/ENaC channel function.

    Directory of Open Access Journals (Sweden)

    Yehuda Ben-Shahar

    2010-02-01

    Full Text Available Degenerin/epithelial Na(+ channels (DEG/ENaC represent a diverse family of voltage-insensitive cation channels whose functions include Na(+ transport across epithelia, mechanosensation, nociception, salt sensing, modification of neurotransmission, and detecting the neurotransmitter FMRFamide. We previously showed that the Drosophila melanogaster Deg/ENaC gene lounge lizard (llz is co-transcribed in an operon-like locus with another gene of unknown function, CheB42a. Because operons often encode proteins in the same biochemical or physiological pathway, we hypothesized that CHEB42A and LLZ might function together. Consistent with this hypothesis, we found both genes expressed in cells previously implicated in sensory functions during male courtship. Furthermore, when coexpressed, LLZ coprecipitated with CHEB42A, suggesting that the two proteins form a complex. Although LLZ expressed either alone or with CHEB42A did not generate ion channel currents, CHEB42A increased current amplitude of another DEG/ENaC protein whose ligand (protons is known, acid-sensing ion channel 1a (ASIC1a. We also found that CHEB42A was cleaved to generate a secreted protein, suggesting that CHEB42A may play an important role in the extracellular space. These data suggest that CHEB42A is a modulatory subunit for sensory-related Deg/ENaC signaling. These results are consistent with operon-like transcription of CheB42a and llz and explain the similar contributions of these genes to courtship behavior.

  20. Animals′ Role in Proper Behaviour: Cheŵa Women′s Instructions in South-Central Africa

    Directory of Open Access Journals (Sweden)

    Leslie F Zubieta

    2016-01-01

    Full Text Available The most common role of animals in the Cheŵa culture of south-central Africa is twofold: they are regarded as an important source of food, and they also provide raw materials for the creation of traditional medicines. Animals, however, also have a nuanced symbolic role that impacts the way people behave with each other by embodying cultural protocols of proper — and not so proper — behaviour. They appear repeatedly in storytelling and proverbs to reference qualities that people need to avoid or pursue and learn from the moral of the story in which animals interplay with each other, just as humans do. For example, someone who wants to prevent the consequences of greed is often advised to heed hyena stories and proverbs. My contribution elaborates on Brian Morris's instrumental work in south-central Africa, which has permitted us to elucidate the symbolism of certain animals and the perception of landscape for Indigenous populations in this region. I discuss some of the ways in which animals have been employed to teach and learn proper behaviour in a particular sacred ceremony of the Cheŵa people which takes place in celebration of womanhood: Chinamwali.

  1. Compilation of the opinions expressed by the CCTN in 1997; Raccolta dei pareri espressi dalla CCTN nel 1997

    Energy Technology Data Exchange (ETDEWEB)

    Camoni, I [Istituto Superiore di Sanita` , Rome (Italy). Lab. di Tossicologia Applicata; Mucci, N [ISPESL, Monteporzio Catone, Rome (Italy). Dipt. di Medicina del Lavoro

    1999-12-31

    The advice expressed by the Italian National Advisory Toxicological Committee (CCTN) in 1997 are presented. Among the most important advice, the following may be mentioned: (1) air quality criteria for CO and NO{sub 2}; (2) risk evaluation associated to the presence of mixtures of pesticide residues in food; (3) re-evaluations of the toxic properties of DDT; (4) evaluations of the carcinogenic evidences of several active substances of antiblastic drugs. [Italiano] Vengono presentati i pareri espressi dalla Commissione Consultiva Tossicologica Nazionale (CCTN) nel 1997. Tra i piu` importanti possono essere menzionati i pareri riguardanti: 1) criteri di qualita` dell`aria per il CO e l`NO{sub 2}; 2) rischio tossicologico da residui di miscele di pesticidi presenti negli alimenti; 3) rivalutazione delle proprieta` tossiche del DDT; 4) valutazione dell`evidenza di cancerogenita` di alcuni principi attivi di chemioterapici antiblastici.

  2. Compilation of the opinions expressed by the CCTN in 1997; Raccolta dei pareri espressi dalla CCTN nel 1997

    Energy Technology Data Exchange (ETDEWEB)

    Camoni, I. [Istituto Superiore di Sanita`, Rome (Italy). Lab. di Tossicologia Applicata; Mucci, N. [ISPESL, Monteporzio Catone, Rome (Italy). Dipt. di Medicina del Lavoro

    1998-12-31

    The advice expressed by the Italian National Advisory Toxicological Committee (CCTN) in 1997 are presented. Among the most important advice, the following may be mentioned: (1) air quality criteria for CO and NO{sub 2}; (2) risk evaluation associated to the presence of mixtures of pesticide residues in food; (3) re-evaluations of the toxic properties of DDT; (4) evaluations of the carcinogenic evidences of several active substances of antiblastic drugs. [Italiano] Vengono presentati i pareri espressi dalla Commissione Consultiva Tossicologica Nazionale (CCTN) nel 1997. Tra i piu` importanti possono essere menzionati i pareri riguardanti: 1) criteri di qualita` dell`aria per il CO e l`NO{sub 2}; 2) rischio tossicologico da residui di miscele di pesticidi presenti negli alimenti; 3) rivalutazione delle proprieta` tossiche del DDT; 4) valutazione dell`evidenza di cancerogenita` di alcuni principi attivi di chemioterapici antiblastici.

  3. Cloning, overexpression, purification, crystallization and preliminary X-ray analysis of CheY3, a response regulator that directly interacts with the flagellar ‘switch complex’ in Vibrio cholerae

    International Nuclear Information System (INIS)

    Khamrui, Susmita; Biswas, Maitree; Sen, Udayaditya; Dasgupta, Jhimli

    2010-01-01

    A chemotaxis response regulator CheY3 from V. cholerae has been cloned, overexpressed, purified and crystallized. The crystals of CheY3 diffracted to 1.86 Å resolution. Vibrio cholerae is the aetiological agent of the severe diarrhoeal disease cholera. This highly motile organism uses the processes of motility and chemotaxis to travel and colonize the intestinal epithelium. Chemotaxis in V. cholerae is far more complex than that in Escherichia coli or Salmonella typhimurium, with multiple paralogues of various chemotaxis genes. In contrast to the single copy of the chemotaxis response-regulator protein CheY in E. coli, V. cholerae contains four CheYs (CheY1–CheY4), of which CheY3 is primarily responsible for interacting with the flagellar motor protein FliM, which is one of the major constituents of the ‘switch complex’ in the flagellar motor. This interaction is the key step that controls flagellar rotation in response to environmental stimuli. CheY3 has been cloned, overexpressed and purified by Ni–NTA affinity chromatography followed by gel filtration. Crystals of CheY3 were grown in space group R3, with a calculated Matthews coefficient of 2.33 Å 3 Da −1 (47% solvent content) assuming the presence of one molecule per asymmetric unit

  4. The role of 3D Helical CT in the reconstructive treatment of maxillofacial cancers; Tomografia Computerizzata spirale con elaborazioni tridimensionali di superficie nel trattamento ricostruttivo dei tumori maligni del massiccio facciale

    Energy Technology Data Exchange (ETDEWEB)

    De Rosa, V.; Ziviello, M. [Ospedale Cardarelli, Servizio di Radiodiagnostica, Naples (Italy); Ionna, F.; Mozzillo, N. [Ospedale Cardarelli, Div. di Chirurgia B, Ist. Nazionale Tumori Fondazione G. Pascale, Naples (Italy); Parascandolo, S. [Ospedale Cardarelli, Div. di Chirurgia Maxillo-Facciale, Naples (Italy)

    2000-12-01

    -ferrous metal of low atomic number that allows very clear CT and MR images to be obtained. Further Ti features are strength, biocompatibility and easy handling. 3D Helical CT scan has proven to be the most complete and accurate imaging technique for reconstructive plastic surgery with alloplastic material in advanced maxillofacial cancer, also considering the anatomic and functional complexity of his area. The prospect is provided to identify virtual 3D presurgical ablation planes. These may allow the surgeon to improve plastic reconstruction and shorten intervention time. [Italian] Scopo di questo articolo e' quello di analizzare il ruolo della TC spirale e i vantaggi delle ricostruzioni tridimensionali di superficie nella pianificazione e controllo degli interventi di chirurgia ricostruttiva plastica con materiale alloplastico nelle neoplasie maligne del massiccio facciale. Sono state eseguite dal 1996 al 1999 11 ricostruzioni plastiche dell'osso mascellare per neoplasie osteodestruenti il massiccio facciale utilizzando materiale alloplastico. Per la ricostruzione della parete anteriore dell'osso mascellare e del pavimento orbitario e' stata utlizzata una rete di titanio al 100% modulabile. Applicato nel cavo residuo dell'osso un otturatore siliconato sormontante una protesi acrilica con arcata dentaria per la ricostruzione del palato. In due casi utilizzato pericardio bovino modulato sulla soluzione di continuo. Tutti i pazienti sono stati studiati con TC spirale sia nella fase preoperatoria che entro il sesto mese dall'intervento chirurgico. Elaborate ricostruzioni tridimensionali della superficie (shaed surface display-SSD) con valori soglia compresi tra 425 e 630 UH ma con intervallo piu' stretto di finestra sui valori UH all'interfaccia osso/rete di titanio nei controlli del modellamento protesico. L'elaborazione tridimensionale della superificie sui dati ottenuti con acquisizione volumetrica ha fornito in tutti casi la fedele

  5. Sottoscrizioni autografe nelle più antiche carte del monastero di S. Liberatore alla Maiella. Contributo alla storia del rapporto tra scrittura e alfabetismo in Abruzzo nel secolo X Autograph subscriptions in the oldest cards of the monastery of S. Liberatore of the Maiella. A contribution to the history of the relationship between writing and literacy in Abruzzo in 10th Century

    Directory of Open Access Journals (Sweden)

    Mariano Dell'Omo

    2005-06-01

    Full Text Available

    Il saggio che si propone di contribuire alla storia delle relazioni tra scrittura e alfabetismo in Abruzzo nel secolo X, deriva da una sezione (pp. CXLI-CLXX della “Introduzione storica, paleografica e archivistica” al volume pubblicato dall’autore nel 2003. L’immediato contesto geo-monastico è quello di S. Liberatore alla Maiella, la più grande delle dipendenze di Montecassino in Abruzzo, e una delle prepositure più notevoli tra le circa sessanta che appartennero al monastero cassinese nell’Italia centro-meridionale. L’obiettivo più generale è quello di far conoscere l’intero fondo archivistico di S. Liberatore, sia quello di età medievale con il citato volume, sia quello di età moderna con il successivo, apparso nel 2006. Questa specifica serie dell’Archivio cassinese, gravitante intorno a S. Liberatore ma relativa anche ad altri centri monastici minori di area abruzzese, e che occupa oggi le capsule da XCIX a CIV, racchiude complessivamente 801 documenti.

    Tra questi se ne annoverano alcuni particolarmente noti agli studiosi – specialmente dopo i lavori di Enrico Carusi (1929, 1932 e Herbert Bloch (1986 –, come il “Memoratorium” dell’abate Bertario († 883 e il “Commemoratorium” – inventario testamentario – del preposito maiellese, poi abate di Montecassino Teobaldo († 1035/1037.

    Alcuni hanno riservato interessanti scoperte, come l’attuale caps. XCIX, fasc. I, n. 4, una carta del luglio 936, che racchiude la più antica sottoscrizione autografa (“Ego qui supra Arechisi iudex” di Arechi, giudice della città di Capua, lo stesso che sottoscrisse il celeberrimo placito del 960, prima testimonianza ufficiale di volgare italiano.

    Altri costituiscono un nucleo di documenti omogenei (nn. 7, 8, 9, 10, 12, 13 la cui edizione integrale ha offerto finalmente in modo completo la più antica collezione di contratti agrari di Montecassino (dal 950 al 984, specialmente sotto forma di

  6. «Ad faciendum et distrenpandum colores». Giorgio da Firenze e la pittura murale a olio in Piemonte nel Trecento / «Ad faciendum et distrenpandum colores». Giorgio da Firenze and the oil mural painting in Piemonte in the 14th Century

    Directory of Open Access Journals (Sweden)

    Bernardo Oderzo Gabrieli

    2013-11-01

    Full Text Available Il periferico Piemonte ospita dalla fine del Settecento un erudito dibattito su di una serie di documenti che testimoniano l’uso dell’olio in pittura murale da parte di un pittore toscano, Giorgio degli Agli, artista di corte dei Savoia tra il 1314 ed il 1348. L’analisi dei ricettari e dei trattati di tecnica artistica medievale rivela quanto fosse nota la possibilità di una pittura a olio o totalmente a tempera su muro, dalla Schedula di Teophilus fino al Manoscritto di Strasburgo. I documenti d’archivio inglesi trecenteschi confermano le quantità e i prezzi pagati nelle attestazioni piemontesi, sia per i pigmenti che per i leganti, dove uova, colla e olio sono ad faciendum et distrenpandum colores. Recenti campagne analitiche infine hanno permesso di riconoscere la presenza di leganti di natura organica tra i diversi strati della pellicola pittorica, rivelando una tradizione tecnica tutta oltralpina (a partire dal cantiere assisiate; fra questi, Jean de Grandson, collaboratore e allievo di Giorgio, nel ciclo della Camera Domini del Castello di Chillon (1342-1343 dipinge su muro proprio come se si trattasse di una tavola.   To the late eighteenth century, the peripheral Piedmont hosts a scholarly debate on a series of documents which demonstrate the use of oil in mural painting by a Tuscan painter, Giorgio degli Agli, court artist of the Savoy between 1314 and 1348. The analysis of medieval technique treaties reveals how was known the use of oil or tempera on wall painting, from the Schedule of Theophilus to the Manuscript in Strasbourg. The English fourteenth archive documents confirm the quantities and prices paid claims in Piedmont, both for the pigments to the medium, where eggs, glue and oil are used at faciendum et distrenpandum colores. Recent analytical campaigns finally made it possible to recognize the presence of organic media between the different film layers of paintings, revealing a whole transalpine technical tradition

  7. A technician monitors the CHeX, a USMP-4 experiment which will be flown on STS-87, in the SSPF

    Science.gov (United States)

    1997-01-01

    United States Microgravity Payload-4 (USMP-4) experiments are prepared to be flown on Space Shuttle mission STS-87 in the Space Station Processing Facility at Kennedy Space Center (KSC). Here, a technician is monitoring the Confined Helium Experiment, or CHeX, that will use microgravity to study one of the basic influences on the behavior and properties of materials by using liquid helium confined between silicon disks. CHeX and several other experiments are scheduled for launch aboard STS-87 on Nov. 19 from KSC.

  8. Il problema dei debiti internazionali nel periodo tra le due guerre mondiali. (The international debt problem in the interwar period

    Directory of Open Access Journals (Sweden)

    M. DE CECCO

    2013-12-01

    Full Text Available Grande attenzione è stata recentemente dedicata al problema attuale del debito del terzo mondo e le sue implicazioni per il sistema bancario internazionale . Una rassegna di eventi simili a volte precedenti in passato dimostra che gli operatori dei mercati finanziari internazionali hanno la memoria corta , poiché la maggior parte degli aspetti della crisi si sono verificati in passato. Questo è confermato dal considerare il problema del debito internazionale tra la prima e la seconda guerra mondiale . La principale differenza tra allora e adesso è che il periodo tra le due guerre fu un periodo di transizione da un sistema di commercio dominato daòòa sterlina ad uno dominato  dal dollaro statunitense . Molti dei problemi di oggi derivano da questa continua dominazione dollaroConsiderable attention has recently been paid to the current problem of third world debt and its implications for the international banking system. A review of similar events at previous times in the past shows that operators in international financial markets have very short memories, since most of the aspects of the current crisis have occurred in the past. This is borne out by considering the international debt problem between the first and second world wars. The major difference between then and now is that the interwar period was a time of transition from a sterling-dominated trading system to one dominated by the US dollar. Many of today's problems stem from this continuing dollar domination.JEL: N24

  9. Novel activation domain derived from Che-1 cofactor coupled with the artificial protein Jazz drives utrophin upregulation.

    Science.gov (United States)

    Desantis, Agata; Onori, Annalisa; Di Certo, Maria Grazia; Mattei, Elisabetta; Fanciulli, Maurizio; Passananti, Claudio; Corbi, Nicoletta

    2009-02-01

    Our aim is to upregulate the expression level of the dystrophin related gene utrophin in Duchenne muscular dystrophy, thus complementing the lack of dystrophin functions. To this end, we have engineered synthetic zinc finger based transcription factors. We have previously shown that the artificial three-zinc finger protein named Jazz fused with the Vp16 activation domain, is able to bind utrophin promoter A and to increase the endogenous level of utrophin in transgenic mice. Here, we report on an innovative artificial protein, named CJ7, that consists of Jazz DNA binding domain fused to a novel activation domain derived from the regulatory multivalent adaptor protein Che-1/AATF. This transcriptional activation domain is 100 amino acids in size and it is very powerful as compared to the Vp16 activation domain. We show that CJ7 protein efficiently promotes transcription and accumulation of the acetylated form of histone H3 on the genomic utrophin promoter locus.

  10. Bertilla e Berta: il ruolo di Santa Giulia di Brescia e di San Sisto di Piacenza nel regno di Berengario I Bertilla and Berta: the role of St. Giulia of Brescia and St. Sisto of Piacenza in the reign of Berengar I

    Directory of Open Access Journals (Sweden)

    Cristina Sereno

    2012-10-01

    Full Text Available Di nessuna delle due mogli di Berengario I – Bertilla, la prima, un’aristocratica di origine supponide e Anna, la seconda, una principessa bizantina – si sono conservate le carte dei dotari. Di entrambe, inoltre, nessuna carta ricorda attività economiche o patrimoniali. Nel contesto familiare di Berengario I emerge però una delle due figlie, Berta, che fu badessa del monastero di San Salvatore di Brescia e poi anche, per nomina paterna, del monastero di San Sisto di Piacenza, fondato pochi decenni prima da Angelberga. Entrambi i monasteri avevano raccolto nei loro patrimoni larghe quote del fisco regio, spesso in prima istanza transitati nei dotari delle regine: le curtes e i monasteri dipendenti erano sparsi in tutta la parte settentrionale della penisola e, in taluni casi, oltrepassavano la linea degli Appennini. Berta appare così assumere presso la corte di Berengario una funzione di grande rilievo nella gestione e nella salvaguardia dei patrimoni di tali monasteri.Of none of the two wives of Berengar I - Bertilla, the first, an aristocratic woman from the Supponids and Anna, the second, a Byzantine princess - have been preserved dower charters; moreover no charter reminds businesses or assets. In the family context of Berengar I emerges, however, one of his two daughters, Berta, who was abbess of the monastery of St. Salvatore in Brescia and later, by his father's appointment, of the monastery of St. Sisto in Piacenza, founded a few decades earlier by Angelberga. Both monasteries were collected in their assets large shares of royal treasury, often in the first instance passed through in doweries of the queens: the curtes and the dependent monasteries were spread across the northern part of the peninsula and, in some cases, they passed the line of the Apennines. It looks like as at the court of Berengar Berta  assumes a role of great importance in the management and safeguarding of the assets of these monasteries.

  11. Review: Thomas Bierschenk and Eva Spies (eds, 50 Jahre Unabhängigkeit in Afrika: Kontinuitäten, Brüche, Perspektiven (2012

    Directory of Open Access Journals (Sweden)

    Geert Castryck

    2015-01-01

    Full Text Available Review of the edited volume: Thomas Bierschenk and Eva Spies (eds, 50 Jahre Unabhängigkeit in Afrika: Kontinuitäten, Brüche, Perspektiven, Cologne: Rüdiger Köppe Verlag, 2012, ISBN 9783896458292, 572 pages

  12. Noi siamo quello che ricordiamo - Le frazze di Crucoli: il teatro, il rito, il riscatto sociale

    Directory of Open Access Journals (Sweden)

    Tonia Mingrone

    2012-01-01

    Full Text Available Abstract - IT Questo lavoro nasce da una ricerca di campo sulle frazze, termine dialettale che indica le farse di Carnevale che si rappresentavano fino a cinquant’anni fa in molti paesi calabresi, tra cui il mio, Crucoli, in provincia di Crotone. Lo scopo di questo lavoro non è fare un resoconto esaustivo di tutto ciò che accadeva a Crucoli durante la celebrazione del Carnevale, impresa assai difficile dal momento che non ci sono documenti scritti e quindi bisogna affidarsi ai racconti orali delle persone intervistate, spesso non fedeli alla realtà, perché modificati dal tempo e dalla memoria. L’approccio con cui ho intrapreso questa ricerca è sicuramente legato all’aspetto teatrale e performativo dell’evento, senza trascurarne la rilevanza antropologica. Il materiale raccolto è frutto di interviste e colloqui con la gente del posto unito ad un grande lavoro di ricerca bibliografica di autori che avevano trattato di questo argomento in relazione ai loro paesi di origine.Lo scopo è quello di delineare l’organizzazione e lo svolgimento delle frazze, cercando di ricostruire la sua durata e le ripercussioni sulla comunità, nonché dimostrare ancora una volta come il teatro, messo a disposizione di alcuni eventi, diventi un mezzo forte di liberazione e di contestazione. Abstract - FR Cet article prend sa naissance par une recherche sur champ concernant les frazze, terme dialectal qui dénote les farces du Carnaval mises en scène jusqu'à il y a cinquante ans dans plusieurs villages en Calabria, entre eux le mien, Crucoli, dans la province de Crotone. La raison de ce travail n'est pas d'accomplir un compte rendu exhaustif de tout ce qui avait lieu à Crucoli pendant la célébration du Carnaval, l'exploit étant très difficile, du moment qu'aucun document écrit a été parvenu et par conséquence il est nécessaire de se remettre aux contes des témoins interviewés, souvent pas fidèles au réel, parce-que détournés par les

  13. The effects of home computer access and social capital on mathematics and science achievement among Asian-American high school students in the NELS:88 data set

    Science.gov (United States)

    Quigley, Mark Declan

    The purpose of this researcher was to examine specific environmental, educational, and demographic factors and their influence on mathematics and science achievement. In particular, the researcher ascertained the interconnections of home computer access and social capital, with Asian American students and the effect on mathematics and science achievement. Coleman's theory on social capital and parental influence was used as a basis for the analysis of data. Subjects for this study were the base year students from the National Education Longitudinal Study of 1988 (NELS:88) and the subsequent follow-up survey data in 1990, 1992, and 1994. The approximate sample size for this study is 640 ethnic Asians from the NELS:88 database. The analysis was a longitudinal study based on the Student and Parent Base Year responses and the Second Follow-up survey of 1992, when the subjects were in 12th grade. Achievement test results from the NELS:88 data were used to measure achievement in mathematics and science. The NELS:88 test battery was developed to measure both individual status and a student's growth in a number of achievement areas. The subject's responses were analyzed by principal components factor analysis, weights, effect sizes, hierarchial regression analysis, and PLSPath Analysis. The results of this study were that prior ability in mathematics and science is a major influence in the student's educational achievement. Findings from the study support the view that home computer access has a negative direct effect on mathematics and science achievement for both Asian American males and females. None of the social capital factors in the study had either a negative or positive direct effect on mathematics and science achievement although some indirect effects were found. Suggestions were made toward increasing parental involvement in their children's academic endeavors. Computer access in the home should be considered related to television viewing and should be closely

  14. Meir Sternberg, Raccontare nel Tempo (II: Cronologia, Teleologia, Narrativita Meir Sternberg, Telling in Time II: Chronology, Theleology, Narrativity

    Directory of Open Access Journals (Sweden)

    Franco Passalacqua

    2010-06-01

    Full Text Available In questa sezione centrale di Telling in Time II, Meir Sternberg rivolge la propria riflessione alle questioni sorte dall’incontro tra temporalità e narrazione osservato nella parte iniziale del saggio: strategie retoriche di controllo discorsivo, effetti narrativi, dinamica teleologica della sorpresa, sono tutte problematiche, queste, appartenenti a quella dimensione pragmatica che caratterizza la prospettiva di indagine dell’autore. Il percorso argomentativo dei primi capitoli di queste pagine affronta infatti il discorso sugli effetti narrativi, presente nella storia degli studi letterari fin dalla Poetica aristotelica, a partire da premesse che consentono di gettare nuova luce su di essi: se i concetti aristotelici di «rovesciamento», «riconoscimento» e «sorpresa» sono entrati nelle teorizzazioni novecentesche – Sternberg osserva in particolare i lavori pioneristici di Propp e le implicazioni introdotte nell’esperienza narratologica – in forma pressoché immutata, conservando un ancorag- gio alla realtà narrata più che alle modalità narrative, Telling in Time II propone invece di concepirli in relazione al loro «funzionamento comunicativo» e al cosiddetto «principio di Proteo». Nei capi- toli conclusivi dell’articolo, delineata una tale cornice concettuale, queste dinamiche – cui si aggiungono quelle di «suspense» e «curiosità» – vengono assunte quali fattori invarianti del genere narrativo, posti alla base della rete di rapporti teleologici tra il livello rappresentativo e il livello comunicativo che costituiscono il nucleo essenziale della proposta critica sternberghiana.The central section of Telling in Time II directs the attention to the consequences coming from the meeting between time and narrative considered in the first part of this essay: rhetorical strategies, narratives effects, teleological dynamic of surprise are all questions that belong to the pragmatic dimension of

  15. RESISTENCIA MICROBIANA EN EL CARDIOCENTRO ERNESTO CHE GUEVARA. ESTUDIO DE 5 AÑOS / Microbial resistance at the “Ernesto Che Guevara” Cardiology Hospital. A five year study

    Directory of Open Access Journals (Sweden)

    Nérida Rodríguez Oliva

    2009-06-01

    Full Text Available Introduction and Objectives: The appearance of nosocomial bacterial resistance represents a problem of growing concern because it largely affects the evolution of patients and the health resources devoted to it. The objective of this work was to determine the most common germs and their microbial resistance. Methods: A descriptive retrospective study was carried out analyzing the result of the isolation of germs from all type of secretions and from the blood cultures of a group ofpatients hospitalized at the Ernesto Che Guevara Cardiology Hospital in a five year period. Results: A total of 397 strains were isolated, 77 Staphylococcus aureus and 320 Enterobacteriaceae. The former presented 100% resistance to penicillin. The Staphylococcus sensitive to methicillin presented 4.9 % resistance to cotrimoxazole and gentamicin. The strains resistant to methicillin or oxacillin had a high resistance to gentamicin (87.5 % and ciprofloxacin (81.2 %, a medium resistance to cefazolin and oxacilline (20.5 %, and just 12.5 percent resistance to cotrimoxazole. Conclusions: the Staphylococcus aureus and the Enterobacteriaceae were the most common germs. The preoperative prophylaxis in these patients must not be done with cefazolin as a routine because the staphylococci resistant to methicillin or oxacillin have influence on other antimicrobials.

  16. Novel Wnt Regulator NEL-Like Molecule-1 Antagonizes Adipogenesis and Augments Osteogenesis Induced by Bone Morphogenetic Protein 2

    Science.gov (United States)

    Shen, Jia; James, Aaron W.; Zhang, Xinli; Pang, Shen; Zara, Janette N.; Asatrian, Greg; Chiang, Michael; Lee, Min; Khadarian, Kevork; Nguyen, Alan; Lee, Kevin S.; Siu, Ronald K.; Tetradis, Sotirios; Ting, Kang; Soo, Chia

    2017-01-01

    The differentiation factor NEL-like molecule-1 (NELL-1) has been reported as osteoinductive in multiple in vivo preclinical models. Bone morphogenetic protein (BMP)-2 is used clinically for skeletal repair, but in vivo administration can induce abnormal, adipose-filled, poor-quality bone. We demonstrate that NELL-1 combined with BMP2 significantly optimizes osteogenesis in a rodent femoral segmental defect model by minimizing the formation of BMP2-induced adipose-filled cystlike bone. In vitro studies using the mouse bone marrow stromal cell line M2-10B4 and human primary bone marrow stromal cells have confirmed that NELL-1 enhances BMP2-induced osteogenesis and inhibits BMP2-induced adipogenesis. Importantly, the ability of NELL-1 to direct BMP2-treated cells toward osteogenesis and away from adipogenesis requires intact canonical Wnt signaling. Overall, these studies establish the feasibility of combining NELL-1 with BMP2 to improve clinical bone regeneration and provide mechanistic insight into canonical Wnt pathway activity during NELL-1 and BMP2 osteogenesis. The novel abilities of NELL-1 to stimulate Wnt signaling and to repress adipogenesis may highlight new treatment approaches for bone loss in osteoporosis. PMID:26772960

  17. Efficacia e indicazioni del counseling e delle strategie educative nel miglioramento della compliance alla ventilazione a pressione positiva continua – CPAP

    Directory of Open Access Journals (Sweden)

    Elena Peila

    2017-07-01

    Conclusioni: Le strategie educative sono tecniche efficaci per migliorare l'adrenza alla CPAP anche in popolazioni che abitualmente presentano bassa compliance come i pazienti senza beneficio soggettivo dalla terapia con CPAP o pazienti con comorbilità psichiatrica o cognitiva. Tuttavia sono raccomandati interventi educativi brevi.

  18. Atomistic structural ensemble refinement reveals non-native structure stabilizes a sub-millisecond folding intermediate of CheY

    International Nuclear Information System (INIS)

    Shi, Jade; Schwantes, Christian; Bilsel, Osman

    2017-01-01

    The dynamics of globular proteins can be described in terms of transitions between a folded native state and less-populated intermediates, or excited states, which can play critical roles in both protein folding and function. Excited states are by definition transient species, and therefore are difficult to characterize using current experimental techniques. We report an atomistic model of the excited state ensemble of a stabilized mutant of an extensively studied flavodoxin fold protein CheY. We employed a hybrid simulation and experimental approach in which an aggregate 42 milliseconds of all-atom molecular dynamics were used as an informative prior for the structure of the excited state ensemble. The resulting prior was then refined against small-angle X-ray scattering (SAXS) data employing an established method (EROS). The most striking feature of the resulting excited state ensemble was an unstructured N-terminus stabilized by non-native contacts in a conformation that is topologically simpler than the native state. We then predict incisive single molecule FRET experiments, using these results, as a means of model validation. Our study demonstrates the paradigm of uniting simulation and experiment in a statistical model to study the structure of protein excited states and rationally design validating experiments.

  19. L’estetica dell’ebreo e del cristiano nei racconti de Lo scialle andaluso di Elsa Morante

    NARCIS (Netherlands)

    Cascio, G.

    2007-01-01

    Quest’articolo indaga alcuni elementi fisiognomici ricorrenti nelle figure che popolano le novelle de Lo scialle andaluso di Elsa Morante. Cioè, qui suggeriamo l’ipotesi che nel piano narrativo ci sia una categorizzazione estetica che si riversa nel progetto dei contenuti e si proponga di dedurre i

  20. Modelli di valutazione ambientale per i Bovidi (Capra ibex, Rupicapra rupicapra e i Cervidi (Capreolus capreolus, Cervus elaphus nel Parco Nazionale del Gran Paradiso

    Directory of Open Access Journals (Sweden)

    C. Oppio

    2003-10-01

    Full Text Available La conservazione delle popolazioni di stambecco ha grande rilevanza a livello italiano ed europeo, a causa della distribuzione concentrata in poche aree, mentre le consistenti popolazioni di camoscio hanno importanza economica e gestionale. L?espansione dell?areale di distribuzione dei cervidi in territorio alpino, è un fenomeno ormai consolidato e legato all?abbandono dei territori collinari e montani ma anche alle reintroduzioni e alle azioni di tutela nei confronti delle specie. I modelli d?idoneità ambientale rappresentano un efficace strumento per il confronto a livello qualitativo (numero di specie e quantitativo (abbondanza delle popolazioni tra l?attuale popolamento faunistico dei territori alpini e la loro situazione potenziale. Il Parco Nazionale del Gran Paradiso si estende per oltre 700 km² sul territorio di Piemonte e di Valle d?Aosta; gli affioramenti rocciosi ne occupano il 37.0%, la vegetazione rada il 20.1% e le praterie sommitali e le brughiere il 17.3%. L?analisi ambientale del Parco è stata effettuata mediante Arcview 3.2 per Windows misurando il valore di 20 variabili ambientali (Corine Land Cover III Liv., 27 fisiche (DTM e 17 di complessità paesaggistica in 2925 Unità Campione di 0,5 km di lato. Per la formulazione dei modelli relativi alla distribuzione (presenza/assenza dello stambecco sono stati utilizzati i dati dei censimenti (1999 effettuati nel Parco; per il camoscio ed il capriolo sono stati utilizzati i dati rilevati nelle province di Vercelli e Biella (1997 e in quella di Verbania (1999, mentre per il cervo sono stati utilizzati quelli relativi alla sola provincia di Verbania (1999. I modelli sono stati formulati mediante Analisi di Funzione Discriminante (Magnusson, 1983; Massolo & Meriggi, 1995 e Analisi di Regressione Logistica (Norusis, 1994. Per lo stambecco i dati sono stati suddivisi in due sets, di cui uno utilizzato per la formulazione del modello e l?altro per la sua validazione. Mediante un test

  1. Substitution of the burning PRIOR SSB 10 for SSB7 in the Furnace 10 of the Company Major Ernesto Che Guevara

    Directory of Open Access Journals (Sweden)

    Ivett María Ramírez-Pérez

    2017-01-01

    Full Text Available One of the fundamental causes of massive destruction of chambers and vaults in the Furnace of Reduction at the Ernesto Che Guevara Factory is due to operate the combustion chambers with excess of contribution of heat, causing that the flame of very high temperature penetrates into the homes, affecting the throats of the chambers, the vaults, teeth and arms. The burners current are Prior SSB10. In this paper is demonstrated that the burning Prior SSB 10 have double productivity that the SSB 7 with the same quantity of air to the burner. It is evaluated the substitution of the burning Prior SSB 10 by SSB 7 on the operation of the Furnace of Reduction No. 10 at the Ernesto Che Guevara (ECG Factory. Demonstrating that the change not produce variations in the operation.

  2. Effects of Kapton Sample Cell Windows on the Detection Limit of Smectite: Implications for CheMin on the Mars Science Laboratory Mission

    Science.gov (United States)

    Achilles, C. N.; Ming, Douglas W.; Morris, R. V.; Blake, D. F.

    2012-01-01

    The CheMin instrument on the Mars Science Laboratory (MSL) rover Curiosity is an X-ray diffraction (XRD) and X-ray fluorescence (XRF) instrument capable of providing the mineralogical and chemical compositions of rocks and soils on the surface of Mars. CheMin uses a microfocus X-ray tube with a Co target, transmission geometry, and an energy-discriminating X-ray sensitive CCD to produce simultaneous 2-D XRD patterns and energy-dispersive X-ray histograms from powdered samples. CheMin has two different window materials used for sample cells -- Mylar and Kapton. Instrument details are provided elsewhere. Fe/Mg-smectite (e.g., nontronite) has been identified in Gale Crater, the MSL future landing site, by CRISM spectra. While large quantities of phyllosilicate minerals will be easily detected by CheMin, it is important to establish detection limits of such phases to understand capabilities and limitations of the instrument. A previous study indicated that the (001) peak of smectite at 15 Ang was detectable in a mixture of 1 wt.% smectite with olivine when Mylar is the window material for the sample cell. Complications arise when Kapton is the window material because Kapton itself also has a diffraction peak near 15 Ang (6.8 deg 2 Theta). This study presents results of mineral mixtures of smectite and olivine to determine smectite detection limits for Kapton sample cells. Because the intensity and position of the smectite (001) peak depends on the hydration state, we also analyzed mixtures with "hydrated" and "dehydrated"h smectite to examine the effects of hydration state on detection limits.

  3. Un uomo che valuta

    Directory of Open Access Journals (Sweden)

    Massimiliano Nicoli

    2015-12-01

    Full Text Available This article – written as a short story in the second-person narrative mode – focuses on the subjective, everyday experience of an individual concerned by some practices of evaluation. Through the telling of this concrete experience, it aims at giving substance to the idea that the practices of evaluation constitute an «environmental technology of government» typical of neoliberal governmentality as well as a self-disciplined technique of building one’s own «soul» as human capital.

  4. Department of Che

    African Journals Online (AJOL)

    USER

    2015-03-26

    Mar 26, 2015 ... watering, fish culturing and nursery of seedlings. Air is also very ... synthesized organic and inorganic fertilizers are made, synthesized pesticides and herbicides for ..... production and nutritional quality of grains. (Graham and ...

  5. I nuovi criteri di valutazione dei terreni in seguito al regolamento spagnolo per la valutazione dei terreni del 2011: l’oggettivazione delle aspettative edificatorie nel territorio rurale

    Directory of Open Access Journals (Sweden)

    Ana Maria De La Encarnación Valcárcel

    2013-06-01

    Full Text Available Il regime di valutazione dei terreni ha subito una delle sue più importanti modifiche ad opera della Legge sui Suoli del 2008 e del relativo Regolamento del 2011. Secondo il cosiddetto principio di oggettività, che definisce tutti i metodi fissati per le nuove "situazioni di base" dei terreni, ed in base al prescritto divieto di prendere in considerazione le aspettative edificatorie derivanti dal rilascio di una concessione edilizia, è facilmente desumibile l’esistenza di circostanze, che non sono una conseguenza naturale degli investimenti effettuati per il bene da parte del proprietario. Questo è in contrasto con lo spirito della Legge sui Suoli in vigore, enunciato nella Relazione Esplicativa.

  6. APPLICATION OF PSEUDOMONAS PUTIDA AND RHODOCOCCUS SP. BY BIODEGRADATION OF PAH(S, PCB(S AND NEL SOIL SAMPLES FROM THE HAZARDOUS WASTE DUMP IN POZĎÁTKY (CZECH REPUBLIC

    Directory of Open Access Journals (Sweden)

    Radmila Kucerova

    2006-12-01

    Full Text Available The objective of the project was a laboratory check of biodegradation of soil samples contaminated by PAH(s, PCB(s and NEL from the hazardous waste dump in the Pozďátky locality. For the laboratory check, pure bacterial cultures of Rhodococcus sp. and Pseudomonas putida have been used. It is apparent from the laboratory experiments results that after one-month bacterial leaching, applying the bacterium of Rhodococcus sp. there is a 83 % removal of NEL, a 79 % removal of PAH(s and a 14 % removal of PCB(s. Applying a pure culture of Pseudomonas putida there is a 87 % removal of NEL, a 81 % removal of PAH(s and a 14 % removal of PCB(s.

  7. Dal materiale all’immateriale. Verso un approccio sostenibile alla gestione nel contesto glocale / From material to immaterial: towards a sustainable approach to management in the glocal context

    Directory of Open Access Journals (Sweden)

    Mara Cerquetti

    2015-02-01

    Full Text Available Il saggio ripercorre le principali tappe del dibattito internazionale che negli ultimi anni ha condotto ad una nozione di cultural heritage aperta e dinamica, volta al superamento del dualismo tra materiale e immateriale e attenta al ruolo delle comunità locali nei processi di riconoscimento, tutela e valorizzazione del patrimonio stesso. Dopo aver preso in esame l’apporto degli studi giuridici, con specifico riferimento al contesto italiano, si analizza il contributo delle scienze sociali, soprattutto manageriali, particolarmente sensibili al tema della sostenibilità delle politiche e delle azioni finalizzate alla valorizzazione del patrimonio culturale materiale e immateriale anche attraverso l’applicazione di strumenti partecipativi. In quest’ottica, riconoscendo un ruolo centrale alla governance e alla collaborazione tra attori pubblici e privati che operano in un medesimo contesto, si porta infine l’attenzione sugli ecomusei, come caso esemplare dell’“immateriale che vive nella materialità”, evidenziando i nodi problematici che emergono dall’analisi della realtà italiana e suggerendo possibili linee di ricerca future.   The paper traces the main steps of the international debate that during the last years lead to an open and dynamic notion of cultural heritage, overcoming the dualism between tangible and intangible and considering the role of local communities in the processes of heritage recognition, safeguarding and enhancement. After examining the contribution of legal studies, above all in Italy, the approach of social sciences is analysed, focusing on management. These studies have explored the sustainability of policies and actions towards tangible and intangible cultural heritage enhancement, also through the application of participatory tools. In this perspective, governance and collaboration among different actors working in the same context gain a central role. Finally, the attention is focused on eco

  8. Structural studies of conformational changes of proteins upon phosphorylation: Structures of activated CheY, CheY-N16-FliM complex, and AAA + ATPase domain of NtrC1 in both inactive and active states

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Seok-Yong [Univ. of California, Berkeley, CA (United States)

    2003-04-10

    Protein phosphorylation is a general mechanism for signal transduction as well as regulation of cellular function. Unlike phosphorylation in eukaryotic systems that uses Ser/Thr for the sites of modification, two-component signal transduction systems, which are prevalent in bacteria, archea, and lower eukaryotes, use an aspartate as the site of phosphorylation. Two-component systems comprise a histidine kinase and a receiver domain. The conformational change of the receiver domain upon phosphorylation leads to signal transfer to the downstream target, a process that had not been understood well at the molecular level. The transient nature of the phospho-Asp bond had made structural studies difficult. The discovery of an excellent analogue for acylphosphate, BeF3-, enabled structural study of activated receiver domains. The structure of activated Chemotaxis protein Y (CheY) was determined both by NMR spectroscopy and X-ray crystallography. These structures revealed the molecular basis of the conformational change that is coupled to phosphorylation. Phosphorylation of the conserved Asp residue in the active site allows hydrogen bonding of the T87 Oγ to phospho-aspartate, which in turn leads to the rotation of Y106 into the ''in'' position (termed Y-T coupling). The structure of activated CheY complexed with the 16 N-terminal residues of FliM (N16-FliM), its target, was also determined by X-ray crystallography and confirmed the proposed mechanism of activation (Y-T coupling). First, N16-FliM binds to the region on CheY that undergoes a significant conformational change. Second, the ''in'' position of Y106 presents a better binding surface for FliM because the sidechain of Y106 in the inactive form of CheY (''out'' position) sterically interferes with binding of N16-FliM. In addition to confirmation of Y-T coupling, the structure of the activated CheY-N16-FliM complex suggested that the

  9. Introduction of a new management programme for the urban solid waste in the placed organized by 'Consorzio AREA' of Copparo (FE). Verification at pilot scale; Introduzione di un nuovo sistema per la gestione dei rifiuti solidi urbani nel territorio del Consorzio AREA di Copparo (FE). Verifica pilota del sistema

    Energy Technology Data Exchange (ETDEWEB)

    Ceccotto, D.; Barboni, A.; Malago, L.; Sunseri, M.; Spiandorello, R. [Consorzio Aziendale di Igiene Ambientale e Servizi Polivalenti, Copparo, FE (Italy)

    1999-08-01

    The paper describes an Integrate Source Collection System applied to municipal solid waste, through: introduction of source collection methodologies of the organic fraction (FORSU), of the co-mingled recyclable fraction (RDM) and of the no-recyclable fraction (remaining part), realization of structures (transfer station) able to optimize the sorting and the transportation of the different fraction. The main principle followed interprets the differential collection no longer as an additional service (which would mean an increase in cost) but a substitutive service to the normal one (where the increase in cost is compensated by a reduction of cost referent to no-recyclable fraction). The objects of the studied system: increasing of the collection aimed to recover and recycling minimizing managing cost; have been carried out through an experimental application. Moreover the optimization of the collection routes, reached using numerical computing is presented. [Italian] Nel presente lavoro si descrive l'applicazione di un servizio di raccolta integrale dei RSU tramite: l'introduzione delle metodologie di raccolta Umido (Frazione Organica dei Rifiuti Solidi Urbani), Secco Riciclabile (Raccolta Differenziata Multimediale) e Secco Non Riciclabile (Indifferienziato), la realizzazione delle strutture necessarie al suo funzionamento ed alla sua razionalizzazione economica (Stazione di Trasferenza). La metodologia proposta presenta un carattere fortemente innovativo. Il principio generale seguito interpreta la raccolta indifferenziata non piu' come servizio aggiuntivo (quindi con incremento dei costi in funzione dell'incremento dei servizi relativi), ma come sistema sostitutivo al normale servizio (incremento dei costi compensato dalla riduzione dei costi relativi alla frazione indifferenziata sia in temini di smaltimento che di raccolta). Le finalita' del sistema: massimizzare i livelli di intercettazione e recupero delle frazioni riciclabili

  10. Nel segno di Polifilo

    Directory of Open Access Journals (Sweden)

    Vanja Strukelj

    2010-12-01

    Full Text Available During the nineteenth and twentieth centuries, many artists have evoked or rather “surreptitiously” quoted the Hypnerotomachia Poliphili. In particular, this work has incessantly been admired for its thriving iconography, composed of the printing of the tale and its illustrations. This article aims to make a comparison between some specific cases –namely the Victorian artists Rossetti, Burne-Jones and Beardsley, and the surrealist Leonor Fini – of appropriation and reformulation of this source. Indeed, we will try to highlight the different mechanisms of appropriation, interpretation and reuse, thus showing the various meanings that the reference to “Poliphilo’s Strife of Love in a Dream” has developed in different cultural contexts.

  11. Nouvelles fonctions de l'agriculture et dynamiques des exploitations: une analyse chorématique dans les monts d'Ardèche

    Directory of Open Access Journals (Sweden)

    Muriel Bonin

    2001-06-01

    Full Text Available Les modèles spatiaux sont utilisés pour l'analyse des trajectoires d'exploitations agricoles pour mettre en évidence les liens entre les transformations socio-économiques et les dynamiques de territoires. Les traits de dynamiques spatiales sont identifiés et utilisés pour analyser l'impact de l'introduction de l'agritourisme dans les exploitations dans le Parc naturel régional des monts d'Ardèche.

  12. Automatización del control del cálculo de extracciones en la mina de la empresa niquelera Ernesto Che Guevara

    Directory of Open Access Journals (Sweden)

    Arístides A. Legrá-Lobaina

    2010-03-01

    Full Text Available En el artículo se muestran los elementos fundamentales de un algoritmo cuyo objetivo es establecer el contenido y el orden de los procedimientos necesarios para realizar el control del cálculo de extracciones en la mina de la empresa Ernesto Che Guevara que explota, a cielo abierto, yacimientos lateríticos ferroniquelíferos en la región de Moa, Cuba. Asimismo se presenta el diseño de los diálogos informáticos que han automatizado el algoritmo en la aplicación informática Tierra.

  13. Filosofia della fisica

    CERN Document Server

    1997-01-01

    Un libro che mancava : attraverso i contributi dei maggiori specialisti italiani, la definizione rigorosa di una disciplina, la filosofia della fisica, che si pone nel punto d'incontro tra la cultura scientifica e quella umanistica.

  14. Giammario Borri (a cura di, Fermo città egemone. Il dominio vescovile su Ripatransone nel Duecento / Giammario Borri (edited by, Fermo, a haegemonic city. The bishop supremacy on Ripatransone in the 13th Century

    Directory of Open Access Journals (Sweden)

    Francesco Pirani

    2014-04-01

    Full Text Available Recensione / Book review Borri G., a cura di (2012, Fermo città egemone. Il dominio vescovile su Ripatransone nel Duecento, Spoleto: Fondazione Centro italiano di studi sull’alto medioevo («Fonti documentarie della Marca medievale», 6, lxiv+202 pp.

  15. Monitoring of pesticides and nitrates on water, soil and agricultural production in the Bracciano lake district; Monitoraggio di pesticidi e nitrati nelle acque, suolo, e prodotti agricoli nel bacino del lago di Bracciano

    Energy Technology Data Exchange (ETDEWEB)

    Caffarelli, V; Correnti, A [ENEA, Div. Biotecnologie e Agricoltura, Centro Ricerche Casaccia, Rome (Italy); Cecchini, G; Frugis, A; Segatori, M [WRc Italia SpA, Gruppo ACEA, Centro di Ricerca e Sviluppo, Rome (Italy); Conte, E; Milani, R; Morali, G [Istituto Sperimentale per la Patologia Vegetale, Rome (Italy); Ciampi, G [Agenzia Regionale per l' Innovazione e lo Sviluppo in Agricoltura del Lazio, Rome (Italy)

    2001-07-01

    In the Bracciano Lake district, in actuation of the 2081/93 EEC, obj. 5b, a study was carried out, aimed to the realisation of a territorial informative system and supply technical support to the farmers for phyto pathological problems. A monitoring program has been realized for pesticide and nitrate in environmental samples and agricultural products. Five hundred and sixteen samples have been collected and analysed, from march 1999 to October 2000: 191 samples of water (ground and surface water), 20 samples of soil, 340 samples of agricultural products (vegetables and fruit). Pesticides were found in irrigation water and soil samples; the irregularities on agricultural products, 3% could disappear if the treatments are correct and respect the label indications. [Italian] In attuazione del regolamento 2081/93 ECC ob.5 b, nel bacino del lago di Bracciano, e' stato realizzato uno studio mirato alla realizzazione di un sistema informativo territoriale e a fornire un supporto tecnico per la gestione della difesa fitosanitaria della produzione agricola. Una campagna di monitoraggio e' stata realizzata per l'analisi della presenza di pesticidi in campioni ambientali e nei prodotti agricoli. Sono stati prelevati e analizzati 516 campioni nel periodo marzo '99. Ottobre 2000: 191 campioni di acque superficiali e di falda, 20 campioni di suolo, 340 campioni (frutta e vegetali). Pesticidi sono stati ritrovati nelle acque di irrigazione e nel suolo; la presenza di irregolarita' riscontrate nel 3% dei prodotti agricoli, e' da attribuire a un uso non corretto dei prodotti fitosanitari.

  16. Nicola Michelassi y Salomé Vuelta García, Il teatro spagnolo a Firenze nel Seicento. Vol. I: Giacinto Andrea Cicognini, Giovan Battista Ricciardi, Pietro Susini, Mattias Maria Bartolommei

    Directory of Open Access Journals (Sweden)

    Diego Símini

    2015-01-01

    Full Text Available Reseña de Nicola Michelassi y Salomé Vuelta García, Il teatro spagnolo a Firenze nel Seicento. Vol. I: Giacinto Andrea Cicognini, Giovan Battista Ricciardi, Pietro Susini, Mattias Maria Bartolommei, Alinea (Secoli d’Oro, 67; Commedia Aurea Spagnola e Pubblico Italiano, VIII, Florencia, 2013, 257 pp. ISBN: 9788860557865.

  17. A 36,000-Year-Old Volcanic Eruption Depicted in the Chauvet-Pont d’Arc Cave (Ardèche, France)?

    Science.gov (United States)

    Nomade, Sébastien; Genty, Dominique; Sasco, Romain; Scao, Vincent; Féruglio, Valérie; Baffier, Dominique; Guillou, Hervé; Bourdier, Camille; Valladas, Hélène; Reigner, Edouard; Debard, Evelyne; Pastre, Jean–François; Geneste, Jean-Michel

    2016-01-01

    Among the paintings and engravings found in the Chauvet-Pont d’Arc cave (Ardèche, France), several peculiar spray-shape signs have been previously described in the Megaloceros Gallery. Here we document the occurrence of strombolian volcanic activity located 35 km northwest of the cave, and visible from the hills above the cave entrance. The volcanic eruptions were dated, using 40Ar/39Ar, between 29 ± 10 ka and 35 ± 8 ka (2σ), which overlaps with the 14C AMS and thermoluminescence ages of the first Aurignacian occupations of the cave in the Megaloceros Gallery. Our work provides the first evidence of an intense volcanic activity between 40 and 30 ka in the Bas-Vivarais region, and it is very likely that Humans living in the Ardèche river area witnessed one or several eruptions. We propose that the spray-shape signs found in the Chauvet-Pont d’Arc cave could be the oldest known depiction of a volcanic eruption, predating by more than 34 ka the description by Pliny the Younger of the Vesuvius eruption (AD 79) and by 28 ka the Çatalhöyük mural discovered in central Turkey. PMID:26745626

  18. A 36,000-Year-Old Volcanic Eruption Depicted in the Chauvet-Pont d'Arc Cave (Ardèche, France)?

    Science.gov (United States)

    Nomade, Sébastien; Genty, Dominique; Sasco, Romain; Scao, Vincent; Féruglio, Valérie; Baffier, Dominique; Guillou, Hervé; Bourdier, Camille; Valladas, Hélène; Reigner, Edouard; Debard, Evelyne; Pastre, Jean-François; Geneste, Jean-Michel

    2016-01-01

    Among the paintings and engravings found in the Chauvet-Pont d'Arc cave (Ardèche, France), several peculiar spray-shape signs have been previously described in the Megaloceros Gallery. Here we document the occurrence of strombolian volcanic activity located 35 km northwest of the cave, and visible from the hills above the cave entrance. The volcanic eruptions were dated, using 40Ar/39Ar, between 29 ± 10 ka and 35 ± 8 ka (2σ), which overlaps with the 14C AMS and thermoluminescence ages of the first Aurignacian occupations of the cave in the Megaloceros Gallery. Our work provides the first evidence of an intense volcanic activity between 40 and 30 ka in the Bas-Vivarais region, and it is very likely that Humans living in the Ardèche river area witnessed one or several eruptions. We propose that the spray-shape signs found in the Chauvet-Pont d'Arc cave could be the oldest known depiction of a volcanic eruption, predating by more than 34 ka the description by Pliny the Younger of the Vesuvius eruption (AD 79) and by 28 ka the Çatalhöyük mural discovered in central Turkey.

  19. Geologia, misura e posizionamento spaziale

    Directory of Open Access Journals (Sweden)

    Renzo Carlucci

    2007-04-01

    Full Text Available Le Scienze della Terra sono poi date dall’insieme delle discipline che studiano la struttura interna, la morfologia superficiale e tutta l’atmosfera che circonda il pianeta Terra e la sua evoluzione nel tempo. Potremmo anche dire ormai che lo studio della Terra costituisce un caso particolare delle Scienze Planetarie, che si occupano dello studio dei pianeti presenti nel nostro sistema solare.

  20. A model for restoration of the vegetation complex in the ENEA Trisaia research center; Un modello per il riassetto della vegetazione nel centro di ricerche ENEA della Trisaia

    Energy Technology Data Exchange (ETDEWEB)

    D' Aquino, L.; Pace, S.; Marannino, P. [ENEA, Centro Ricerche Trisaia, Rotondella, MT (Italy). Dipt. Innovazione; Cassano, G. [ENEA, Centro Ricerche Trisaia, Rotondella, MT (Italy). Dipt. Ambiente; Cirio, U. [ENEA, Centro Ricerche Casaccia, Casaccia, S. Maria di Galeria, RM (Italy). Dipt. Innovazione

    1999-07-01

    A model for management of the vegetation complex in the ENEA (National Agency for New Technology, Energy and the Environment) Trisaia research center in Rotondella (Southern Italy), based on the restoration of wild potential vegetation and application of sustainable agriculture practices, is proposed. Benefits on environmental status and vegetation management are discussed. [Italian] Viene presentato un modello di intervento di rsistemazione della vegetazione nel centro di ricerche ENEA della Trisaia di Rotondella (Matera), finalizzato a ricostruire aree di copertura boschiva e a macchia, riconducibili alla vegetazione naturale potenziale del sito, in equilibrio con agrositemi gestiti secondo le tecniche dell'agricoltura sostenibile, e tenendo conto delle esigenze di urbanizzazione del centro. Sono discussi i vantaggi ottenibili dall'applicazione del modello di intervento sull'ambiente locale e sulla gestione del verde.

  1. Il potere di Prometeo e il dovere di Kant

    Directory of Open Access Journals (Sweden)

    Stefano Picchetti

    2006-10-01

    Full Text Available Kant ci suggerisce qualcosa che Prometeo e il mito greco avevano già accennato. L'imperativo che pone freno al fare, è già in sé nel soggetto ed è per questo che egli che egli è responsabile delle proprie azioni, indipendentemente dalla legge scritta.

  2. Functional analysis of NopM, a novel E3 ubiquitin ligase (NEL domain effector of Rhizobium sp. strain NGR234.

    Directory of Open Access Journals (Sweden)

    Da-Wei Xin

    Full Text Available Type 3 effector proteins secreted via the bacterial type 3 secretion system (T3SS are not only virulence factors of pathogenic bacteria, but also influence symbiotic interactions between nitrogen-fixing nodule bacteria (rhizobia and leguminous host plants. In this study, we characterized NopM (nodulation outer protein M of Rhizobium sp. strain NGR234, which shows sequence similarities with novel E3 ubiquitin ligase (NEL domain effectors from the human pathogens Shigella flexneri and Salomonella enterica. NopM expressed in Escherichia coli, but not the non-functional mutant protein NopM-C338A, showed E3 ubiquitin ligase activity in vitro. In vivo, NopM, but not inactive NopM-C338A, promoted nodulation of the host plant Lablab purpureus by NGR234. When NopM was expressed in yeast, it inhibited mating pheromone signaling, a mitogen-activated protein (MAP kinase pathway. When expressed in the plant Nicotiana benthamiana, NopM inhibited one part of the plant's defense response, as shown by a reduced production of reactive oxygen species (ROS in response to the flagellin peptide flg22, whereas it stimulated another part, namely the induction of defense genes. In summary, our data indicate the potential for NopM as a functional NEL domain E3 ubiquitin ligase. Our findings that NopM dampened the flg22-induced ROS burst in N. benthamiana but promoted defense gene induction are consistent with the concept that pattern-triggered immunity is split in two separate signaling branches, one leading to ROS production and the other to defense gene induction.

  3. Rachunek dochodów i wydatków budżetu jednostki samorządu terytorialnego na przykładzie gminy Chełmiec w latach 2011-2013

    OpenAIRE

    Rodak, Anna

    2015-01-01

    Przedłożona praca ma na celu wskazanie źródeł i struktury dochodów budżetowych oraz charakteru wydatkowania środków budżetowych gminy Chełmiec, a także dokonanie rzetelnej oceny sytuacji finansowej wymienionej powyżej jednostki. Analiza budżetu obejmuje zakres czasowy od 2011 do 2013 roku. Szczegółowe pytania, na które starano się w niniejszej pracy odpowiedzieć są następujące: Czy gmina Chełmiec jest gospodarna w wykorzystywaniu środków budżetowych? oraz jak gmina Chełmiec mając do dyspozycj...

  4. Evita Perón y el Che Guevara: De la historia a la construcción literaria del mito biográfico

    Directory of Open Access Journals (Sweden)

    Cecilia López Badano

    2014-06-01

    Full Text Available Eva Perón y el Che Guevara son dos de las figuras paradigmáticas argentinas, conocidas internacionalmente a través no sólo de sus vidas, que pueden reconstruirse a partir de documentos históricos, sino por el mito nacional - e internacional - que la muerte temprana ha configurado con ambos mediante la ayuda de la literatura y el cine, expandiendo ficcionalmente el matiz revolucionario de su accionar. El presente texto se propone, en consecuencia, dar cuenta de esas "capas" ficcionales que conforman la construcción estética de los dos mitos biográficos e inciden en la evaluación de sus protagonistas reales, modelando la percepción de ambos, particularmente, la considerada por el gran público más que por los especialistas.

  5. Changes of serum levels of prealbumin (PAB), cholinesterase (CHE), total bile acid (TBA) and ALT as related to the severity of inflammatory process and hepatic fibrosis in patients with chronic virus B hepatitis

    International Nuclear Information System (INIS)

    Chi Xiaoxia; Chen Jianxiong; Xiong Ying

    2005-01-01

    Objective: To study the correlationship between the serum levels of PAB, CHE, TBA, ALT and the severity of the disease process in patients with chronic virus B hepatitis. Methods: Serum levels of PAB, CHE, ALT (with biochemical methods) and TBA (with RIA) were examined in 93 patients with biopsy proven virus B hepatitis and 46 controls. Results: The 93 patients were of two groups: a less advanced group (n=51) and a more advanced group (n=42). Serum TBA, ALT levels were significnatly higher and serum PAB, CHE levels were significantly lower in the more advanced group than those in the less advanced group (P 0 to s 4 . Changes of levels of ALT were of no regular pattern, but serum levels of TBA regularly increased and levels of PAB, CHE regularly decreased as the fibrosis grading proceeded from s 0 to s 4 and the differences between the levels in s 4 and any other grading were significant (P<0.01). Conclusion: Combined determination of these serum markers might reflect the degree of inflammatory process and hepatic fibrosis in patients with virus B hepatitis, leading to earlier detection of cirrhosis. (authors)

  6. Per un insegnamento moderno della relatività

    CERN Document Server

    Fabri, Elio

    1995-01-01

    Nel 1985 furono distributi al Congresso AIF gli appunti di un corso di relatività, intitolato "Il tempo relativistico"; nel 1987, sempre in occasione del Congresso AIF, usciva "Massa ed energia", che ne costituiva il completamento. Quella che presento oggi, ancora a distanza di due anni, è la versione integrata e rielaborata di quei due volumetti.

  7. Giorgio Perlasca, 'Giusto tra le nazioni' e 'eroe italiano'

    NARCIS (Netherlands)

    Jansen, M.M.

    2008-01-01

    Giorgio Perlasca che, fingendosi console spagnolo, nel 1944 salvò più di cinquemila ebrei ungheresi a Budapest, è stato proclamato “Giusto tra le Nazioni” a Yad Vashem nel 1989, dopo di che è seguito il suo riconoscimento all’estero ed in Italia come “uomo giusto” e come “eroe italiano”. Dopo il

  8. L'ISOLA DI ARTURO DI ELSA MORANTE

    African Journals Online (AJOL)

    User

    Vi è una curiosa atmosfera di attesa negli anni '50, ed è questa temperie morale che Elsa Morante rappresenta e interpreta nell'Isola di Arturo. Nel romanzo la Morante ci dà veramente un ritratto intero di quegli anni, nel senso che dal testo sorge una attitudine complessa, contenente in sè la percezione del tempo in corso, ...

  9. Monitoring of pesticides and nitrates on water, soil and agricultural production in the Bracciano lake district; Monitoraggio di pesticidi e nitrati nelle acque, suolo, e prodotti agricoli nel bacino del lago di Bracciano

    Energy Technology Data Exchange (ETDEWEB)

    Caffarelli, V.; Correnti, A. [ENEA, Div. Biotecnologie e Agricoltura, Centro Ricerche Casaccia, Rome (Italy); Cecchini, G.; Frugis, A.; Segatori, M. [WRc Italia SpA, Gruppo ACEA, Centro di Ricerca e Sviluppo, Rome (Italy); Conte, E.; Milani, R.; Morali, G. [Istituto Sperimentale per la Patologia Vegetale, Rome (Italy); Ciampi, G. [Agenzia Regionale per l' Innovazione e lo Sviluppo in Agricoltura del Lazio, Rome (Italy)

    2001-07-01

    In the Bracciano Lake district, in actuation of the 2081/93 EEC, obj. 5b, a study was carried out, aimed to the realisation of a territorial informative system and supply technical support to the farmers for phyto pathological problems. A monitoring program has been realized for pesticide and nitrate in environmental samples and agricultural products. Five hundred and sixteen samples have been collected and analysed, from march 1999 to October 2000: 191 samples of water (ground and surface water), 20 samples of soil, 340 samples of agricultural products (vegetables and fruit). Pesticides were found in irrigation water and soil samples; the irregularities on agricultural products, 3% could disappear if the treatments are correct and respect the label indications. [Italian] In attuazione del regolamento 2081/93 ECC ob.5 b, nel bacino del lago di Bracciano, e' stato realizzato uno studio mirato alla realizzazione di un sistema informativo territoriale e a fornire un supporto tecnico per la gestione della difesa fitosanitaria della produzione agricola. Una campagna di monitoraggio e' stata realizzata per l'analisi della presenza di pesticidi in campioni ambientali e nei prodotti agricoli. Sono stati prelevati e analizzati 516 campioni nel periodo marzo '99. Ottobre 2000: 191 campioni di acque superficiali e di falda, 20 campioni di suolo, 340 campioni (frutta e vegetali). Pesticidi sono stati ritrovati nelle acque di irrigazione e nel suolo; la presenza di irregolarita' riscontrate nel 3% dei prodotti agricoli, e' da attribuire a un uso non corretto dei prodotti fitosanitari.

  10. Incontri musicologici 2005 „Il dramma per musica al tempo del Farinelli. Nel 300° anniversario della nascita di Carlo Broschi detto il Farinelli“, Bologna 10.-11. 11. 2005

    Czech Academy of Sciences Publication Activity Database

    Jonášová, Milada

    2006-01-01

    Roč. 43, č. 1 (2006), s. 102-1003 ISSN 0018-7003. [Il dramma per musica al tempo del Farinelli. Nel 300° anniversario della nascita di Carlo Broschi detto il Farinelli. Bologna, 10.11.2005-11.11.2005] Institutional research plan: CEZ:AV0Z90580513 Keywords : dramma per musica * Farinelli * conference * Bologna Subject RIV: AL - Art, Architecture, Cultural Heritage

  11. Razgovor s Ðurom Sederom. Intervista con Ðuro Seder

    Directory of Open Access Journals (Sweden)

    Radmila Iva Janković

    2013-12-01

    Full Text Available Radmila Iva Janković ha intervistato nel luglio 2013 Ðuro Seder, artista che aveva partecipato al gruppo Gorgona e preso parte alla residenza d'artista a Brunnenburg nel 1991 organizzata da Francesco Conz con l'obiettivo di includere il gruppo di artisti nel progetto La Livre, una monumentale edizione d'artista dedicata a Ezra Pound.

  12. Bruno Touschek e l'arte della fisica

    CERN Document Server

    Agapito, Enrico

    2007-01-01

    Bruno Touschek, nato a Vienna nel 1921 e morto a Igls, in Austria, nel 1978, fu il fisico che nel 1960 progettò e portò a compimento, la costruzione di AdA, il primo Anello di Accumulazione di materia e antimateria (elettroni e positroni), presso i Laboratori del CNEN di Frascati.

  13. la distruzione dell'esperienza in quaderno proibito di alba de cés

    African Journals Online (AJOL)

    User

    the main works of Alba de Cespedes, Quaderno proibito. I will show how the .... un'opera abbastanza datata, che descrive un tipo di società e un mondo ... padre: romanzo sportivo nel 1935; Prigionie nel 1936; Concerto: racconti nel 1937). A.

  14. Conditions of concentration and composition of suspended load in the Vistula River between Wyszogród and Chełmno

    Science.gov (United States)

    Kaszubski, Michal

    2014-05-01

    The main objective of the study is to explain causes of variations of concentration, particle size distribution and composition of suspended load in the riverbed of the lower Vistula between Wyszogród and Chełmno. The study was conducted in seven bridge cross-sections (three above and four below the Włocławek reservoir). In each cross-section, three water samples were collected in the characteristic parts of the riverbed. Since July 2012 fifteen measurement series were carried out. During each measurement series 22 samples of water were collected. In each sample the overall concentration of suspended load, the proportion of the organic matter and particle size distribution of the mineral fraction were measured. Variation of concentration and characteristics of suspended load were studied both in the cross-sections of the Vistula riverbed and along its longitudinal profile. The study focus primarily on determining the qualitative and quantitative variation in the properties of suspended load in the cross-sections located in different morphological riverbed type, various level of its hydrotechnical management, including the operation on the Włocławek reservoir, and the diversity of the water flow conditions. The author tested the correlation occurring between the size of suspended load concentration as well as the flow rate and flow velocity at the water sampling sites. Moreover, the author determined the effect of morphological variation of the Vistula riverbed (the riverbed depth and the location of points of collecting water samples relative to the riverbed mesoforms) on the concentration size, composition structure and the particle size distribution of suspended load. Measurement sessions were chosen in such a way as to cover the widest possible spectrum of the water flow conditions in the riverbed of the Vistula. In addition to the low and medium flow the variability in concentration during flood flows of various types (ice jam, snowmelt and rainfall) were

  15. Un percorso di trasformazione nel nuovo assetto detentivo/riabilitativo post OPG: esposizione di un caso / Un processus de transformation dans le nouveau dispositif d’emprisonnement / de réinsertion après la fermeture des hôpitaux psychiatriques judiciaires : une étude de cas / A process of transformation within the new custodial/rehabilitative framework after the closure of the judicial psychiatric hospitals: a case-study

    Directory of Open Access Journals (Sweden)

    Selvino M.S.

    2017-12-01

    Full Text Available L’articolo illustra il lavoro psicologico-clinico effettuato all’interno della “Articolazione per la Tutela della Salute Mentale in Carcere”, nuovo contesto di cura ed assistenza nato alla luce dei radicali cambiamenti attivati dal processo di superamento degli Ospedali Psichiatrici Giudiziari (OPG e che accoglie soggetti autori di reato affetti da patologia psichiatrica, garantendone un’osservazione costante ed interventi riabilitativi ad alta intensità terapeutica. Il caso presentato, attraverso la narrazione del percorso detentivo/riabilitativo di un soggetto, iniziato con la reclusione in regime ordinario, proseguito con l’assegnazione all’OPG e con il successivo approdo presso l’Articolazione SMC (Salute Mentale in Carcere, ed esitato nel trasferimento in un contesto comunitario, mira ad essere esemplificativo della valenza trasformativa di un approccio rivolto al paziente che, nella gestione della patologia psichiatrica, superi i limiti di un assetto prevalentemente custodialistico, spesso predominante nei pregressi contesti ad essa dedicati, e dia priorità alle finalità terapeutico-riabilitative. L’article décrit le travail clinique-psychologique mené dans le « dispositif pour la protection de la santé mentale en prison » géré par les services locaux de santé de Salerne (Italie. Il s’agit d’un nouveau service de santé mentale et de traitement créé grâce aux changements radicaux apportés par la fermeture des hôpitaux psychiatriques judiciaires en Italie. Ce service accueille les criminels souffrant de pathologies psychiatriques, assurant leur contrôle régulier et des traitements de réadaptation à forte intensité thérapeutique. L’étude de cas présentée dans cet article concerne l’histoire d’une personne initialement détenue en prison, puis transférée dans un hôpital psychiatrique judiciaire et, enfin, accueillie par le « dispositif pour la protection de la santé mentale en prison

  16. The CheMin XRD on the Mars Science Laboratory Rover Curiosity: Construction, Operation, and Quantitative Mineralogical Results from the Surface of Mars

    Science.gov (United States)

    Blake, David F.

    2015-01-01

    The Mars Science Laboratory mission was launched from Cape Canaveral, Florida on Nov. 26, 2011 and landed in Gale crater, Mars on Aug. 6, 2012. MSL's mission is to identify and characterize ancient "habitable" environments on Mars. MSL's precision landing system placed the Curiosity rover within 2 km of the center of its 20 X 6 km landing ellipse, next to Gale's central mound, a 5,000 meter high pile of laminated sediment which may contain 1 billion years of Mars history. Curiosity carries with it a full suite of analytical instruments, including the CheMin X-ray diffractometer, the first XRD flown in space. CheMin is essentially a transmission X-ray pinhole camera. A fine-focus Co source and collimator transmits a 50µm beam through a powdered sample held between X-ray transparent plastic windows. The sample holder is shaken by a piezoelectric actuator such that the powder flows like a liquid, each grain passing in random orientation through the beam over time. Forward-diffracted and fluoresced X-ray photons from the sample are detected by an X-ray sensitive Charge Coupled Device (CCD) operated in single photon counting mode. When operated in this way, both the x,y position and the energy of each photon are detected. The resulting energy-selected Co Kalpha Debye-Scherrer pattern is used to determine the identities and amounts of minerals present via Rietveld refinement, and a histogram of all X-ray events constitutes an X-ray fluorescence analysis of the sample.The key role that definitive mineralogy plays in understanding the Martian surface is a consequence of the fact that minerals are thermodynamic phases, having known and specific ranges of temperature, pressure and composition within which they are stable. More than simple compositional analysis, definitive mineralogical analysis can provide information about pressure/temperature conditions of formation, past climate, water activity and the like. Definitive mineralogical analyses are necessary to establish

  17. RELÉ ELECTRÓNICO PARA LA DETECCIÓN DEL MOVIMIENTO EN LOS TANQUES DE SEDIMENTACIÓN DE LA EMPRESA COMANDANTE ¨ERNESTO CHE GUEVARA¨

    Directory of Open Access Journals (Sweden)

    Orlys Ernesto Torres Breffe

    2011-02-01

    Full Text Available En este trabajo se muestran los resultados del diseño de un dispositivo electrónico para detectar el movimiento del tanquede sedimentación de la planta de lixiviación de la Empresa Ernesto Che Guevara.Estos tanque actualmente se encuentran sin esta protección y su parada por avería solo es detectada de forma visual por eloperario o cuando la densidad de la pulpa aumente a valores tan altos que sea reflejado en el sistema de monitoreo instalado(EROS. La parada inadvertida de estos tanque casi siempre sucede por razones fácilmente corregibles, pero si no se detectaa tiempo la sedimentación del minerales es casi inevitable y las pérdidas de recursos y materiales son cuantiosas.La propuesta electrónica en sustitución a las desechas electromagnéticas, es muy barata y su reproducción es fácilmenterealizable en la propia empresa, dado que los elementos que se utiliza son clásicos, sin exigencias de fabricación, tolerancias,etc.  The main goal of this research paper is to show the electronic device design results while dealing with the location of thesedimentation tank on the leaching plant located on Ernesto Che Guevara factory.Nowadays there is no protection for this tank, thus, if it stops working it can only be noticed by the engine sunner on avisual way or when the extremely high figures of the pulp density are reflected on the available monitor system (EROS.The unnoticed misfunctioning of this device is caused mainly to easily solved reasons. Nevertheless, when not detected ontime, the mineral sedimentation is almost unavoidable which results on the losses of resources.The electronic proposal to substitute the electromagnetic scraps is very cheap and easily to reproduce on the factory itself forthe needed elements are classic with no resistance and manufacture demands.

  18. Rock shelter occupation during isotopic stage 5: level D of the site of Payre (Ardèche, France. Territorial organisation and intra-site activities

    Directory of Open Access Journals (Sweden)

    Moncel, Marie-Hélène

    2007-06-01

    Full Text Available This paper presents the results obtained from an interdisciplinary study of the level D archaeological assemblages from Payre (Ardèche, France. This site is dated to the final of OIS 6 and the beginning of OIS 5. The combined analysis of the lithic and faunal assemblages accumulated and their management “into” and “out of” the site gives a better understanding of the behaviour of the Neanderthal groups that inhabited it. This study has allowed us to correlate the territorial exploitation for game hunting and for raw material procurement, within the context of seasonal short term occupations probably during the end of autumn and the beginning of winter.  

    Este artículo presenta los resultados obtenidos a través del estudio multidisciplinar del registro arqueológico del nivel D del yacimiento de Payre (Ardèche, Francia datado entre el final del OIS 6 y el comienzo del OIS 5. El análisis conjunto de la industria lítica y de los restos óseos recuperados en el yacimiento y de la gestión de dichos recursos dentro y fuera de él, ha hecho posible la comprensión de los comportamientos humanos de los grupos neandertales que lo ocuparon. Dicho estudio nos ha permitido poner en relación el tipo de explotación del territorio de caza y de captación de materias primas, dentro del marco de ocupaciones estacionales de corta duración desarrolladas probablemente entre el final del otoño y el principio del invierno.  

  19. LUCI ED OMBRE NELL’ATTUAZIONE DEL SISTEMA DI RISOLUZIONE ALTERNATIVA DELLE CONTROVERSIE NEL CONTENZIOSO TRIBUTARIO ITALIANO ED IN QUELLO CROATO

    Directory of Open Access Journals (Sweden)

    Marco Greggi

    2017-01-01

    Full Text Available Nel lavoro gli autori esaminano il sistema della risoluzione alternativa delle controversie (ADR - Alternative Dispute Resolution nelle questioni fi scali in un’ottica comparatistica, ovvero alla luce delle legislazioni e delle dottrine italiana e croata. Nella prima parte del lavoro l’attenzione è rivolta all’esperienza italiana di attuazione del sistema ADR; mentre la seconda parte del lavoro è dedicata all’evoluzione del quadro normativo croato nei tentativi di costruzione di meccanismi di ADR. Il lavoro in entrambe le sue parti contiene una rassegna degli orientamenti dottrinali e attraverso i vari capitoli si sottolinea l’aspetto storico e teorico della questione esaminata. Gli autori dibattono ed espongono sul piano comparatistico anche le implicazioni dell’attuazione del sistema in esame; mentre l’infl uenza della dottrina di diritto pubblico sulla comparsa e lo sviluppo del sistema ADR viene evidenziata mediante l’esposizione della recente prassi italiana e croata del sistema di risoluzione dei contenziosi tributari.

  20. Survey on the consumptions of energy sources in the tertiary sector in Italy in 1999; Indagine sui consumi di fonti energetiche nel settore terziario in Italia. Anno 1999

    Energy Technology Data Exchange (ETDEWEB)

    Iorio, G. [ENEA, Funzione Centrale Studi, Centro Ricerche Casaccia, Rome (Italy); Perrella, G. [ENEA, Divisione Promozione degli Usi Efficienti e Diversificazione dell' Energia, Centro Ricerche Casaccia, Rome (Italy); Ballin, M. [Istituto Nazionale di Statistica, Dipt. Statistiche Economiche, Rome (Italy)

    2001-07-01

    This report has the aim to introduce the results of the sampling survey performed to determinate the consumption of energy sources (electricity, natural gas, fuel oil, diesel oil, etc.) in the tertiary sector. The energy consumptions report to 1999 and they are disaggregated for typology of use: energy consumptions for productive uses, for production of energy and for traction. The economic energy intensive activities have represented the nucleus of the survey. Particular attention has been devoted to the production of energy and the consumption of heat. [Italian] Il presente rapporto ha l'obiettivo di presentare i risultati dell'indagine campionaria effettuata per determinare il consumo di fonti energetiche (energia elettrica, gas naturale, olio combustibile, gasolio, ecc.) nel settore terziario. I consumi energetici si riferiscono al 1999 e sono disaggregati per tipologia di utilizzo: consumi energetici per usi produttivi, per produzione di energia e per trazione. Le attivita' economiche ad alta intensita' energetica hanno rappresentato il nucleo dell'indagine. Particolare attenzione e' stata dedicata alla produzione di energia e al consumo di calore.

  1. Survey on the consumptions of energy sources in the tertiary sector in Italy in 1999; Indagine sui consumi di fonti energetiche nel settore terziario in Italia. Anno 1999

    Energy Technology Data Exchange (ETDEWEB)

    Iorio, G [ENEA, Funzione Centrale Studi, Centro Ricerche Casaccia, Rome (Italy); Perrella, G [ENEA, Divisione Promozione degli Usi Efficienti e Diversificazione dell' Energia, Centro Ricerche Casaccia, Rome (Italy); Ballin, M [Istituto Nazionale di Statistica, Dipt. Statistiche Economiche, Rome (Italy)

    2001-07-01

    This report has the aim to introduce the results of the sampling survey performed to determinate the consumption of energy sources (electricity, natural gas, fuel oil, diesel oil, etc.) in the tertiary sector. The energy consumptions report to 1999 and they are disaggregated for typology of use: energy consumptions for productive uses, for production of energy and for traction. The economic energy intensive activities have represented the nucleus of the survey. Particular attention has been devoted to the production of energy and the consumption of heat. [Italian] Il presente rapporto ha l'obiettivo di presentare i risultati dell'indagine campionaria effettuata per determinare il consumo di fonti energetiche (energia elettrica, gas naturale, olio combustibile, gasolio, ecc.) nel settore terziario. I consumi energetici si riferiscono al 1999 e sono disaggregati per tipologia di utilizzo: consumi energetici per usi produttivi, per produzione di energia e per trazione. Le attivita' economiche ad alta intensita' energetica hanno rappresentato il nucleo dell'indagine. Particolare attenzione e' stata dedicata alla produzione di energia e al consumo di calore.

  2. Evaluation of distribution of nonpolar extractable in the geological environment of Quaternary sediments; Hodnotenie distribucie NEL v geologickom prostredi kvarternych sedimentov

    Energy Technology Data Exchange (ETDEWEB)

    Macek, J [Univerzita Komenskeho v Bratislave, Prirodovedecka fakulta, Katedra geocheomie, 84215 Bratislava (Slovakia)

    2012-04-25

    Hydrocarbons are one of the most common environmental contaminants, especially in urban areas. This paper analyzes the situation and possible eco-toxicological effects of the two plants on contamination of soil and groundwater at the model site in Bratislava. The first is the largest leak of petroleum products in Bratislava at all - the bombing of oil refineries Apollo in 1944 and the subsequent contamination of vast areas and groundwater. The second is represented by existence of a state enterprise Kovosrot, where waste containing oil material was liquidated, also a service of mechanical machinery and vehicles was carried out there. The first is located about 1 km from the area of interest; the other is right next to it. 71 soil samples from three depth levels were analyzed by the method of infrared spectroscopy and a detailed analysis of one sample of groundwater was also made. Subsequently, a distribution of non-polar extractable substances (NEL) in the rock environment was visualized on the map's reconstructed by the MapInfo Professional Program. Thanks to this it was possible to identify the originator of pollution. (authors)

  3. LA DIAGNOSI DELLE COMPETENZE LINGUISTICHE IN UN CONTESTO MULTILINGUE: UN PROCESSO CONTINUO CHE FAVORISCE L’INSEGNAMENTO E L’APPRENDIMENTO INDIVIDUALIZZATO

    Directory of Open Access Journals (Sweden)

    Drorit Lengyel

    2011-07-01

    Full Text Available Il presente studio affronta il problema della valutazione diagnostica delle competenze linguistiche in contesti educativi multilingui, con particolare attenzione ai bisogni dei bambini e degli adolescenti immigrati. Vengono brevemente esposti gli obiettivi, le funzioni e i principi della valutazione diagnostica e della valutazione formativa considerate parte integrante di una educazione linguistica continua che prevede un insegnamento-apprendimento individualizzato. Sul piano teorico le procedure della valutazione diagnostica delle competenze linguistiche in contesti multilingui fanno riferimento all’apprendimento delle lingue inteso come attività socio-culturale.     Language diagnostics in multilingual settings with respect to continuous procedures as accompaniment of individualized learning and teaching   This study provides an introduction to language diagnostics in multilingual educational settings, with particular reference to the needs of children and adolescents from migrant backgrounds. It summarises the objectives and functions of language diagnostics and the principles that govern diagnostics including formative assessment, considered to be an integral part of continuous language education that emphasises individualised teaching and learning. From a theoretical perspective, diagnostic procedures in multilingual settings treat language learning as a socio-cultural activity.  

  4. Il Salento che abbiamo attraversato: Rina Durante e Bruno Brancher, il racconto di due vite diverse sulle strade di terra d'Otranto

    Directory of Open Access Journals (Sweden)

    Massimo Melillo

    2015-07-01

    Full Text Available Rina Durante ha rappresentato il meglio della cultura meridionale, ne ha raccolto l’eredità e ne è stata tra le interpreti più acute. Abbiamo avuto l’onore della sua amicizia fraterna e solidale, conosciuto l’azzardo e la radicalità delle sue scelte di vita, la sua dolce timidezza e l’ardita padronanza e consapevolezza del suo ruolo: anni di discussioni, di confronto, di legame cementato da infuocati innamoramenti intellettuali per uno scrittore, un poeta, un regista, di accese ironie sui nostri caratteri, di scontri politici e furibondi litigi finiti in un abbraccio. Anche per Bruno Brancher, milanese di tutti e di nessuno, il ricordo si fa memoria per le sue mille improvvise e imprevedibili incursioni in terra salentina. Non era un uomo facile, anche se aveva dalla sua parte il puntiglio dell’innocenza tipica del ladro gentiluomo. Portava leggero il fardello di due vite in una: la prima segnata da una marginalità, fattasi a volte precariamente lussuosa con i proventi di furti e disarmanti rapine; l’altra con la faccia del redento, che con la scoperta della scrittura diventa cosciente di sé.

  5. Evaluation of the Addition liquor with high ammonia and Carbon Dioxide contentin the still 208 of the “Comandante Che Guevara” industry (ECG

    Directory of Open Access Journals (Sweden)

    María Elena Magaña-Haynes

    2015-12-01

    Full Text Available Adding fresh liquor through the 5th ring in still 208 of distilling liquor product (liquor obtained as a result of ammonium carbonate leaching of lateritic ore in the “Comandante Che Guevara” industry, were evaluated with the objective of reducing the dissolved nickel content of the effluent there from, as well as to improve the characteristics of the nickel carbonate which is delivered to the calcinations process. For the development of the survey, the same methodology used in 2001 for the test was applied. The results showed that by adding fresh liquor, it is possible to reduce the dissolved nickel content at the exit of the distillation column, so that the need for precipitation is minimized, thereby reducing the consumption of reagents and the and the cost for their acquisition. It was possible to corroborate the relationship between the content of NH3 at the discharge and the nickel dissolved therein appreciating that to achieve these results it is necessary to maintain the ammonia in the discharge between 1,0-1,8 g/L. The carbonate obtained in the column where liquor is added with high CO2 and NH3 reached high values of this last element in its composition and to the extent that increased sulphur content decreased. It was also seen an increase in the size of the coarse carbonates particles, which will influence in a decrease of energy consumption.

  6. Democritus and Epicurus on Sensible Qualities in Plutarch's Against Colotes 3-9 Les qualités sensibles selon Démocrite et Epicrue dans le Contre Colotès de Plutarque (§§3-9 La qualità sinsibilit secondo Domocrito ed Epicuro nel Contro Colote di Plutarco (§§3-9

    Directory of Open Access Journals (Sweden)

    Luca Castagnoli

    2013-05-01

    apparently opposite claims about the “reality” of secondary qualities, Democritus and Epicurus shared either a form of radical relativism or a form of commonsense “intersubjectivism” in their evaluations of ascriptions of such qualities to macroscopic objects.A partire da una lettura dettagliata dei capitoli 3-9 del Contro Colote di Plutarco, questo studio ricostruisce ed interpreta (1 l’originale critica epicurea dell’epistemologia e dell’ontologia democritee, e in particolare della teoria democritea delle qualità sensibili, e (2 la duplice critica di Plutarco (2a dell’epistemologia epicurea (critica fondata su argomenti analoghi, e (2b delle discutibili manovre esegetiche ed argomentative dell’epicureo Colote. Nel corso dell’interpretazione del testo di Plutarco, (3 questo articolo riflette sulla natura, le intenzioni e la credibilità delle strategie esegetiche ed argomentative dello stesso Plutarco. Infine, (4 esso suggerisce che una lettura attenta del Contro Colote ci permette di comprendere meglio se, indipendentemente dalle loro posizioni divergenti sulla “realtà” delle qualità secondarie, Democrito ed Epicuro condividessero una forma di relativismo radicale o una forma di “intersoggettivismo” del senso comune nelle loro valutazioni delle attribuzioni di tali qualità ad oggetti macroscopici.

  7. Sadomasochism in the filmic element: Eros melancholy and versification

    Directory of Open Access Journals (Sweden)

    Chiara Bille

    2011-06-01

    Full Text Available Le perversioni che albergano nell’animo umano sono insidiate lì comodamente nel profondo e inconsciamente si manifestano con una veste di crudeltà seducente nel reale, seguendo la trama di un sottile e raffinato ricamo che mai nessuno osa ri- conoscere, bensì solo confondere in un lussurioso giuoco di dominio morboso che con l’ausilio di un agire anancastico è proteso verso la ricerca del paradiso perduto.

  8. Valutazione degli elementi di struttura e monitoraggio microbiologico nel Comparto operatorio comune del Dipartimento ortopedico dell'Azienda ospedaliera di Parma

    Directory of Open Access Journals (Sweden)

    C. Pasquarella

    2003-05-01

    Full Text Available Obiettivi: scopo di questo studio, che si inserisce nell’ambito di un progetto multicentrico promosso dal Gruppo Italiano Studio Igiene Ospedaliera, è stato quello di valutare le condizioni ambientali e gestionali delle sale operatorie del comparto ortopedico dell’Azienda ospedaliera di Parma. Metodi: l’indagine, svolta nell’ottobre 2002, ha previsto la compilazione di un questionario, riguardante gli aspetti strutturali, impiantistici, organizzativi e gestionali, e l’effettuazione di un monitoraggio microbiologico ambientale nelle diverse aree del blocco operatorio. La carica microbica dell’aria è stata valutata utilizzando piastre di sedimentazione per la rilevazione dell’Indice Microbico Aria (IMA mentre per le superfici sono state impiegate membrane di nitrocellulosa. I campionamenti sono stati effettuati prima dell’inizio e durante l’attività chirurgica. Risultati: i dati ottenuti per mezzo del questionario hanno evidenziato condizioni generalmente buone, sia dal punto di vista strutturale che gestionale del comparto operatorio studiato. Per quanto riguarda il controllo microbiologico, nelle sale operatorie, in tutte le rilevazioni prima dell’attività si sono ottenuti valori di IMA uguali a 0; durante l’attività, si è registrato un valore massimo di IMA di 4 in quelle a flusso laminare e di 19 in quelle con flusso turbolento, al di sotto dei valori limite, rispettivamente di 5 e 25; i valori di contaminazione microbica delle superfici prima dell’attività hanno oscillato da un minimo di 0 ufc/cm2 a un massimo di 0,20 ufc/cm2; durante l’attività, solo in una rilevazione si è registrato un valore di 0,58 ufc/cm2, superiore al valore soglia stabilito. Anche negli altri ambienti del comparto operatorio la contaminazione microbica è risultata complessivamente al di sotto dei limiti di riferimento. Conclusioni: il questionario si è rivelato un valido strumento

  9. Population dynamics of toxic phytoplankton and bacterial flora in the waters of the low Adriatic sea; Dinamica di popolazione di fitoplancton tossico e flora batterica nel basso Adriatico

    Energy Technology Data Exchange (ETDEWEB)

    Caroppo, C.; Stabili, L.; Cavallo, R.A.; Pastore, M. [CNR, Ist. Sperimentale Talassografico Attlio Cerruti, Taranto (Italy); Marchiori, E. [Rome Univ., Rome (Italy). Dipt. di Chimica Organica; Bruno, M. [Istituto Superiore di Sanita' , Laboratorio di Igiene Ambientale, Rome (Italy)

    2000-07-01

    The coastal areas of the Southern Adriatic Sea, in particular the Apulian ones, may be considered an example of intact ecosystem and represent an ideal term of comparison to other marine ecosystems having higher levels of pollution (Northern Adriatic Sea). In order to evaluate the sanitary levels of this environment, four transect were investigated during two years monitoring (April 1995-March 1997) along the Otranto Channel coasts, by joint research groups of the Environmental Hygiene Laboratory of the Istituto Superiore di Sanita' and the Istituto Sperimentale Talassografico A. Cerruti of CNR in Taranto. The study underlines the phytoplanktic and bacterial population dynamics, and the detection of the microbiological water quality along the coast tract Brindisi-Lecce-Otranto-S. Maria di Leuca. The results acquired pointed out population dynamics of some potantially toxic species of Dinophysis genus and Pseudo-nitzschia delicatissima. These depended on the winter nutrient loads due to the ASW (Adriatic Superficial Waters) and to the LIW (Levantine Intermediate Waters). The bacterial community was mainly constituted by genera Aeromonas, Photobacterium, Cytophaga and Pseudomonas. Also the presence of Enterobacteriaceae family was relevant. Among the pathogenic vibrios the most frequently isolated species were Vibrio alginolyticus and Vibrio vulnificus. [Italian] Considerando che le zone del basso Adriatico, in particolare quelle pugliesi, costituiscono un biotopo ancora relativamente inalterato, esse sono state oggetto di un'indagine sperimentale condotta in 24 mesi di attivita' (aprile 1995-marzo 1997) lungo le coste del Canale di Otranto, ad opera di un gruppo congiunto del Laboratorio di Igiene Ambientale dell'Istituto Superiore di Sanita' e dei laboratori dell'Istituto Sperimentale Talassografico A. Cerruti del CNR di Taranto, ai fini di valutare lo stato di salute di questo ambiente, che fornisce, con buona probabilita', un

  10. En los muros del Palacio: Pedro Nel Gómez en el imaginario social en Medellín, 1930-1950

    Directory of Open Access Journals (Sweden)

    Juan Carlos Gómez

    2013-07-01

    Full Text Available Durante la década de 1920 apareció en Latinoamérica una serie de vanguardias culturales que cuestionaron la realidad nacional de sus países buscando cambios en la estructura social y política. Los políticos liberales colombianos, en su intento por llegar al poder, reconocieron en ellas diferentes ideas que influyeron en su desarrollo político. Con las reformas de Alfonso López Pumarejo se buscó un acercamiento con los artistas para que estos desarrollaran una tipología de arte en la que se involucrara a la sociedad y así ésta tomara conciencia de su historia e idiosincrasia. Bajo estos lineamientos Pedro Nel Gómez fue contratado para decorar el Palacio Municipal de Medellín con diferentes murales al fresco que cumplieran este propósito. El artista presentó nueve frescos que despertaron polémica debido al llamado de conciencia social que realizó al retratar los principales problemas de su país, situación que no solo le ganó el apelativo de socialista sino que años más tarde lo llevó a la censura. Con este texto se pretende interpretar esos murales como fuente de conocimiento histórico y ver en ellos los problemas sociales de la Colombia de los años treinta expresados por el artista desde su pensamiento socialista e influencia marxista.

  11. Mineralogy, provenance, and diagenesis of a potassic basaltic sandstone on Mars: CheMin X-ray diffraction of the Windjana sample (Kimberley area, Gale Crater)

    International Nuclear Information System (INIS)

    Treiman, Allan H.; Bish, David L.; Chipera, Steve J.; Blake, David F.

    2015-01-01

    The Windjana drill sample, a sandstone of the Dillinger member (Kimberley formation, Gale Crater, Mars), was analyzed by CheMin X-ray diffraction (XRD) in the MSL Curiosity rover. From Rietveld refinements of its XRD pattern, Windjana contains the following: sanidine (21% weight, ~Or 95 ); augite (20%); magnetite (12%); pigeonite; olivine; plagioclase; amorphous and smectitic material (~25%); and percent levels of others including ilmenite, fluorapatite, and bassanite. From mass balance on the Alpha Proton X-ray Spectrometer (APXS) chemical analysis, the amorphous material is Fe rich with nearly no other cations—like ferrihydrite. The Windjana sample shows little alteration and was likely cemented by its magnetite and ferrihydrite. From ChemCam Laser-Induced Breakdown Spectrometer (LIBS) chemical analyses, Windjana is representative of the Dillinger and Mount Remarkable members of the Kimberley formation. LIBS data suggest that the Kimberley sediments include at least three chemical components. The most K-rich targets have 5.6% K 2 O, ~1.8 times that of Windjana, implying a sediment component with >40% sanidine, e.g., a trachyte. A second component is rich in mafic minerals, with little feldspar (like a shergottite). A third component is richer in plagioclase and in Na 2 O, and is likely to be basaltic. The K-rich sediment component is consistent with APXS and ChemCam observations of K-rich rocks elsewhere in Gale Crater. The source of this sediment component was likely volcanic. Finally, the presence of sediment from many igneous sources, in concert with Curiosity's identifications of other igneous materials (e.g., mugearite), implies that the northern rim of Gale Crater exposes a diverse igneous complex, at least as diverse as that found in similar-age terranes on Earth.

  12. Quality of the Fosso della Casaccia: analysis of the macroinvertebrates colonizing artificial substrates; Stato di qualita` del fosso della Casaccia: analisi dei macroinvertebrati che colonizzano substrati artificiali

    Energy Technology Data Exchange (ETDEWEB)

    Prato, S.; Morgana, J.G.; Antonelli, D.; Folletto, A. [ENEA, Centro Ricerche Casaccia, Rome (Italy). Dipt. Ambiente

    1999-01-01

    Aim of this work is to analyse the environmental quality of a small stream, the Fosso della Casaccia, flowing near Research Centre of ENEA (Rome, Central Italy). The study was carried out comparing zoo benthic communities of two sampling sites, chosen upstream and downstream the sewage of the Research Centre. Macro invertebrates were sampled using artificial substrates and standard hand net. Taxa number and distribution along along the watercourse were compared. Moreover, biotic index values (I.B.E.=Indice Biotico Esteso) were calculated using data on macro invertebrates collected with both sampling methodologies. Artificial substrates were also useful in establishing colonization patterns at each sampling site, and bio masses of individuals belonging to different trophic groups. The results show the greater sampling effectiveness of artificial substrates, confirming their usefulness for establishing the environmental quality. [Italiano] Il presente lavoro prende in considerazione la qualita` ambientale del Fosso della Casaccia, un piccolo corso d`acqua che scorre in prossimita` del Centro di Ricerche ENEA Casaccia (Italia Centrale). Lo studio e` stato realizzato in base al confronto fra le comunita` zoobentoniche di due stazioni sperimentali situate a monte e a valle dello scarico di acque reflue del centro. Il campionamento dei macroinvertebrati e` stato effettuato utilizzando due diversi metodi di raccolta: i substrati artificiali e il retino immanicato standard. Gli organismi sono stati classificati in unita` sistematiche, e si e` analizzata la loro distribuzione lungo il corso d`acqua. Inoltre sono stati calcolati i valori degli indici biotici I.B.E. (Indice Biotico Esteso) utilizzando i dati ottenuti con le due metodologie di campionamento. L`uso di substrati artificiali in ogni stazione di campionamento e` stato utile anche per stabilire il tipo di colonizzazione, l`abbondanza e le biomasse degli individui appartenenti ai vari gruppi trofici. I nostri

  13. Issues relating to classification of colluvial soils in young morainic areas (Chełmno and Brodnica Lake District, northern Poland

    Directory of Open Access Journals (Sweden)

    Świtoniak Marcin

    2015-06-01

    Full Text Available Colluvial soils (in Polish: gleby deluwialne are an important part of the soil cover in young morainic landscapes of northern Poland. They evolved as a result of the accumulation of eroded material at the foot of the slopes and bottoms of closed depressions. The aim of this study was to determine the systematic position of colluvial soils commonly found in the Chełmno and Brodnica Lake District, northern Poland. Ten soil pits located in different types of landscapes were selected for testing soil properties. The colluvial material is characterized by diversified properties: thickness, particle-size distribution, organic carbon content, color, pH, and base saturation. As a result, the investigated soils represent broad spectrum of typological units according to Polish Soil Classification (2011. Some of them contain epipedons mollic and meet the criteria of colluvial chernozemic soils. They were found mainly on buried black earths in areas with small slope inclinations. Many pedons contain pale colored acidic colluvial material with low base saturation and low organic carbon content and must be classified as other types: arenosols (in Polish: arenosole or rusty soils (in Polish: gleby rdzawe. These soils occur mostly in areas with intensive relief and overlay the different soil types, including rusty soil and organic soils. They are formed as a result of soils lessivés and rusty soils truncation. An introduction of the additional units of “proper colluvial soils” which have epipedon ochric, and “rusty-colluvial soils” with endopedon sideric to the next edition of Polish Soil Classification would enable a more precise expression of the genesis of these soils in the type rank. Moreover, the definition of chernozemic colluvial soils could be extended to colluvial soils with umbric horizon. Classifying soils derived from colluvial material as soils of other types leads to the disappearance of this units on maps and underestimation of the

  14. Unconditional nonlinear exponential stability in the Benard problem; Stabilita' nonlineare esponenziale incondizionata nel problema di Be'nard per ina miscela: condizioni necessarie e sufficienti.

    Energy Technology Data Exchange (ETDEWEB)

    Mulione, G. [Catania, Univ. (Italy). Dip. di Matematica; Rionero, S. [Napoli, Univ. (Italy). Dip. di Matematica e applicazioni

    1998-07-01

    The Lyapunov direct method is applied to study nonlinear stability of a basic motionless state to imposed linear temperature and concentration fields of a binary fluid mixture heated and salted from below, in the Oberbeck-Boussinesq scheme. Stress-free and rigid surfaces are considered and absence of Hopf bifurcation is assumed. We prove the coincidence of the linear and (unconditional) nonlinear critical stability limits, when the ratio between the Schmidt and the Prandtl numbers is less or equal to 1. Precisely, we obtain necessary and sufficient conditions of unconditional nonlinear exponential stability of the basic motionless state. [Italian] Si applica il metodo diretto di Lyapunov allo studio della stabilita' non lineare esponenziale della soluzione di conduzione-diffusione di una miscela fluida binaria riscaldata e salata da sotto, nello schema di Oberbeck-Boussinesq. Si considerano superfici rigide e 'stress-free'; si supponeche non ci sia biforcazione di Hpf. Supposto che il rapporto fra i numeri di Schmidt e di Prandtl e' minore o uguale a 1, si prova la coincidenza tra i paramentri critici della stabilita' lineare e non lineare. Si ottengono condizioni necessarie e sufficienti di stabilita' non lineare esponenziale del moto base.

  15. Textile industrial enzymatic processes; Enzimologia nel tessile. Biopreparazione del cotone ed uso degli enzimi nell'industria tessile. (2. parte)

    Energy Technology Data Exchange (ETDEWEB)

    Galante, Y. M. [Lamberti SpA, Albizzate, VA (Italy)

    2001-05-01

    In the last ten years, the textile industry has become one of the main field of industrial applications of enzymes. From traditional desizing to enzymatic stone washing to biopolishing of cellulosic fibers to protease treatment of silk and wool to catalase utilization after bleaching, textile processing has evolved into a field of primary importance for modern enzymology. A number of new recombinant and/or bioengineered enzymes (e.g., cellulases) have been recently introduced into textile processing and finishing dye-houses. Furthermore, new recombinant redox enzymes have been developed for dye oxidation on garments or in the liquor bath (e.g., laccase and peroxidase), which in the future might replace more harsh and polluting chemical oxiding systems. [Italian] Si presenta un approccio enzimatico integrato nella filiera tessile e si dimostra che e' possibile e conveniente applicare in un singolo processo differenti enzimi (ad esempio amilasi, pectinasi, catalisi, cellulasi) in successione o in contemporaneo, in combinazione con ausiliari chimici facilmente biodegradabili.

  16. Prefazione

    NARCIS (Netherlands)

    Gobbo, F.; Caligaris, I.

    2016-01-01

    Chi sono gli esperantisti? Perché scelgono di studiare l’esperanto? Per quali ragioni si accostano al movimento? Che cosa rappresenta per loro questa lingua? Quali valori veicola? Che posizione occupa nel loro repertorio linguistico? Ma soprattutto: l’esperanto è solo una lingua? E in che modo è

  17. Subversion and reconstruction of the detective novel: a reading of ...

    African Journals Online (AJOL)

    Nella lettura che si fa del terzo romanzo poliziesco di Sciascia, lo si scompone per dimostrare come l'autore intenzionalmente sovverte, manipola e rielabora la tecnica e gli elementi che costituiscono il 'giallo' come genere. Nel contempo si cerca di decifrare la pletora di citazioni pittoriche e letterarie che s'intrecciano nella ...

  18. ARTICLES / SAGGI

    African Journals Online (AJOL)

    User

    tardi, nel V libro dei Discorsi del poema eroico. 5, il Tasso, dopo aver affermato che non solo Dante ha innalzato il livello di reputazione dell'allegoria, ma che tutta la Commedia poggia su basi allegoriche (“non è parte che non sia allegorica”)6 ribadisca il concetto della medesima postilla: “Ma egli non dechiara se stesso ...

  19. The deregulation of the Italian natural gas industry and diversification processes in the down-stream sector; I riflessi dell'apertura del mercato italiano del gas naturale sul riposizionamento strategico degli operatori nel settore down-stream

    Energy Technology Data Exchange (ETDEWEB)

    Fazioli, R. [Ferrara Univ., Ferrara (Italy); Quaglino, S. [Cap Gemini Ernst and Young, Energy Division, Milan (Italy); Di Domenico, M. [Milan Bocconi Univ., Milan (Italy). Istituto di Economia delle Fonti di Energia

    2000-07-01

    The opening of the italian gas market , due to the privatisation and liberalisation process, has been implemented by the important normative evolution of this sector both at european and national level. The debate following this process in the gas market has focussed, basically, on the up-stream sector leaving aside the important down-stream sector also concerning gas local distribution and sales. In this article it is paid more attention to the down-stream sector considering the firms' evolution from a basic mono utility to multi utility and multi services organisational structure. This potential firms' evolution in the italian gas market will be considered also referring to specific international experience in this market. [Italian] L'apertura del mercato italiano del gas naturale e' la conseguenza, principalmente, dei processi di privatizzazione e liberalizzazione che sono seguiti alla normativa europea e nazionale che disciplinano tale mercato. Il dibattito seguito a questo processo si e' essenzialmente focalizzato sul settore up-stream e poca attenzione e' stata invece rivolta all'importante settore down-stream, ossia la distribuzione locale e la vendita. Su tale settore si focalizza l'attenzione di questo articolo nell'intento di delineare i possibili scenari di sviluppo delle imprese operanti che, da una semplice strutura mono-utility, si evolvano verso una struttura multi-utility e multi-service.

  20. Fuel-cell technology for vehicular applications; L`introduzione delle pile a combustibile nel settore dei trasporti: proposte, standard e normative per sistemi di bordo ed impianti

    Energy Technology Data Exchange (ETDEWEB)

    Ciancia, A.; Pede, G.; Marmigi, R. [ENEA, Centro Ricerche Casaccia, Rome (Italy). Dip. Energia

    1998-12-31

    viene descritta la situazione normativa nel settore dei serbatoi per gas compressi, esponendo poi le attivita` dell`ENEA in proposito. La parte finale e` dedicata ai problemi e possibili linee nella distribuzione e rifornimento del combustibile per i veicoli elettrici a celle a combustibile.

  1. Çokşeritli Dönel Kavşaklarda Kapasite Analizi: Highway Capacity Manual 2010 Kapasite Modeliyle Bir Değerlendirme

    Directory of Open Access Journals (Sweden)

    Melike Ersoy

    2014-06-01

    Full Text Available Bu çalışmada, genel kabul görmüş çok şeritli dönel kavşak kapasite hesap yöntemlerinin uygulanabilirliği, yeni Highway Capacity Manual (HCM 2010 yöntemiyle karşılaştırılmıştır. Yöntemlerden elde edilen sonuçlar, yerel çalışmalardan toplanan verilerin ışığında değerlendirilmiştir. Karşılaştırma için regresyon analiz yöntemini temsilen Transportation Research Laboratory (TRL formülasyonu, Kritik aralık kabulü yöntemini temsilen Avusturya Hesap Yöntemi seçilmiştir. Bunlara ek olarak, sınırlı öncelik ve ters öncelik koşullarının göz önünde bulundurulduğu kalibre edilmiş kritik aralık yöntemi ve HCM 2010 da yerel uygulamalar için öngörülen kalibre edilmiş formüller ile hesaplamalar yapılmış ve HCM 2010'un olağan değerleriyle karşılaştırılmıştır.Çalışmanın sonucunda elde edilenler, kritik aralık kabul yöntemi ve regresyon yönteminin HCM 2010 olağan değerlerine kıyasla genellikle daha yüksek sonuçlar verdiğini göstermiştir. Yöntemler arasında yapılan regresyon analizleri sonucu, özellikle yüksek dönen akımlar altında kritik aralık kabul yönteminin HCM 2010 yönteminden daha uygun sonuçlar verdiği görülmüştür. Ancak HCM 2010'da yerel uygulamalar için kalibrasyon yapılmasını sağlayan formülasyon sonucunda elde edilenler, olağan formülasyonun verdiği düşük kapasite tahminlerini daha uygun değerlere yükseltmiştir.

  2. Artificial recharge of the water-table aquifer in the latian volcano in Rome province; Ricarica artificiale dalla falda acquifera presente nel vulcano laziale in Provincia di Roma

    Energy Technology Data Exchange (ETDEWEB)

    Bersani, P.; Piotti, A. [Ambito Territoriale Ottimale, Lazio Centrale, Rome (Italy)

    2001-06-01

    'acquifero superiore. Tale ricarica potrebbe essere effettuata permettendo all'acqua meteorica di infiltrarsi per quanto possibile nel sottosuolo con la realizzazione nella parte piu' depressa della caldera sommitale o di un lago artificiale oppure in alternativa potrebbero essere realizzati una serie di piccoli bacini artificiali di infiltrazione con pozzi a dispersione. Inoltre la realizzazione del lago artificiale restituirebbe al paesaggio un elemento presente nei secoli passati e scomparso solo recentemente.

  3. Sightings of Delphinus delphis (Cetacea, Odontoceti in the Otranto Channel (Southern Adriatic Sea and Northern Ionian Sea / Avvistamenti di Delphinus delphis (Cetacea, Odontoceti nel Canale d'Otranto (Mar Adriatico Meridionale e Mar Ionio Settentrionale

    Directory of Open Access Journals (Sweden)

    Francesco Maria Angelici

    1992-07-01

    Full Text Available Abstract Two sightings of Common dolphin Delphinus delphis in the Channel of Otranto are reported, and the status of this species in the Mediterranean Sea is briefly discussed. Riassunto Sono riportati due avvistamenti di Delfino comune Delphinus delphis nel Canale d'Otranto, lungo la costa greca e quella italiana. Viene inoltre brevemente commentata la frequenza degli avvistamenti e degli spiaggiamenti di tale specie nel Mar Mediterraneo.

  4. Architecture of buried reverse fault zone in the sedimentary basin: A case study from the Hong-Che Fault Zone of the Junggar Basin

    Science.gov (United States)

    Liu, Yin; Wu, Kongyou; Wang, Xi; Liu, Bo; Guo, Jianxun; Du, Yannan

    2017-12-01

    It is widely accepted that the faults can act as the conduits or the barrier for oil and gas migration. Years of studies suggested that the internal architecture of a fault zone is complicated and composed of distinct components with different physical features, which can highly influence the migration of oil and gas along the fault. The field observation is the most useful methods of observing the fault zone architecture, however, in the petroleum exploration, what should be concerned is the buried faults in the sedimentary basin. Meanwhile, most of the studies put more attention on the strike-slip or normal faults, but the architecture of the reverse faults attracts less attention. In order to solve these questions, the Hong-Che Fault Zone in the northwest margin of the Junggar Basin, Xinjiang Province, is chosen for an example. Combining with the seismic data, well logs and drill core data, we put forward a comprehensive method to recognize the internal architectures of buried faults. High-precision seismic data reflect that the fault zone shows up as a disturbed seismic reflection belt. Four types of well logs, which are sensitive to the fractures, and a comprehensive discriminated parameter, named fault zone index are used in identifying the fault zone architecture. Drill core provides a direct way to identify different components of the fault zone, the fault core is composed of breccia, gouge, and serpentinized or foliated fault rocks and the damage zone develops multiphase of fractures, which are usually cemented. Based on the recognition results, we found that there is an obvious positive relationship between the width of the fault zone and the displacement, and the power-law relationship also exists between the width of the fault core and damage zone. The width of the damage zone in the hanging wall is not apparently larger than that in the footwall in the reverse fault, showing different characteristics with the normal fault. This study provides a

  5. [La combinazione di gemcitabina e oxaliplatino (GEMOX) nel trattamento del carcinoma pancreatico in fase avanzata di malattia: le notizie sulla mia morte sono state esagerate?

    Science.gov (United States)

    Giuliani, Jacopo; Bonetti, Andrea

    2017-12-01

    Riassunto. L'analisi è stata condotta al fine di valutare l'effetto sia sulla sopravvivenza globale (OS) sia sulla sopravvivenza libera da progressione di malattia (PFS) della chemioterapia di combinazione in prima linea per il carcinoma pancreatico in fase avanzata di malattia. La presente analisi è limitata agli studi randomizzati controllati (RCT) di fase III. Successivamente è stata applicata la European Society for Medical Oncology Magnitude of Clinical Benefit Scale (ESMO-MCBS) agli RCT di fase III analizzati per ricavare uno score relativo all'entità del beneficio clinico ottenuto per ciascun RCT. Sono state calcolate inoltre le differenze in termini di PFS tra i diversi bracci di trattamento rapportandole con i costi dei farmaci necessari per ottenere il beneficio di PFS. La nostra analisi ha valutato 11 RCT di fase III, per un totale di 4572 pazienti. Combinando i costi della terapia con la misura dell'efficacia espressa dalla PFS, è stato ottenuto un costo di 74,12 euro (€) per mese di vita guadagnato in termini di PFS con la combinazione di 5-fluorouracil, leucovorin, irinotecan e oxaliplatino (FOLFIRINOX), 90,14 € per la combinazione di gemcitabina e oxaliplatino (GEMOX) e 4708,7 € per la combinazione di nab-paclitaxel e gemcitabina. Da questo punto di vista riteniamo che l'utilizzo delle "vecche chemioterapie di combinazione" (per es., GEMOX) non dovrebbe essere completamente abbandonato, ma valutato sul singolo paziente, sulla base di diversi fattori (età, ECOG PS, comorbilità, carico di malattia), al fine di ottenere una reale "tailored therapy".

  6. Parassitosi intestinali umane nel Perugino nel corso del 2005

    Directory of Open Access Journals (Sweden)

    Maria Letizia D’Annibale

    2007-03-01

    Full Text Available During 2005 we analyzed stool specimens of 661 subjects, 221 children (1-16 years old and 440 adults, for O&P (direct and after formalin-etylacetate concentration microscopic observations, Giemsa and modified Ziehl- Neelsen permanent stains when requested. 13.8% of subjects were positive for parasitic infections (13.5% among children and 13.9% among adults. 8.8% of subjects are infected with pathogen parasites (7.2% among children and 9.6% among adults and 5.0% with not pathogens (6.3% and 4.3% respectively. Among pathogen parasites, in children G. duodenalis was observed in 4.1% of cases,D. fragilis in 0.5%, E. vermicularis in 0.9%, T. trichiura in 1.8%. Among adults, D. fragilis was observed in 5.2% of cases, G. duodenalis in 1.8%, Cryptosporidium spp. in 0.5%, E. vermicularis in 0.5%, T. trichiura in 0.7%, S. stercoralis in 0.7%, H. nana in 0.2%, T. saginata in 0.5%, S. mansoni in 0.5%.Among childrens, 76.7% of pathogen parasites were imported from developing countries, particularly G. duodenalis in adopted ones; instead, among adults, 83.6% of pathogens was observed in home/Italian people, particularly D. fragilis. Cellophane tape test was performed on 40 home children and E. vermicularis prevailed in 22%; modified Baermann method was performed on 42 old subjects and S. stercoralis rabdithoid larvae were observed in 7.1% (but the same ones of O&P.The Authors recommend the O&P in subjects with intestinal aspecific troubles, ipereosinophilia, or other justified situations, emphasizing the importance of a rational, good and responsible O&P and/or other techniques for intestinal parasitosis, because are present, even if not frequent, not only imported, particularly D. fragilis, but also helminths, and not only E. vermicularis.

  7. La fotografia tra lutto, riparazione e creatività

    Directory of Open Access Journals (Sweden)

    Stefano Ferrari

    2010-12-01

    Full Text Available In questo saggio vengono analizzati i molteplici processi psichici che caratterizzano la fotografia. Essa viene considerata sia nel suo statuto fondamentale e in particolare nel rapporto con il motivo della caducità e della morte (che sancisce dunque la sua stretta relazione con il tema del lutto, sia nelle dinamiche che riguardano la psicologia di chi fotografa e di chi viene fotografato. Nel primo caso prevalgono meccanismi di difesa: la fotografia è una modalità di controllo onnipotente sulla realtà, che viene resa inoffensiva attraverso un processo di oggettivazione e di addomesticamento. Non mancano qui implicazioni di carattere aggressivo e perverso, legate soprattutto a meccanismi di identificazione introiettiva. Nel secondo caso colui che viene fotografato subisce dunque una trasformazione da soggetto a oggetto: secondo le parole di Roland Barthes, egli vive “una microesperienza della morte” che dà luogo a evidenti effetti di “perturbante”. Nel testo vengono inoltre analizzati alcuni meccanismi di fruizione che intervengono quando si osservano le fotografie; ma in particolare vengono considerati i processi psichici che si attivano nel momento in cui il soggetto è indotto a scegliere una sua propria fotografia. Quest’ultimo aspetto fa già parte della psicologia dell’autoritratto fotografico, a cui viene dedicata l’ultima parte del saggio.

  8. Dose evaluation for workers employed in an industry involving enamel paints containing zirconium silicate; Valutazione di dose per i lavoratori occupati in una industria che utilizza vernici a smalto contenenti silicato di zirconio

    Energy Technology Data Exchange (ETDEWEB)

    Castellani, C.M.; Berico, M.; De Zaiacomo, T.; Formignani, M.; Ianni, A.; Nobili, C.; Sandri, S.; Vasselli, R. [ENEA, Centro Ricerche Ezio Clementel, Bologna (Italy). Dipt. Ambiente

    1999-07-01

    In the frame of the European Recommendations for radiological protection, an evaluation of the annual dose has been made for workers employed in an industry for the production of sanitary equipment involving the use of enamel paints containing zirconium silicate. [Italian] Nella prospettiva dell'applicazione della direttiva europea relativa alla protezione radiologica dei lavoratori, vengono presentati i risultati relativi alla valutazione di dose annuale complessiva per i lavoratori occupati in una industria per la produzione di articoli igienico-sanitari che utilizza vernici a smalto contenenti silicato di zirconio. Il fine e' la valutazione del problema radioprotezionistico per gli addetti a causa delle impurezza radioattive presenti nei materiali utlizzati.

  9. Illustrations to “Gespräche in dem Reiche derer Todten zwischen dem vortreflichen Moscowitischen Czaar Petro Magno und dem grossen Tyrannen Ivan Basilowiz II” (Peter the Great and Ivan the Terrible) by David Fassmann (1725)

    OpenAIRE

    Ekaterina A. Skvortcova

    2017-01-01

    The journal created by David Fassmann (1683–1744), Gespräche in dem Reiche derer Todten, edited in Leipzig, was a huge success. Each of the 240 issues presents a dialogue between two historical figures from the afterworld. In the 83rd–86th Entrevuë, the interlocutors are Peter the Great and Ivan the Terrible. The texts of the four conversations were thoroughly examined by Eckhard Matthes (1987). The present paper explores how the illustrations to the 83rd–86th Entrevuë visualize the texts, w...

  10. Il muro come galleria

    Directory of Open Access Journals (Sweden)

    Duccio Dogheria

    2008-06-01

    Full Text Available Il muro, nel suo grigio rigore formale, nella sua fredda geometria, nel suo intento divisorio, nasconde spesso il cielo. Sovente il linguaggio dell’arte, ma non di meno quello della comunicazione, hanno interferito con le sue algide barriere. In molti casi, beninteso, non è che il potere in altre forme, che interferisce con se stesso: pensiamo ai bandi affissi agli angoli delle città, o le lettere d’indulgenza papali -spesso impreziosite da miniature al punto da poterle considerare antenate dal manifesto- che nel corso del medioevo venivano affisse sulle porte delle chiese.

  11. La legge 154/2001 in tema di "Misure contro la violenza nelle relazioni familiari": cosa è cambiato nel nostro Paese dopo la sua entrata in vigore?

    Directory of Open Access Journals (Sweden)

    Susanna Vezzadini

    2007-09-01

    Full Text Available Domestic violence is a crime. All international and national studies on this subject have contributed to uncovering part of it, shedding light on a very serious and dramatic reality. For that reason, in April 2001, the Italian Parliament passed the law n. 154 concerning “Measures against domestic violence”, therefore affirming in by this act its will to respond to the problem. The law, which is considered an example of a “normative act against the blackmail of fear”, consists of a series of guide lines to prevent the offender from repeating the crime. In view of this, it is essential to find out today what has actually changed in Italy six years after its coming into force. La violence intrafamiliale est un délit. Les études réalisées à l'échelle internationale, tout comme les études nationales, ont ouvert une brèche sur cette réalité dont la gravité est déconcertante. Cependant le Parlement italien a approuvé en avril 2001, la loi relative aux "Mesures contre la violence dans la famille", affirmant ainsi sa volonté de répondre concrètement au problème de la violence domestique en Italie. Cette loi, présentée par les législateurs comme un example "d'acte normatif contre le chantage de la peur", contient une série de provisions destinées à empêcher à l'offenseur de réitérer son crime, introduisant des instruments procéduraux contre les abus intrafamiliaux. Face à de telles innovations, il est d'autant plus utile de continuer à se demander ce qui a changé en Italie, six ans après l'entrée en viguer de la loi.

  12. ‘Unkind and cruel, to deceive your Son | In borrow’d Shapes, and his Embrace to shun’: Mother-son love in T. S. Eliot’s ‘La Figlia Che Piange’

    Directory of Open Access Journals (Sweden)

    Matthew Geary

    2015-01-01

    Full Text Available T. S. Eliot's "La Figlia Che Piange" (1916 is a curious anomaly in his early works. It stands out as a love poem of outstanding grace portraying a more positive relationship to the feminine compared to other poems contemporaneous with its writing such as "The Love Song of St. Sebastian" (1914 and "Hysteria" (1915. This essay shows the import of Eliot's chosen epigraph for "La Figlia" taken from Virgil's Aeneid to have been largely neglected or misread by critics. As a consequence, it argues that critical readings have crucially missed the presence of a shrouded maternal aspect within the poem. Through the lens of Lacanian psychoanalysis and the work of adherents to Lacanian theory — such as Bruce Fink, Shoshana Felman and Slavoj Zizek — this paper newly argues that the poem's meditation on the issues of union and separation between two lovers is in fact a screen for deeper unconscious ambivalent feelings between mother and son. That is to say, Eliot's "La Figlia Che Piange" shows a failed attempt to reconstruct, traverse and separate from the "fundamental fantasy" unconsciously orientating the male speaker of the poem and his desire.

  13. L’importanza dello studio delle emozioni nel dibattito criminologico / L’importance de l’étude des émotions dans le débat criminologique / The importance of studying the emotions in criminology

    Directory of Open Access Journals (Sweden)

    Bisi R.

    2017-12-01

    Full Text Available L’articolo, muovendo dalla constatazione che ogni atto o reazione deve sempre essere considerato come il prodotto di un incontro, di un coagire di due fattori, vale a dire la situazione che fa da stimolo, da un lato, e la personalità che fa da matrice della reazione, dall’altro, affronta, sulla scorta di riflessioni legate alla presentazione di alcuni casi peritali, il tema della necessità di una più attenta considerazione della dimensione emozionale al fine di instaurare entro le scienze criminologiche un più proficuo e, paradossalmente, più razionale dibattito su crimine e giustizia. L’auteur réfléchit au problème lié au fait que toute action ou réaction doit être considérée comme le produit d’une relation entre deux facteurs : d’un côté, la situation qui favorise l’action et de l’autre, la personnalité qui est à la base de la réaction. Par conséquent, par le biais de rapports d’expertise, l’auteur souligne la nécessité d’accorder davantage d’attention à la dimension émotionnelle, afin d’instaurer, dans les sciences criminologiques, un débat plus fructueux et, paradoxalement, plus rationnel sur crime et justice. The author reflects on the problem that every action or reaction has to be considered the product of a relationship between two elements: the situation that acts as a stimulus, on the one hand, and the personality as the reaction’s core (matrix, on the other. Keeping in mind some psychiatrist's reports, the author points out the urgence to pay more attention on the emotional dimension in order to keep alive into criminological sciences a more fruitful and paradoxically more rational discussion on crime and justice.

  14. Ricostruire le risorse locali per competere nel turismo. Alcune evidenze dal caso di Sextantio Hotel / The rediscovery of local assets for tourism competition. Some evidence from the case of Sextantio Hotel

    Directory of Open Access Journals (Sweden)

    Ornella Papaluca

    2016-06-01

    Full Text Available In questo paper si vuole mostrare come un prodotto turistico non mainstream possa portare alla “riscoperta” di risorse, tradizioni e conoscenze caratteristiche di un’area locale quando si coinvolgano attori all’esterno del comparto turistico. La ricerca si avvale del metodo del case study con lo scopo di illustrare le modalità con cui si è avviato un progetto imprenditoriale che ha portato ad un processo di sviluppo sostenibile. Il lavoro non si focalizza sui risultati economici, ma indaga le motivazioni e le modalità che hanno portato allo sviluppo del progetto imprenditoriale. Il processo di ricerca ha mostrato come un progetto imprenditoriale, in seguito premiato dall’Unione Europea, possa generare benefici per il borgo, come agglomerato urbano, e per la valorizzazione delle sue specifiche risorse culturali quando esso sia strutturato in modo da trarre vantaggio dalla valorizzazione degli elementi di autenticità. Il caso, che rappresenta chiaramente una best practice, mostra una possibile modalità di utilizzare lo stesso processo di avvio come modalità per sostenere economicamente il restauro dei borghi minori. Il caso ha evidenti implicazioni sia per la pubblica amministrazione che per il privato. In this paper we have shown that a no mainstream tourism product can lead to “rediscover” the local area’s typical resources, traditions and knowledge when the entrepreneur engages players outside the tourism industry. In this research we have used the case study methodology to show how an entrepreneurial project has led to a sustainable development process. This work does not focus on the economic results of the enterprise but on the motivations and on the choices that have led to its specific design. The research process shows that an entrepreneurial project, that has been awarded by a European Union Commission, can have positive effects on the village, as a human settlement, and it can appreciate village-specific cultural

  15. 10 volti per la Liberazione. Una mostra per le strade della città

    Directory of Open Access Journals (Sweden)

    Margherita Becchetti

    2013-09-01

    Full Text Available Nel saggio si dà conto delle vicende che hanno segnato “10 volti per la Liberazione”, mostra diffusa nelle strade di Parma, allestita in occasione del 25 aprile 2013 dal Centro studi movimenti con sagome a grandezza naturale di alcuni protagonisti della lotta partigiana. L’autrice affronta i problemi incontrati nel corso dell’allestimento e le reazioni che l’iniziativa ha suscitato, elementi che investono direttamente la riflessione storiografica avendo a che vedere con l’uso pubblico della storia, con il rapporto tra memoria pubblica e privata e con il ruolo rivestito dagli storici nella costruzione della memoria collettiva.

  16. Genesis and classification of the soils developed from the sediments of the former Oleszek mill pond basin (the Chełmińskie Lakeland, N Poland / Geneza i pozycja systematyczna gleb wykształconych z osadów niecki dawnego stawu młyńskiego Oleszek (Pojezierze Chełmińskie

    Directory of Open Access Journals (Sweden)

    Mendyk Łukasz

    2015-03-01

    Full Text Available Budowa i funkcjonowanie młynów wodnych znacznie wpłynęły na przekształcenie środowiska przyrodniczego w ich otoczeniu, przede wszystkim na zmiany rzeźby terenu i warunków wodnych. Obszar badañ obejmuje nieckę dawnego stawu młyńskiego Oleszek w okolicach wsi Borówno, w zachodniej części Pojezierza Chełmińskiego, około 20 km na północny wschód od Torunia. Celem badañ było określenie genezy gleb wykształconych z osadów zakumulowanych w niecce dawnego stawu młyńskiego Oleszek. Pięć profili glebowych w transekcie o długości około 550 m zlokalizowanym wzdłuż Strugi Rychnowskiej stanowiącej oś podłużną niecki. Wszystkie przeanalizowane gleby zbudowane są z osadów wypełniających nieckę dawnego stawu młyńskiego. Gleby w opisywanej niecce powstały w wyniku wielu nakładających się procesów, takich jak: proces mułotwórczy, aluwialny, koluwialny oraz glejowy. Dwa z analizowanych profili glebowych (profile 3 i 4 spełniaj¹ kryteria wydzielania gleb organicznych limnowych typowych (Systematyka gleb Polski 2011. Jako pozycję systematyczną kolejnych dwóch gleb (profile 2 i 5 zaproponowano gleby mułowate. W związku z problemami klasyfikacyjnymi dotyczącymi tego typu gleb, przy opracowaniu aktualizacji Systematyki gleb Polski należałoby wprowadzić w typie gleb glejowych podtyp gleb mułowatych lub mułowato-glejowych, obejmuj¹cy gleby wytworzone z mineralno-organicznych utworów aluwialno-mułowych. Cztery wymienione powyżej profile zostały zaklasyfikowane jako Histosols (3 i 4 i Gleysols (2 i 5 według klasyfikacji WRB (2014. Jednostki glebowe wykształcone z osadów aluwialnych (mady wg SgP 2011 lub Fluvic Phaeozems wg WRB 2014 występują w proksymalnej części stawu (cofce.

  17. Mass torts e responsabilità per danno ambientale: una analisi economica

    NARCIS (Netherlands)

    Parisi, F.; Dari-Mattiacci, G.

    2009-01-01

    Nel presente studio verranno esaminate alcune delle problematiche giuridiche e delle categorie economiche introdotte dalla nuova normativa europea in tema di danno ambientale. Le nostre argomentazioni tenderanno a dimostrare che le ipotesi di danno ambientale caratterizzabili come mass torts non

  18. Victims of Occupational Injuries: A Comparison between Migrants and Italians. Results of a survey conducted in Trentino in 2009 / Vittime di infortunio sul lavoro : una comparazione tra italiani e stranieri. Risultati di una ricerca condotta in Trentino nel 2009 / Victimes d’accidents du travail: une comparaison entre travailleurs immigrés et italiens. Résultats d’une enquête conduite en 2009 en Trentin

    Directory of Open Access Journals (Sweden)

    Martinello Daniela

    2011-07-01

    analisi statistica, quali fattori possono aiutare a spiegare la maggiore vittimizzazione degli stranieri. Il presente saggio risponderà alle seguenti domande: Chi è la vittima? Con che frequenza è stata vittimizzata? Qual è la gravità degli infortuni subiti? Quale la tendenza alla non denuncia? Quali le caratteristiche personali (età, genere, ecc. della vittima? E la sua storia professionale? Quali le caratteristiche dell’azienda in cui lavora e il livello di conformità alle norme sulla Salute e Sicurezza nell’azienda stessa? Infine, sono presentati i fattori che possono aiutare a spiegare la maggiore vittimizzazione degli stranieri nel fenomeno e sono indicate alcune possibili direzioni di azione per contrastare la problematica degli infortuni sul lavoro. Cet article attire l’attention sur les victimes d’accidents du travail et, de manière plus spécifique, sur les différences entre travailleurs italiens et immigrés. Une enquête de terrain a été conduite dans la région du Trentin : un questionnaire a été soumis à deux groupes de victimes d’accidents du travail, l'un composé de travailleurs italiens (300 répondants et l'autre d’immigrés (200 répondants. Cette étude a permis d'atteindre les objectifs suivants : vérifier si les travailleurs étrangers sont plus vulnérables aux accidents du travail que les italiens ; décrire le profil des victimes d’accidents du travail (aussi bien italiennes qu’immigrantes ; à travers l'analyse statistique, identifier les facteurs qui peuvent contribuer à expliquer la plus haute proportion de victimes parmi les immigrés.Ensuite, cet article s’attache à répondre aux questions suivantes : Qui est la victime ? Combien de fois est-elle victime ? Quelle est la gravité des accidents subis ? Qu'en est-il de la propension des victimes à ne pas porter plainte ? Quelles sont les caractéristiques personnelles (âge, genre, etc. et l’histoire professionnelle de la victime ? Quelles sont les caractéristiques de

  19. Viva il GIS Day!

    Directory of Open Access Journals (Sweden)

    Redazione Redazione

    2007-03-01

    Full Text Available Il GIS Day è sponsorizzato oltre che da ESRI, dalla National Geographic Society, dalla Association of American Geographers, dalla UCGIS (University Consortium for Geographic Information Science, dalla United States Geological Survey e dalla Library of Congress. Il tutto nasce nel corso della Geography Awareness Week, terza settimana di novembre che nel 1987 il Presidente degli Stati Uniti Ronald Reagan stabilì dovesse essere dedicata alla diffusione della cultura geografica.

  20. Alle origini della conservazione del paesaggio in Belgio: il contributo originale di Louis Van der Swaelmen

    OpenAIRE

    Rapalo, Maria Chiara

    2017-01-01

    La ricerca che si propone si inserisce nell’ambito di alcuni studi condotti nel quadro di una collaborazione Italia-Belgio sulle tematiche della conservazione e tutela dei beni architettonici e del paesaggio, collegate e talvolta intrecciate a quelle dell’urbanistica. Essa nasce dall’esigenza di comprendere gli interessanti e meno approfonditi contributi che, in ambito belga, hanno concorso al delinearsi delle attuali linee di orientamento internazionale nel campo della conservazione e della ...

  1. Flora and vegetation of Rio Torto area in Brasimone ENEA Centre, Bologna; Flora e vegetazione dell'area Rio Torto nel centro ENEA del Brasimone, Bologna

    Energy Technology Data Exchange (ETDEWEB)

    De Mei, M.; Varriale, A. [ENEA, Centro Ricerche Casaccia, Rome (Italy). Dipt. Ambiente

    1999-07-01

    of degradation of this vegetation: it's due, above all, to the intense sylviculture practised in the area and to the severe climatic conditions. Although the human intervention on the wood coming down, effects are still visible and represented by a not easy to classify vegetational disorder. Beechwood has been cutting periodically for a long time, causing a complex structural situation; in fact, seedlings and tillers have different diameters but similar height. Both analysis of flora and vegetational and phytosociological study represent respectively a qualitative and qualitative-quantitative approach for vegetational valuation. [Italian] L'are Rio Torto, situata sul versante settentrionale dell'Appennino tosco-emiliano nella proprieta' del C.R. Enea Brasimone, e' stata oggetto di uno studio floristico e vegetazionale al fine di delineare le condizioni della copertura vegetale e di valutare le variazioni delle caratteristiche del popolamento vegetazionale. Per lo studio della vegetazione e' stato adottato il metodo di Brau-Blanquet, basato sull'accurata analisi della flora e sul campionamento statistico. L'elaborazione dei rilievi e' stata realizzata con il software SYN-TAX. Il faggio e' la specie dominante dell'area; al margine inferiore della faggeta sono ben rappresentati gli elementi dell'associazione Arrhenatheretalia mentre al margine superiore si estende una ampia radura caratterizzata da Pteridium aquilinum, da Prunus spinosa e da Crataegus monogyna. Il sottobosco erbaceo si presenta discretamente ricco dal punto di vista fisionomico-strutturale e dominato da elementi euroasiatici e boreali. Lo spettro biologico che ne deriva indica un valore alto per le emicriptofite e questo e' da considerare un indice di stress. I risultati ottenuti dall'indagine vegetazionale e fitosociologica hanno permesso di inquadrare i popolamenti di faggio nell'Ordine Fagetalia e nell

  2. Flora and vegetation of Rio Torto area in Brasimone ENEA Centre, Bologna; Flora e vegetazione dell'area Rio Torto nel centro ENEA del Brasimone, Bologna

    Energy Technology Data Exchange (ETDEWEB)

    De Mei, M; Varriale, A [ENEA, Centro Ricerche Casaccia, Rome (Italy). Dipt. Ambiente

    1999-07-01

    degradation of this vegetation: it's due, above all, to the intense sylviculture practised in the area and to the severe climatic conditions. Although the human intervention on the wood coming down, effects are still visible and represented by a not easy to classify vegetational disorder. Beechwood has been cutting periodically for a long time, causing a complex structural situation; in fact, seedlings and tillers have different diameters but similar height. Both analysis of flora and vegetational and phytosociological study represent respectively a qualitative and qualitative-quantitative approach for vegetational valuation. [Italian] L'are Rio Torto, situata sul versante settentrionale dell'Appennino tosco-emiliano nella proprieta' del C.R. Enea Brasimone, e' stata oggetto di uno studio floristico e vegetazionale al fine di delineare le condizioni della copertura vegetale e di valutare le variazioni delle caratteristiche del popolamento vegetazionale. Per lo studio della vegetazione e' stato adottato il metodo di Brau-Blanquet, basato sull'accurata analisi della flora e sul campionamento statistico. L'elaborazione dei rilievi e' stata realizzata con il software SYN-TAX. Il faggio e' la specie dominante dell'area; al margine inferiore della faggeta sono ben rappresentati gli elementi dell'associazione Arrhenatheretalia mentre al margine superiore si estende una ampia radura caratterizzata da Pteridium aquilinum, da Prunus spinosa e da Crataegus monogyna. Il sottobosco erbaceo si presenta discretamente ricco dal punto di vista fisionomico-strutturale e dominato da elementi euroasiatici e boreali. Lo spettro biologico che ne deriva indica un valore alto per le emicriptofite e questo e' da considerare un indice di stress. I risultati ottenuti dall'indagine vegetazionale e fitosociologica hanno permesso di inquadrare i popolamenti di faggio nell'Ordine Fagetalia e nell'alleanza Fagionsylvaticae medioeuropeo. Nessuna particolare associazione e' stata identificata all'interno dell

  3. Radioactive investigation in an industrial plant of Ascoli Piceno which makes use of graphite scraps; Indagine radiometrica in un insediamento produttivo di Ascoli Piceno che utilizza rottami di grafite

    Energy Technology Data Exchange (ETDEWEB)

    Di Ciaccio, P.; Grisanti, F.; Sabatini, F. [Istituto Superiore di Sanita' , Working Group on Radioactive Contamination of Graphite Samples, Rome (Italy)

    2001-07-01

    In 1997 a radiological alarm originated in an Italian industrial plant in Ascoli Piceno. This fact required to investigate a peculiar case of a possible radioactive contamination in a working environment up to its solution. A working group made of experts of various Institutes and Organisations, after an analysis of the situation, carried out an experimental study and drew some scientific and radiation protection conclusions. This report contains a review of the work performed by the working group and a summary of the radiation protection intervention at the plant. [Italian] L'allarme radiologico creatosi nel 1997 in un insediamento produttivo di Ascoli Piceno ha portato all'esame ed alla soluzione di un singolare evento di possibile contaminazione di un ambiente di lavoro industriale. Il rapporto riporta il resoconto degli interventi di radioprotezione operativa eseguiti presso l'insediamento, l'analisi del problema e lo studio sperimentale eseguiti da un gruppo di lavoro creato fra varie istituzioni e alcune conclusioni scientifiche e radioprotezionistiche del gruppo stesso.

  4. Idraulica dei sistemi fognari dalla teoria alla pratica

    CERN Document Server

    Gisonni, Corrado

    2012-01-01

    La progettazione dei sistemi fognari e dei manufatti in essi presenti richiede un’attenta conoscenza delle leggi che regolano i fenomeni idraulici, con particolare riferimento alle correnti idriche a superficie libera. Partendo dalle nozioni fondamentali dell’Idraulica, il testo intende colmare alcune importanti lacune che ancora caratterizzano la letteratura italiana nel settore e che spesso sono alla base di errori progettuali, con ovvie conseguenze sulla sicurezza dei centri abitati (come testimoniato dai frequenti fenomeni di allagamento che sono stati registrati negli ultimi anni). Il libro è rivolto agli allievi dei corsi di studio nel settore dell’ingegneria Civile ed Ambientale. Particolare interesse è rivolto ai professionisti operanti nel settore della ingegneria idraulica e della pianificazione urbana, per i quali è forte l’esigenza di testi che contengano indicazioni di carattere sia teorico sia pratico, finalizzate alla progettazione di sistemi di drenaggio nei centri abitati.

  5. Testimonianze di vittime degli anni di piombo

    DEFF Research Database (Denmark)

    Cecchini, Leonardo

    Testimonianze di vittime degli anni di piombo In un articolo pubblicato nel 2008 sulla webzine Nazione indiana Christian Raimo criticava quello che poi Giovanni De Luna qualche anno dopo nel suo libro La Repubblica del dolore (2011) ha chiamato “paradigma vittimario”; cioè la presenza predominante...

  6. Il piu grande centro europeo di ricerca oggi festeggia l'anniversario del Nobel di Rubbia e Van der Meer. Cern, vent'anni guardando al futuro Ora la sfida si gioca sull'acceleratore di particelle pronto per il 2007, che provera a svelare i segreti della materia

    CERN Multimedia

    Durante, E

    2003-01-01

    "CERN, vent'anni guardando al futuro Ora la sfida si gioca sull'acceleratore di particelle pronto per il 2007, che provera a svelare i segreti della materia" [CERN, twenty years of looking towards the future. The present challenge is the particle accelerator that will be ready in 2007, which will try to reveal the secrets of matter] (2 pages)

  7. Due testimonianze di Josip Vaništa

    Directory of Open Access Journals (Sweden)

    Radmila Iva Janković

    2013-12-01

    Full Text Available Radmila Iva Janković ha intervistato nel luglio 2013 Josip Vaništa, artista che aveva partecipato al gruppo Gorgona e preso parte alla residenza d'artista a Brunnenburg nel 1991, organizzata da Francesco Conz con l'obiettivo di includere il gruppo di artisti nel progetto La Livre, una monumentale edizione d'artista dedicata a Ezra Pound.

  8. Pauropolis. Pianificare il controllo attraverso il progetto della sicurezza.

    OpenAIRE

    Ragonese, Marco

    2008-01-01

    2006/2007 “Il grado di sicurezza misura la democrazia di un paese”, con questa frase un esponente della destra salutava l’approvazione nel parlamento italiano del nuovo pacchetto di norme in tema, appunto, di sicurezza. L’affermazione indica sintomaticamente come la questione, seppur non nuova, abbia acquisito un ruolo centrale nel dibattito contemporaneo, facilitata da una perfusione mediatica che ha trasformato l’evento dei primi giorni del settembre 2001 nel simbolo controverso della cr...

  9. Quaderni di filologia e lingue romanze 7 (1992, Supplemento Terza serie, Attidel Convegno "Relazione di viaggi fra Italia e Spagna" Macerata, Università degli Studi, 15-17 dicembre 1992, 259 pp.; 8(1993, 273 pp.; 9(1994, 285 pp.; 10(1995, 346 pp.

    Directory of Open Access Journals (Sweden)

    Pavao Tekavčić

    1996-12-01

    Full Text Available Il periodico maceratese, nato nel 1979, continua ad apparire a ritmo annuale re­ golare. Avendo recensito i voll. 1985-1992 nel numero 34 di «Linguistica», presen­ tiamo qui le annate citate nel titolo, concentrandoci sempre sui contributi di interesse linguistico (o almeno filologico, che continuano ad essere in minoranza di fronte a quelli di argomento letterario.

  10. The environmental performance indicators in the sector of tourist services. The case of study about an international hotel group; Indicatori di performance ambientale nel settore dei servizi turistici. Il caso di studio di una catena alberghiera internazionale

    Energy Technology Data Exchange (ETDEWEB)

    Andriola, L. [ENEA, Divisione Caratterizzazione dell' Ambiente e del Territorio, Centro Ricerche Casaccia, Rome (Italy); Seminara, M.V.

    2001-07-01

    The environmental performance indicators in the tourism sector represents the necessary element to quantify and to simplify information about the environmental performance of a particular field in order to make the comprehension of the interactions between tourist activities and environment understood by the customers and decision makers. This indicators will have to be quantified in order to contribute to focus and explain improvements in environmental management. One of the most important elements to pursue a Sustainable Development is the definition of a series of the right indicators. Basically performance indicators can be applied in the environmental analyses effected for defining the politics of management of tourist development and, particularly, in the procedures of Environmental Impact Assessment and Strategic Environmental Assessment disciplined by the European Directives 85/337/CEE, 97/11/CE, from the proposal of Directive on the SEA and from the relative national normative. This tools should allow to esteem environment conditions and the impacts caused by the tourist activities to find actions to balance the budget between the economic development and the social and environmental issues in a determined territorial context. [Italian] Gli indicatori di performance ambientale applicati settore del turismo costituiscono l'elemento necessario per quantificare e semplificare le informazioni sulle prestazioni ambientali del settore preso in considerazione, in modo da agevolare, sia da parte dei responsabili delle decisioni, sia da parte del pubblico e dei clienti, la comprensione delle interazioni tra le attivita' turistiche e l'ambiente e le relative criticita'. Tali indicatori dovranno essere quantificati per contribuire ad individuare e a spiegare i miglioramenti ottenuti nel tempo. La definizione di un quadro di indicatori adeguato costituisce pertanto uno degli elementi essenziali per il raggiungimento di uno Sviluppo Sostenibile. In

  11. The environmental performance indicators in the sector of tourist services. The case of study about an international hotel group; Indicatori di performance ambientale nel settore dei servizi turistici. Il caso di studio di una catena alberghiera internazionale

    Energy Technology Data Exchange (ETDEWEB)

    Andriola, L. [ENEA, Div. Caratterizzazione dell' Ambiente e del Territorio, Centro Ricerche Casaccia, Rome (Italy); Seminara, M.V.

    2000-07-01

    The environmental performance indicators in the tourism sector represents the necessary element to quantify and to simplify information about the environmental performance of a particular field in order to make the comprehension of the interactions between tourist activities and environment understood by the customers and decision makers. This indicators will have to be quantified in order to contribute to focus and explain improvements in environmental management. One of the most important elements to pursue a Sustainable Development is the definition of a series of the right indicators. Basically performance indicators can be applied in the environmental analyses effected for defining the politics of management of tourist development and, particularly, in the procedures of Environmental Impact Assessment and Strategic Environmental Assessment disciplined by the European Directives 85/337/CEE, 97/11/CEE, from the proposal of Directive on the SEA and from the relative national normative. This tools should allow to esteem environmental conditions and the impacts caused by the tourist activities to find actions to balance the budget between the economic development and the social and environmental issues i a determined territorial context. [Italian] Gli indicatori di performance ambientale applicati al settore del turismo costituiscono l'elemento necessario per quantificare e semplificare le informazioni sulle prestazioni ambientali del settore preso in considerazione, in modo da agevolare, sia da parte dei responsabili delle decisioni, sia da parte del pubblico e dei clienti, la comprensione delle interazioni tra le attivita' turistiche e l'ambiente e le relative criticita'. Tali indicatori dovranno essere quantificati per contribuire ad individuare e a spiegare i miglioramenti ottenuti nel tempo. La definizione di un quadro di indicatori adeguato costituisce pertanto uno degli elementi essenziali per il raggiungimento di uno Sviluppo Sostenibile

  12. “fra questi sí e no son di parer contrario”: affermazione di sé e nome ...

    African Journals Online (AJOL)

    User

    Figurarsi! So bene che nel riparto dei doni della Provvidenza, l'intelligenza è toccata tutta a loro.13. Ricordando la "massima d'oro" che impone alle donne il silenzio. ("Mal sont les gens endoctrinés/ Quand par femme sont sermonnés"), afferma di essersela "mandata a memoria religiosamente" e di averla tenuta nella sua ...

  13. Gödel, Escher, Bach un'eterna ghirlanda brillante : una fuga metaforica su menti e macchine nello spirito di Lewis Carroll

    CERN Document Server

    Hofstadter, Douglas R

    1984-01-01

    Il libro che ha svelato a una immensa quantità di lettori, in tutto il mondo, gli incanti e le trappole di un’Eterna Ghirlanda Brillante i cui fili si chiamano intelligenza artificiale, macchina di Turing, teorema di Gödel. Una «fuga metaforica» nel variegato mondo che si dispiega fra la mente, il cervello e i computer

  14. Serre fotovoltaiche Attenti alle perdite; Stanghellini: il calo produttivo non è da poco

    NARCIS (Netherlands)

    Contri, L.; Stanghellini, C.

    2010-01-01

    Gli installatori di pannelli fotovoltaici hanno nel mirino gli ortoflorovivaisti che gestiscono serre. Costoro, per contro, sono alla ricerca di sistemi atti a far loro recuperare la marginalità perduta in questi anni di crisi. Un matrimonio che s'ha da fare? Meglio di no. A sconsigliarlo è Cecilia

  15. Antonio Catalfamo, Frammenti di memoria. Nicola Teti Editore ...

    African Journals Online (AJOL)

    User

    altro canto, c'è da chiedersi se la stessa affermazione non trovi una sua giustificazione davanti alle deformità sociali del mondo moderno. Si pensi a ciò che significa vivere nel presente nell'ambito di un consumismo che tutto ingoia e per cui ...

  16. L'ULTIMA GIANNA MANZINI

    African Journals Online (AJOL)

    User

    Manzini) la narratrice è in grado di ritrovare e riscoprire situazioni passate che potrebbero apparire banali, senonché, proprio come in Ritratto in piedi, assumono adesso una diversa consistenza, percepite cioè nel loro reale valore sentimentale e spirituale7. Non dimentichiamo, poi, che questo è l'ultimo libro di Gianna.

  17. Analyse de l’effet du type de tâche sur l’évolution des connaissances à la suite d’un processus d’apprentissage collaboratif

    Directory of Open Access Journals (Sweden)

    Sabine Pohl

    2009-04-01

    Full Text Available L’article analyse l’effet du type de tâche sur le partage des connaissances à la suite d’un processus d’interaction dans un contexte d’apprentissage collaboratif. Cet apprentissage collaboratif est réalisé dans le cadre d’une formation universitaire. Deux types de tâches sont réalisés par les apprenants. Ils se distinguent selon que la solution nécessite ou non la confrontation de points de vue portant sur le champ conceptuel lié à l’apprentissage à réaliser. La méthode de collecte des données consiste en un entretien semi-directif. Les résultats montrent un effet du type de tâches sur l’évolution des connaissances partagées des apprenants.This longitudinal research analyses the effect of the type of task on the development of knowledge following an interaction process in a collaborative learning context. The framework for this collaborative learning is a university education. Two types of tasks are provided to the learners. They differ depending on whether or not the solution requires the comparison of points of view on the conceptual scope of what is to be learned. The data are collected through a semi-directive interview. The results show that the type of task has an effect on the development of shared knowledge.

  18. William Franke, Sulla verità poetica che è superiore alla Storia: Porfirio e la critica filosofica della letteratura William Franke, On the Poetic Truth that is Higher than History: Porphyry and the Philosophical Interpretation of Literature

    Directory of Open Access Journals (Sweden)

    Laura Lucia Rossi

    2010-06-01

    Full Text Available

    In this article we propose the translation of William Franke’s paper On the Poetic Truth that is Higher than History: Porphyry and the Philosophical Criticism of Literature, in which the American scholar presents the hermeneutic method of the ancient commentators of Homer, with particular reference to the critic practice applied by the Neoplatonic Porphyry in his De Antro Nympharum. With this treatment Franke proposes and hopes for the return to an interpretive method, called philosophical or speculative, also for contemporary criticism.

    In questo articolo è presentata la traduzione del saggio di William Franke Sulla verità poetica che è superiore alla Storia: Porfirio e la critica filosofica della letteratura, in cui lo studioso americano presenta il metodo ermeneutico degli antichi commentatori di Omero, con particolare riferimento alla critica praticata dal neoplatonico Porfirio, proponendo e auspicando il ritorno ad una modalità interpretativa, detta filosofica o speculativa, anche per la critica contemporanea.

  19. From petroleum to natural gas. New assets in electric power industry; Dal petrolio al gas naturale. Nuovi assetti e linee di sviluppo nel settore dell'energia elettrica

    Energy Technology Data Exchange (ETDEWEB)

    Velona' , F. [Bari Politecnico, Bari (Italy). Centrali Termiche della Facolta' di Ingegneria

    2002-02-01

    Luigi Einaudi Foundation Group organized on November 5th 2001 a roundtable on the theme: Energy in Italy, how to change for surviving. In the congress hall in the National Federation of Italian Press, Valerio Zanone, the president, and other important persons such as Jan Keppler (Associazione Italiana Editori), Edgardo Curcio (Associazione Italiana Economisti dell'Energia), Emilio Gerelli (Pavia University) and Franco Velona' (Bari Politecnico) presented their relations on the theme of competitivity in the italian energy system, on the environmental compatibility and on the diversification sources from petroleum. Among the most interesting ones were those by ing. Machi', president of Gestore Rete Trasmissione Nazionale, by ing. Clavarino, president of Assocarboni, and by ing. Serena, president of Sondel. It seemed that the dialogue between the academies and the production system was taken again successfully. [Italian] La fondazione Luigi Einaudi ha organizzato il 5 novembre 2001 una giornata di studio sul tema L'Energia in Italia, Cambiare per sopravvivere. Nella bella sala convegni della Federazione nazionale della stampa italiana in Roma si sono succeduti dopo l'introduzione del Presidente della Federazione, Valerio Zanone, Jan Keppler dell'AIE, Edgardo Curcio dell'AIEE, Emilio Gerelli dell'Universita' di Pavia e Franco Velona' del Politecnico di Bari, che hanno introdotto le discussioni sulla competitivita' del sistema energetico italiano, sulla compatibilita' ambientale sulla diversificazione dal petrolio. Fra i numerosi interventi, di particolare importanza sono stati quelli dell'in. S. Machi', presidente del Grtn, dell'ing. Clavarino, presidente dell'Assocarboni, dell'ing. Serena della Sondel. Ha concluso i lavori Marcello Inghilesi, che ha ripreso i punti di vista piu' salienti espressi dalle aziende, dai ministeri e dalle associazioni ambientaliste, Il dialogo tra

  20. Servizi finanziari imputati e interdipendenze settoriali: un'analisi settoriale del ruolo del credito nel sistema economico. (Imputed bank services and sectoral interdependences: a structural analysis of the role of credit in the economy

    Directory of Open Access Journals (Sweden)

    C. BIANCHI

    2013-12-01

    Full Text Available I sistemi di contabilità nazionale in base alla metodologia SEC sono soliti comportarsi in modo da garantire l'impossibilità pratica di effettuare qualsiasi assegnazione significativa di servizi bancari imputati tra i singoli rami di attività economica.  Il presente lavoro mostra come questo vieta l'analisi strutturale del ruolo del credito nel sistema di interdipendenze. . L'analisi mette in evidenza la duplice natura del credito come contenuti a valore aggiunto altamente intermedio e alto. È in grado di influenzare forte su i costi di produzione degli altri rami, senza essere influenzato da loro. Queste proprietà conferiscono al settore bancario un potenziale molto elevato per l'inflazione.National accounts systems based on the SEC methodology are usually thought to comport the practical impossibility of carrying out any meaningful allocation of imputed bank services among the single branches of economic activity. As a consequence, the total value of the net interest earned by the credit system as a whole is considered as a cost entry and a negative component of added value in an ad-hoc additional industry, to be aggregated to the main credit one in the typical input-output analysis. The present work shows how this prohibits the structural analysis of the role of credit in the system of interdependencies. A method of is proposed in which imputed services of credit are distributed by branches, on the basis of existing statistics, proving valuable in assessing the significance of certain quantities of national accounts, such as operating results. The analysis highlights the dual nature of credit as highly intermediate and high value-added content. It is able to strongly influence the production costs of the other branches, without being influenced by them. These properties give the banking industry a very high potential for inflation. JEL: E51, G21

  1. Pubblica Amministrazione Direttore e Geomatica

    Directory of Open Access Journals (Sweden)

    Renzo Carlucci

    2007-03-01

    Full Text Available Topografo, rilevatore, fotogrammetrista, foto interprete, cartografo e non solo. Questi ed altri sono gli appellativi di specializzazioni e competenze professionali che ricadono nel campo della Geomatica il cui percorso formativo però, in Italia, non è ben chiaro. Si segue un corso da Geometra? Oppure una Laurea in Ingegneria e poi si segue un Master specialistico? E quali di questi corsi danno accesso a quella professione che nei termini anglosassoni viene identificata con la parola Surveyor? Domande che trovano difficile risposta nel quadro formativo attuale.

  2. Pubblica Amministrazione e Geomatica

    Directory of Open Access Journals (Sweden)

    Renzo Carlucci

    2007-03-01

    Full Text Available Topografo, rilevatore, fotogrammetrista, foto interprete, cartografo e non solo. Questi ed altri sono gli appellativi di specializzazioni e competenze professionali che ricadono nel campo della Geomatica il cui percorso formativo però, in Italia, non è ben chiaro. Si segue un corso da Geometra? Oppure una Laurea in Ingegneria e poi si segue un Master specialistico? E quali di questi corsi danno accesso a quella professione che nei termini anglosassoni viene identificata con la parola Surveyor? Domande che trovano difficile risposta nel quadro formativo attuale.

  3. DALL’«ARTICOLO EPR» AGLI ESPERIMENTI DI ALAIN ASPECT: IL LUNGO CAMMINO DEL PROBLEMA DELLA NONLOCALITÀ IN MECCANICA QUANTISTICA

    OpenAIRE

    Matarese, Vera

    2014-01-01

    Quando, nel 1935, venne pubblicato il famoso articolo chiamato poi “EPR Paper” per le iniziali dei suoi autori - Einstein, Podolsky, Rosen -, la comunità scientifica dovette confrontarsi non solo con le manifeste provocazioni che il suo argomento voleva mostrare, ma anche con latenti problemi che sarebbero sbocciati più avanti in tutti i loro stridenti contrasti. L’incompletezza della meccanica quantistica, che l’“articolo EPR” si proponeva di dimostrare, poggiava infatti su un principio molt...

  4. La figura di Maria Maddalena nella tradizione agostiniana del XII secolo e l'allegoria nuziale in Bernardo di ClairvauxUn'ipotesi di interpretazione alla luce di categorie di ordine psicoanalitico

    Directory of Open Access Journals (Sweden)

    Elena Cartotto

    2008-07-01

    La lettura viene condotta sulla base di categorie concettuali di carattere psicoanalitico, in quanto tali categorie trovano la propria origine, prima ancora che nel pensiero, nella più concreta e profonda esperienza umana. Ed è proprio il collocarsi all'interno di questa viva esperienza umana che consente di cogliere in modo più diretto la dimensione antropologica che pare emergere dagli scrittori monastici di questo periodo.

  5. Pencil and mouse. Drawing in the digital era

    Directory of Open Access Journals (Sweden)

    Giovanni Federle

    2010-12-01

    Full Text Available In questo contributo si considera il ruolo che ha oggi, nella scuola secondaria dopo la riforma, l’insegnamento del disegno a mano libera e con strumenti e i problemi che si pongono nel passaggio dal disegno analogico al disegno digitale. Dalla sintesi delle ricerche sviluppate nell’ultimo decennio si possono cogliere alcune indicazioni per la didattica del disegno. Rimane aperta la questione di un insegnamento laboratoriale che non sia istruzionale.

  6. Legami 2.0. Il genere alla prova della contemporaneità

    Directory of Open Access Journals (Sweden)

    Redazione Camera blu

    2016-12-01

    Full Text Available Numero a cura di Anna Gargiulo. Il numero guarda alle trasformazioni che attengono al genere femminile che vanno oggi configurandosi nel virtuale, nei media, nelle sfide della società contemporanea rivolte ai corpi, alle famiglie, ai sistemi accademici. Si parte dai legami, dai link, che tanto possono connettere paesi e generazioni quanto legare oppressivamente l’altro a sé.

  7. La “grande bellezza” del paesaggio italiano nel cinema contemporaneo: tra falsificazione e finanziamento locale / The “great beauty” of Italian landscape in contemporary movies: between falsification and local funding

    Directory of Open Access Journals (Sweden)

    Eleonora Mastropietro

    2016-05-01

    Full Text Available I film hanno rappresentato l’evoluzione del paesaggio italiano per gran parte del novecento. Negli ultimi due decenni i film italiani hanno però smesso di esplorare le trasformazioni del territorio. La debolezza dell’industria cinematografica spiega in parte l’assenza del contemporaneo dagli schermi. Inoltre il diffuso ricorso al supporto economico degli enti pubblici, che spesso vedono i film come strumenti di promozione turistica, sembra influenzare le modalità di rappresentazione del paesaggio. Il contributo presenta una ricerca condotta sui film di maggior successo tra il 1990 e il 2014 alla ricerca dell’immagine del paesaggio italiano in essi prevalente e evidenzia alcune cause alla base di questa rappresentazione omogenea. Films have portrayed the evolution of the Italian urban landscape in the last 100 years. Nevertheless, contemporary movies partially ignore the recent transformations and represent instead a stereotyped image of Italian landscapes. The structure of the local movie industry could provide a first explanation of this phenomenon. Moreover, the financial support of productions provided by local government influences the choice of including or excluding elements of the landscape in the movies screen. The paper explores the new representations of landscape in Italian movies, in order to show which features of the changing contemporary Italian landscapes are visible and which are hidden.

  8. Impact of environmental pollution on the incidence of malignant neoplasms of upper respiratory tract in the population of Mysłowice, Imielin and Chełm Śląski

    Directory of Open Access Journals (Sweden)

    Jerzy Stockfisch

    2014-03-01

    Full Text Available Background. The paper presents a retrospective analysis of cases of the upper respiratory tract malignant tumors in the settlement: Mysłowice, Imielin, Chełm Śląski based on the patients’ medical history treated in a hospital laryngological ward in Mysłowice between 1995 and 2004. The inspiration to write the paper was the significant frequency of the upper respiratory tract malignant tumor cases in the main areas of Mysłowice; Piasek and Rymera estate. The aim of the study was the assessment of relationship between environmental pollution and territorial diversity in the morbidity of head and neck cancer. Material and methods. The study involved a group of 130 patients with cancer of the upper respiratory tract and a control group of 145 healthy subjects of similar age and sex, living in the different regions of the surveyed towns in the comparable proportions and in the group of patients. The paper aimed to assess the relationship between territorial diversity of the upper respiratory tract cancers, and environmental risk factors. Results. The analysis was based on environmental pollution data. It was confirmed that the geographic picture of the incidence of the upper airways malignant tumors showed that Mysłowice central districts: Piasek and estate Rymera, indicated this region to be particularly critical one. Conclusions. The increased number of morbidity cases in these districts may be associated with: environmental risk factors, increased consumption of high percentage alcohol, excessive amount of smoked cigarette and low socio-economic status of the patients.

  9. Il samizdat a Leningrado negli anni Settanta: struttura e dinamiche di una ‘seconda’ realtà culturale

    Directory of Open Access Journals (Sweden)

    Marco Sabbatini

    2015-07-01

    Full Text Available Il presente lavoro prende in considerazione la generazione di autori e artisti di Leningrado che hanno iniziato la loro attività nel corso degli anni Settata, nel contesto della stampa clandestina nel sottosuolo. Lo studio descrive gli eventi, i gruppi non ufficiali, i principali periodici del samizdat e le attività informali poste in essere da molti giovani scrittori, tra cui Viktor Krivulin e Boris Ivanov, due tra le personalità più rappresentative della cultura sovietica alternativa a Leningrado nel periodo tra il 1975 e il 1981.

  10. Zur chemie der marsoberfläche

    Science.gov (United States)

    Keil, Klaus; Clark, Benton C.; Baird, A.K.; Toulmin, Priestley; Rose, Harry J.

    1978-01-01

    Analyses of 13 samples of Martian surface materials with the Viking X-ray fluorescence spectrometers show SiO2 similar to that of terrestrial mafic rocks, whereas Fe2O3, Cl, and S are higher and Al2O3, K2O, Rb, Sr, Y, and Zr are lower. Low totals suggest presence of CO2, H2O, and Na2O. Duricrust fragments are higher in S than fines, but samples from both landing sites are surprisingly similar. We suggest that Martian surface materials are aeolian deposits of complex mixtures of weathering products of maficultramafic rocks, possibly consisting of iron-rich clays, sulfates, iron oxides, carbonates, and chlorides.

  11. La nuova fisica che ci aspetta

    CERN Multimedia

    Shiga, David

    2007-01-01

    The big accelerator that will enter in function at CERN at the end of the year will have the hard task to verify the relevance of the string theory, today the better candiddate to be the famous "theory of everything" that physicists are looking for since decades. (1 page)

  12. Using Screencasts in ChE Courses

    Science.gov (United States)

    Falconer, John L.; deGrazia, Janet; Medlin, J. Will; Holmberg, Michael P.

    2009-01-01

    Screencasts are digital recordings of the output from a computer monitor, including narration. Their use was piloted in five chemical engineering courses and the feedback from students was overwhelmingly positive. The screencasts were produced on Tablet PCs using Camtasia Studio software and were posted to the Blackboard classroom management…

  13. Illustrations to “Gespräche in dem Reiche derer Todten zwischen dem vortreflichen Moscowitischen Czaar Petro Magno und dem grossen Tyrannen Ivan Basilowiz II” (Peter the Great and Ivan the Terrible by David Fassmann (1725

    Directory of Open Access Journals (Sweden)

    Ekaterina A. Skvortcova

    2017-12-01

    Full Text Available The journal created by David Fassmann (1683–1744, Gespräche in dem Reiche derer Todten, edited in Leipzig, was a huge success. Each of the 240 issues presents a dialogue between two historical figures from the afterworld. In the 83rd–86th Entrevuë, the interlocutors are Peter the Great and Ivan the Terrible. The texts of the four conversations were thoroughly examined by Eckhard Matthes (1987. The present paper explores how the illustrations to the 83rd–86th Entrevuë visualize the texts, which is significant as they were an important instrument for disseminating certain notions about Russia. While the illustration to the first dialogue of the suite juxtaposes Peter and Ivan, the illustration to the second one emphasizes the similarities between them. So the image of the “tyrant” and “barbarian” Ivan becomes a reference point with which a reader is urged to compare Peter’s deeds, seeing not only the differences but also the similarities. This greatly contributes to the creation of the multifaceted image of Russia of the early 18th century. The characters of the second illustration—a tiger and an executioner—can be identified as Ivan and Peter only if the reader takes into consideration an epigram to the illustration, the illustration to the previous dialogue, the text of the next Entrevuë, and facts about the execution of the strel’tsy known from other texts and images, about which Fassmann remains silent in the spirit of ars dissimulandi, which was typical for baroque culture. The paper offers an attempt to trace the iconography of the tyrant as a tiger. In the frontispiece to the 85th Entrevuë, a secretary bringing news from the world of the living and a portrait of Catherine I emphasize the connection of the past and the present, i.e., history and policy. Finally, the illustration to the last dialogue of the series returns to the glorification of Peter the Great declared in the first dialogue.

  14. El maestro Pedro Nel Gómez

    Directory of Open Access Journals (Sweden)

    Mario Rivero

    1978-12-01

    Full Text Available Puede compararse la técnica del fresco, en donde deben tomarse todas las precauciones para una ejecución ágil y decisiva, puesto que el pintor debe cubrir una determinada cantidad de espacio en un tiempo preciso.

  15. Echi omerici nel libro di Tobia ?

    Directory of Open Access Journals (Sweden)

    Toloni, Giancarlo

    2007-06-01

    Full Text Available The journey home to Nineveh by Tobiah recalls Odysseus’ novstoı to Ithaca, a journey marked by dangers and adventures and by the ideas of love and the family. The biblical book stands as a historical-religious novel although the origin is to be sought in the literary genre of folktalle enriched with didactic, edifying, and prophetic elements. This elementary narrative structure could go back to the Odyssey – archetype of the modern novel – and particularly to the folktale of Odysseus. The hagiographer could have thus re-written in theological perspective the ancient story of Tobit and Tobiah from biblical and parabiblical tradition so as to answer the problems of the Israel of his time. The numerous analogies concerning the themes (the journey to the East, the dangers, the family feelings, etc. and the narrative elements (the relation father-son, the dog,the intermediaries, the drug, etc. show that the author must have known Odysseus’ novstoı, and also that he relied on his readers’ knowledge of it when he outlined the story of Tobiah following the scheme of the Greek hero’s journey. One should speak of an intelligent attempt to exploit the fame of the Homeric tale in order to confer authoritative status to his story, rather than of literary dependence or emulation. Indeed, the author of the story of Tobiah uses the folktale of Odysseus to revive the hope of the Jewish community to return to their land, just like Tobiah returned to Nineveh from Rages happily married with Sarah.

    El viaje de vuelta a casa de Tobías evoca el novstoı de Odiseo a Ítaca marcado igualmente por peligros y aventuras y por asuntos de amor y familia. Este libro bíblico es una novela históricoreligiosa, pero, en su origen se encuentra el género literario de cuento popular, enriquecido con elementos didácticos, edificantes y proféticos. Esta estructura narrativa elemental podría remontarse a la Odisea –arquetipo de la novela moderna– y particularmente al cuento popular de Odiseo. El hagiógrafo, por tanto, pudo haber reelaborado con perspectiva teológica esta antigua historia de Tobit y Tobías, recogida de la tradición bíblica y parabíblica, para responder a los problemas del Israel de su tiempo. Las numerosas analogías entre los temas (el viaje de Oriente, los peligros, los sentimientos familiares… y los elementos narrativos (la relación padre-hijo, el perro, los intermediarios, la medicina… confirman que el autor debió de conocer el novstoı de Odiseo. Se basaba en el conocimiento que sus lectores tenían de él para delinear la historia de Tobías sobre el esquema de viaje del héroe griego. Más que de una dependencia literaria o de una emulación, se trata de un intento inteligente de explotar la fama del relato homérico para poner un sello autoritativo a su historia. En ese sentido, parte del relato popular de Odiseo para revivir las expectativas de la comunidad judía hacia una diáspora oriental, sometida e incierta sobre su destino, previendo la vuelta de la deportación como Tobías, que volvió a Nínive desde Rages, feliz de haberse casado con Sara.

  16. La consulenza di parte nel caso Cogne

    Directory of Open Access Journals (Sweden)

    Elena Bianchini

    2015-03-01

    Full Text Available The interview with Prof. Pietro Pietrini is principally focused on his expert activity done in reference to the so-called “Cogne case”. First, Prof. Pietrini expressed his appreciation about the interviews carried out with his client, he finds it adequate from the point of view of both quality and quantity. He also appreciated the work done in cooperation with Prof. Balloni, the expert appointed by the Surveillance Court of Bologna. Then, he points out that meetings with AMF have certainly represented a real beginning of her psychotherapeutic path, which aim is to give back to Lady F. her role of being a wife, a mother and a woman outside of the walls of the prison. Finally, Prof. Pietrini hopes that this family, particularly the two sons, would no longer be in the focus of attention or at least that the interest on this case will not continue since the incident happened a long time ago.

  17. Processi intertestuali nel “Piacere”

    Directory of Open Access Journals (Sweden)

    Raffaella Bertazzoli

    2015-06-01

    Full Text Available D’Annunzio’s first novel, Il piacere (1898, was immediately accused of more or less explicit plagiarism. With critical acumen, D’Annunzio replied that imitation was an active force in the creative process and writing was a ‘transversal operation’, a bridge between literature and other art forms. In this fashion, he implicitly raised some crucial questions about the discourse of intertextuality: what is the relationship between a poet and his/her literary precursors? What does originality mean? From these premises, this article attempts to analyse Il piacere as a complex transtextual architecture, focusing on highly visible examples of paratextuality, metatextuality, and hypertextuality.

  18. Sui monosillabi nel pentametro: elegia ed epigramma

    OpenAIRE

    Magnelli, E.

    2012-01-01

    Questo studio offre un’analisi di prima mano sull’uso di monosillabi alla fine del primo emisticho del pentametro, nell’elegia e nell’epigramma greco fino all’età di Giustiniano. Nessun tipo di restrizione sembra riguardare i monosillabi appartenenti a una ‘parola metrica’. I dati riguardanti i monosillabi indipendenti – ossia non appositivi e non preceduti da un’appositiva – sono meno facili da interpretare, e non è chiaro se i poeti greci cercassero di evitarne la collocazione i...

  19. Il disgusto nel secolo dei Lumi

    Directory of Open Access Journals (Sweden)

    Maddalena Mazzocut-Mis

    2013-12-01

    Full Text Available In this essay I try to answer two different questions: ‘how can we define disgust?’ and ‘which kind of relationship is there between taste and disgust?’. In order to give a definition of the notion of disgust I analyze the works of different modern philosophers of the 18th century. In the first part of my writing I support the idea that disgust is strictly connected to the sense of smell. Taking into account this consideration and the idea that aesthetic feeling is never a mere pleasure of sense, I then make a distinction between feeling and emotion. This distinction allows me to say that disgust is always an emotion, and it is never connected to a judgment of taste. Within the experience of disgust, the distance and the disinterest that aesthetics requires are nullified: both in reality and in works of art disgust can never be mixed with pleasure. On this basis, I analyze the connection between disgust and hunger, as discussed by Diderot and Lessing, sympathy and animals. Ultimately, I can state that disgust can never be mixed with pleasure, and it can never find a place in the judgment of taste. Disgust isn’t opposed to beauty, but it marks its limits.

  20. Le donne dei principi nel Lazio protostorico

    Directory of Open Access Journals (Sweden)

    Gilda Bartoloni

    2009-11-01

    Full Text Available This paper focuses on the role of women in the societies of ancient Latium. In this contribution many cases of burials are presented to illuminate the importance of their role. The analysis of these burials, in terms of grave goods and their setting within the grave, is carried out in comparison with  Etruscan and other pre-Roman areas and with attention to Greek and Roman literary sources, in order to present some specific aspects and activities that involved women in the aristocratic society of the Orientalizing period.

  1. La scienza nel processo penale: Porto Marghera

    Directory of Open Access Journals (Sweden)

    Marina de Ghantuz Cubbe

    2014-12-01

    Full Text Available It was called Morto Marghera. By the beautiful Venice, Porto Marghera has been since 1917 the area where a very important italian industrial development has taken place. It was the industrial estate where for example the Montedison company has empowered itself. The promise of a better future was the reason why a lot of workers and families moved here from all Italy. But after the seventies and the worker’s struggles the expectation moved in tragedy: 157 workers dead, killed by the substance they handled. Porto Marghera’s history shifts through a lawsuit in which the “truth” of scientific evidence risks to crush the justice and italian laws. In an interview Gianfranco Bettin recall the process: “it’s impossible to absolve who, knowing that workers were exposed to lethal effects, has hid”.

  2. Magia e superstizione: viaggio nel tempo

    OpenAIRE

    D’Agati, Marina

    2016-01-01

    Michael D. Bailey’s Magia e superstizione in Europa dall’Antichità ai giorni nostri (Magic and Superstition in Europe: A Concise History from Antiquity to the Present) is a useful work for a wide audience. Based on a wide scholarship of the history of magic and witchcraft, it gives readers a comparative perspective on how different Western societies viewed and categorized magic and superstition, and how magical traditions changed and adapted to different historical conditions. Bailey looks at...

  3. Riscritture del romance nel secondo Novecento italiano

    Directory of Open Access Journals (Sweden)

    Stefano Nicosia

    2013-01-01

    Full Text Available Many authors in the last century offer us the possibility to look at romance through their rewriting of Italian tradition, but they also offer the possibility to look at rewriting through romance. A systematic examination of every single work would need an article itself. Here the focus is rather on the phenomenon and its implications with tradition and its transformations; and on the intellectual context where they take place. Despite the very core of the poetics of rewriting can be located between the Sixties and the Eighties, these palimpsests go further, into the Nineties. From Calvino, Manganelli and Sanguineti, to Celati, Bufalino and Santagata, we are able to look at different declensions of rewriting. Through these texts and the techniques they are built with, it is possible to verify the strength and the qualities of some cultural and intellectual practices, which can be related to a coherent Italian postmodern poetics, which operates through the reuse of traditional materials. These reuse should be seen – and this is one of the cues and conclusions the article would like to offer – as a vital way of reproducing stories and genres in the postmodern era.

  4. Il rituale amoroso nel Casanova di Fellini

    Directory of Open Access Journals (Sweden)

    Federico Castigliano

    2012-07-01

    Full Text Available L’auteur analyse le rapport entre le scénario du Casanova de Federico Fellini, écrit par le réalisateur en collaboration avec Zapponi, et l’Histoire de ma vie, l’autobiographie de Giacomo Casanova. La sélection des épisodes ainsi que les choix narratologiques opérées par les scénaristes montrent que le film vise, à travers un bouleversement parodique du texte original, à une démolition progressive du « mythe » du séducteur et de l’homme de lettre. Cette mécanisme déformant – qui trouve des correspondances dans les éléments propre au langage filmique – touche à son apogée dans la représentation caricaturale du rituel amoureux, jusqu’à la réduction de Casanova à un homme-machine : prodigieux athlète du sexe mais amant et intellectuel frustré.

  5. Vico nel 350° anniversario della nascita

    Directory of Open Access Journals (Sweden)

    Manuela Sanna

    2017-12-01

    Full Text Available Vico in the 350th anniversary of his birth. This article introduces the program celebrations for the 350th anniversary of Giambattista Vico’s birth, organized by the CNR Institute for the History of Philosophy and Science in Modern Age along with several other institutions. The Author stresses the meaning of Vico’s ideas for the understanding of contemporary world. A brief appendix gives an account of the conception of the celebrations logo.

  6. A Comprehensive Model of the Dry Desulphurisation Process Une modélisation non empirique du procédé de désulfuration par voie sèche

    Directory of Open Access Journals (Sweden)

    Flament P.

    2006-11-01

    humide des fumées, le procédé de désulfuration par voie sèche reste un moyen attractif pour éliminer le dioxyde de soufre lorsque le taux de réduction souhaité ne dépasse pas 90 %. Dans cette technique, l'élimination du SO2 se fait en injectant directement dans les produits de combustion de très fines particules d'un absorbant calcique tel que le calcaire (CaCO3 ou la chaux (Ca(OH². L'absorbant est tout d'abord transformé en oxyde de calcium (CaO avant de réagir avec le SO2 pour former un composé stable : le sulfate de calcium (CaSO4. Bien que les réactions globales soient extrêmement simples, une description complète des mécanismes nécessite de connaître à la fois, les propriétés physiques initiales de l'absorbant et leur évolution durant la réaction. De plus, les conditions d'injection des particules jouent un rôle prépondérant dans le procédé de désulfuration par voie sèche. Tous ces aspects sont traités dans ce papier. Le modèle de désulfuration a d'abord été testé seul par comparaison avec les données cinétiques de la Fondation Internationale de Recherches sur les Flammes (FRIF, puis, couplé avec le code KIVA, il a été utilisé pour simuler la désulfuration dans un nouveau type de chaudière développée par Babcock Entreprise et l'Institut Français du Pétrole (chaudière 'AUDE'. Dans ce dernier cas, l'objectif poursuivi était de déterminer la meilleure configuration à donner au système d'injection des particules pour obtenir un taux de désulfuration maximum. La dispersion des particules étant un paramètre important du procédé de désulfuration, un exemple de validation du modèle de dispersion est également traité. L'injection de particules dans une couche de mélange a été choisie comme cas test. L'accord entre les valeurs expérimentales de Ando et al. (1990 et les calculs effectués avec KIVA est satisfaisant.

  7. DALL’«ARTICOLO EPR» AGLI ESPERIMENTI DI ALAIN ASPECT: IL LUNGO CAMMINO DEL PROBLEMA DELLA NONLOCALITÀ IN MECCANICA QUANTISTICA

    Directory of Open Access Journals (Sweden)

    Vera Matarese

    2014-03-01

    Full Text Available Quando, nel 1935, venne pubblicato il famoso articolo chiamato poi “EPR Paper” per le iniziali dei suoi autori - Einstein, Podolsky, Rosen -, la comunità scientifica dovette confrontarsi non solo con le manifeste provocazioni che il suo argomento voleva mostrare, ma anche con latenti problemi che sarebbero sbocciati più avanti in tutti i loro stridenti contrasti. L’incompletezza della meccanica quantistica, che l’“articolo EPR” si proponeva di dimostrare, poggiava infatti su un principio molto problematico, quello della località, che sarebbe esploso nell’esperimento prima concettuale di Bohm e poi sperimentale di Aspect. Ciò che questo articolo vuole delineare è lo sviluppo del problema della nonlocalità, dai suoi albori fino alla prova della sua effettiva esistenza nel mondo quantistico, dove, come ben ha dimostrato Bell, nulla possono fare le variabili nascoste per dissolvere la realtà nonlocale di alcuni fenomeni.

  8. Atomi, molecole e solidi esercizi risolti

    CERN Document Server

    Balzarotti, Adalberto; Fanfoni, Massimo

    2015-01-01

    Questo eserciziario nasce dalla raccolta di problemi d'esame assegnati agli studenti del corso di Struttura della Materia, che si colloca al confine fra il Corso Triennale e quello Magistrale. Alla fine di ciascun capitolo si trova un riepilogo ragionato di formule utili, e l’ultima parte del volume è dedicata alle unità di misura, alle formule di Meccanica Quantistica e alle tecniche per manipolare il momento angolare, i metodi variazionale e quello perturbativo elementare. Quasi tutti i problemi sono applicazioni della Meccanica Quantistica, anche se si utilizzano nozioni di Termodinamica, Meccanica ed Elettromagnetismo. I problemi di questo manuale differiscono rispetto a quelli che caratterizzano libri di Fisica Teorica (che possono anche essere astratti o rilevanti per l'Astrofisica o le Interazioni Deboli, soprattutto nel fatto che) soprattutto nel fatto che questi devono alla fine determinare dei valori realistici di misure standard su atomi molecole o solidi. In Fisica, la conoscenza di ogni argom...

  9. Test of numerical methods for the integration of kinetic equations in tropospheric chemistry; Confronto di metodi numerici per l'integrazione di sistemi di equazioni differenziali ordinarie di tipo STIFF inserite nel modello fotochimico Calgrid

    Energy Technology Data Exchange (ETDEWEB)

    Lorenzini, R.; Passoni, L. [ENEA, Centro Ricerche Ezio Clementel, Bologna (Italy). Dipt. Ambiente

    1999-07-01

    The integration of ordinary differential equations systems (ODEs) is of significant concern to tropospheric and stratospheric chemistry modelers. The solution of the ODEs requires a large computational effort because of their stiff nature; in a three-dimensional photochemical model the solution of the ODEs required at least 70% of the total CPU time. Several numerical integration techniques exist which attempt to provide accurate and computationally efficient solutions. In this work it is presented a comparison of some of the techniques in terms of solution accuracy and required computational time. It has been compared the Hybrid Solver (Young and Boris, 1977), the Quasi Steady-State Approximation method (Hesstvedt et al., 1978) and the Chemical Solver for Ordinary Differential Equations (Aro, 1996), by using the CALGRID photochemical model. The accuracy is evaluated by comparing the results of every method with the solutions obtained by the Livermore Solver for Ordinary Differential Equations (Hindmarsh, 1980). The comparison has been made varing the parameters of the error tolerances, and taking into account the trade-off between solution accuracy and computational efficiency. [Italian] L'integrazione di sistemi di equazioni differenziali ordinarie (ODEs), e' un problema significativo per i modellisti della chimica troposferica e stratosferica. A causa della loro natura stiff la soluzione degli ODEs richiese un notevole sforzo computazionale; in un modello fotochimico tridimensionale la soluzione degli ODEs richiede almeno il 70% del tempo totale di CPU. Esistono diverse tecniche di integrazione numerica che possono fornire soluzioni accurate e computazionalmente efficienti: in questo lavoro presentiamo un confronto fra alcune tecniche in termini di accuratezza della soluzione e tempo computazionale richiesto. Si sono confrontati il Solver Ibrido (Young and Boris, 1977), il metodo Quasi Steady-State Approximation (Hesstvedt et al., 1978) ed il Chemical

  10. Doutorado-sanduíche em enfermagem: relato de experiência Doctorado sándwich en enfermería: relato de experiencia Sandwich doctoral program in nursing: an experience report

    Directory of Open Access Journals (Sweden)

    Rosane Arruda Dantas

    2009-06-01

    Full Text Available Relato de experiência acerca de estágio de doutorando-sanduíche realizado com bolsa da Coordenação de Aperfeiçoamento de Pessoal de Nível Superior, durante o período de outubro de 2005 a janeiro de 2006, na Faculdade de Enfermagem de D. Ana Guedes, no Porto, em Portugal, instituição já visitada na graduação. Tive a oportunidade de replicar a metodologia de parte da dissertação com crianças portuguesas. Isso permitiu estudo comparativo entre duas culturas que guardam afinidades, mas têm características distintas. Além disso, ministrei aulas, participei de cursos e seminários e aprofundei os conhecimentos acerca da Teoria da Universalidade e Diversidade do Cuidado Cultural. Considero que esta experiência é um estímulo para a garantia da autonomia do enfermeiro na assistência de enfermagem, como pesquisador e docente, ampliando conhecimentos e os inserindo no processo de cuidado. Ademais, influencia positivamente no amadurecimento psicológico, cultural e social do doutorando.Relato de experiencia acerca de pasantía de doctorado sándwich realizado con suporte financiero de la Coordinación de Mejora del Personal del Nivel Superior, durante el período de octubre de 2005 a enero de 2006, en la Facultad de Enfermería de D. Ana Guedes, en Porto, Portugal, institución ya visitada durante la graduación. Tuve la oportunidad de replicar la metodología de parte de la disertación junto a niños portugueses. Esto permitió un estudio comparativo entre dos culturas que guardan afinidades, pero tienen características distintas. Además, ministré clases, participé de cursos y seminarios y me profundicé en los conocimientos acerca de la Teoría de la Universalidad y Diversidad del Cuidado Cultural. Considero que esta experiencia es un estímulo para la garantía de la autonomía del enfermero en la atención de enfermería, como investigadora y docente, ampliando conocimientos e insertándolos en el proceso de cuidado. Adem

  11. Variations autour de la tâche dans l'enseignement / apprentissage des langues aujourd'hui What kind of tasks are used for L2 teaching and learning today?

    Directory of Open Access Journals (Sweden)

    Elke Nissen

    2011-10-01

    Full Text Available Cet article se donne pour objectif d'identifier les types de tâches, et leurs dénominateurs communs, qui sont présentés aujourd'hui – où "l'approche par les tâches" est soutenue par le Conseil de l'Europe – aux apprenants. Il analyse pour cela les articles issus de deux numéros de revues et un ouvrage collectif récents. Il apparaît que la grande majorité des scénarios pédagogiques s'y inscrit dans la perspective actionnelle... du moins d'après la déclaration des auteurs, car leur définition de ce qu'est une tâche ne correspond pas toujours à celle du CECR. Pour le public visé, étudiants ou professionnels, on propose le plus souvent des mono-tâches, mais également des projets, ou encore des simulations avec un enchaînement de plusieurs tâches. Elles s'inscrivent généralement dans la (future réalité sociale des apprenants, mais certaines laissent également la place à des thèmes artistiques ou (interculturels. Contrairement à ce que l'on aurait pu attendre dans une démarche qui responsabilise l'apprenant, le recours à Internet n'est pas toujours systématique.At a time when action- and task-based learning is sustained by the European Council, this paper explores which types of tasks are given to second language learners today and what aspects these tasks have in common. The paper analyses two recent issues of scientific journals and one collective book. The analysis shows that the majority of pedagogical scenarios described in these texts claim to adopt an action- and task-based approach. However, in reality the way they define a task does not always correspond to the definition given by the European Framework of Reference for Languages. The described tasks are exclusively dedicated to higher and professional education; they are mostly single tasks, but they can also be projects and simulations including several successive tasks. They generally correspond to the learners' (future reality, with themes that are

  12. Approche multidimensionnelle de la difficulté objective dans une tâche d’anticipation coï ncidence Multidimensional approach of objective difficulty in an aiming task

    Directory of Open Access Journals (Sweden)

    P. Deneuve

    2010-09-01

    Full Text Available

     

    Cet article a pour objet de proposer une nouvelle procédure pour classer les tâches motrices à caractère informationnel à partir d’une approche multidimensionnelle de la difficulté. L’expérimentation a consisté à faire passer des tests de pointage à 345 sujets sur cibles mobiles créées et gérées par ordinateur. Les paramètres des cibles ont été choisis pour leur indépendance et la possibilité de les positionner sur des échelles numériques. Trois descripteurs ont été retenus : la vitesse de déplacement, la surface de la cible et l’incertitude spatiale. La performance ne semblant pas être la seule variable dépendante résumant la difficulté, il lui a été adjoint trois autres variables : les tentatives, le temps de réaction et le temps moteur. En utilisant des outils statistiques permettant des analyses de données multidimensionnelles (CAH, AFC, il a été possible soit d’agréger des tâches aux profils identiques soit de les différencier en fonction du poids de chaque descripteur sur les variables dépendantes. Surtout, il est envisageable de préciser l’apport de chaque variable dans la définition de la difficulté que se donne a posteriori le chercheur.
    PALABRAS CLAVE: Difficulté, traitement de l’information, tâche motrice, classification, analyse de données.

    This article deals with a new method to classify informational motor tasks, through a multidimensional approach of difficulty. The following experiment is used: 345 subjects are asked to point at computer-managed mobile targets. The 3 selected target parameters are: velocity, area and spatial uncertainty. Independence and numerical scalability are the reasons for this choice. As performance does not sump up difficulty, other dependent variables have been added: number of attempts, reaction time and motor time. The use of

  13. La strana storia della luce e del colore

    CERN Document Server

    Guzzi, Rodolfo

    2011-01-01

    Sino al 1600 la luce era oggetto di studio degli scienziati ed il colore dei filosofi. Questa dicotomia fu superata dall’Esperimentum Crucis di Newton che spiego’ come la luce contenesse il colore. Il libro analizza le teorie che furono sviluppate dai greci, per evolversi successivamente nelle teorie degli scienziati arabi e approdare al medio evo. Con l’Esperimentum Crucis Newton dimostro’ che la luce conteneva i colori primari. Tra gli esperimenti che egli fece ci furono anche quelli sulla percezione che risultarono sbagliati; solo Goethe capi’ quale era la vera portata di quegli esperimenti e li rifece dando una interpretazione che, oggi, sappiamo essere vera, ma che a quel tempo fu alquanto osteggiata. Nel frattempo la comunita’ scientifica progrediva sul concetto di visione e di sensazione, poiche’ gli strumenti di indagine si raffinavano. Bisogna pero’ arrivare ai giorni nostri per avere una spiegazione sul comportamento della luce e del colore e come questa viene percepita da noi. Solo ...

  14. Il corpo, lo sport, le immagini

    Directory of Open Access Journals (Sweden)

    Nicola Porro

    2009-07-01

    Full Text Available E’ stato per primo Norbert Elias, nella sua critica al riduzionismo sociologico, a lamentare la difficoltà delle scienze sociali a misurarsi con le problematiche dello sport, così come delle emozioni, della sessualità, del gioco e della guerra. Attività umane che convergono in quell’autentico luogo sociale che è il corpo. Nel caso che ci interessa, si tratta di connettere il corpo, nella sua dimensione biologica, psichica e sociale, con quell’aspetto cruciale della civilizzazione che Elias definisce sportivizzazione.

  15. L'evoluzione del WEB GIS la filiera postgis-mapserver-geoext- openlayers per sviluppare piattaforme GIS complete, agili ed economiche

    Directory of Open Access Journals (Sweden)

    Francesco Mariucci

    2012-04-01

    Full Text Available Spesso, nel nostro ambito, ci si sente dire che il GIS è un bene di lusso, dal quale, soprattutto in epoca di crisi economica, le piccole entità (sia in ambito pubblico che privato possono facilmente prescindere. Questo articolo vuole segnalare la presenzadi tecnologie non nuove ma consolidate che unite insieme possono costituire una base informatica flessibile e di costi ridotti per l'implementazione di piattaforme GIS dedicate che siano di supporto anche per le piccole realtà nella gestione di dati ed attività territoriali, con notevoli vantaggi sulla produttività e sull'immagine

  16. B-mode for thyroid nodule characterization at 7.5 MHz versus 13 MHz; Attualita' dell'ecografia nel modo B nella caratterizzazione delle malattie nodulari tiroidee: studio ecografiaco di confronto con sonde da 7.5 e da 13 MHz

    Energy Technology Data Exchange (ETDEWEB)

    Amodio, F.; Carbone, M.; Rossi, E.; Brunese, L.; Vallone, G. [Neaples Univ., Neaples (Italy). Dipt. di Scienze Biomorfologiche, Ist. di Scienze Radiologiche; Pisano, G.; Iorio, S. [Neaples Univ., Neaples (Italy). Dipt. di Scienze Biomorfologiche, Sez. di Anatomia Patologica e Citopatologica; Benincasa, G. [Neaples Univ., Neaples (Italy). Dipt. di Scienze Biomorfologiche, Ist. di Endocrinologia, Medicina Interna e Malattie della Nutrizione

    1999-09-01

    The paper investigates B-mode ultrasonography capabilities in diagnosis and characterizing thyroid nodules and compared the personal experience findings with those of few analytical studies in the literature. It is also compared the diagnostic accuracy of conventional 7.5 MHz versus more recent 13 MHz transducers. [Italian] Lo studio presenta i dati sull'accuratezza diagnostica dell'ecografia nel modo B con trasduttore da 7.5 MHz con quella di un trasduttore di piu' recente commercializzazione da 13 MHz. E' una tappa fondamentale nell'iter diagnostico del nodulo tiroideo, se integrata con lo studio qualitativo (color e power Doppler) e semiquantitativo (Doppler pulsato) della vascolarizzazione nodulare.

  17. La presa di parola di Anne Hutchinson. Insubordinazione e conflitto nella giovane America puritana

    Directory of Open Access Journals (Sweden)

    Itala Vivan

    2016-04-01

    Full Text Available Anne Hutchinson lasciò l’Inghilterra nel 1634 per emigrare nel Massachusetts puritano, dove nel 1637 e 1638 fu processata, condannata, scomunicata ed espulsa come donna insubordinata, deviante e pericolosa. Il suo ruolo intellettuale e politico nell’alba incandescente della prima America viene qui analizzato e discusso ascoltando da presso il racconto che promana dalla voce della stessa Anne Hutchinson attraverso i verbali dei due processi, trascritti dai contemporanei con la fedeltà letterale che era tipica del puritanesimo americano. La drammatica controversia che ebbe al centro la presa di parola di questa donna segnò la prima grande crisi della neonata società coloniale – la cosiddetta crisi antinomiana -- e ne determinò gli sviluppi futuri, indirizzandoli verso un sistema di potere politico su basi teocratiche.

  18. “Si lasci quindi ad ognuno il diritto di raccontare i fatti suoi a modo suo”

    Directory of Open Access Journals (Sweden)

    Doris Nátia Cavallari

    2015-06-01

    Full Text Available Nel Decameron di Giovanni Boccaccio i personaggi-narratori raccontano novelle con la propria intonazione narrativa e creano una nuova estetica della prosa letteraria. La libertà del modo di narrare i fatti presi dalla vita e trasformati in fiction rivela la proposta dell’autore di segnare la distanza tra vita e arte, che ha come risultato un testo rinnovatore nel carattere pluridiscorsivo e pluristilistico

  19. “Si Lasci Quindi ad Ognuno il Diritto di Raccontare i Fatti suoi a Modo suo”

    Directory of Open Access Journals (Sweden)

    Doris Nátia Cavallari

    2015-06-01

    Full Text Available Nel Decameron di Giovanni Boccaccio i personaggi-narratori raccontano novelle con la propria intonazione narrativa e creano una nuova estetica della prosa letteraria. La libertà del modo di narrare i fatti presi dalla vita e trasformati in fiction rivela la proposta dell’autore di segnare la distanza tra vita e arte, che ha come risultato un testo rinnovatore nel carattere pluridiscorsivo e pluristilistico

  20. Andrea Corrado – Igor Mariottini, Cinema e autori sulle tracce delle migrazioni

    Directory of Open Access Journals (Sweden)

    Lorenzo Mari

    2016-06-01

    Full Text Available Nel dibattito pubblico così come, inevitabilmente, nel senso comune, l’interpretazione della storia post-unitaria italiana alla luce delle migrazioni – prima come flussi in uscita, poi sia in entrata che in uscita – ha innescato la costruzione di un preciso discorso retorico, alimentato da pubblicazioni come L’orda. Quando gli albanesi eravamo noi (2005 di Gian Antonio Stella.

  1. Evidence Based Education: centri di ricerca e risorse in Rete

    Directory of Open Access Journals (Sweden)

    Filippo Bruni

    2013-08-01

    Full Text Available Nel corso degli ultimi anni, si è assistito a una diffusione della cultura “evidence based” nell’ambito della ricerca educativa. La quantità di centri di ricerca e risorse disponibili online, riferibili a tale prospettiva, sta crescendo esponenzialmente e rappresenta un patrimonio di conoscenza che può essere assai utile per insegnanti ed educatori. Per tale ragione, nel presente contributo, si offre una panoramica dei principali centri e iniziative rintracciabili in Rete.

  2. Regolazione della biosintesi delle fenazine in una pseudomonadi fluorescente, Pseudomonas aureofaciens 30-84

    OpenAIRE

    Puopolo, Gerardo

    2006-01-01

    Gli pseudomonadi fluorescenti, che colonizzano la rizosfera di molte piante coltivate, sono dei potenziali farmaci biologici in quanto capaci di proteggere le colture dall’attacco di microrganismi patogeni e quindi di aumentarne le loro rese produttive. Nel corso del lavoro, diiversi ceppi batterici afferenti al genere Pseudomonass sono stati oggetti ad analisi incentrate alla potenziale applicazione di tali microrganismi nel controllo biologico di fitopatie fungine. Gli isolati batterici so...

  3. Studio della frazione flavonoidica di specie vegetali del genere Huperzia

    OpenAIRE

    Ponce Zea, Jorge Eduardo

    2012-01-01

    Ad oggi il principale scopo delle ricerche nel campo dei prodotti naturali continua ad essere quello di trovare molecole (metaboliti secondari) che abbiano un impiego medico-farmaceutico. Poco più di 3569 anni fa, nel 1804 Friedrich Sertürner isolò la prima molecola pura farmacologicamente attiva derivante da una pianta: la morfina. Questo diede inizio ad un'era in cui i farmaci potevano essere purificati, studiati, e somministrati in dosi precise.

  4. Il muro nella mente:

    Directory of Open Access Journals (Sweden)

    Carmen Concilio

    2013-07-01

    Full Text Available A 78 anni, Nadine Gordimer, premio Nobel per la letteratura nel 1991, è infaticabile: il suo ultimo romanzo The Pick up è stato pubblicato negli Stati Uniti e in Inghilterra, dove ha ricevuto però tiepida accoglienza,e ora anche in Italia1. Alcuni mesi fa, tuttavia, Nadine Gordimer veniva ricordata dai giornali per un’impresa non letteraria: si tratta di un film-documentario dal titolo Johannesburg-Berlin, The Wall in the Mind, che Gordimer ha scritto e che ha girato con suo figlio, Hugo Cassirer, nel 1995-1996.

  5. La città come teatro / The City as a Theather

    Directory of Open Access Journals (Sweden)

    Jonathan Kirschenfeld

    2014-05-01

    Full Text Available Il lavoro di progettazione del nostro ufficio nel corso degli ultimi 15 anni comprende social housing, piscine pubbliche e progetti di teatri. Questi progetti apparentemente distanti condividono un filo comune che attraversa la loro forma concettuale se non fisica: il concetto di “stanza urbana” come teatro. In ogni caso, sia che si tratti di una piscina, di un teatro o di un’abitazione, mobili o adattabili a diversi siti, nel corso di questi progetti sono privilegiati gli spazi cosiddetti di “impegno sociale”. Queste stanze urbane, nelle parole di Aldo Rossi, agiscono per approntare la scena per il teatro della vita quotidiana.

  6. La crescita di Gesù nello Spirito Santo alla luce di Lc 4, 1. 14

    OpenAIRE

    Piotr Florencjan Szymański

    2006-01-01

    L’autore analizza i due versetti di Lc (4, 1. 14) in cui appare in modo evidente il legame fra Gesù e lo Spirito Santo nel contesto della tentazione del Signore da parte del diavolo. L’indagine di Lc 4, 1 mostra che Gesù, come in Mt e Mc, fu condotto nel deserto dallo Spirito che Egli ha ricevuto al battesimo. Grazie alla forza dello Spirito, Gesù è capace di affrontare il diavolo nella lotta iniziale decisiva e poi compiere fedelmente la sua missione. Realizzandola il Sig...

  7. I varchi della letteratura: tra scienza, follia e spiritualità

    Directory of Open Access Journals (Sweden)

    Stefano Redaelli

    2017-08-01

    Full Text Available Nel novecento italiano spiccano scrittori nella cui opera la letteratura si è aperta ad altre discipline, come la scienza, la psichiatria, la teologia. In questo articolo si descrive lo scambio tra saperi attraverso l’immagine dei varchi, portando l’esempio di Primo Levi (nel varco tra letteratura e scienza e Alda Merini (nel varco tra letteratura, follia, spiritualità. Se da una parte nella vita degli scrittori il varco è vissuto come spaccatura, dall’altra troviamo nella loro opera una fusione di saperi e linguaggi diversi, che concorrono a una rappresentazione più ampia della natura e dell’uomo.

  8. Wordstar professional : breve guida di consultazione

    OpenAIRE

    Biagioni, Stefania

    1990-01-01

    La presente nota ? una breve guida all'uso di WordStar Professional 4.0, utile per una rapida consultazione. Non intende esaurire l'argomento e neppure riportare tutto quello che pu? essere trovato nei manuali citati nella bibliografia presente nel testo. I comandi sono trattati secondo il raggruppamento dei MENU guida che WordStar offre agli utenti, mentre alcune delle funzioni pi? complesse sono spiegate pi? in dettaglio unitamente ad alcuni esempi.

  9. TERREMOTI DELLA VAL PADANA DEL 15-16 MAGGIO 1951

    Directory of Open Access Journals (Sweden)

    M. C. SPADEA

    1956-06-01

    Full Text Available Dalle notizie rilevate dalla Stampa
    e da quelle tratte dall'indagine che l'ufficio Centrale di Meteorologia
    ha compiuto per nostro conto, si è potuto stabilire che la zona epicentrale
    cadeva nel lodigiano, dove ha sviluppato una intensità valutata
    dal V I al V I I grado della scala Mercalli.

  10. Una rappresentazione simbolica di comunicazione urbana: il graffito

    Directory of Open Access Journals (Sweden)

    Luciano Spinelli

    2008-07-01

    Full Text Available La nostra intenzione è quella di dare una lettura semiotica dello spazio urbano attraverso lo studio dei graffiti necessari, in un’analogia della soggettivazione che il cittadino fa dello spazio nel suo vissuto quotidiano. I suoi graffiti sono integrati ad altri segni proposti dallo Stato e dall’iniziativa privata che compongono così l'apparenza loquace della città polifonica.

  11. se una notte d'inverno di italo calvino: la letteratura tra gioco ...

    African Journals Online (AJOL)

    User

    immergerti nel libro» non riesce più, e Calvino, sempre vigile nei commenti metanarrativi, interviene facendo ... pensi alla Lettrice che in questo momento sta aprendo anche lei il libro, ed ecco che al romanzo da ..... (la parola è di Calvino), si può rendere con la formula matematica di tre alla terza (33). In letteratura però i ...

  12. “Il Risorgimento in scena. Le donne in mostra”

    Directory of Open Access Journals (Sweden)

    Francesco Muollo

    2013-01-01

    Full Text Available Questo paper nasce in seguito alla raccolta dei lavori del convegno “IL RISORGIMENTO IN SCENA. LE DONNE IN MOSTRA”. Ciascuna delle tre giornate che hannoarticolato il convegno, sono dedicate al protagonismo femminile nel Risorgimento, rappresentate dal cinema, dalla danza e dall’ arte. Le arti figurative e sceniche hanno saputo, forse meglio dei libri, preservare la memoria delle donne che hanno fatto l’Italia.

  13. A reading of Antonio Tabucchi's Il filo dell'orizzonte | Wilson | Italian ...

    African Journals Online (AJOL)

    Questa lettura de Il filo dell'orizzonte (1986) di Antonio Tabucchi esamina il percorso del protagonista, Spino, attraverso gli spazi di una città. La sua è una ricerca ossessiva delle “segrete ragioni” che guidano una vita. Nel tentativo di restituire l'esistenza ad un morto, Spino percepisce che la reciprocità del legame fra vita e ...

  14. Generalizzazione cartografica tra ricerca e applicazione La Cartografia Tecnica Regionale delle Marche

    Directory of Open Access Journals (Sweden)

    Stefano Bellesi

    2007-03-01

    Full Text Available Il problema della generalizzazione cartografica è uno dei temi principe nel dibattito cartografico tra gli addetti ai lavori. La cartografia multiscala rappresenta infatti una delle chimere dell’era digitale e, man mano che i DB cartografici si sono popolati di informazioni, ha dimostrato la sua realtà. L’orientamento è quello di automatizzare al massimo tutte le procedure prendendo in considerazione quelle che sono le esigenze della rappresentazione.

  15. Customer response to media in marketing promotion: print versus online

    OpenAIRE

    Ieva, Marco

    2016-01-01

    Il lavoro di tesi, che si compone di tre articoli di ricerca, analizza, nel contesto della marketing promotion, la risposta del consumatore ai media in termini di ricordo, intenzione di acquisto, comportamento di acquisto e preferenza per il medium. Il lavoro, in particolare, mette a confronto due tipologie di media, carta e online, nell’ambito della price e loyalty promotion, utilizzando due disegni di ricerca sperimentali ed uno correlazionale. I risultati del lavoro mostrano che la rispost...

  16. Veredas inciertas, destinos cruzados. Migración femenina de Honduras y su paso por México

    OpenAIRE

    López Pozos, Cecilia

    2015-01-01

    Le donne migranti dell'America Centrale sin dall'infanzia vivono una storia di violenza personale e sociale che continua anche nel viaggio migratorio, nell'attraversare i confini di Honduras, Guatemala e Messico. Violentate dai gruppi criminali sono sottomesse e fragilizzate, alcune continuano la loro strada fino a raggiungere il confine settentrionale degli Stati Uniti, mentre altre decidono di riadattarsi ai nuovi spazi sociali. Oltre alle esperienze traumatiche soffrono alterazioni che inc...

  17. Cambiamenti nell’organizzazione territoriale in seguito alle migrazioni: La periferia del parco “W” – Benin, Burkina Faso, Niger

    OpenAIRE

    Ghisalberti, Alessandra

    2008-01-01

    La periferia del Parco Regionale “W” (Benin, Burkina Faso e Niger) è caratterizzata da una molteplicità etnica, oltre che da flussi migratori che generano mutazioni nell’organizzazione territoriale. L’obiettivo dell’articolo è di mostrare i cambiamenti determinati da tali processi migratori, in un contesto sprovvisto di dati diretti sulle migrazioni. La metodologia utilizzata si basa su una banca-dati di terreno, raccolti nel corso di una pluriannuale ricerca, e le analisi vengono presentate ...

  18. Real Estate Crowdfunding. Un’innovazione finanziaria per gli investimenti immobiliari

    Directory of Open Access Journals (Sweden)

    Giacomo Morri

    2016-12-01

    Full Text Available Questo articolo presenta una panoramica del crowdfunding e delle sue potenziali applicazioni al settore immobiliare. La crisi economica globale del 2008 ha condotto a una paralisi dell’economia che ha comportato la riduzione della fiducia nel sistema bancario e nei servizi finanziari in generale. Nell’ultimo decennio una delle tecniche di finanziamento più rivoluzionaria è stata il crowdfunding, cioè la possibilità di essere finanziati dalla “folla” (crowd attraverso l’utilizzo di Internet. Il crowdfunding nel settore immobiliare ha origine negli Stati Uniti nel 2012 con il Jumpstart Our Business Start-up Act (JOBS Act, dove da allora si sta sviluppando a ritmi elevati. In Italia, il crowdfunding per progetti nel settore immobiliare non si è ancora sviluppato in quanto la legge in concreto non ne consente l’utilizzo; tuttavia esistono alcune piattaforme che stanno utilizzando il concetto in modi differenti, raccogliendo un certo interesse. Il Real Estate Crowdfunding può rappresentare un’interessante opportunità per i privati che vogliono investire nel settore immobiliare, ma non hanno abbastanza capitale per partecipare a grandi transazioni o esperienza nella gestione. In quest’articolo, dopo un’iniziale descrizione del crowdfunding in generale, ci si focalizza sulla sua applicazione nel settore immobiliare, analizzando il mercato statunitense dove vi sono le piattaforme più sviluppate. Infine, si presenta una panoramica del mercato italiano, spiegando le normative e i limiti del crowdfunding e descrivendo la modalità operativa sviluppata da alcune piattaforme per superare legalmente tali limitazioni. Negli Stati Uniti sono già operative oltre 125 piattaforme con una raccolta superiore a un miliardo di dollari; in Italia invece ci sono ancora limiti per le start-up che si occupano di crowdfunding e sono state create solo poche piattaforme che operano con un modello parzialmente diverso.

  19. Doutorado sanduíche: considerações para uma experiência de sucesso no exterior Doctorado sándwich: consideraciones para una experiencia exitosa en el extranjero 'Sandwich PhD': considerations for a successful experience abroad

    Directory of Open Access Journals (Sweden)

    Marina de Goes Salvetti

    2013-03-01

    Full Text Available O estágio de doutorado no exterior, conhecido, no Brasil, como "Doutorado Sanduíche", é uma oportunidade de aprimorar as habilidades em pesquisa, destacar-se no meio acadêmico e estabelecer e/ou ampliar oportunidades de trabalho em contexto internacional. Neste artigo, descrevemos elementos-chave do processo de planejamento e desenvolvimento do Doutorado Sanduíche aprendidos por professores e alunos envolvidos na colaboração entre a Escola de Enfermagem da Universidade de São Paulo e a Lawrence S. Bloomberg Faculty of Nursing, Universidade de Toronto, Canadá, e apresentamos a participação em uma rede de doutorados, como alternativa ao Doutorado Sanduíche. A experiência internacional, quando bem planejada e desenvolvida, promove o desenvolvimento pessoal e profissional do aluno, favorece a internacionalização dos programas de pós-graduação e dos grupos de pesquisa brasileiros.Una estancia de doctorado internacional, "Doctorado Sándwich" como es conocido en Brasil, es una oportunidad de mejorar las habilidades de investigación, hacerse conocido académicamente y establecer y/o agrandar las oportunidades de trabajo en el contexto internacional. En este artículo, nosotros describimos factores importantes del proceso de la planificación y desarrollo del "Doctorado Sándwich" aprendidos por estudiantes y profesores involucrados en la colaboración entre la Escuela de Enfermería de la Universidad de São Paulo y la Facultad de Enfermería Lawrence S. Bloomberg, Universidad de Toronto, Canadá y presentamos la participación en una red de doctorados como una alternativa a la estancia doctoral internacional. La experiencia internacional, cuando bien planeada y desarrollada, promueve el desarrollo personal y profesional del estudiante y favorece la internacionalización de los programas de postgrado y de los grupos de investigación brasileños.International PhD internship, named "Sandwich PhD'" in Brazil, is an opportunity to

  20. Tendenza al minor sforzo dell'espressione nelle lingue romanze

    Directory of Open Access Journals (Sweden)

    Mitja Skubic

    2013-12-01

    Full Text Available Lʼidea dello sforzo minore - in linea generale valida e rispettata - è senzʼaltro giusta. Havers (1931 a pienamente ragione. Dobbiamo però considerare che lʼesprimersi troppo succintamente non è sempre il più facile, anche se per il locutore più sbrigativo, e - se non cʼè dubbio che esprimersi ampiamente, con più elementi linguistici, sia desiderabile e auspicabile da parte dellʼinterlocutore - non è sempre facile nemmeno per il locutore, "più facile" nel senso di trovare subito il termine adeguato, forse più espressivo che convenga allʼinterlocutore. Il locutore è certo il nucleo della comunicazione, vuol dire, può creare espressioni nuove, il che è nella lingua un procedimento costante, oppure scegliere tra le possibilità che gli si offrono, persino violando il sistema morfosintattico valido il che può portare addirittura allʼannientamento del sistema in vigore e la sua sostituzione con un altro. Il che si verificò, nel mondo linguistico romanzo, appunto con il declino totale dellʼesistenza del sistema della flessione del sostantivo, e parzialmente nel sistema del verbo, in misura minore in quello del pronome. Analizzando tali cambiamenti constatiamo che il principio della legge del minor sforzo, formulato da Havers (1931, è senzʼaltro valido, cerchiamo tuttavia di trovare le ragioni le quali, talvolta, spingono il locutore a violare il sistema in vigore. Crediamo che anche in tale scelta abbia un peso importante una espressione o una struttura spontanea, perciò più naturale e con questo più facile.

  1. La sociologia oltre la globalizzazione

    OpenAIRE

    Ceri, Paolo

    2017-01-01

    Gli esiti di una riflessione collettiva sul rapporto tra la sociologia e la globalizzazione, che qui cerchiamo di avviare, sono tutt’altro che scontati e ancor meno certi nella loro utilità. Si tratta, infatti, di mettere in relazione una pratica conoscitiva – la sociologia – e una fenomenologia – la globalizzazione – che si presentano all’incontro nel modo più asimmetrico. L’una, la sociologia, debilitata e frammentata; l’altra, la globalizzazione, invadente e ubiqua. L’una, incerta nella pr...

  2. L’immaginario collettivo nell’era biomediatica

    Directory of Open Access Journals (Sweden)

    Massimiliano Valerii

    2017-12-01

    Full Text Available Grazie alla diffusione delle tecnologie digitali, nel giro di un decennio la grande trasformazione dei media ha determinato una rivoluzione copernicana, che ha posto l’io-utente al centro del sistema. Questo lavoro prende spunto dal 14° Rapporto sulla comunicazione del Censis per analizzare i processi in corso. In particolare, ci si focalizza sull’ingresso nella cosiddetta era biomediatica, caratterizzata dalla trascrizione virtuale e dalla condivisione telematica in tempo reale delle biografie personali attraverso i social network, che sanciscono il primato dell’io-utente, produttore esso stesso – oltre che fruitore – di contenuti.

  3. Deborah Cadbury, Princes at War: The British Royal Family’s Private Battle in the Second World War

    OpenAIRE

    Baldoli, Claudia; Petrella, Luigi

    2017-01-01

    Le vicende della famiglia reale inglese durante la Seconda guerra mondiale sono al centro del libro di Deborah Cadbury, scrittrice di storia pluripremiata e per trent’anni producer della BBC. Il suo lavoro parte dalla crisi che condusse nel 1936 all’abdicazione di Edoardo VIII, che rinunciò al trono per sposare Wallis Simpson, e si snoda negli anni della crescente minaccia nazista in Europa. Il fratello minore Albert, che divenne re con il nome di Giorgio VI, pur afflitto dalla balbuzie e da ...

  4. “Patti di morte”. Internet, suicidi e la spettacolarità del crimine / "Pactes de mort." Internet, suicides et spectacularité du crime / “Pact of death”: Web, Suicides and the Crime Show

    OpenAIRE

    Mason C.

    2010-01-01

    Il Web è diventato davvero uno specchio per vanitosi? Giovani e adulti si cimentano in bravate, oscenità, per poi filmarsi e pubblicare il video. Anche il suicidio può venire facilitato dal Web: mentre in Giappone si sottoscrivono patti di morte con sconosciuti, in occidente ci si toglie la vita di fronte la webcam nella solitudine della propria stanza. Se nel paese orientale le persone cercano di fuggire da una società che le rifiuta, che accetta solo la maschera che mostrano in pubblico e n...

  5. Antoine Hatzenberger, Rousseau et l’utopie. De l’état insulaire aux cosmotopies

    OpenAIRE

    Todesco, Francesca

    2016-01-01

    Il saggio di Hatzenberger propone un’ampia riflessione sul tema dell’utopia, affrontato nella sua complessità percorrendo l’opera di Rousseau dai primi scritti alle pubblicazioni postume. «Rousseau était-il utopiste?» (p. 7): è un interrogativo relativo alla storia della ricezione, centrale nel dibattito interpretativo sull’opera di Rousseau. Ma è anche una questione che interessa la storia delle idee e domanda che si consideri, oltre ai motivi utopici che percorrono il pensiero di Rousseau, ...

  6. 23 000 000 a.C. - 2014 d.C.Natura e architetture nell’arcipelago di La Maddalena

    Directory of Open Access Journals (Sweden)

    Andrea Grippo

    2014-12-01

    Full Text Available Esistono zone d’indeterminazione concettuale, percettiva, emozionale che l’uomo traduce spontaneamente in articolazioni spaziali dialettiche. Per renderle più comprensibili e al tempo stesso più ambigue, le carica d’immagini che sono tanto più forti quanto più sono sganciate da una diegesi riconoscibile. Questo le fa galleggiare nel senso senza che debbano sforzarsi di produrre senso, disarticolate, neutralizzanti. E proprio per questo riescono ad attivare nell’uomo una condizione di sospensione estatica, dentro il tempo e fuori dalla storia.

  7. Accesso a internet, libertà religiosa informatica e buon costume

    Directory of Open Access Journals (Sweden)

    Luca Pedullà

    2012-11-01

    Full Text Available SOMMARIO: 1. Accesso a internet: nuove libertà e nuovi pericoli – 2. La formazione individuale del sentire religioso, oggi, nel nuovo contesto che potremmo definire di "libertà religiosa informatica" – 3. L'attuale senso della nozione di "buon costume" al vaglio del cyberspace e ipotesi de jure condendo.

  8. The Cinema of Federico Fellini and 8½ | Cardullo | Italian Studies in ...

    African Journals Online (AJOL)

    L'articolo ripercorre i grandi temi del cinema di Federico Fellini alla luce della sua biografia: nel nodo tra arte e vita, l'autore vede i segni di un rapido superamento delle strettoie del neorealismo, da cui il regista era partito, e un approdo ai grandi temi di un'immaginazione, qui definita 'neo-romantica', che si muove tra ...

  9. Design e valutazione di una esperienza di mobile learning

    Directory of Open Access Journals (Sweden)

    Marco Arrigo

    2008-01-01

    Full Text Available Analisi dello sviluppo scientifico e tecnologico nel campo di mobile learning, con particolare riferimento ai problemi di progettazione e valutazione nelle esperienze. Vengono analizzate le caratteristiche di metodologia didattica innovativa insieme a delle proposte per strumenti operativi concreti che consentano di progettare interventi didattici di mobile learning.

  10. Equazioni: le icone del sapere

    NARCIS (Netherlands)

    Bais, S.

    2009-01-01

    Il mistero del cosmo è scritto nel linguaggio della matematica, e le equazioni sono le frasi che ne esprimono la bellezza e la profondità. Cercare di spiegare la scienza senza equazioni è come cercare di spiegare l’arte senza illustrazioni: partendo da questo presupposto, Sander Bais presenta una

  11. The launch of new brands by professional soccer teams: The case of U.S. Lecce – Salento 12

    OpenAIRE

    P. Guenzi; M. Nocco

    2006-01-01

    L'articolo analizza la letteratura sul branding nel marketing sportivo e partendo da essa sviluppa e testa empiricamente su un campione di tifosi del Lecce un modello che valuta le determinanti del successo del lancio di un nuovo marchio ad esso associato.

  12. ARTICLES / SAGGI

    African Journals Online (AJOL)

    User

    per l'italiano» infatti «mancano ancóra indagini esaustive nel settore: le difficoltà stanno non nelle carenze degli apparecchi, ma nella teoria linguistica, o nella realtà da descrivere, o in entrambe8. Di questo stato di cose, è naturale che anche ...

  13. Premessa del progetto esecutivo del piano pilota per la conservazione dei beni culturali in Umbria / Introduction to the executive project of the Pilot plan for the “programmed conservation” of cultural heritage in Umbria Region

    Directory of Open Access Journals (Sweden)

    Giovanni Urbani

    2011-11-01

    Il primo testo prescelto, che appare ancora oggi sostanzialmente attuale e predittivo rispetto ai problemi contemporanei della gestione dei beni culturali, è lapremessa al progetto esecutivo del piano pilota per la conservazione dei beni culturali della regione Umbria, elaborato da Giovanni Urbani nel 1975.

  14. Momenti nella vita di uno scienziato

    CERN Document Server

    Rossi, Bruno

    1987-01-01

    Nel giro di pochi decenni, la nostra visione del mondo fisico, dal mond subatomico al mondo del cosmo, ha subito una profonda evoluzione. In questo libro, uno degli scienziati che hanno contribuito a tale sviluppo narra la storia della sua vita e del suo lavoro.

  15. Inizio di Carlo Sini: la crisi dei saperi e il compito pedagogico del pensiero

    Directory of Open Access Journals (Sweden)

    Paolo Beretta

    2016-08-01

    Full Text Available Nelle diverse sezioni che compongono Inizio, Carlo Sini affronta in vari modi, a partire da spunti differenti, la crisi attuale dei saperi nel loro senso complessivo e la necessità per la filosofia di ritornare alla sua vocazione pedagogica.

  16. Nicola Turi (ed., Ecosistemi letterari. Luoghi e paesaggi nella finzione novecentesca

    Directory of Open Access Journals (Sweden)

    Salvatore Renna

    2017-11-01

    Full Text Available In un articolo recentemente apparso per il New York Magazine, il giornalista David Wallace-Wells ha tracciato un quadro quanto mai apocalittico del destino che attende il nostro pianeta nel futuro prossimo. L’interpretazione decisamente pessimistica della situazione ambientale fornita dall’autore, basatosi sui più recenti studi sul cambiamento climatico, ha sollevato non poche polemiche.

  17. Gentile e i matematici italiani lettere 1907-1943

    CERN Document Server

    Nastasi, Pietro

    1993-01-01

    Che cosa possono scrivere dodici grandi matematici italiani, tra cui Guido Castelnuovo, Federigo Enriques e Leonida Tonelli, a Giovanni Gentile? La pubblicazione di questo carteggio, ricavato dal patrimonio archivistico del Fondo Gentile, getta una nuova luce su alcuni aspetti della storia della scienza (e della cultura) italiana nel nostro secolo, nonché sulla figura dello stesso Gentile.

  18. Guardarsi per incontrarsi: la costruzione della relazione di cura con il migrante

    Directory of Open Access Journals (Sweden)

    Ivo Lizzola

    2013-12-01

    Full Text Available Questa introduzione apre la seconda parte del numero monografico, i cui interventi focalizzano la loro attenzione sugli operatori impegnati nel lavoro di cura con persone che appartengono a culture Altre o sulla società d’accoglienza. Nella giornata congressuale, invece, il Prof. Lizzola apriva la giornata con un saluto e qualche riflessione; riflessioni riportate ora qui sotto.

  19. I LABIRINTI NARRATIVI DI MARCELLA CIONI

    African Journals Online (AJOL)

    User

    La critica ufficiale non ha ancora colto l'alta cifra stilistica e la complessa struttura .... Il viaggio all'interno di se stessi, conseguente al trauma conflittuale col mondo ..... proprio “centro”, che si scatena in una forte energia pulsionale. (nel caso di ...

  20. la condizione psicologica dell'io nelle opere di giorgio saviane

    African Journals Online (AJOL)

    User

    by the “I” in order to acquire a moral and cultural identity. A journey which. Saviane develops in three phases: in Il .... castrato dai vizi educativi di una cultura borghese che ha perso ogni autentico slancio morale ed è scaduta nel culto di una .... familiare, il patrimonio familiare. (123). Anche la storia sembra aver ucciso il suo ...

  1. il verbo di bodhisattva». de pisis, le avanguardie, l'oriente

    African Journals Online (AJOL)

    User

    Il Verbo di Bodhisatthva (1917), written at the end of de Pisis' avant-garde years, starts from the ... Egli seguiva molto la rivista dato che, nel periodo in cui la diresse De ..... Blavatsky, sosteneva l'ipotesi secondo la quale, alla base di tutte le.

  2. Editoriale

    Directory of Open Access Journals (Sweden)

    Egidio Pozzi

    2014-01-01

    Full Text Available Questo numero della rivista presenta due articoli proposti rispettivamente al Quarto Incontro di Studio di Analitica, tenuto a Rimini nel marzo del 2006, e all'International Conference on Music Perception and Cognition (ICMPC9 che si svolse a Bologna dal 22 al 26 agosto dello stesso anno.

  3. NOTES AND GLEANINGS / NOTE E CURIOSITÀ

    African Journals Online (AJOL)

    User

    per le loro idee lontane da ogni conformismo e da ogni pacificazione, lontane da ogni convenienza, confraternita, piccola corte.” (9) “Eretici” nel senso etimologico del termine, che deriva dal greco hairein, prendere, scegliere, questi poeti scelgono l'assoluto della poesia, l'amore folle e senza riserve, la dedizione oscura e ...

  4. nelle pagine di dolores prato

    African Journals Online (AJOL)

    User

    il libro possa vedere la luce. Passeranno altri diciassette anni prima dell'uscita dell'edizione integrale del testo, curata da Giorgio Zampa sul dattiloscritto originale. 3. Cfr. a riguardo Veschi (2008:82) che, nel sottolineare l'importanza dell'organizzazione. «spaziale» del libro, individua nella casa degli zii il primo di una serie ...

  5. INTRODUZIONE / INTRODUCTION

    African Journals Online (AJOL)

    Lumley, nel lontano (ma non troppo) 1996. L'apparizione di quel libro ha provocato una sorta di reazione a catena il cui primo risultato è stato il numero di Annali d'Italianistica del 1998, dedicato anch'esso agli Italian Cultural Studies, che in un certo senso ne rappresenta il corrispettivo nordamericano (Dombroski 1998). A.

  6. l'isola di demetra e il destino di kore nelle poesie di dacia maraini1

    African Journals Online (AJOL)

    User

    infine, con il racconto biografico, Bagheria, uscito nel 1993,5 ci fornisce forse la chiave adatta a spiegare con risvolti più profondi il vincolo che la lega all'isola materna. Il libro è un viaggio affascinante nella memoria in cui rievoca luoghi, tempi, personaggi, odori e colori di tempi passati. Emerge la. Bagheria mitica della sua ...

  7. Risparmi e investimenti nei principali paesi industriali.

    Directory of Open Access Journals (Sweden)

    S. LEONETTI

    2014-08-01

    Full Text Available Nel presente lavoro vengono  esaminati tre fenomeni strettamente connessi fra loro: la formazione del risparmio, la dissociazione fra risparmi e investimenti e i movimenti internazionali di capitali.  Nella parte relativa alla formazione del risparmio vengono in particolare studiate, ricorrendo a stime economiche, le relazioni che intercorrono fra prelievo netto della Pubblica Amministrazione e il risparmio delle famiglie.

  8. Uso dello spazio da parte dello scoiattolo comune (Sciurus vulgaris in bosco di conifere

    Directory of Open Access Journals (Sweden)

    M. Adamo

    2003-10-01

    Full Text Available Nell?ambito di un progetto di ricerca sull?ecologia dello scoiattolo comune in boschi di conifere delle Alpi, abbiamo avviato uno studio con la radiotelemetria per indagare i fattori che influiscono sull?uso dello spazio da parte degli animali. I risultati riportati nel presente lavoro si riferiscono a due anni successivi caratterizzati da una diversa disponibilità alimentare. L?area di studio si trovava nel Parco Nazionale del Gran Paradiso, in Val di Rhemes, all?interno di una pecceta subalpina (Picea abies 85%, Larix decidua 11%, alberi morti 4%. La produzione energetica del bosco (semi delle conifere è stata valutata moltiplicando il n. di piante per ettaro x il n. medio di coni prodotti (contati su 60 alberi campione x il n. medio di semi per cono x il peso medio dei semi, trasformando poi la biomassa in Mj. Le catture sono state effettuate tre volte l?anno nel 2001 e 2002 con 30 trappole incruente Tomahawk tipo 201. Diciotto scoiattoli nel 2001 e 13 nel 2002 sono stati dotati di radiocollare (PD-2C Holohil Systems Ltd. e seguiti in estate e autunno. Sono stati calcolati i seguenti parametri: home range MCP 100%, MCP 95% (animali con singole escursioni, 100% Cluster-based (animali che usavano differenti aree di attività; stime delle core-area mono e multinucleari effettuate con la tecnica della Cluster Analysis 85%; sovrapposizione delle core-area. Nel 2001, all?inizio dell?estate, 4 maschi su 8 e 7 femmine su 8 sono emigrati nella valle adiacente o a quote più basse. Nel 2002, tutti gli individui sono rimasti residenti. La dimensione media degli home range stagionali nel 2001 è stata di 83,30 ± 48,72 ha (n = 30 contro 31,04 ± 16,65 ha (n = 19 nel 2002, la media delle core-area è stata 18,18 ± 17,74 ha nel 2001 e 9,36 ± 5,40 ha in 2002 (Kruskal-Wallis ANOVA: home range H = 22,6; g.l. = 1, P < 0,0001; core-area H = 4,55, g.l. = 1, P = 0,033. La sovrapposizione delle core-area maschio/femmina e femmina/maschio

  9. Disturbi dello spettro autistico tra filosofia della medicina e delle neuroscienze

    Directory of Open Access Journals (Sweden)

    Carlo Maria Cirino

    2012-05-01

    Full Text Available L’autismo è un disturbo pervasivo dello sviluppo neuropsicologico che interessa all’incirca un bambino su mille. Purtroppo, si tratta di un dato destinato ad aumentare, anche per via dell’interesse mediatico e scientifico che questa patologia è stata capace di richiamare intorno a sé. Da un lato, infatti, sono aumentate le richieste di screening presso i numerosi centri che monitorano questa complessa patologia neurologica e dall’altro sono migliorate le tecniche di diagnosi che sempre più spesso si avvalgono di esami genetici all’avanguardia in aggiunta alle ormai classiche interviste psicologiche. L’autismo pone, dunque, serie questioni all’attenzione della ricerca scientifica sia nel vasto campo delle neuroscienze che in quello della neuropsichiatria e della psicologia clinica. Ebbene: quel settore della filosofia che guarda alla scienza con interesse particolare, non può che seguire con partecipazione i progressi nella spiegazione di questa misteriosa patologia che, attualmente, resta un vero e proprio rompicapo per tutti coloro che hanno a che fare con la complessità dell’organizzazione cerebrale dell’essere umano.

  10. The Making of RDA

    Directory of Open Access Journals (Sweden)

    Tom Delsey

    2016-05-01

    Full Text Available L'autore ripercorre lo sviluppo di RDA dal principio, nel 2005, fino alla sua prima pubblicazione, nel 2010. L'impegno di sviluppo è inserito nel contesto di un ambiente digitale in evoluzione che trasforma sia la produzione sia la diffusione delle risorse informative e delle risorse utilizzate per creare, immagazzinare e accedere ai dati che descrivono tali risorse. L'autore esamina l'interazione tra l'impegno strategico ad allineare RDA con i nuovi modelli concettuali, le strutture di database emergenti e lo sviluppo dei metadati nelle comunità alleate, da una parte, e la compatibilità con l'eredità di AACR2 e dei database esistenti dall'altra. Gli aspetti esaminati comprendono la strutturazione di RDA come linguaggio di descrizione delle risorse, l'organizzazione del nuovo standard come uno strumento di lavoro e il raffinamento delle linee guida e delle istruzioni per la registrazione dei dati secondo RDA.

  11. La ricostruzione grafica del pavimento musivo di una villa romana

    Directory of Open Access Journals (Sweden)

    Caterina Gattuso

    2015-01-01

    Full Text Available Nel processo di analisi conoscitiva finalizzato alla conservazione e/o al restauro di un manufatto storico, la documentazione grafica offre un contributo importante ai fini della redazione del quadro anamnesico. Essa costituisce uno strumento conoscitivo che, nel rappresentare e registrare lo stato di conservazione nonché gli eventuali interventi di restauro cui il bene è stato sottoposto, permette di completare e di integrare le informazioni già ottenute mediante il dossier fotografico. In questo contesto si vuole dimostrare l’importanza del disegno informatico, da intendere come strumento utile per l’elaborazione di un corretto piano diagnostico, illustrando la ricostruzione grafica di una complessa pavimentazione musiva che decora un particolare ambiente di una villa di epoca romana posta sulle rive del lago d’Esaro nel comune di Roggiano Gravina (CS, ottenuta attraverso l’uso di un particolare software di design grafico e disegno vettoriale.

  12. Os imigrantes italianos em São Paulo, na perspectiva de Alcântara Machado

    Directory of Open Access Journals (Sweden)

    Vera Lúcia de Oliveira

    2004-12-01

    Full Text Available Il libro Brás, Bexiga e Barra Funda, di Alcântara Machado, pubblicato nel 1927, tratta della vit di alcuni quartieri poplari di San Paolo (indicati nel titolo dell´opera, obitari da immigranti italiani. Il narratore rappresenta questo universo - ora con simpatia ora con ironia - rivelando, in modo chiaro o tra le righe, gli sterotipi in voga in quel periodo sugli italiani arrivati da poco, che non conoscevano ancora la lingua e le tradizioni del Brasile, ma desideravano raggiungere rapidamente una posizione social ed economica elevata, per conquistare un posto nella nuova società. Nell´articolo si propone una lettura dello scontro fra gli immigranti e la società brasiliana, scontro filtrato nei racconti che presentano - con straordinaria vivacità - il quotidiano dei quartieri popolari di San Paolo, proprio nel momento in cui vari gruppi di immigranti stanno vivendo il processo di integrazione e assimilazione.

  13. Rimozione Urbana: La Necessità di una Nuova Direzione di Attività di Pubblica Amministrazione

    Directory of Open Access Journals (Sweden)

    Eneida Criscuolo Gabriel Bueno Silva

    2015-12-01

    Full Text Available Questo lavoro si propone di discutere la legitimità delle decisioni amministrative nel democratico Stato di diritto; il discorso e la democrazia sono correlati nel mondo contemporaneo, mostrando la necessità di discussione pubblica in attività amministrativa, in tale contesto, con il passare dell'atto amministrativo, la razionalità degli decisioni amministrativa dovrebbe essere dimostrata attraverso del processo amministrativo come mezzo di discussione in una prospettiva democratica. Pacifico che il discorso è un mezzo attraverso il quale la democrazia può avvenire, ma devono osservare qui: senza partecipazione sociale, senza coscienza politica, il discorso porta a una democrazia apparente. Questo articolo discute la relazione tra democrazia, discorso e attività amministrativa in processi di rimozione urbana, indagando gli aspette che riguardano, a fini de equilibrio nel rapporto tra stato e cittadino. Questo lavoro ha origine de una ricerca de 2232 documenti, utilizzando la tecnica di analisi di contenuto.

  14. [Role of vitamin D in female reproduction].

    Science.gov (United States)

    DE Leo, Vincenzo; Cappelli, Valentina; Morgante, Giuseppe; DI Sabatino, Alessandra

    2017-11-10

    La vit. D, o calcitriolo, è stata identificata inizialmente nei primi anni '20 ed ha un ruolo chiave nella regolazione del metabolismo osseo, nell'omeostasi del calcio e del fosforo e nel promuovere la mineralizzazione ossea. Le azioni della vit. D sono mediante tramite un recettore nucleare (VDR), che è espresso in numerosi organi come l'intestino, l'osso e il rene, ma anche nelle gonadi, nel seno, nel pancreas, nel sistema cardiovascolare, nel cervello (microglia) e nelle cellule del sistema immunitario. In tutti questi tessuti bersaglio non classici la 1,25(OH)2D sembra avere un ruolo nel ridurre il rischio di alcune malattie croniche (incluso il cancro, le infezioni, le patologie autoimmuni e cardiache) attraverso la modulazione della crescita cellulare, un'azione neuromuscolare, immunitaria e antiinfiammatoria. Il VDR agisce soprattutto attraverso la regolazione dell'espressione di quei geni i cui promotori contengono specifiche sequenza DNA note come vitamin D response elements (VDRE). La vit. D ha un ruolo chiave sia nella fisiologia della riproduzione che nello sviluppo di varie patologie ginecologiche come la PCOS, l'endometriosi, la fibromatosi e anche di tipo ostetrico (pre-eclampsia, diabete gestazionale) e negli ultimi tempi sta assumendo un ruolo importante nelle tecniche di fecondazione in vitro.

  15. Il mondo in un giardino (e in un labirinto, in un tappeto, in un romanzo illimitato

    Directory of Open Access Journals (Sweden)

    Guido Laino

    2011-06-01

    Full Text Available Per Michel Foucault il giardino è il più antico esempio di un’eterotopia che “ha il potere di giustapporre, in un unico luogo reale, diversi spazi, diversi luoghi che sono tra loro incompatibili” (Foucault 1994, 16; è un luogo sacro di tradizione millenaria che, in Oriente, rappresenta simbolicamente un microcosmo, “la più piccola particella del mondo e […] anche la totalità del mondo” (ibid. 18. Il giardino è un’eterotopia che Foucault pone in parallelo allo spazio teatrale e al cinema, che nella propria cornice pure riproducono il mondo nella sua sostanza eterogenea: nell’opera d’arte, come nel giardino, convivono diversi luoghi, le distanze sono ridotte alla geometria della propria rappresentazione, il tempo si comprime o si espande all’interno di un ordine narrativo funzionale alla rilettura dell’artista.

  16. La politica ottimale per il Mezzogiorno:un commento a Moro

    Directory of Open Access Journals (Sweden)

    Bert Jossa

    2002-09-01

    Full Text Available In uno scritto recente ho sostenuto la tesi che la politica ottimale per il Mezzogiorno non è il laissez faire, né l’intervento diretto dello stato nell’economia, ma un intervento pubblico, anche “massiccio”, realizzato mediante leggi generali e astratte, che per loro natura sono di tipo non discrezionale.La necessità di un intervento generalizzato a favore di una zona meno sviluppata si giustifica con l’esistenza delle “diseconomie esterne”, che frenano lo sviluppo di tutte le imprese che operano in quella zona. Ha destato, perciò, in me meraviglia leggere l’articolo scritto contemporaneamente da Beniamino Moro (2001 e pubblicato nel numero 215 di questa rivista, che raggiunge lo stesso risultato con argomentazioni di segno opposto.

  17. L'equazione di Dio Einstein, la relatività e l'universo in espansione

    CERN Document Server

    Aczel, Amir D

    2000-01-01

    Prendendo in esame le ultime scoperte della comunità scientifica mondiale, l'autore parla di cosmologia, ovvero lo studio della natura dell'universo. Servendosi di Einstein e delle sue teorie che spiegano i legami tra relatività e cosmologia, Aczel ci spiega come il grande scienziato si sia praticamente trasformato nel portavoce di Dio rivelandoci le verità fondamentali dell'universo in cui viviamo. In realtà lo studioso, quando nel 1912 dedusse dai suoi calcoli che l'universo era in continua espansione, ritenne implausibili le conclusioni della sua scoperta e inventò una costante matematica (la "costante cosmologica") che ovviasse al problema. Oggi la scienza conferma sempre più quell'ipotesi di novant'anni fa.

  18. Note di fotonica

    CERN Document Server

    Degiorgio, Vittorio

    2016-01-01

    L’invenzione del laser ha generato una vera rivoluzione nella scienza e nella tecnologia e ha dato luogo alla nascita di una nuova disciplina chiamata Fotonica. Le applicazioni della Fotonica che hanno un impatto cruciale in molti ambiti della nostra vita sono le comunicazioni in fibra ottica su cui si basa il funzionamento di Internet e del traffico telefonico su grandi distanze, i dischi ottici (CD, DVD, Blu-ray), la sensoristica ottica di tipo industriale e ambientale, la lavorazione dei materiali e la chirurgia con il laser, l’illuminazione con i LED. Questa seconda edizione contiene diversi ampliamenti e modifiche al testo pubblicato nel 2012, che ha colmato un vuoto nel panorama italiano di testi universitari riguardanti la Fotonica. Dopo avere esposto in modo sintetico ma rigoroso i concetti che stanno alla base del funzionamento del laser e della propagazione della luce nella materia, sono descritti i principali componenti e dispositivi ottici e optoelettronici, quali le fibre ottiche, gli amplifi...

  19. Studio di prototipo di calorimetro per neutroni per l'esperimento ALICE

    CERN Document Server

    Arnaldi, R; Cicalò, C; Cortese, P; De Falco, A; Dellacasa, G; De Marco, N; Gallio, M; Macciotta, P; Masoni, A; Musso, A; Oppedisano, C; Piccotti, A; Puddu, G; Scomparin, E; Siddi, S; Serci, E; Soave, C; Usai, G L; Vercellin, Ermanno

    1999-01-01

    ALICE e uno dei quattro esperimenti previsti ad LHC, al CERN, il cui scopo e lo studio delle osservabili che danno informazioni rilevanti sulla formazione del quark gluon plasma, che potrebbe essere prodotto in collisioni centrali Pb-Pb, di energia nel centro di massa di 5.5 A TeV.Il parametro di impatto di tali collisioni verra determinato grazie ad un insieme di calorimetri per protoni e neutroni che misureranno l'energia portata in avanti dai nucleoni non interagenti(spettatori).E' stato costruito un prototipo di calometro per neutroni, formato da piani di fibre di quarzo, posti a 45 gradi rispetto all'asse del fascio e inframmezzati da piani di materiale passivo denso(tungsteno). La luce Cerenkov prodotta nelle fibre dallo sciame sviluppato nel materiale passivo,viene raccolta da guide ottiche in aria.Verranno presentati i rilustati di un test previsto al CERN SPS per il luglio 1999.

  20. Evidence Based Education: un quadro storico

    Directory of Open Access Journals (Sweden)

    Giuliano Vivanet

    2013-08-01

    Full Text Available Nel corso dell’ultimo decennio, nel pensiero pedagogico anglosassone, si è affermata una cultura dell’evidenza cui ci si riferisce con l’espressione “evidence based education” (EBE. Secondo tale prospettiva, le decisioni in ambito educativo dovrebbero essere assunte sulla base delle conoscenze che la ricerca empirica offre in merito alla minore o maggiore efficacia delle differenti opzioni didattiche. Si tratta di un approccio (denominato “evidence based practice” che ha origine in ambito medico e che in seguito ha trovato applicazione in differenti domini delle scienze sociali. L’autore presenta un quadro introduttivo all’EBE, dando conto delle sue origini e dei differenti significati di cui è portatrice.

  1. I corpi disponibili dei lavoratori senza progetti

    Directory of Open Access Journals (Sweden)

    Andrea Pietrantoni

    2011-07-01

    Full Text Available Quei lavoratori senza progetti, cui sarcasticamente si allude nel titolo, debbono essere sempre pronti ad un nuovo incarico (non a caso si parla di missione, capaci di immaginarsi in nuove attività, plastici e performanti; traggono la loro motivazione e un’improbabile compensazione in un’impiegabilità, sempre revocabile e provvisoria, che trasforma il lavoro in una ricerca trobadorica, in un percorso spirituale. La possibilità di accedere ad un’occupazione è vincolata a un continuo rimodellamento della proprie caratteristiche, attitudini, abilità, con un dispendio di risorse, materiali e simboliche, che supera ampiamente la riorganizzazione di tempi e spazi di vita in funzione della produttività imposta dal fordismo, o l’iperidentificazione con il proprio lavoro nel senso weberiano del sentirsi vocati a ciò che si fa.

  2. Evoluzione dell' abitudine al fumo nei locali dellíAzienda Ospedaliera Universitaria Senese dal 1998 al 2003

    Directory of Open Access Journals (Sweden)

    B. Bianconi

    2003-05-01

    Full Text Available

    Obiettivi: l’ospedale dovrebbe rappresentare un modello per la promozione della salute, tuttavia, nonostante i divieti di legge, l’abitudine di fumare in ospedale è ancora diffusa. Obiettivo dello studio è rilevare l’abitudine al fumo di personale sanitario, pazienti e visitatori, nei locali dell’AOUS.

    Metodi: alcuni studenti universitari, durante le loro attività curricolari, hanno percorso i locali del policlinico in orari diversi, contando il numero di persone incontrate, operatori sanitari e pazienti/visitatori, e indicando il numero di coloro che stavano fumando, in entrambe le categorie. Questo studio è stato ripetuto negli anni 1998, 1999 e 2003.

    Risultati: la prevalenza di persone che stavano fumando è risultata del 6,4% nel 1998, del 3,8% nel 1999 e dell’1,1% nel 2003. La prevalenza di operatori sanitari che fumavano rispetto al totale dei fumatori è risultata rispettivamente del 25%, del 26% e del 23,8%. Nei due anni passati, nell’atrio, nel bar e nelle zone antistanti i reparti c’era una maggiore presenza di persone che fumavano; mentre nell’ultima indagine sono stati riscontrati più fumatori, oltre che nell’atrio, nei corridoi del piano didattico, zona non indagata in precedenza. Nell’ultima rilevazione, non sono stati individuati fumatori nei due bar del policlinico; mentre sono sempre stati rilevati, in numero esiguo, operatori sanitari che fumano all’interno delle corsie di degenza.

    Conclusioni: la diminuzione costante del numero di fumatori in ospedale, mostra come ci sia stato negli ultimi anni un rispetto sempre maggiore del divieto di fumo nei luoghi di cura. Il coinvolgimento di futuri medici permette di promuovere il problema fumo in ospedale.

  3. Dicty_cDB: CHE694 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available KLLTEKHIALNVKEDGLDWLADQGYDPIYGARPLKRVIQKXRIKSNGKTNT *r*n*rsxxcynxlrinqkxn*klqvnkik Translated Amino Acid seq...ANXPDNTPSATAREEVMGVVRSRFPPEFLNRIDDMILFNRLXRKDMDKI VEIQLXDLRKLLTEKHIALNVKEDGLDWLADQGYDPIYGARPLKRVIQKXRIKSNGKTNT *r*n*rsxxc

  4. Dicty_cDB: CHE829 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available dsl**sx*frlw*rf*m*n*t*wfpmlcpfrkttpttt*xm**xmpxrp*m* s*stckrmmrccp*tttxmxfkmsxkt*m*sxplx*rmlcxxxpr*mfixmsxrp...xm*s* stwkrmxrccp*ttxkmxixmsxkt*m*nqsxw*rmlc*kxx*lf Frame B: lfnfifnhsn*kknnn*ls*

  5. Dicty_cDB: CHE174 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available stallinum mRNA for putative vacuolar ATPase subunit 100 kDa subunit (vpha-a gene). 46 1e-10 4 CV164410 |CV164410.1 rsmsx...54 8e-09 3 CV172465 |CV172465.1 rsmsxlre_008717.z1.scf cDNA Library of Salvia mil

  6. Pragmatic Idealism: Ernesto Che Guevaras Strategic Choice for Bolivia

    Science.gov (United States)

    2017-06-01

    security could be achieved through a more mature guerrilla movement. B. LITERATURE REVIEW A review of previous analysis and criticism regarding...was, he split his time prior to Bolivia between Tanzania and Czechoslovakia.24 Whether Guevara spent the majority of his time nursing the emotional ...believed it rational to pursue revolution prior to the maturation of a revolutionary movement as long as the objective

  7. Che fatica far festa all’Odin Teatret!

    DEFF Research Database (Denmark)

    Chemi, Tatiana

    2004-01-01

    A report of the many activities, planned to celebrate a unique birthday: the one of a theatre group existing for 40 years. A piece of history of contemporary theatre is going to show its past, its present and its future. With a synoptic table for the activities in Denmark.......A report of the many activities, planned to celebrate a unique birthday: the one of a theatre group existing for 40 years. A piece of history of contemporary theatre is going to show its past, its present and its future. With a synoptic table for the activities in Denmark....

  8. Dicty_cDB: CHE366 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ce update 2002. 9.10 Translated Amino Acid sequence ---xxxxxxxxnfxxxxxxxxxxxlxsxrxxxxxkxvkxxxxxkxgxxxxxxxx...xxxxg* TIXKXVXXFXXYNIXXXSXXXLVLRLXGGMQXFVKTXXGKTITLEVEGXDNIENVKXKIQ DKEGIPPDQQRXIFX...MQIFVKTLTGKTITLEVEGSDNIENVX Translated Amino Acid sequence (All Frames) Frame A: ---xxxxxxgxxfxxxxxxgxxxx...fxkxkxxxxxxxcxxxxxxxxrxxxxxxxxxxfxwv nnxkxgxxxxgx*hxkxixxpxsfkixrwyanxc*nxxw*nnhfrs*...tirrwsysf*lqyskrihspfsfkikr wyanlc*nshw*nnhfrs*rf**h*kcx Frame B: ---xxxxxxxxnfxxxxxxxxxxxlxsxrxxxxx

  9. Le sfide che i figli degli immigrati devono affrontare

    Directory of Open Access Journals (Sweden)

    Sandra Sicurella

    2015-05-01

    Full Text Available Economic changes, poverty, wars, violence and socio-political conditions generated waves of migrants that irreversibly affect the daily lives in our country too. Children of migrants are requested to face many difficulties which are transformed into challenges on a daily basis in order to assert a position in the host society. The number of admissions of foreign children is constantly growing and often the culture clash may lead to exclusion. This is an extremely difficult situation, especially for children who sometimes do not have the adequate tools to deal with this.

  10. Einstein: I cento anni che sconvolsero il mondo

    CERN Multimedia

    Di Giorgio, Claudia

    2005-01-01

    In 1905, the german physicist published five articles about relativity, a theory which changed for ever our knowledge and our life. This beginning year will be "the mondial Year of Physcis" and the physics Community celebrate the Nobel Prize (⅓ page)

  11. Le parole che noi usiamo: l’errore in storia

    Directory of Open Access Journals (Sweden)

    Aurelio Musi

    2017-04-01

    Full Text Available Unlike the hard sciences, historiography lacks a specific nomenclature. The lexicon employed by historians is drawn from the plain language of everyday life. Therefore, the words of history are to be defined within the spatio-temporal framework, and to be construed through processes of contextualization and comparison. My work here stems from these considerations, and attempts to chart the occurrence of errors in historiography. In particular, I take into account the way in which historiographic mistakes arise from the intermingling of words, space, and historical time. Another significant aspect concerns the relationship between history, fiction, and arbitrariness. The latter concept is linked to historical interpretation, which constitutes the last stage of historiographical work, after the analysis and the reconstruction of events. The last part of this paper offers a typology of frequent errors in historiography.

  12. Dicty_cDB: CHE216 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available TNTTTAGTTCAATTGCAAACTTTATAANACCTATATTAATCTA TTTGAAATCGATTCAATTTAGAAGAGGTCATANAAAAATGACCCCAGAACANCNACNAAT CCT...ATAANACCTATATTAATCTA TTTGAAATCGATTCAATTTAGAAGAGGTCATANAAAAATGACCCCAGAACANCNACNAAT CCTTAAAACTTTAGNTGCCGAAACTA

  13. Il derubato che sorride. La tragedia umoristica di Pasolini

    Directory of Open Access Journals (Sweden)

    Stefano Casi

    2017-02-01

    Full Text Available In the studies about Pasolini’s work the analysis of the use of comedy and humor is often ignored. This article analyzes the relationship of Pasolini with the forms of comedy, from the indication of Charlot as emblematic point of reference for his own intellectual commitment to the development of an original meaning of the concept of humor. By analyzing statements and plays, a new aspect of Pasolini comes to light. In a conscious and tormented way, Pasolini adheres to humor as the main means of the bourgeoisie, entrusting to it much of its work in the last decade of his life. For Pasolini humor is the communication code of the bourgeoisie, that bourgeoisie uses to distance itself from reality. Thus, by using humor as alienating weapon inside the form-tragedy, Pasolini plans to fight bourgeoisie, challenging it on the ground of the theatrical representation of reality, through its own communication means.

  14. Integrating the ChE Curriculum via a Recurring Laboratory

    Science.gov (United States)

    Kubilius, Matthew B.; Tu, Raymond S.; Anderson, Ryan

    2014-01-01

    A recurring framework has been integrated throughout the curriculum via a Continuously Stirred Tank Reactor (CSTR) platform. This laboratory is introduced during the material and energy balance course, and subsequent courses can use these results when explaining more advanced concepts. Further, this laboratory gives students practical experience…

  15. Dicty_cDB: CHE818 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 8.1 Habrotrocha constricta 82 kDa heat shock protein 2 (hsp82-2) gene, partial cds. 88 3e-48 4 AF143854 |AF143854.1 Sinantherina soci...alis 82 kD heat shock protein (hsp82) gene, partial cds.

  16. P. RICOEUR: UN’ANTROPOLOGIA CHE NON ESCLUDE IL FONDAMENTO

    Directory of Open Access Journals (Sweden)

    Attilio Danese

    2013-08-01

    Full Text Available A filosofia de Paul Ricoeur estáligada a uma exigência filosofica de não exclusão das inquietações que dizem respeito ao sentido do agir e do viver, demonstrando o laço indissolúvel entre antropologia, filosofia e busca das verdades últimas que dão sentido ao viver.

  17. Dicty_cDB: CHE850 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available DILFNGI EYQCKGWISGFTKCDWKGDSIER--- ---ESLEGNMIENQYITLKTQTHST**r*csl*nlgrlccq*sr*ti*nqylcsrysft* ere*k*tfhslgkr*e*itlmaw**vn*frid...---ESLEGNMIENQYITLKTQTHST**r*csl*nlgrlccq*sr*ti*nqylcsrysft* ere*k*tfhslgkr*e*itlmaw**vn*fridclagikncsticskn

  18. LES VIBRIONS DANS LES PRODUITS DE LA PÊCHE

    African Journals Online (AJOL)

    PC_WINDOWS

    Santé Publique (ENSP) à Rennes et le Centre National de Référence des vibrions et du Choléra (CNRVC) à l'Institut Pasteur ... l'Alimentation, en France, dans le but de normaliser les protocoles d'étude et de recherche de V. cholerae et ..... Vibrio présente dans l'environnement avec les méthodes de détection habituelles.

  19. Dicty_cDB: CHE555 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available la EST MtBC10B03R1 : T7 end of clone MtBC10B03 of cDNA library MtBC from arbuscular mycorrhiza of cultivar J...03F1 : T3 end of clone MtBC10B03 of cDNA library MtBC from arbuscular mycorrhiza ...a EST MtBC39A08F1 : T3 end of clone MtBC39A08 of cDNA library MtBC from arbuscular mycorrhiza of cultivar Je

  20. ChE Undergraduate Research Projects in Biomedical Engineering.

    Science.gov (United States)

    Stroeve, Pieter

    1981-01-01

    Describes an undergraduate research program in biomedical engineering at the State University of New York at Buffalo. Includes goals and faculty comments on the program. Indicates that 58 percent of projects conducted between 1976 and 1980 have been presented at meetings or published. (SK)

  1. Una presenza che si fa ombra in Oriente

    OpenAIRE

    Giovanni Azzaroni

    2017-01-01

    In the contest of Asian culture the “shadow structure” is discussed connected to its native world and then it has to be interpreted starting to the culture of its original world. This essay investigates three different geographic situation, that is Japan (nōtheatre), China (shadow theatre) and Indonesia (shadow theatre), to connect as well as possible the vision and “shadow philosophy” to accurate and cultural perspectives, which can relate it to real cultural images.

  2. Una presenza che si fa ombra in Oriente

    Directory of Open Access Journals (Sweden)

    Giovanni Azzaroni

    2017-03-01

    Full Text Available In the contest of Asian culture the “shadow structure” is discussed connected to its native world and then it has to be interpreted starting to the culture of its original world. This essay investigates three different geographic situation, that is Japan (nōtheatre, China (shadow theatre and Indonesia (shadow theatre, to connect as well as possible the vision and “shadow philosophy” to accurate and cultural perspectives, which can relate it to real cultural images.

  3. 97 Luigi Malerba, Che vergogna scrivere, Milano: Mondadori, 1996 ...

    African Journals Online (AJOL)

    User

    This collection of four loosely-connected essays deals, inter alia, with the status of literature and the writer in society. The first, "Lo scrittore come fantasma", moves from the servile position of the author during the Renaissance, to the author becoming a producer of commodities with the advent of copyright in 1793, pointing.

  4. The bumpy face of che guevara: An interesting case

    Directory of Open Access Journals (Sweden)

    Kingshuk Chatterjee

    2017-01-01

    Full Text Available Placement of decorative tattoo on the skin may lead to various immunological, infective, and coincidental complications. Inoculation of human papillomavirus leading to development of verruca is an uncommon complication of tattoos. The present report highlights the development of verruca vulgaris, developing after 2 years of tattooing in a young male.

  5. à l'encoche sèche

    African Journals Online (AJOL)

    naturel est une matière première importante en industrie. Il intervient à 70% dans la ... caoutchouc naturel de cette région est en constante progression, due au .... L'analyse a été effectuée avec le test statistique de Duncan au risque alpha = 5 % avec les valeurs de LEM transformées en Arc Sinus. Racine carrée de LEM ...

  6. El Che y la natación

    Directory of Open Access Journals (Sweden)

    Ana Maria Peña Rojas

    2009-09-01

    Full Text Available Sobre la vida de Ernesto Guevara de la Serna se puede hablar de una trayectoria tan rica en todos los campos; que se pudiera decir del héroe de nuestra América, el guerrillero, el economista, el escritor, el fotógrafo y un gran apasionado por el deporte. Se aborda algunos aspectos relacionados con el Ché como practicante sistemático de la Natación en el sector residencial y escolar durante su vida, pues siempre le interesó la actividad deportiva a pesar de su escasa salud, por el padecimiento de asma bronquial desde su nacimiento. Tuvo junto a sus padres estancia en varios lugares, buscando condiciones para el progreso de su salud, pues además era el hijo primogénito y su madre padeció de la misma enfermedad durante su niñez, aunque heredó otras cosas muy buenas de ella. Supo sobreponerse con tesón y voluntad, tuvo gran incidencia en actividades relacionadas con la natación y otros deportes. Demostró gran destreza en el estilo Mariposa; aunque también practicaba el estilo pecho y el clavado. Su interactuar apasionado como deportista durante su juventud y adultez, lo hicieron más fuertes para enfrentar la vida, lo que posibilitó una formación integra en su persona; aquí se expresa la versatilidad e integridad y fortaleza de un hombre apasionado por la naturaleza, la formación de un hombre nuevo, con diferentes matices de ejemplaridad y paradigma de los pueblos de América Latina.

  7. LES VIBRIONS DANS LES PRODUITS DE LA PÊCHE

    African Journals Online (AJOL)

    PC_WINDOWS

    polyunsaturated fatty acids omega 3 (EPA and DHA) of frozen sardine. The results ... Keywords : conservability, sardine, freezing, chemical weathering, omega-3 fatty acids, EPA, DHA, TVB-N ...... deterioration of salmon during frozen storage.

  8. L'impronta idrica di quello che mangiamo

    NARCIS (Netherlands)

    Bacenetti, J.; Lovarelli, D.; Fiala, M.; Hoekstra, Arjen Ysbert

    2015-01-01

    È stata recentemente approvata la norma ISO (ISO 14046 Water footprint – requirements and guidelines) per la definizione dell’impronta idrica (Water Footprint) (vedi box). Questo nuovo indicatore di sostenibilità ambientale permette di quantificare il consumo di acqua dolce associato, direttamente o

  9. Dicty_cDB: CHE547 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 25 Translated Amino Acid sequence glleninni*q*tk*INKKKNNNHFFFLXFXIKN--- ---MNWAIRDGTYESFKGSPASKGILQFDMWNVTPS...r*cnsihc*snrisnskts*k*yklnytt*nsn*n skll Frame C: glleninni*q*tk*INKKKNNNHFFFLXFX

  10. Dicty_cDB: CHE515 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available hvpkkxv*lilqsilmitmhvplipvhhqlvfptlqltvmi vnpctidscnnstglxxhsnqw****slvp*ih--- --...FGLXGGFXGGGTXGKXDCXTCKN*xtxfi*lxfkk ixkkfxkkfxkkkklfvflsniynf*k*kf Frame C: nkctvdscsnstgcvntpincddsnpctvdscnns

  11. Genealogy of the body and genealogical body

    Directory of Open Access Journals (Sweden)

    Paola Cecchetti

    2011-06-01

    Full Text Available A partire da un quadro di Frida Kahlo intitolato I miei nonni, i miei genitori e io le due autrici indagano quel testo-immagine che sta all'origine dello stile di lettura del soggetto. Posto dinanzi alla stessa immagine, ciascuno ne fa una rappresentazione estremamente personale, un quadro delle proprie vicissitudini interne e dei legami transgenerazionali che lo hanno segnato. I momenti nei quali si articola la ricerca sono tre: la scrittura dell’occhio, il ricalco e il percorso della mano, il negativo e l’assenza.A essi segue poi lo psicodramma. Tale successione temporale abitua a vedere nell'immagine disegnata l'immagine negata, assente. L'esperienza sembra aver creato un nuovo metodo di indagine della psiche rispetto al transgenerazionale, metodo che intreccia il genogramma (di origini sistemico-relazionale e lo psicodramma analitico, e che viene chiamato “genodramma psicoanalitico”. Partendo da un dato clinico – l'esilità del legame che le nuove generazioni intrattengono con quelle che le precedono, sembra vogliano rinegoziare il contratto narcisistico che assegna al passato il posto dell'assenza. Il contributo si chiude con un interrogativo: “Alla ricerca di che cosa? Della presenza o, meglio, delle tracce lasciate nel soggetto dall'Altro che precede l'insediamento dell'Io”.

  12. Il cielo sopra Roma I luoghi dell’astronomia

    CERN Document Server

    Buonanno, Roberto

    2008-01-01

    L’astronomia a Roma c’è sempre stata, ma un po’ nascosta: era nei palazzi, nelle chiese o, meglio, sopra le chiese, specole disseminate lungo un percorso che oramai conoscono in pochi. I romani hanno assistito, incuriositi ed impauriti, al rogo di Giordano Bruno in un angolo di Campo de' Fiori a loro familiare, ma probabilmente non capirono bene di quale colpa fosse accusato. Non pensarono certo che si trattasse di un filosofo e di uno scienziato che aveva cercato di immaginare in che modo era fatto il mondo. Chi era questo Galileo, di cui si celebrava il processo a S. Maria sopra Minerva? Era un uomo che voleva cambiare la prospettiva del mondo e che, per questo, era stato ammonito da Roberto Bellarmino. E chi era questo gesuita, Secchi, che nel 1870 costringeva gli Italiani a privare Roma del suo Osservatorio Astronomico, visto che il Direttore non riconosceva lo Stato Italiano? Come è possibile che dopo la visita di Hitler a Mussolini alla vigilia della Guerra, la Germania decise di regalare all’...

  13. Ateliers dell'Immaginario Autobiografico: quarto ciclo seminari di formazione

    Directory of Open Access Journals (Sweden)

    Maria Immacolata Macioti

    2012-07-01

    Full Text Available Un numero di Magma dedicato al tema “Memoria, Autobiografia e Immaginario” non può che essere vario e molteplice nei contenuti e nella forma. Non può che presentare contributi che chiamano in causa realtà locali e internazionali, tempi complessi: ieri ed oggi, ieri e domani. Abbiamo messo in evidenza, nella prima sezione di questo numero, due temi fondamentali e trasversali: le memorie ed il loro contesto, l’immaginazione e l’immaginario. Le memorie risentono del tempo, del luogo e del contesto nel quale sono elaborate e raccolte, e il ruolo della politica e del potere ne condiziona il loro vissuto e la loro stessa rielaborazione e interpretazione. L’immaginazione come particolare forma di rappresentazione della realtà, di conoscenza riproduttiva e ri-costruttiva, è anche reinterpretazione creativa nel processo della narrazione della storia individuale e sociale. L’immaginario individuale, sociale e sacrale, come forma estetica delle narrazioni individuali e collettive, è parte costitutiva del pensiero e della coscienza delle donne e degli uomini, e ci svela a capacità di evocare e di creare dei soggetti, di rappresentarsi il mondo, attraverso la funzione dell’immaginazione simbolica. I contributi che abbiamo selezionato e che compaiono in questo numero all’interno delle altre sezioni, sviluppano questi due temi chiave tra spazi angusti e ampie distese che travalicano confini; confini tra terre abitate, confini tra discipline.

  14. Fonologia etrusaa fonetiaa toscana, Il problema del sostra­ to, Atti della Giornata di Studi organizzata dal Gruppo Archeo­ logico Colligiano, Colle di Val d'Elsa, 4 aprile 1982; a cura di L. Agostiniani e L. Giannelli, Biblioteca dell' "Archivum Romanicu

    Directory of Open Access Journals (Sweden)

    Pavao Tekavčić

    1983-01-01

    Full Text Available Che cosa sia la gorgia tosaana lo sanno probabilmente tutti i cultori della linguistica romanza nel mondo; ed è risaputo anche che, dopo poco meno di un secolo di discussioni, il volume di H. J. Izzo Tuscan and Etruscan, Toronto 1972 sembrò dare il colpo di grazia alla tesi sostratista: "La gorgia etru­sca è morta!" si credette di pater dire, adattando la prima par­te del celebre detto francese. Perciò sorprenderà non poco che, a distanza di dieci anni dal libra di Izzo, si veda risuscitare l'ipotesi dell'origine preromana della gorgia; ossia, che forse si debba dire - continuando il citato detto - "viva la gorgia etrusca!". Si, il richiamo alla nota formula francese non è senza una sua giustificazione, perché l'ipotesi della gorgia etrusca - oltre ad essere sostenuta da una netta minoranza de­ glistudiosi- ci si presenta semmai in una veste nueva. Chi vorrà leggere i contributi nel ricco ed interessante volume che qui recensiamo, potrà convincersi che la discussione sul possi­bile influsso del sostrato etrusco nella gorgia toscana non è per niente esaurita rna continua, con argomenti nuovi basati su ricerche recenti.

  15. Onde elettromagnetiche

    CERN Document Server

    Toraldo di Francia, Giuliano

    1988-01-01

    Prefazione: "L'opera "Onde Elettromagnetiche" di Giuliano Toraldo di Francia vide la luce per i tipi della Casa Editrice Zanichelli nel lontano 1953. Tradotta ben presto in inglese e in giapponese, ha incontrato il favore di varie generazioni di studenti universitari e un apprezzamento dei docenti che non sembra ancora estinto. Ma è evidente che in trentacinque anni tante cose, troppe cose sono avvenute in quel campo di studio, per poter pensare che oggi il vecchio libro non presenti cospicue lacune. Ed è proprio a colmare tali lacune che ci siamo dedicati nell'elaborare il presente volume, pur conservando quasi tutto il materiale che aveva dato buona prova nel suo progenitore. La mole è inevitabilmente raddoppiata; eppure siamo ben lungi dall'avere esaurito un dominio così vasto, né ci eravamo proposti di farlo. Quello che presentiamo è il frutto di una scelta ragionata. Abbiamo ritenuto opportuno ampliare la parte sulle onde piane (con l'introduzione dei parametri di Stokes, e dei concetti di velocit�...

  16. Reti di città, mobilità e ambiente: il Preliminare di PTCP di Avellino

    Directory of Open Access Journals (Sweden)

    Carmela Gargiulo

    2010-02-01

    Full Text Available  L’articolo propone la lettura dei contenuti del Preliminare del PTCP di Avellino, un piano per molti aspetti innovativo, soprattutto per aver coniugato pianificazione di area vasta di tipo tradizionale e logica “strategica”. In particolare, l’articolo descrive idee guida, contenuti e strategie del piano orientate, prevalentemente, a stimolare lo sviluppo sostenibile di un’area in ritardo di sviluppo come la provincia irpina, attraverso la salvaguardia e valorizzazione delle risorse naturali e storico-culturali, la costruzione di reti di medie e piccole città e reti di mobilità alle diverse scale, da quella urbana a quella internazionale, e interventi sul sistema della mobilità. Nel 2004, ormai più di cinque anni fa, è stato adottato, a maggioranza assoluta (solo due gli astenuti, il Preliminare di Piano Territoriale di Coordinamento della Provincia di Avellino, dopo un lavoro di oltre due anni che ha visto impegnati gli uffici provinciali con due dipartimenti universitari. Il lavoro, che va ben oltre il significato e la valenza di un preliminare e che coniuga due pratiche di piano diverse (quella tradizionale e quella strategica ruota attorno a tre idee di fondo, tra loro strettamente interrelate, che costituiscono i criteri guida che finora ha inteso seguire la provincia di Avellino nell’attività di governo delle trasformazioni. Tali idee, quindi, costituiscono le fondamenta su cui è stato costruito il Preliminare e sono la griglia di specificazione delle strategie e degli obiettivi di piano. Esse sono alla base delle scelte elaborate per lo sviluppo compatibile del territorio, e sono riferibili alle azioni operative di trasformazione del territorio che gli Enti locali, cui è demandato tale compito, nel prossimo futuro dovranno affrontare. Le tre idee forza del Preliminare, descritte nel seguito, sono riferibili ai sistemi di risorse principali della provincia di Avellino, oggetto di una indagine analitico

  17. Trasformazione urbana verso la mobilità dolce: il caso di Istanbul

    Directory of Open Access Journals (Sweden)

    Emilia Giovanna Trifiletti

    2008-12-01

    Full Text Available Nell’articolo si descrivono le recenti trasformazioni urbane della città di Istanbul in Turchia in relazione all’implementazione di aree pedonali e all’utilizzo di mobilità dolce. Il sistema trasportistico è stato ampliato ed integrato di recente ed in tempi molto brevi: nei soli ultimi due anni è stata potenziata la linea tranviaria, sono state inaugurate una funicolare ed una teleferica ed è stata realizzata una stazione di interscambio gomma-ferro, ponendo grande attenzione all’integrazione del trasporto su ferro e/o gomma con la mobilità pedonale. Allo stesso modo sono state implementate le linee marittime che collegano le diverse sponde della città ed integrate alle linee su ferro e su gomma. Lo sviluppo e la riqualificazione della città sono dunque stati guidati dalla trasformazione del sistema trasportistico che ha rappresentato il vero motore della riqualificazione urbana. L’antico quartiere di Sultanahmet è stato interamente riqualificato e collegato, attraverso la linea tranviaria veloce che lo attraversa interamente, al resto della città fino ai quartieri più periferici. Allo stesso modo nel quartiere di Beyoglu che, dopo l’indipendenza era caduto in totale rovina, ha riacquistato l’antica eleganza che lo connotava. Il viale dell’Indipendenza (antica Rue De Pera che attraversa tutto il quartiere è stato reso pedonale e con un tram vintage che percorre tutto il viale sono stati collegati il nodo di interscambio Taksim, dotato di metropolitana e funicolare, con il nodo di interscambio Tünel, dotato di tram veloce e trasporto su gomma. Nell’articolo si è inteso evidenziare come la riqualificazione urbana della città sia stata guidata da interventi integrati trasporto/territorio e come i risultati ottenuti, nel caso-studio, siano stati anche il frutto di politiche attente alla sicurezza sociale.

  18. Teoria dei quanti di luce

    CERN Document Server

    Einstein, Albert

    1992-01-01

    In questo scritto un’intuizione storica limpida e penetrante, con la quale il giovane Einstein pose le basi per i successivi studi sulla teoria della relatività, è consegnata al lettore in forma chiara ed essenziale. Nel 1905, appena ventiseienne, Einstein intervenne nel dibattito sulle leggi di distribuzione della radiazione luminosa che all’epoca animava gli ambienti scientifici e che si inseriva nel più ampio processo di revisione delle scienze fisiche e naturali. Il giovane scienziato tentò di dimostrare come «...una radiazione monocromatica di densità ridotta... si comporta, per quanto riguarda la termodinamica, come se fosse composta da quanti di energia indipendenti l’uno dall’altro». In altre parole, nel caso limite di basse temperature e piccole lunghezze d’onda, la teoria ondulatoria della luce, tradizionalmente accettata e riconosciuta dai fisici, sembrava destituita di ogni fondamento, e si faceva strada l’ipotesi che la radiazione viaggiasse “a pacchetti”. Lo sviluppo succe...

  19. Il simbolo della finestra nel Melkij Bes di F. Sologub

    Directory of Open Access Journals (Sweden)

    Linda Torresin

    2015-01-01

    Full Text Available This article explores the symbolic image of the “window” in Fyodor Sologub’s novel The Petty Demon (Melky bes, with a particular focus on the connections between literature, semiotics, and psychopathology. Windows can be thought of as thin and transparent frameworks which divide the external world (“the others” from the internal one (“the self”, but, at the same time, they allow interactions between the two as well. Peaceful interactions are seldom contemplated; in most cases, the individual ego clashes with the collectivity. This is what happens in Sologub’s Petty Demon. Here, windows represent the struggle of the novel’s anti-hero Peredonov against the world; they stand as a symbol of his alienation from Russian society and life. Windows appear several times in the novel to signify Peredonov’s troublesome relationship with other people. In particular, broken windows and glasses suggest a growing gap between “the self” and “the others”, Peredonov and reality. Imagery drawn from the visual field helps the author to describe the protagonist’s fall into madness. On one hand, Peredonov sees the world through his paranoid eyes, and considers “the others” as a threat to his own identity. Even though, on the other hand, it is Peredonov himself, who suffering from persecution mania, fears that he is spied on by enemies. At the end, alterity will triumph over him. Thus, the novel also portrays Peredonov’s tragedy: the loss of his own “self”.

  20. L'azione Efficace nel Teatro del Novecento

    Directory of Open Access Journals (Sweden)

    Marco Marinis

    2000-12-01

    Full Text Available A partire dalle esperienze fin de siecle dei simbolisti, e dalle ricerche sinestetiche fra pittura musica e teatro di Wassily Kandinsky, l'articolo prende in esame alcuni fra i principali tentativi intrapresi dai maestri della scena contemporanea per fare dei teatro e dello spettacolo gli strumenti di un'azione efficace sullo spcttatore e, prima ancora, sullo stesso attore, soffermandosi in particolare su Eisenstcin, Artaud e Grotowski.

  1. La perizia grafica e documentale nel caso Lindbergh

    Directory of Open Access Journals (Sweden)

    Beatrice Catenacci

    2012-11-01

    Full Text Available Graphology experts operate in two main areas: verification of the authenticity of a piece of writing in cases of imitations or counterfeits, and the search for the identity of the writer in the case of anonymous letters. Letters have an expressive power relating to the author, as the author unwittingly expresses a complete set “fugitive gestures”. Such individual habitual slips are of particular value as they escape conscious control. In an investigation it is a essential to go from testimony to proof, and scientific research therefore aims at finding something, rather than someone. These somethings are of demonstrative objective value, and are called “silent witnesses”. In the case of the Lindbergh kidnapping and murder in America in 1932, the 14 ransom letters sent by the kidnapper turned out to be the main indictment for the prime suspect, Bruno Richard Hauptmann: the comparison between his handwriting and that of the anonymous letters represented a reliable clue to the kidnapper’s identity, thus showing graphology expertise to be a valid investigative technique.

  2. Percorsi del riconoscimento nel lavoro dell’insegnante

    Directory of Open Access Journals (Sweden)

    Caterina Merola

    2013-12-01

    Full Text Available I believe that to undertake the work of recognition in educational practice with the students is necessary to dwell on the words. The words show evidence sometimes not directly comprehensible to the listener because it is necessary to go back to them: there is a well, a can not be perceived at a glance. The words hold representations of the world, telling the story of the specific distinctions and interconnections of meaning, in the density of hidden nodes and the warp chains which have their origin in the experience from each. The inner world, the emotions, the “emotional thoughts” with the moral roots, seeds already internalized bright and open to becoming, belonging to the uniqueness of each individual, they emerge from the narrative and create pathways of recognition. From this point you can take philosophical reflections in class in the construction of a work together as a theory of recognition.

  3. Conoscere Fermi nel centenario della nascita : 29 settembre 1901 - 2001

    CERN Document Server

    Bonolis, Luisa

    2001-01-01

    Il lavoro scientifico di Fermi riguarda molti campi disparati, ciascuno dei quali ha avuto uno sviluppo peculiare in tempi successivi alla morte. In questo volume un certo numero di specialisti contemporanei di ciascun settore espone in forma semplice l'idea originaria e la sua successiva evoluzione. INDICE. Carlo Bernardini, "Introduzione"; Giorgio Salvini, "Enrico Fermi. La sua vita, ed un commento alla sua opera"; Edoardo Amaldi, "Commemorazione del Socio Enrico Fermi"; Enrico Persico, "Commemorazione di Enrico Fermi"; Franco Rasetti, "Enrico Fermi e la Fisica Italiana"; Franco Bassani, "Enrico Fermi e la Fisica dello Stato Solido"; Giorgio Parisi, "La statistica di Fermi"; Giovanni Gallavotti, "La meccanica classica e la rivoluzione quantistica nei lavori giovanili di Fermi"; Tullio Levi-Civita, "Sugli invarianti adiabatici"; Bruno Bertotti, "Le coordinate di Fermi e il Principio di Equivalenza"; Marcello Cini, "Fermi e l'elettrodinamica quantistica"; Nicola Cabibbo. "Le interazioni deboli"; Ugo Amaldi, "...

  4. Nutritional support of children with chronic liver disease | Nel | South ...

    African Journals Online (AJOL)

    Diets are usually enriched with medium-chain fatty acids because of their better absorption in cholestatic liver disease. High-dose fat-soluble vitamin supplements are given while care is taken to avoid toxicity. Initial doses are two to three times the RDI and then adjusted according to serum levels or international normalised ...

  5. Nuovi strumenti di telerilevamento da satellite nel controllo del territorio

    OpenAIRE

    Michele Dussi

    2008-01-01

    New satellite remote sensing instruments for land managementCOSMO-Skymed remote sensing images, as well as other SAR (Synthetic Aperture Radar) missions, have their specific features, partly similar to optical system products.Pre-processing activities, allow the user to exploit the systems capabilites fairly easily after a focused training. SAR imaging's applications range from mission-critical applications (i.e. civil and military security applications) to simple user-driven ones (i.e. quali...

  6. Ricerca del saggio di capitalizzazione nel mercato immobiliare

    Directory of Open Access Journals (Sweden)

    Marco Simonotti

    2011-12-01

    Full Text Available In the search of capitalization rate, the international valuation standards impose the reference to the data and the information of real estate market of the same segment or, very probably, in similar segments of the property being appraised. In this last case with adjustments of rents and market prices. The adjustments don’t concern the capitalization rate but rents and prices. Accordingly capitalization rate cannot be obtained by the rate other than real estate investments, for instance financial, because a property market segment, where data can be collected, always exists.

  7. Protezionismo e obiettivi di politica industriale nel pensiero di Keynes

    Directory of Open Access Journals (Sweden)

    L.M. MILONE

    2013-10-01

    Full Text Available When studying Keynes’ ideas regarding protectionism, scholars have traditional focused on the relevance that he attached to trade policy interventions geared towards macroeconomic objectives. Specifically, he was concerned with the role of the balance of payments as a constraint on full employment. Less attention has been devoted to keynes’ ideas on trade policy aimed at microeconomic objectives. These are the subject of the present paper, with a particular focus on industrial policy objectives as framed by Keynes within the UK/US negotiations between the 1930s and 1940s.  JEL Codes: E12, F13, L52 

  8. Affetto e pensiero nel modello Klein-Bion

    Directory of Open Access Journals (Sweden)

    Marco Innamorati

    2010-01-01

    Full Text Available Affect and Thought in the Klein-Bion Model - This paper investigates the development of the psychoanalytic theory of affect according to the Klein/Bion approach, with special regard to the relationship between affect and thought which has strategic importance in the complex picture in post-war Anglo-Saxon psychoanalysis. Klein’s contributions on affect are discussed and confronted with the other elements of the psychological world: representations, drives, objects and positions. The second part of the paper presents and discusses Bion’s theory of “emotional experiences”, in which a primordial identity between thought and feelings generates every form of knowledge.

  9. VERSO NUOVI MODELLI DI SUPPORTO ALLE DECISIONI NEL CONTESTO URBANO

    Directory of Open Access Journals (Sweden)

    Sara Torabi Moghadam

    2016-12-01

    Full Text Available The current growth of urbanization rate indicates that this trend is not going to stop, and therefore, it stresses the necessity of actions for mitigating the local and global pollution. Moreover, most of the actual stock is characterized by low energy performances since it pre-dates the energy regulation. The paper aims at addressing this issue by proposing the integration of Building Simulation (BS approach, Multi-Criteria Analysis (MCA methods and Geographic Information System (GIS tool for developing a new Multi-Criteria Spatial Decision Support System (MC-SDSS in urban context. The BS of relevant building archetypes allows to identify different resolutions of energy data: hour-by-hour data can be useful for demand-side management or renewable integration while aggregated data can be used for load forecasting and retrofit simulations. The MCA permits choosing between different building renovation alternatives by considering both qualitative and quantitative criteria. Moreover, the GIS support the method by creating geo-referenced databases. The method purposes in giving a comprehensive view to address the complexity of urban building energy planning; due to its flexibility, it can be applied to several urban areas. Three main phases characterize the study: i. overview of relevant existing techniques; ii. description of the integrated proposed method; iii. discussion and future application. The method can provide relevant feedbacks for ranking complex design energy options.

  10. Metafore del meccanico nel pensiero di Diderot. Arti e tecniche

    Directory of Open Access Journals (Sweden)

    Paolo Quintili

    2014-12-01

    Full Text Available The natural philosophy of Diderot is built from the experience of the fundamental Description des Arts in the Encyclopedia, or from the «great and beautiful collection of machines» which the work provides a very rich representation. Models and metaphors that Diderot constructs to describe the world of organic beings, from the Pensées sur l'Interpretation de la nature (1753, are inspired by the world of the mechanical arts and crafts. The manouvriers d’expériences, the experimental philosophers, are the great inventors and discoverers of the secrets of nature and living being: to them Diderot inspire itself and his work as a philosopher of nature and arts. From the loom to weave socks, to the fire pump, the description of the machine proceeds through a complex network of metaphors that combine the operation of the instrument to that of organic life. The machine energises itself and the organism, in turn, is mechanized in a maze of functional architectures, according to new models and artistic metaphors of living beings, other than cartesian one. Diderot does not cease to be mechanistic still in his last vitalistic works, from Le Rêve de D’Alembert, to the Éléments de Physiologie. The new world of handicraft and artisans remains the key reference point in the philosophical work of the encyclopaedist-naturalist: weaving loom socks and sensible harpsichord are the two tools / metaphors that describe the man and his rational and specific nature.

  11. Patologie da Porcine Circovirus tipo 2 (PCV2) nel suino

    OpenAIRE

    Fusaro, Laura

    2011-01-01

    The main work involved the PMWS (Post-weaning multisystemic Wasting Syndrome), caused by PCV-2 (Porcine Circovirus type 2) that involved post-weaned pigs. Merial Italy has funded a study activity in which groups of 3-5 animals were sampled for lungs, tracheo-bronchial and superficial inguinal lymph nodes, ileum and tonsils. The protocol applied can be identified as a more diagnostic potential on the individual than on the group. PNP. Another investigation has been conducted to study prolif...

  12. Formazione, tecnologia e mercati nel contesto di una multinazionale

    Directory of Open Access Journals (Sweden)

    Elena Bougleux

    2014-03-01

    Full Text Available The present paper discusses the hypothesis of a new understanding of the traditional and academic paths in the history of science and technology, trying to introduce a multi-sited and multi-centred approach that overtakes the prevalent current narrations. The hypothesis is discussed considering a relevant case study connected with issues in higher education, scientific and technological competencies and global markets. The paper presents the controversies that emerge within a high level training program provided by a multinational corporation operating in the area of energy production, and targeted to local middle eastern operators. The training program in advanced technology and related applicative competences remains framed inside a market oriented strategy, and it responds to logic of asymmetric power typical of a post colonial scenario. The higher education program becomes a pretext to hide persistent cultural and gender prejudices and to enforce existing or newly established relations of subalternity.  The presented case study offers also the possibility of discussing an example of re-appropriation and re-signification in the historic and scientific tradition of the West, providing a basis for challenging the hypothesis outlined above.

  13. Storicismo e realismo nel pensiero di Alasdair Macintyre

    OpenAIRE

    Concu, Nicoletta

    2016-01-01

    My aim, in this work, is to analyze Alasdair MacIntyre’s theoretical system. MacIntyre (1929-) is a Scottisch born and American ‘adopted’ philosopher. Critics usually framed his moral position as representative of current normative ethics of virtue inspired from Aristotle, and his political thought as conservative, seeing as how they consider MacIntyre as neo-comunitarian thinker. But, as I have tried to show, this is a misunderstanding of his political position. Anyway critics...

  14. HIV and the histopathologist | Nel | Southern African Journal of HIV ...

    African Journals Online (AJOL)

    The practicing histopathologist is often a forgotten link in the management of HIV patients. This article aims to highlight the unique challenges faced by anatomical pathologists as well as focusing on the valuable contribution they can make to ensure prompt and accurate diagnoses that will ultimately benefit the patient.

  15. Il laser scanner nel panorama attuale della geomatica

    Directory of Open Access Journals (Sweden)

    Fulvio Rinaudo

    2009-03-01

    Full Text Available LiDAR techniques as a new standard in Geomatic applications.Today, many applications fields can found a correct solution just by using LiDAR systems. The recent introduction of the full-wave form analysis both in terrestrial and aerial LiDAR equipment stretched out the accuracy and the application fields of this technology. Both acquisition systems and processing data software offer today a good integration between LiDAR and Digital Photogrammetry: the interpretation is more quick and the accuracy of the resulting 3D Models higher than in the past. In a few years new possibilities will come out from a different integration between LiDAR and Digital Photogrammetry: LiDAR data can be used as a good approximate starting point for the multi-image autocorrelation algorithms: the point clouds resulting from LiDAR and Photogrammetric correlations will solve in a professional way new application fields.

  16. Musica, identita e mitografie nazionali dei cechi nel dicianovesimo secolo

    Czech Academy of Sciences Publication Activity Database

    Slavický, Tomáš

    2016-01-01

    Roč. 12, č. 1 (2016), s. 45-56. ISBN 978-961-254-915-2. ISSN 1854-3405 Institutional support: RVO:68378076 Keywords : Czech national music * Czech historical myths * Panslavism * Austroslavism Subject RIV: AL - Art, Architecture, Cultural Heritage; AL - Art, Architecture, Cultural Heritage (UEF-S)

  17. Capriole in cielo : Aspetti fantastici nel racconto di Gianni Rodari

    OpenAIRE

    Schwartz, Cecilia

    2006-01-01

    The purpose of this dissertation is to study the fantastic in the tales of the Italian children’s author Gianni Rodari. This analysis is grounded in the hypothesis that the fantastic is primarily characterized by two esthetic qualities, play and lightness, both of which are manifested at different levels in these texts, as well as in the relation between children and adults. As a background for the textual analysis in the present work, an introductory review is provided of previous research, ...

  18. Hadra di possessione nel Wollo - Possession hadra in Wollo

    Directory of Open Access Journals (Sweden)

    Laura Budriesi

    2012-12-01

    Full Text Available In this essay the authoress describes one of the various healing sessions or hadras, which she attended filming and photographing during her fieldwork in Ethiopia. In this case the ritual took place in a village at some distance from Dessie (Wollo. The curer Teshome Feleke assumes the name of Ali and acts as “Allah representative”. Hadras are night sessions dedicated to healing and consulting about different questions which are not necessarily linked to physical health. The authoress observes that they are mostly family controversies and that Ali settles the disputes with the consent of local authorities. Ali is a “great possessed”, he speaks behind the cover a small curtained window, he boasts a pleasant voice and also heals those affected by buda, sheitan or zar by means of a “drum treatment” with the cooperation of some loyal assistants. Hadras are intense circumstances: Ali’s small lodging is crowded with Christian and Muslim followers seeking his aid. Males and females are separated by a thin wall. The brotherhood’s elders sing prayers to Allah, clap their hand and chew chat. Many women go into trance and dance. Sometimes Ali joins the dance and also goes into trance.

  19. Strategie enunciative nel discorso cinematografico europeo degli anni Cinquanta

    Directory of Open Access Journals (Sweden)

    Lorenza Di Francesco

    2012-11-01

    Full Text Available This essay, taken from my doctoral dissertation entitled "Dal documentario al film di famiglia: spazialità, enunciazione e valori dal Free Cinema inglese alle nuove pratiche di riuso filmico" (From documentaries to home movies: spatiality, enunciation and values from British Free Cinema to cinematographic re-use practices discusses several articles by film critics that appeared in the most authoritative British and French journals during the second half of the Fifties. Bearing in mind that these were the years in which tension towards rebuilding a national identity was strong, the essay concentrates on the aggressive and strategic discursive dimension employed by two director-critics, Lindsay Anderson and Jean-Luc Godard, to highlight the film-making movements to which they belonged, i.e. British Free Cinema and French Nouvelle Vague, within the European film-making industry. Our opinion is that, by axiologizing presumed value-based diversities and an astute construction of the relationship between author and reader, the reviews in question were used to enhance one movement to the detriment of the other within a closed system oppressed in those years by competition from the big Hollywood film companies and the latest innovation, television. They succeeded in their intention because within a short while, Anderson and Godard acquired acclaim on the European film-making scene and were therefore able, thanks to economic support from institutions, film studios and film distributors, to explore and develop subjects and themes that Free Cinema and Nouvelle Vague had introduced.

  20. Nel tunnel alla ricerca di una nuova fisica

    CERN Multimedia

    Durante, Elisabetta

    2003-01-01

    The Large Hadron Collider is at the top of world-wide science for particle physics. It promises to open the road to a new knowledge of the universe and its nature. Luciano Maiani and Robert Aymar, actual and future Director Generals of CERN, explain the aims of this most powerful instrument, the difficulties and the industrial repercussions, among which will be the "Grid", that will change the telecommunications (4 pages)